Sequence alignment for CL0106

PF07479

O51341_BORBU/184-347--------------------------------------------------------------------------------
GPDA_DROEZ/194-343--------------------------------------------------------------------------------
GPDA_RABIT/192-342--------------------------------------------------------------------------------
GPDA_MYCLE/190-341--------------------------------------------------------------------------------
GPD2_YEAST/282-432--------------------------------------------------------------------------------
GPDA_SYNY3/159-303--------------------------------------------------------------------------------
GPDA_ARCFU/180-331--------------------------------------------------------------------------------
GPDA_TRYBB/191-335--------------------------------------------------------------------------------
GPDA_TAKRU/193-344--------------------------------------------------------------------------------
GPDA_CHLPN/180-324--------------------------------------------------------------------------------
GPDA_TREPA/194-353--------------------------------------------------------------------------------
GPDA_STRCO/182-326--------------------------------------------------------------------------------
GPDA_METTH/174-309--------------------------------------------------------------------------------
GPDA_CHLTR/180-324--------------------------------------------------------------------------------
GPDA_SHIFL/183-327--------------------------------------------------------------------------------
GPDA2_MYCTU/183-327--------------------------------------------------------------------------------
GPDA_LEIME/198-342--------------------------------------------------------------------------------
GPDA_BACSU/180-324--------------------------------------------------------------------------------
O22216_ARATH/273-432--------------------------------------------------------------------------------
GPDA_CUPLA/213-364--------------------------------------------------------------------------------
GPDH2_CAEEL/236-385--------------------------------------------------------------------------------
GPD2_SCHPO/224-373--------------------------------------------------------------------------------
GPD1_SCHPO/220-369--------------------------------------------------------------------------------
O61368_APIME/194-343--------------------------------------------------------------------------------
O96558_LOCMI/194-343--------------------------------------------------------------------------------
GPDA_HAEIN/183-327--------------------------------------------------------------------------------
GPDA_HELPY/165-305--------------------------------------------------------------------------------

PF00725

HCDH_HUMAN/216-313--------------------------------------------------------------------------------
HBD_THETC/184-280--------------------------------------------------------------------------------
CRYL1_RABIT/192-283--------------------------------------------------------------------------------
ECHP_HUMAN/478-582--------------------------------------------------------------------------------
ECHP_CAVPO/481-585--------------------------------------------------------------------------------
Q9YBW6_AERPE/198-292--------------------------------------------------------------------------------
Q9HQ61_HALSA/191-286--------------------------------------------------------------------------------
FADB_ECOLI/496-592--------------------------------------------------------------------------------
O17612_CAEEL/535-630--------------------------------------------------------------------------------
O29956_ARCFU/188-278--------------------------------------------------------------------------------
MFPA_CUCSA/495-588--------------------------------------------------------------------------------
HBD_CLODI/183-279--------------------------------------------------------------------------------
Q9ZBJ9_STRCO/502-598--------------------------------------------------------------------------------
Q9Y1C5_APIME/7-98--------------------------------------------------------------------------------
Q9I300_PSEAE/499-599--------------------------------------------------------------------------------
Q9HU01_PSEAE/190-281--------------------------------------------------------------------------------
LCDH_PSEAE/188-280--------------------------------------------------------------------------------
HBD_CLOAB/184-280--------------------------------------------------------------------------------
Q9KIE3_STRHY/181-277--------------------------------------------------------------------------------
Q9HY36_PSEAE/415-510--------------------------------------------------------------------------------
Q9F9V1_AZOEV/190-287--------------------------------------------------------------------------------
FADJ_VIBCH/497-590--------------------------------------------------------------------------------
O53872_MYCTU/508-607--------------------------------------------------------------------------------
O28011_ARCFU/200-294--------------------------------------------------------------------------------
Q9RZ10_DEIRA/239-335--------------------------------------------------------------------------------
HCDH2_CAEEL/211-308--------------------------------------------------------------------------------
O29143_ARCFU/183-276--------------------------------------------------------------------------------
O84980_PSEPU/190-287--------------------------------------------------------------------------------
Q988C8_RHILO/184-282--------------------------------------------------------------------------------
ECHA_HUMAN/544-639--------------------------------------------------------------------------------
O88051_STRCO/206-302--------------------------------------------------------------------------------
Q97VU5_SULSO/190-286--------------------------------------------------------------------------------
O30218_ARCFU/190-288--------------------------------------------------------------------------------
Q99WZ1_STAAM/189-287--------------------------------------------------------------------------------
O57660_CHICK/551-646--------------------------------------------------------------------------------
Q98BD2_RHILO/509-606--------------------------------------------------------------------------------
Q9UX37_SULSF/193-287--------------------------------------------------------------------------------
Q9RUA4_DEIRA/490-582--------------------------------------------------------------------------------
O29237_ARCFU/186-280--------------------------------------------------------------------------------
O44608_CAEEL/202-299--------------------------------------------------------------------------------
Q9HY36_PSEAE/189-286--------------------------------------------------------------------------------
Q98EK7_RHILO/475-561--------------------------------------------------------------------------------
Q9HJM0_THEAC/219-314--------------------------------------------------------------------------------
Q9KGA8_BACHD/186-281--------------------------------------------------------------------------------
Q98LG2_RHILO/186-278--------------------------------------------------------------------------------
Q9X7N8_STRCO/504-604--------------------------------------------------------------------------------
Q9LDF5_ARATH/187-283--------------------------------------------------------------------------------
Q9ZBJ9_STRCO/196-292--------------------------------------------------------------------------------
Q97UX0_SULSO/186-280--------------------------------------------------------------------------------
FADB_PSEFR/497-592--------------------------------------------------------------------------------
AIM1_ARATH/492-585--------------------------------------------------------------------------------
HBD_BACSU/186-282--------------------------------------------------------------------------------
FADB2_MYCTU/190-286--------------------------------------------------------------------------------
Q97AH0_THEVO/189-285--------------------------------------------------------------------------------
O29062_ARCFU/188-281--------------------------------------------------------------------------------
Q9XA30_STRCO/413-504--------------------------------------------------------------------------------
O29090_ARCFU/181-277--------------------------------------------------------------------------------
Q9I394_PSEAE/414-509--------------------------------------------------------------------------------
O29815_ARCFU/186-282--------------------------------------------------------------------------------
HCDH1_CAEEL/199-296--------------------------------------------------------------------------------
Q9VXI1_DROME/191-282--------------------------------------------------------------------------------
Q9ABZ4_CAUCR/482-579--------------------------------------------------------------------------------
O29077_ARCFU/192-288--------------------------------------------------------------------------------
PAAH_ECOLI/188-285--------------------------------------------------------------------------------
Q53926_STRCH/176-278--------------------------------------------------------------------------------
FADJ_ECOLI/492-586--------------------------------------------------------------------------------
Q9V397_DROME/556-651--------------------------------------------------------------------------------
FAD3_RICPR/193-295--------------------------------------------------------------------------------
Q97UK9_SULSO/186-281--------------------------------------------------------------------------------
Q9HRI4_HALSA/190-285--------------------------------------------------------------------------------
Q9ADL9_SORCE/196-292--------------------------------------------------------------------------------
Q978T2_THEVO/186-280--------------------------------------------------------------------------------
Q979P5_THEVO/219-314--------------------------------------------------------------------------------
Q9K4C6_STRCO/186-282--------------------------------------------------------------------------------
Q9KBD3_BACHD/187-283--------------------------------------------------------------------------------
Q9XA30_STRCO/190-287--------------------------------------------------------------------------------
Q9A3L4_CAUCR/483-581--------------------------------------------------------------------------------

PF00984

Q56812_XANCA/203-296--------------------------------------------------------------------------------
P72132_PSEAI/211-307--------------------------------------------------------------------------------
VIPA_SALTI/201-295--------------------------------------------------------------------------------
YTCA_BACSU/196-291--------------------------------------------------------------------------------
ALGD_AZOVI/203-300--------------------------------------------------------------------------------
Q54365_STRLN/196-291--------------------------------------------------------------------------------
O31279_GLUXY/206-301--------------------------------------------------------------------------------
UGDH_DROME/209-306--------------------------------------------------------------------------------
UDG_STRPY/197-290--------------------------------------------------------------------------------
UGDH_SOYBN/209-306--------------------------------------------------------------------------------
P72834_SYNY3/219-314--------------------------------------------------------------------------------
YWQF_BACSU/197-292--------------------------------------------------------------------------------
EPSD_RALSL/211-303--------------------------------------------------------------------------------
WECC_METJA/202-293--------------------------------------------------------------------------------
CAPL_STAAU/196-290--------------------------------------------------------------------------------
WECC_ECOLI/205-297--------------------------------------------------------------------------------
O29659_ARCFU/243-338--------------------------------------------------------------------------------
O07248_MYCTU/203-300--------------------------------------------------------------------------------
O26924_METTH/203-298--------------------------------------------------------------------------------
UDG_RICPR/197-292--------------------------------------------------------------------------------
ALGD_PSESH/203-300--------------------------------------------------------------------------------
ALGD_PSEAE/203-300--------------------------------------------------------------------------------
TUAD_BACSU/198-293--------------------------------------------------------------------------------
UGDH_CAEEL/220-317--------------------------------------------------------------------------------
P72381_STAAU/197-289--------------------------------------------------------------------------------
Y1054_METJA/198-295--------------------------------------------------------------------------------

PF01450

ILVC_METTH/183-328--------------------------------------------------------------------------------
ILVC_HAEIN/210-486--------------------------------------------------------------------------------
ILVC_METJA/184-329--------------------------------------------------------------------------------
ILVC_SYNY3/184-329--------------------------------------------------------------------------------
ILVC_RHIME/184-329--------------------------------------------------------------------------------
ILVC_MYCAV/181-326--------------------------------------------------------------------------------
O94135_9FUNG/200-347--------------------------------------------------------------------------------
ILVC_BUCAP/209-485--------------------------------------------------------------------------------
ILV5_SCHPO/255-402--------------------------------------------------------------------------------
ILVC_ARCFU/185-330--------------------------------------------------------------------------------
ILVC_HELPY/186-330--------------------------------------------------------------------------------
ILVC_STRAW/184-329--------------------------------------------------------------------------------
ILVC_RHOMO/184-329--------------------------------------------------------------------------------
ILVC_LEUMC/184-329--------------------------------------------------------------------------------
ILV5_SPIOL/308-593--------------------------------------------------------------------------------
ILVC_BACSU/183-328--------------------------------------------------------------------------------
ILVC_AQUAE/184-328--------------------------------------------------------------------------------
ILVC_CORGL/185-330--------------------------------------------------------------------------------
ILV5_YEAST/248-395--------------------------------------------------------------------------------

PF08125

YN073_YEAST/229-475-DKVTSPNSMVD--------------RVTPRCTDKERKYVADTWG-----------IKDQCPVVAE--------------
MTLD_BACSU/147-345-ETVGFPNSAVD--------------RIVP............IQH-----------HEDPLKVSVE--------------
MTLK_RHOSH/208-451-AQVAFPNGMVD--------------RITPATGPHER.ELAQGFG-----------LADPVPVTCE--------------
UXAB_ECOLI/203-459-QANSFCSTLVD--------------RIVTGYPRDEVAKLEEELG-----------YHDGFLDTAE--------------
O08355_PSEFL/220-465-AHVSFPNAMVD--------------RITPMTSTAHRLQLHDEHG-----------IDDAWPVVCE--------------
YEIQ_ECOLI/216-462-EHVSFPGTMVD--------------RIVPAATDESLVEISQHLG-----------VNDPCAISCE--------------
MTLD_ECOLI/148-374-EHVGFVDSAVD--------------RIVPPS..........ASA-----------TNDPLEVTVE--------------
DALD_KLEPN/195-439-ANTTCPNTMVD--------------RITPRPAADLPARIKAQAG-----------IDDKAPVMGE--------------
YDFI_ECOLI/213-460-DNVTFPSTMVD--------------RIVPAVTEDTLAKIEQLTG-----------VRDPAGVACE--------------
UXUB_ECOLI/216-463-ENVTFPCTMVD--------------RIVPAATPETLQEIADQLG-----------VYDPCAIACE--------------
MTLD_GEOSE/149-374-KYYGFLNCAVD--------------RIVP............NQK-----------HDDPLSVVVE--------------
O68111_RHOCA/209-452-ASVAFPNSMVD--------------RITPATGDRER.AMAADLG-----------LDDAAPVTCE--------------
MTLD_MYCPN/135-355-TQVNFVDVVID--------------TIAPN...........FEK-----------KANFLDIYCE--------------
MTLD_ENTFA/148-371-QWIGFPDAAVD--------------RIVP............LQK-----------HEDPLFVQVE--------------
MTLD_CLOAB/148-373-KSVGFPNCTVD--------------RIVPN..........VDIE-----------KELPIDVAVE--------------
MTLD_STRMU/151-374-DYIGFPNAAVD--------------RIVP............AQV-----------HEDPLFVVVE--------------

PF00393

A9CIZ2_AGRT5/180-470GHFVKTIHNGIEYADMQMIAEIYGILRDGLKMSAVEIADVFAEWN.KGRLNSYLIEITEKVLRAAD....PIT.G..K..
6PGD_SHEEP/180-470GHFVKMVHNGIEYGDMQLICEAYHLMKDVLGLGHKEMAKAFEEWN.KTELDSFLIEITASILKFQD.....AD.G..K..
6PGD_SYNE7/179-471GHYVKMVHNGIEYGDMQLIAEAYDLLKSVAGLNASELHDVFAAWNKTPELDSFLIEITADIFTKVDD...LGT.G..Q..
O32911_MYCLE/189-478GHFVKMVHNGIEYSDMQLIGEAYQLLRDGLGMSAPQIADVFTEWN.RGDLNSYLVEITAEVLRQTD....IKT.G..R..
Q6WAT4_TRYCR/180-474GSCVKMYHNAGEYAVLQVWGEAFDILR.AMGLSNDEVAAVFEDWKAKGFLTSYMLDISIVAARAKV.....AD.G..S..
O66227_ECOLX/179-467GHYVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWN.EGELSSYLIDITKDIFTKKD.....EE.G..K..
O22111_SOYBN/184-478GNFVKMIHNGIEYGDMQLIAEAYDVLKSVGKLSNEELQSVFSEWN.KGELLSFLIEITADIFGIKDD...KGD.G.....
Q836Q9_ENTFA/179-470GHYVKMVHNGIEYGDMQLIAESYDLMKQILGLSVDEMAEIFKEWN.EGELDSYLIEITADILTRKD.....DE.GTDQ..
Q83G38_TROWT/177-468GHFVKMVHNGIEYADMQIIAESYDLLRRGLGLSPTRISDIFREWN.SGELESYLVGVTADILSHRD....KRT.G..K..
6PGD_BUCBP/178-467GHYVKMVHNGIEYGDMQLIAESYFILKTLLRLDNQSISKIFDIWN.QGELNSYLIDITKDILIKKD.....DQ.N..N..
Q8YLM3_NOSS1/179-469GHYVKMVHNGIEYGDMQLIAEAYDLLKNAGGLNAKQLHEVFTEWNTTDELNSFLIEITANIFPYID....PET.K..L..
Q8SAQ6_CHLRE/182-474GNFVKMVHNGIEYGDMQLISEAYDVLKTLGGLNNEELAAVFKEWN.DAELKSFLVEITAIIVNKKDD...QAP.G.....
6PGD_TREPA/179-475GHYVKMIHNGIEYGDMQIIAEGYWFMKHALGMSYEHMHHTFTRWN.TGRLHSYLIEITAAILAHQD.....TD.G..T..
Q8G729_BIFLO/181-475GHFVKMVHNGIEYADMQVIGEAYDILRRGLGMDAEEIGDVFAEWN.KGDLDSYLIEITAEILHHKD....AET.G..K..
Q6LS71_PHOPR/196-486GHFVKMVHNGIEYGDMQLISEAYHFMKEGLGLSYDEMQAIFKEWN.DTELNSYLVEITADILGYRD.....ED.G..E..
Q8A8E5_BACTN/188-478GHFVKMIHNGIEYGDMQLIAEAYWVMKNLIDLTNEEMADVFARWN.EGKLRSYLIEITSNILRHKD.....KS.G..G..
Q6HPK6_BACHK/178-469GHYVKMVHNGIEYGDMQLICEAYFFLKQTLDLTAEEFHEIFAEWN.KGELNSYLIEITADIFKKKD.....EETG..K..
6PGD_BACSU/177-467GHFTKMVHNGIEYADMQLIAEAYTFLRETLRLPLDEIASIFETWN.QGELKSYLIEITAEILRKKD....EKT.G..Q..
Q8SRX1_ENCCU/178-458GHFVKMVHNGIEYGDMAIISETYLVLK.SLGLSNMEISSLFDSWN.GMESESYLLRISCSILRMEN.....ER.G.....
Q8SAQ8_PHYIN/182-472GNYVKMVHNGIEYGDMQLIAEAYDILKIAGGLTNDELASVFDEWN.KGELESFLIEITAQIFAKKDD..LTDD.G.....
Q7VC99_PROMA/179-471GHFVKTVHNGIEYGIEQILSEGYDLMKRVCKMNCDEISDVFGIWNKTEELSSYLVEITEICLRTKD....PTD.G..A..
Q6A799_PROAC/184-473GHFVKMVHNGIEYADMQFIGEAHSLLR.AAGLTNAEAADAFESWN.HGDLNSYLVEITSRVLRAKD....PRNPD..T..
Q8CXN9_OCEIH/178-468GHFVKMVHNGIEYGDMQLIAEAYDLMKNVLGLDAKELHNVFKEWN.DGELDSYLIEITADIFTKVD.....EETG..K..
O51509_BORBU/175-464GHYVKMIHNGVEYADMQLISEVYFFMKKAFNLDNLKISEVFEKWN.EGDLSGYLLEITSKILKYKE.....NN....E..
6PGD_CERCA/180-468GHFVKMVHNGIEYGDMQLICEAYQIMK.ALGLSQAEMATEFEKWN.SEELDSFLIEITRDILNYQD.....DR.G.....
Q7SFZ4_NEUCR/212-510GHYVKMVHNGIEYGDMQLICEAYDIMKRGLGLSHKEMGDVFAKWN.KGVLDSFLIEITRDIMYFTD.....DD.G..T..
6PGD_CUNEL/182-472GHYVKMVHNGIEYGDMQLITEVYQILHEGLGLSHDEMADIFEEWN.KGDLDSFLIEITRDILRFKD.....TD.G..Q..
6PGD_CANAX/204-504GHYVKMVHNGIEYGDMQLICEAYDLMKRVGKFEDKEIGDVFATWN.KGVLDSFLIEITRDILYYND....PTD.G..K..
Q8SAQ5_PORYE/41-338GNYVKMVHNGIEYGDMQLIGEAYDVLKTVGGMSASEIAAVFEEWN.ESNLQSFLVEITAAILRTSDD..LVGD.G..S..
6PGD_DICDI/183-480GHYVKMVHNGIEYGDMQLISEAYFILKHYLGLSNDELQKTFAKWN.TGDLDSYLIEITADIFAKKC....EKDPN..T..
Q6UA37_9ENTR/194-483GHYVKMVHNGIEYGDMQLISESYFILKHSLNLNNKQLSKIFSNWN.KGELKSYLIEITKNIFLKKD.....SS.G..K..
Q7Y248_ORYSJ/168-466GNFVKMVHNGIEYGDMQLIAEAYDVLRRVGGLSNSEIADVFAEWN.RGELESFLVEITADIFTVADPLDGSGG.G.....
Q71ZU4_LISMF/178-468GHYVKMVHNGIEYGDMQLIAEAYTILKEIGGLSHDELADVFEEWN.NGELDSYLIEITKNILKVKD.....EETG..K..
6PGD_SYNY3/189-481GHYVKMVHNGIEYGDMQLIAEAYDILKNGLGLSNEQLHEVFGQWNQTDELNSFLIEISTDIFAKKD....PET.G..G..
6PGD_CAEEL/179-471GHFVKMVHNGIEYGDMQLIAEAYHLLSKAVELNHDQMAEVLDDWN.KGELESFLIEITANILKYRD.....EQ.G..E..
Q7VRX5_BLOFL/180-472GHYVKMMHNGMEYGDMQIISEIYFFLKMVLHLTAKQLGKIFSDWN.MGELSSYLIEITSHILMKSD.....NN.Q..Y..
Q6TUM2_LEIME/182-476GSCVKMYHNAGEYAVLQIWGEAYSALL.AFGFNNDQIADVFESWKADGFLKSYMLDISIVACRARE.....AA.G..N..
Q6MEF8_PARUW/181-471GHYVKMVHNGIEYGDMQLISEAYYLLKEALHLNQNELYQVFADWN.KGDLDSYLIEITSKIFKVND.....ED.G..K..
Q826E4_STRAW/181-471GHFVKMVHNGIEYADMQLIGEAYQLLRDVAGYTPAQIADIFRTWN.TGRLDSYLIEITAEVLSHVD....AAT.G..K..
Q6NHC5_CORDI/183-476GHFVKMVHNGIEYADMQVIGEAYQLLRYATEMQPSEIADVFKTWN.QGDLDSYLIEITSEVLAQVD....SET.G..T..
Q98GH7_RHILO/180-470GHFVKTIHNGIEYADMQMIAEIYGILRDGLGMGPKDIGTVFSNWN.KGRLNSYLIEITAKVLAADD....PKT.G..K..
Q8TA04_TRIVA/158-442GHFVKMVHNAIEYADMQLIAETYYIMKNALKMDNVAIADVFGKWN.QGVLKSYLIEITEKVLRKKE.....GD....K..
Q893F9_CLOTE/178-468GHYVKMVHNGIEYADMQLISEAYMLLKHLGKFNNKELHGIFAKWN.EGELESYLIKITSNIFTVKD....RET.N..N..
6PGD_BUCAI/178-467GHYVKMVHNGIEYGDMQLISESYFLLKYLLNMSNEELSSTFSKWN.KGELNSYLIEITKNIFIEKD.....EK.G..K..
Q7V1T5_PROMP/179-471GHFVKTVHNGIEYGIEQILAEAYDLMKRVKNMNGSQMAEVFGLWNNTDELASYLVEITQICLNTKD....ELT.G..E..
6PGD_CHLTR/180-472GHFVKAVHNGIEYGDIQLICETYEILKTRLNLSLEQIGNIFFEWN.QTDLNSYLIGAAAAVLIAKD.....EN.G..N..
Q7NLK6_GLOVI/192-482GHYVKMVHNGIEYGDMQLIAEAYDLLRQTLGLGAAELHDIFAEWN.AGELKSFLIEITADIFTKID....PET.G..K..
6PGD_SCHPO/183-479GHYVKMVHNGIEYGDMQLICETYDIMKRGLGMSCDEIADVFEKWN.TGKLDSFLIEITRDVLRYKA.....DD.G..K..
Q8EFR5_SHEON/206-499GHYVKMVHNGIEYADMQLICEAYQLLHDGLGMSAAEVGEVFERWN.QGSLNSYLMGISAEVLKQAD....PLT.G..K..
Q823H8_CHLCV/180-472GHYVKTVHNGIEYGDIQLICEAYGLLRTRLGISPEGISEIFAEWN.SRELESYLMRISVEVLSLKG.....PD.G..S..
Q6ADQ1_LEIXX/183-473GHFVKMIHNGIEYADMQLIAEAYDLLRMVGGLEPAAIADVFAEWN.TGSLESYLIEITAKVLRQVD....AET.G..K..
6PGD_CHLPN/178-470GHYVKAVHNGIEYGDIQLICEAYGILRDFLKLSATAVATILKEWN.TLELESYLIRIASEVLALKD.....PE.G..I..
Q8SAQ4_PORYE/75-372GHYVKMVHNGIEYGDMQLICEAYSLLRTVLGLSNDKCADVFDEWN.KGSLDSYLIEITANILRYKD....TKD.G..KGD
6PGD_STAAS/178-466GHYVKMVHNGIEYADMQLIAESYAMMKELLGMSHEDIAQTFKDWN.AGELESYLIEITGDIFMKLD.....EN.K..E..
Q7M451_ASCSS/181-470GHYVKMVHNGIEYGDMQLICETYHIMKLVLGMNNDEISEVFAEWN.KGELDSFLIEITRDIMKFRD.....TD.N..V..
Q9SME1_9PHAE/183-473GNYVKMVHNGIEYGDMQLIAEVYDVLKHVAGLTNDELSATFTDWN.QGELQSFLIEITAVIFSRKDD..LTSS.G.....
Q74H97_LACJO/176-459GHYVKMVHNGIEYGIMQIISEVYDVLRTVGHYSNNEMSEIFKNWD.KGGLQAYLIEITSKVLKQKDN...LTD....D..
Q8FXG6_BRUSU/180-469GHFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWN.EGPLNSYLIEITAKVLKSTD....PET.G..K..

PF07479

O51341_BORBU/184-347-----------------------------------------NDVFGVQIAAALKNVFAIAFGILDAYKLNYPNLIG....
GPDA_DROEZ/194-343-----------------------------------------EDADAVEVCGALKNIVACGAGFVDG......LKLG....
GPDA_RABIT/192-342-----------------------------------------QEVNTVEICGALKDLVAVGAGFCDG......IGFG....
GPDA_MYCLE/190-341-----------------------------------------SDVVGTEIGGVCKNVIALACGMAAG......VGFG....
GPD2_YEAST/282-432-----------------------------------------DDVAGISIAGALKNVVALACGFVEG......MGWG....
GPDA_SYNY3/159-303-----------------------------------------NDPLGTELGGTLKNVMAIAVGVCEG......LGLG....
GPDA_ARCFU/180-331-----------------------------------------TDIIGTEITSALKNVYSIAIAWIRG......YESRKNVE
GPDA_TRYBB/191-335-----------------------------------------TDVIGCEIASAMKNVLAIASGALKG......LGTE....
GPDA_TAKRU/193-344-----------------------------------------EEYDVVEICGALKNIVAVGAGFCDG......LGFG....
GPDA_CHLPN/180-324-----------------------------------------TDIKGAALGGALKNVIAIACGIAEG......LSFG....
GPDA_TREPA/194-353-----------------------------------------LDVVGVQVCAAVKNVIAIAFGLLDAMA.EHSEAFG....
GPDA_STRCO/182-326-----------------------------------------TDVVGCELGGAVKNVIGLAVGIADG......MGLG....
GPDA_METTH/174-309-----------------------------------------ENVEGVEFCGILKNVYAVAMGILDG......QITG....
GPDA_CHLTR/180-324-----------------------------------------SDLKGVALGGALKNVIAIACGISDG......FRFG....
GPDA_SHIFL/183-327-----------------------------------------PDFIGVQLGGAVKNVIAIGAGMSDG......IGFG....
GPDA2_MYCTU/183-327-----------------------------------------DDVVGVETAGALKNVFAIAVGMGYS......LGIG....
GPDA_LEIME/198-342-----------------------------------------TDTVGCEVASAVKNVLAIGSGVANG......LGMG....
GPDA_BACSU/180-324-----------------------------------------PDIIGVEIGGALKNIIALAAGITDG......LGYG....
O22216_ARATH/273-432-----------------------------------------SDLVTHEVMGGLKNVYAIGAGMVAA......LTNE....
GPDA_CUPLA/213-364-----------------------------------------EDVEGVELCGTLKNIVAIAAGFVDG......LEMG....
GPDH2_CAEEL/236-385-----------------------------------------EDAHTVELCGALKNVVACAAGFTDG......LGYG....
GPD2_SCHPO/224-373-----------------------------------------EDVPGVALGGALKNIVAVAAGIIDG......LELG....
GPD1_SCHPO/220-369-----------------------------------------DDVAGVALGGALKNVVAMAVGFADG......LEWG....
O61368_APIME/194-343-----------------------------------------EDVDSVECCGALKNIVACGAGFIDG......LGLG....
O96558_LOCMI/194-343-----------------------------------------DDVNAVEACGALKNIIAVGVGFVDG......LGYG....
GPDA_HAEIN/183-327-----------------------------------------SDMTGVQLGGAIKNVIAIGAGISDG......MGFG....
GPDA_HELPY/165-305-----------------------------------------QDIIGGEIAGAYKNVIAIAGGVCDG......LKLG....

PF00725

HCDH_HUMAN/216-313--------------------------------------------------GFIVNRLLVPY-------------------
HBD_THETC/184-280--------------------------------------------------GFVVNRILIPM-------------------
CRYL1_RABIT/192-283--------------------------------------------------GFVLNRLQYAI-------------------
ECHP_HUMAN/478-582--------------------------------------------------GFVGNRMLNPY-------------------
ECHP_CAVPO/481-585--------------------------------------------------GFVGNRMLRSY-------------------
Q9YBW6_AERPE/198-292--------------------------------------------------GFIVNRILGRL-------------------
Q9HQ61_HALSA/191-286--------------------------------------------------GFVVNRILVPL-------------------
FADB_ECOLI/496-592--------------------------------------------------GFFVNRVLFPY-------------------
O17612_CAEEL/535-630--------------------------------------------------GFFVVRCLSPM-------------------
O29956_ARCFU/188-278--------------------------------------------------GFIVNRILVPY-------------------
MFPA_CUCSA/495-588--------------------------------------------------GFAVNRMFFPY-------------------
HBD_CLODI/183-279--------------------------------------------------GFVVNRILIPM-------------------
Q9ZBJ9_STRCO/502-598--------------------------------------------------GFIVNALLFPY-------------------
Q9Y1C5_APIME/7-98--------------------------------------------------GFVLNRIQYAI-------------------
Q9I300_PSEAE/499-599--------------------------------------------------GFFTSRVFGTF-------------------
Q9HU01_PSEAE/190-281--------------------------------------------------GFIGNRMLEPY-------------------
LCDH_PSEAE/188-280--------------------------------------------------GFIADRLLEAL-------------------
HBD_CLOAB/184-280--------------------------------------------------GFVVNRILIPM-------------------
Q9KIE3_STRHY/181-277--------------------------------------------------GFVTSRLLHPM-------------------
Q9HY36_PSEAE/415-510--------------------------------------------------GFIVQRTLASI-------------------
Q9F9V1_AZOEV/190-287--------------------------------------------------GFIVNRVARPY-------------------
FADJ_VIBCH/497-590--------------------------------------------------GFYVNRILAPY-------------------
O53872_MYCTU/508-607--------------------------------------------------GFFTSRVIGTF-------------------
O28011_ARCFU/200-294--------------------------------------------------GFIVNRVQAPA-------------------
Q9RZ10_DEIRA/239-335--------------------------------------------------GYILNTLLVPL-------------------
HCDH2_CAEEL/211-308--------------------------------------------------GFIVNRLLVPY-------------------
O29143_ARCFU/183-276--------------------------------------------------GFLINRINIRV-------------------
O84980_PSEPU/190-287--------------------------------------------------GFIVNRVARPF-------------------
Q988C8_RHILO/184-282--------------------------------------------------GFVENRVLYAL-------------------
ECHA_HUMAN/544-639--------------------------------------------------GFYTTRCLAPM-------------------
O88051_STRCO/206-302--------------------------------------------------GFVVNALLIPY-------------------
Q97VU5_SULSO/190-286--------------------------------------------------GYVVNRILGQI-------------------
O30218_ARCFU/190-288--------------------------------------------------GFIVNRIFVTM-------------------
Q99WZ1_STAAM/189-287--------------------------------------------------GFVANRVGTQT-------------------
O57660_CHICK/551-646--------------------------------------------------GFYTTRCLGPM-------------------
Q98BD2_RHILO/509-606--------------------------------------------------GFYVNRCVLRY-------------------
Q9UX37_SULSF/193-287--------------------------------------------------GFIGNRLAFAL-------------------
Q9RUA4_DEIRA/490-582--------------------------------------------------GFVGNRMVHRY-------------------
O29237_ARCFU/186-280--------------------------------------------------GFIANRVVAPR-------------------
O44608_CAEEL/202-299--------------------------------------------------GFIVNRLLIPY-------------------
Q9HY36_PSEAE/189-286--------------------------------------------------GFIVNHAGRAF-------------------
Q98EK7_RHILO/475-561--------------------------------------------------GFVGNRMLAAR-------------------
Q9HJM0_THEAC/219-314--------------------------------------------------GFIVNRLLIPL-------------------
Q9KGA8_BACHD/186-281--------------------------------------------------GFVTSRISALI-------------------
Q98LG2_RHILO/186-278--------------------------------------------------GFIMNRLQGAL-------------------
Q9X7N8_STRCO/504-604--------------------------------------------------GFFTSRVIGHF-------------------
Q9LDF5_ARATH/187-283--------------------------------------------------GFVVNRILMPM-------------------
Q9ZBJ9_STRCO/196-292--------------------------------------------------GFVADGLLFGY-------------------
Q97UX0_SULSO/186-280--------------------------------------------------GFVVNRILLRI-------------------
FADB_PSEFR/497-592--------------------------------------------------GFLVNRVLFPY-------------------
AIM1_ARATH/492-585--------------------------------------------------GFAVNRTFFPY-------------------
HBD_BACSU/186-282--------------------------------------------------GFVSNRVLLPM-------------------
FADB2_MYCTU/190-286--------------------------------------------------GFVVNALLVPY-------------------
Q97AH0_THEVO/189-285--------------------------------------------------GFYTTRFIEGW-------------------
O29062_ARCFU/188-281--------------------------------------------------GMVANRLAAAL-------------------
Q9XA30_STRCO/413-504--------------------------------------------------GMIVARTVARI-------------------
O29090_ARCFU/181-277--------------------------------------------------GHVLNRMLAAA-------------------
Q9I394_PSEAE/414-509--------------------------------------------------GFVVQRVLAMI-------------------
O29815_ARCFU/186-282--------------------------------------------------GFATSRLGLVL-------------------
HCDH1_CAEEL/199-296--------------------------------------------------GFIVNRLLIPY-------------------
Q9VXI1_DROME/191-282--------------------------------------------------GFALNRIQYAI-------------------
Q9ABZ4_CAUCR/482-579--------------------------------------------------GFYTSRCFGTF-------------------
O29077_ARCFU/192-288--------------------------------------------------GFFTTRFINSW-------------------
PAAH_ECOLI/188-285--------------------------------------------------GFIVNRVARPY-------------------
Q53926_STRCH/176-278--------------------------------------------------GFAANRLQSAL-------------------
FADJ_ECOLI/492-586--------------------------------------------------GFYVNRILAPY-------------------
Q9V397_DROME/556-651--------------------------------------------------GFYTTRILSTM-------------------
FAD3_RICPR/193-295--------------------------------------------------GFIANRVGCFL-------------------
Q97UK9_SULSO/186-281--------------------------------------------------GFVSNRIFLRL-------------------
Q9HRI4_HALSA/190-285--------------------------------------------------GFVTNRILMPW-------------------
Q9ADL9_SORCE/196-292--------------------------------------------------GFVSNRVLMLT-------------------
Q978T2_THEVO/186-280--------------------------------------------------GFVVNRINAPE-------------------
Q979P5_THEVO/219-314--------------------------------------------------GFIVNRLLIPF-------------------
Q9K4C6_STRCO/186-282--------------------------------------------------GFVTTRLISAL-------------------
Q9KBD3_BACHD/187-283--------------------------------------------------GFIVNRIMIPQ-------------------
Q9XA30_STRCO/190-287--------------------------------------------------GFVVNRVARPF-------------------
Q9A3L4_CAUCR/483-581--------------------------------------------------GFVGNRMLAQR-------------------

PF00984

Q56812_XANCA/203-296--------------------------------------VRSAELTKYAANAMLATKISF---------------------
P72132_PSEAI/211-307--------------------------------------TKAAEMTKLLENIHRAVNIGL---------------------
VIPA_SALTI/201-295--------------------------------------IKVAEAAKVIENTQRDLNIAL---------------------
YTCA_BACSU/196-291--------------------------------------LAGAELIKYANNFFLAAKISF---------------------
ALGD_AZOVI/203-300--------------------------------------IAVAEMIKYTCNVWHATKVTF---------------------
Q54365_STRLN/196-291--------------------------------------LTEAELVKHATNAYLGMCVSF---------------------
O31279_GLUXY/206-301--------------------------------------LETAELIKYSANSFLAMKITF---------------------
UGDH_DROME/209-306--------------------------------------TWSSELSKLAANAFLAQRISS---------------------
UDG_STRPY/197-290--------------------------------------ASEAEAVKLFANTYLALRVAY---------------------
UGDH_SOYBN/209-306--------------------------------------LWSAELSKLAANAFLAQRISS---------------------
P72834_SYNY3/219-314--------------------------------------LSSAEMIKYAANAFLATKISF---------------------
YWQF_BACSU/197-292--------------------------------------IRSAEMIKYASNAFLATKISF---------------------
EPSD_RALSL/211-303--------------------------------------ARTAEMCKLTENAFRDVNIAF---------------------
WECC_METJA/202-293--------------------------------------AKTAEMVKLMENTYRDVNIAL---------------------
CAPL_STAAU/196-290--------------------------------------IKVAEAAKVIENTQRDVNIAL---------------------
WECC_ECOLI/205-297--------------------------------------SRTAEMCKLTENSFRDVNIAF---------------------
O29659_ARCFU/243-338--------------------------------------IKTAEMIKYASNAFLATKISF---------------------
O07248_MYCTU/203-300--------------------------------------LQTAELVKVSANAFLATKISF---------------------
O26924_METTH/203-298--------------------------------------LMTAEMVKLMENTYRDTNIAL---------------------
UDG_RICPR/197-292--------------------------------------LVTSELIKYVSNSFLATKIAF---------------------
ALGD_PSESH/203-300--------------------------------------IAVAEMIKYTCNVWHATKVTF---------------------
ALGD_PSEAE/203-300--------------------------------------VEVAEMIKYTCNVWHAAKVTF---------------------
TUAD_BACSU/198-293--------------------------------------LESAEMIKYAANAFLATKISF---------------------
UGDH_CAEEL/220-317--------------------------------------TWSSELSKLVANAFLAQRISS---------------------
P72381_STAAU/197-289--------------------------------------ARTAEMSKLMENTYRDVNIAL---------------------
Y1054_METJA/198-295--------------------------------------WETAELIKYASNAFLATKISF---------------------

PF01450

ILVC_METTH/183-328-------------------------------------FREETETDLFGEQAVLCGGVTE.....................
ILVC_HAEIN/210-486-------------------------------------FVAEVKSDLMGEQTILCGMLQAGSIVCYDKLVADGKDPAYAGK
ILVC_METJA/184-329-------------------------------------FREETETDLFGEQVVLCGGVTE.....................
ILVC_SYNY3/184-329-------------------------------------FREETETDLFGEQVVLCGGLTA.....................
ILVC_RHIME/184-329-------------------------------------FKEECETDLFGEQVVLCGGLVE.....................
ILVC_MYCAV/181-326-------------------------------------FKDETETDLFGEQAVLCGGTEE.....................
O94135_9FUNG/200-347-------------------------------------FERETYSDLTGERGTLMGCIQG.....................
ILVC_BUCAP/209-485-------------------------------------FIAEVKSDLMGEQTILCGLLQTASLICYEKLIKDKHNPSYAAK
ILV5_SCHPO/255-402-------------------------------------FKKEVISDLVGERGCLMGGING.....................
ILVC_ARCFU/185-330-------------------------------------FKEETETDLFGEQVDLCGGVAE.....................
ILVC_HELPY/186-330-------------------------------------FKEECESDLFGEQAVLCGGLEA.....................
ILVC_STRAW/184-329-------------------------------------FTEETETDLFGEQAVLCGGTAA.....................
ILVC_RHOMO/184-329-------------------------------------FREECETDLFGEQVVLCGGLSK.....................
ILVC_LEUMC/184-329-------------------------------------FEEETTEDLFGEQAVLCGGLTQ.....................
ILV5_SPIOL/308-593-------------------------------------LEQEYKSDIFGERGILLGAVHGIVECLFRRYTESGMSEDLAYK
ILVC_BACSU/183-328-------------------------------------FKEETETDLFGEQAVLCGGLSA.....................
ILVC_AQUAE/184-328-------------------------------------FKEETETDLFGEQMVLCGGVTA.....................
ILVC_CORGL/185-330-------------------------------------FEAETVTDLFGEQAVLCGGTEE.....................
ILV5_YEAST/248-395-------------------------------------FEREVNSDLYGERGCLMGGIHG.....................

PF08125

YN073_YEAST/229-475----PFIQ-------------WVLEDNFSDGRPP...WELVGVQVVKDVDSYELMKLR----LLNG-------GHSAMGY
MTLD_BACSU/147-345----PFFE-------------WVIDESGFKG.KT...PVINGALFVDDLTPYIERKLF----TVNT-------GHAVTAY
MTLK_RHOSH/208-451----PFRQ-------------WVIEDHFPAGRPA...LEKVGVTFTPHVHAYEAMKIR----ILNG-------GHAVIAY
UXAB_ECOLI/203-459----HFYL-------------FVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERKVA----ILNG-------AHTALVP
O08355_PSEFL/220-465----PFVQ-------------WVLEDKFVNGRPA...WEKVGVQFTDDVTPYEEMKIG----LLNG-------SHLALTY
YEIQ_ECOLI/216-462----PFIQ-------------WVVEDNFVAGRPA...WEVAGVQMVNDVLPWEEMKLR----MLNG-------SHSFLAY
MTLD_ECOLI/148-374----TFSE-------------WIVDKTQFKG.AL...PNIPGMELTDNLMAFVERKLF----TLNT-------GHAITAY
DALD_KLEPN/195-439----TFIQ-------------WVVENNFRDVRPN...LEAVGVEMVESVIPYEEAKIR----ILNA-------SHSCIAW
YDFI_ECOLI/213-460----PFRQ-------------WVIEDNFVAGRPE...WEKAGAELVSDVLPYEEMKLR----MLNG-------SHSFLAY
UXUB_ECOLI/216-463----PFRQ-------------WVIEDNFVNGRPD...WDKVGAQFVADVVPFEMMKLR----MLNG-------SHSFLAY
MTLD_GEOSE/149-374----PFFE-------------WVIEKRNIIG.AI...PPIQGAHFVDDLKPYIERKLF----TVNT-------GHAIASY
O68111_RHOCA/209-452----TFRQ-------------WVIEDKFPAGRPA...LEKVGVTFTPHVDKFETMKIR----ILNG-------GHAIIAY
MTLD_MYCPN/135-355----KYSE-------------IYAETFPLEI........KGVNQKNS.LDRFIIKKLL----LVNA-------LHSVIGL
MTLD_ENTFA/148-371----PFCE-------------WVIDDTNRKA.KE...IQLEGVHYVADLEPYIERKLF----SVNT-------GHATVAY
MTLD_CLOAB/148-373----DFYE-------------WDIEKNKVKI..N...NKIIGAEYVEKLDPYLERKLF----LLNG-------AHATIAY
MTLD_STRMU/151-374----PFSE-------------WVVETAAMKN.PD...LKLSSVHYEENLEPFIERKLF----SVNS-------GHATTAY

PF00393

A9CIZ2_AGRT5/180-470....PMVDLILDKAGQKGTGKWSVIEAQNMGVAA---TAIEAAVAARILSSQKDEREAAEK.IFGL...PT....LAAAP
6PGD_SHEEP/180-470....HLLPKIRDSAGQKGTGKWTAISALEYGVPV---TLIGEAVFARCLSSLKDERIQASK.KLKG...PQ....NIPFE
6PGD_SYNE7/179-471....PLVELILDAAGQKGTGRWTVETALEIGVAI---PTIIAAVNARILSSIKAERQAASE.ILSG...PI....TEPFS
O32911_MYCLE/189-478....PLVDVILDKAEQKGTGRWTVQSALDLGVPI---TGIAEAVFARALSGSVLQRKAAIG.LASG........KLGNKP
Q6WAT4_TRYCR/180-474....HLSEHVKDCIGSKGTGLWSAQEALEVGVPA---PSLNMAVLSRQMTMYKSERELNAK.TLPF..VLKVPGYAIKDK
O66227_ECOLX/179-467....YLVDVILDEAANKGTGKWTSQSSLDLGEPL---SLITESVFARYISSLKDQRVAASK.VLSG...PQ.....AQPA
O22111_SOYBN/184-478....YLVDKVLDKTGMKGTGKWTVQQAAELSIAA---PTIEASLDARFLSGLKEERVEAAK.VFKSGGIGD...IVTDQH
Q836Q9_ENTFA/179-470....PIVDVILDAAGNKGTGKWTSQSALDLGVPL---PLITESVFARFISAYKEERVKASG.ILSK...PA....AFNFA
Q83G38_TROWT/177-468....PFVDIVLDQAGAKGTGAWTAQNALDLGVPA---GSVSEAVFARSLSS.DEQRCQVQQ.KLSR.....SQASSHEAP
6PGD_BUCBP/178-467....YLIDCILDEGSSKGTGTWTTKSALDLNEPL---TLITESVFFRYLSSLKSQRLLASK.ILCG...PK....DFFIV
Q8YLM3_NOSS1/179-469....PLVDLIVDAAGQKGTGRWTVQTALELGVSI---PTITAAVNARIISSIRDERIAASK.QLTG...PS.....GKYD
Q8SAQ6_CHLRE/182-474....YLVDQIVDQTGSKGTGKWTVQQAAELAVAA---PTMASALDARYMSALKSERVAASK.SFTSCVTPG.....PVAG
6PGD_TREPA/179-475....PLLEKILDAAGQKGTGRWTCVAALEEGSPL---TLITESVMARSLSAQKQARCKAHR.VFGS..PVKVSKAETLSA
Q8G729_BIFLO/181-475....PFVDVVVDHAGMKGTGTWTVQTGLECGSPV---AAIGEAVFARALSSHGELREDAQKEGLAG...PN..KTIDLAG
Q6LS71_PHOPR/196-486....PLLEKILDTAGQKGTGKWTGINALDLGIPL---TLITESVFARCLSAIKDQRVEAEA.LFGKTIQPI........D
Q8A8E5_BACTN/188-478....YLIDKILDAAGQKGTGKWSVINAMELGMPL---GLIATAVFERSLSAQKELRHLASK.QFLC........KHTLPI
Q6HPK6_BACHK/178-469....PLVDVILDTAGQKGTGKWTSQSALDLGISL---PIITESVFARCISALKEERVNASK.VLSG...PK...DKTAIG
6PGD_BACSU/177-467....PLIDVILDKTGQKGTGKWTSMQAIDNGIPS---TIITESLFARYLSSLKEERMAAQD.VLAG...PE....AEEKH
Q8SRX1_ENCCU/178-458....SVLDQIADVSGQKGTGMEAVVSSMEMGQPI---PAIMEAVASRMVSYAKKKRCWLSE.RLEG............GK
Q8SAQ8_PHYIN/182-472....YVVDKILDKTGMKGTGRWTVQEAAERSIAA---PTITASLDARYLSARKDERVFASK.ILSG...PS.....EIPA
Q7VC99_PROMA/179-471....DLVEKIMDKAGQKGTGLWTVVSALQLGASV---PTIYASLNGRVMSSMKSERVKAEK.VFGK.....L.SIERTDL
Q6A799_PROAC/184-473....DLLDVIRDEAGMKGTGTWTVQTALELGVDV---STISEAVFARSVSSAVPLRTVGQH.VLAG.......PEHTITV
Q8CXN9_OCEIH/178-468....PLVEVILDKAGQKGTGKWTSKNALDLGVPL---PLITESVFARFISSLKDERVRASK.ELSG...PT....NAMLG
O51509_BORBU/175-464....YLVDKILDIANQKGTGVWTAIDALESGVPV---NLIVESVFSRFMSGLKHERIIASD.LLKM........DTSSFE
6PGD_CERCA/180-468....YLLERIRDTAGQKGTGKWTAISALQYGVPV---TLIGEAVFSRCLSALKDERVAASK.QLKG...PN....VNAKV
Q7SFZ4_NEUCR/212-510....PLVEKILDKAGQKGTGKWTAVNALDLGMPV---TLIAEAVLARCLSGIKEERVKAST.KLEFVGRAN......KFE
6PGD_CUNEL/182-472....PLVTKIRDTAGQKGTGKWTAIDSLDRGIPV---TLIGEAVYSRCLSSLKDERVRASK.ILQG...PS....SSKFT
6PGD_CANAX/204-504....PLVEKILDTAGQKGTGKWTAVNALDLGIPV---TLIGEAVFSRCLSAMKAERVEASK.ALKG...PQ..VTGESPI
Q8SAQ5_PORYE/41-338....ALVEKVLDQTGAKGTGMWTVQEAAARLVPI---PTIAAALEARYLSALKEDRTAASA.VLAG...PSTDAAPSVTA
6PGD_DICDI/183-480....YVVDTILDSAGQKGTGKWTAINALDVGIPL---TLVAESVFARCVSSFKEERVKAST.ILAG...PNPNEANKKFT
Q6UA37_9ENTR/194-483....YLIDVILDKANNKGTGKWTSQSALNLGEPL---SLITQSVFFRYLSSFKNQRLQASK.ILYG...PK....PSQDV
Q7Y248_ORYSJ/168-466....GLVDKILDKTGMKGTGKWTVQQAAELAIAA---PTIAASLDGRYLSGLKDERVAAAG.VLKAEGMPS..GLLETIN
Q71ZU4_LISMF/178-468....PIVDVILDKAGQKGTGKWTSQSALDLGVPL---SLITESVFARYISALKDERVYAST.VLSG...PS....NYRFE
6PGD_SYNY3/189-481....HLIDYILDAAGQKGTGRWTVMSGLELGVPI---PTIYAAVNARVMSSLKEERVAASG.QLSG...PS.....KTFS
6PGD_CAEEL/179-471....PIVPKIRDSAGQKGTGKWTCFAALEYGLPV---TLIGEAVFARCLSALKDERVRASK.QLPR...PQ..VSPDTVV
Q7VRX5_BLOFL/180-472....CVLDYILDVADNKGTGLWSSKDALDLGVPS---TMITESVFARYLSTLKNQRIQASK.VFSNVFEGK....VNFDL
Q6TUM2_LEIME/182-476....YLSEKVLDRIGSKGTGLWSAQEALEVGVPA---PSLNMAVISRQMTMYKAERVANSK.AFPH..FPCGPCEKATDK
Q6MEF8_PARUW/181-471....PLVDKILDVAGQKGTGKWTVINALDLGMPL---TLIGEAVFARCLSALKDERVAASE.LLKG...PD.....AKFE
Q826E4_STRAW/181-471....PFVDVVQDQAEQKGTGRWTVQIALDLGVPV---SGIAEAVFARSLSGHQELREASRG..LAG...PK...AAPLGE
Q6NHC5_CORDI/183-476....PLIDLIVDEAGQKGTGRWTVKAALDLGIAT---TGIGEAVFARALSGATTQRKAAQGNLPAG...TL..ESLASLN
Q98GH7_RHILO/180-470....PVVDIILDRAGQKGTGKWSVIEAQQLGIPA---TAIEAAVAARVLSSIKDERLAAEK.AYGN.......IGVSKIS
Q8TA04_TRIVA/158-442....HIVDLILDTAEQKGTGKWTSQDSFDIPSAT---PAFAEAVYARVISCLKPERVEASK.IIKH.........HPLEG
Q893F9_CLOTE/178-468....YLLDMILDKASQKGTGKWTNMEAIDLGVDV---SIITSALNGRFMSNLKEERLRASK.ILNG.......KVESSIN
6PGD_BUCAI/178-467....YLIDRILDVAEDKGTGKWISKSALDLREPL---SLITESVFARYLSSLKRQRIIASK.ILQG...PK....IKTFI
Q7V1T5_PROMP/179-471....DVVEKILDKAGQKGTGLWTVVSALELGISV---PTIYASLNARVMSSLKVQRSEIEK.TIPM.....E.AIEDFDL
6PGD_CHLTR/180-472....AIASTILDVAGQKGTGRWVAEDAIKAGVPM---SLIIESVLARYLSTWKEVRTKAAQ.EFPG.....I.PLLCQPP
Q7NLK6_GLOVI/192-482....PLVDLILDKAGQKGTGKWTSQNAYDLGIPI---PTINAAVESRILSAYKSERVAASK.ILSG...PE....RPPFT
6PGD_SCHPO/183-479....PLVEKILDAAGQKGTGKWTAQNALEMGTPV---SLITEAVFARCLSSLKSERVRASK.KLTG...PN.....TKFT
Q8EFR5_SHEON/206-499....PLVEMILDKAGQKGTGLWTAVSSLQIGCPA---PTIAEAVYARAVSTQKSLRVELSK.KLAG.....P.LSPAMDE
Q823H8_CHLCV/180-472....PVIDTILDVAGQKGTGRWTAIDAIDSGVPL---SLIIESVLARFLSSWKTVREQAAS.ELPG.....I.PIVFEKP
Q6ADQ1_LEIXX/183-473....PFVDIVLDQAGSKGTGVWTVQNALDLGIPV---GGIAEAVFARAVSSKPAQRTAVQR.VITS.......RPEAQRP
6PGD_CHLPN/178-470....PVIDTILDVVGQKGTGKWTAIDALNSGVPL---SLIIGAVLARFLSSWKEIREQAAR.NYPG.....T.PLIFEMP
Q8SAQ4_PORYE/75-372ADTPSLVDKIMDRAQQKGTGKWTVGTSLDMGVPV---TLISEAVFARMLSSMKEERVRASE.KLSG...PS.....SEFK
6PGD_STAAS/178-466....ALVEKILDTAGQKGTGKWTSINALELGIPL---TIITESVFARFISSIKEERVNASK.ELNG...PK.....ASFD
Q7M451_ASCSS/181-470....HLLDKIRDAAGQKGTGKWTAISALEFGMPL---TLIGESVFARCLSSLKDERVIASK.QLSG...PT.....PSFT
Q9SME1_9PHAE/183-473....HVVDKILDKTGMKGTGRWTVQEAAERSTAA---PTMAAALDARYMSGRKGERVEAAK.TLKG...PS.....TIPQ
Q74H97_LACJO/176-459....HIIDHILNEASYKGTGNWMLEDAIRLGAPI---TVIAEAVLARFMSKATLRNDPEPK...............IDPE
Q8FXG6_BRUSU/180-469....AMVDMILDEAGQKGTGRWAAIEAQILGVPA---TGIEAAVAARSLSSMKGEREEAAK.AYKS.......GARTLDI

PF07479

O51341_BORBU/184-347.NNTES--------------------------------------------------------------------------
GPDA_DROEZ/194-343.DNTKA--------------------------------------------------------------------------
GPDA_RABIT/192-342.DNTKA--------------------------------------------------------------------------
GPDA_MYCLE/190-341.ENTAA--------------------------------------------------------------------------
GPD2_YEAST/282-432.NNASA--------------------------------------------------------------------------
GPDA_SYNY3/159-303.TNAKS--------------------------------------------------------------------------
GPDA_ARCFU/180-331MSNAKG--------------------------------------------------------------------------
GPDA_TRYBB/191-335.NNARA--------------------------------------------------------------------------
GPDA_TAKRU/193-344.DNTKA--------------------------------------------------------------------------
GPDA_CHLPN/180-324.NNAKA--------------------------------------------------------------------------
GPDA_TREPA/194-353.DNTES--------------------------------------------------------------------------
GPDA_STRCO/182-326.DNAKG--------------------------------------------------------------------------
GPDA_METTH/174-309.ENHRH--------------------------------------------------------------------------
GPDA_CHLTR/180-324.DNAKS--------------------------------------------------------------------------
GPDA_SHIFL/183-327.ANART--------------------------------------------------------------------------
GPDA2_MYCTU/183-327.ENTRA--------------------------------------------------------------------------
GPDA_LEIME/198-342.LNARA--------------------------------------------------------------------------
GPDA_BACSU/180-324.DNAKA--------------------------------------------------------------------------
O22216_ARATH/273-432SATSKS--------------------------------------------------------------------------
GPDA_CUPLA/213-364.NNTKA--------------------------------------------------------------------------
GPDH2_CAEEL/236-385.DNTKA--------------------------------------------------------------------------
GPD2_SCHPO/224-373.DNTKS--------------------------------------------------------------------------
GPD1_SCHPO/220-369.GNTKA--------------------------------------------------------------------------
O61368_APIME/194-343.DNTKA--------------------------------------------------------------------------
O96558_LOCMI/194-343.DNTKA--------------------------------------------------------------------------
GPDA_HAEIN/183-327.ANART--------------------------------------------------------------------------
GPDA_HELPY/165-305.NSAKA--------------------------------------------------------------------------

PF00725

HCDH_HUMAN/216-313-LMEAI--------------------------------------------------------------------------
HBD_THETC/184-280-INEAI--------------------------------------------------------------------------
CRYL1_RABIT/192-283-ISEAW--------------------------------------------------------------------------
ECHP_HUMAN/478-582-YNQAY--------------------------------------------------------------------------
ECHP_CAVPO/481-585-YEQTN--------------------------------------------------------------------------
Q9YBW6_AERPE/198-292-MESAC--------------------------------------------------------------------------
Q9HQ61_HALSA/191-286-LNEAA--------------------------------------------------------------------------
FADB_ECOLI/496-592-FAGFS--------------------------------------------------------------------------
O17612_CAEEL/535-630-MSEIV--------------------------------------------------------------------------
O29956_ARCFU/188-278-LVLAI--------------------------------------------------------------------------
MFPA_CUCSA/495-588-SQAAI--------------------------------------------------------------------------
HBD_CLODI/183-279-INEAV--------------------------------------------------------------------------
Q9ZBJ9_STRCO/502-598-LNNAV--------------------------------------------------------------------------
Q9Y1C5_APIME/7-98-LNEAW--------------------------------------------------------------------------
Q9I300_PSEAE/499-599-TNEGI--------------------------------------------------------------------------
Q9HU01_PSEAE/190-281-ATEAR--------------------------------------------------------------------------
LCDH_PSEAE/188-280-WREAL--------------------------------------------------------------------------
HBD_CLOAB/184-280-INEAV--------------------------------------------------------------------------
Q9KIE3_STRHY/181-277-INDAA--------------------------------------------------------------------------
Q9HY36_PSEAE/415-510-VNLAC--------------------------------------------------------------------------
Q9F9V1_AZOEV/190-287-YAEAL--------------------------------------------------------------------------
FADJ_VIBCH/497-590-MNEAA--------------------------------------------------------------------------
O53872_MYCTU/508-607-VNEAL--------------------------------------------------------------------------
O28011_ARCFU/200-294-SVLLM--------------------------------------------------------------------------
Q9RZ10_DEIRA/239-335-LGAAL--------------------------------------------------------------------------
HCDH2_CAEEL/211-308-MFEAL--------------------------------------------------------------------------
O29143_ARCFU/183-276-FVEAI--------------------------------------------------------------------------
O84980_PSEPU/190-287-YAESL--------------------------------------------------------------------------
Q988C8_RHILO/184-282-LREAV--------------------------------------------------------------------------
ECHA_HUMAN/544-639-MSEVI--------------------------------------------------------------------------
O88051_STRCO/206-302-LLSAI--------------------------------------------------------------------------
Q97VU5_SULSO/190-286-NIASC--------------------------------------------------------------------------
O30218_ARCFU/190-288-SNEAS--------------------------------------------------------------------------
Q99WZ1_STAAM/189-287-MNDIM--------------------------------------------------------------------------
O57660_CHICK/551-646-LAEVG--------------------------------------------------------------------------
Q98BD2_RHILO/509-606-MSEAY--------------------------------------------------------------------------
Q9UX37_SULSF/193-287-FREAV--------------------------------------------------------------------------
Q9RUA4_DEIRA/490-582-GDEAR--------------------------------------------------------------------------
O29237_ARCFU/186-280-GVLLH--------------------------------------------------------------------------
O44608_CAEEL/202-299-LMDSI--------------------------------------------------------------------------
Q9HY36_PSEAE/189-286-GTEAL--------------------------------------------------------------------------
Q98EK7_RHILO/475-561-GSESE--------------------------------------------------------------------------
Q9HJM0_THEAC/219-314-INSAS--------------------------------------------------------------------------
Q9KGA8_BACHD/186-281-GNEAL--------------------------------------------------------------------------
Q98LG2_RHILO/186-278-LEEAF--------------------------------------------------------------------------
Q9X7N8_STRCO/504-604-INEGV--------------------------------------------------------------------------
Q9LDF5_ARATH/187-283-INEAF--------------------------------------------------------------------------
Q9ZBJ9_STRCO/196-292-LNQAA--------------------------------------------------------------------------
Q97UX0_SULSO/186-280-ITTAC--------------------------------------------------------------------------
FADB_PSEFR/497-592-FGGFA--------------------------------------------------------------------------
AIM1_ARATH/492-585-SQAAH--------------------------------------------------------------------------
HBD_BACSU/186-282-INEAI--------------------------------------------------------------------------
FADB2_MYCTU/190-286-LLSAI--------------------------------------------------------------------------
Q97AH0_THEVO/189-285-LLSAI--------------------------------------------------------------------------
O29062_ARCFU/188-281-WREAV--------------------------------------------------------------------------
Q9XA30_STRCO/413-504-IDLAF--------------------------------------------------------------------------
O29090_ARCFU/181-277-GVAVG--------------------------------------------------------------------------
Q9I394_PSEAE/414-509-VNLAC--------------------------------------------------------------------------
O29815_ARCFU/186-282-GKEAL--------------------------------------------------------------------------
HCDH1_CAEEL/199-296-FFEAA--------------------------------------------------------------------------
Q9VXI1_DROME/191-282-LNETW--------------------------------------------------------------------------
Q9ABZ4_CAUCR/482-579-VQEGL--------------------------------------------------------------------------
O29077_ARCFU/192-288-LVEAV--------------------------------------------------------------------------
PAAH_ECOLI/188-285-YSEAW--------------------------------------------------------------------------
Q53926_STRCH/176-278-LRESI--------------------------------------------------------------------------
FADJ_ECOLI/492-586-INEAI--------------------------------------------------------------------------
Q9V397_DROME/556-651-LSEAI--------------------------------------------------------------------------
FAD3_RICPR/193-295-LELVV--------------------------------------------------------------------------
Q97UK9_SULSO/186-281-MQEAC--------------------------------------------------------------------------
Q9HRI4_HALSA/190-285-INEGV--------------------------------------------------------------------------
Q9ADL9_SORCE/196-292-INEAI--------------------------------------------------------------------------
Q978T2_THEVO/186-280-SLYFC--------------------------------------------------------------------------
Q979P5_THEVO/219-314-INEAS--------------------------------------------------------------------------
Q9K4C6_STRCO/186-282-VVEAA--------------------------------------------------------------------------
Q9KBD3_BACHD/187-283-FIEAI--------------------------------------------------------------------------
Q9XA30_STRCO/190-287-YAEAL--------------------------------------------------------------------------
Q9A3L4_CAUCR/483-581-QREAQ--------------------------------------------------------------------------

PF00984

Q56812_XANCA/203-296-MNEIA--------------------------------------------------------------------------
P72132_PSEAI/211-307-VNEMK--------------------------------------------------------------------------
VIPA_SALTI/201-295-VNELA--------------------------------------------------------------------------
YTCA_BACSU/196-291-INEMA--------------------------------------------------------------------------
ALGD_AZOVI/203-300-ANEIG--------------------------------------------------------------------------
Q54365_STRLN/196-291-GNELG--------------------------------------------------------------------------
O31279_GLUXY/206-301-INEIS--------------------------------------------------------------------------
UGDH_DROME/209-306-INSLS--------------------------------------------------------------------------
UDG_STRPY/197-290-FNELD--------------------------------------------------------------------------
UGDH_SOYBN/209-306-VNAMS--------------------------------------------------------------------------
P72834_SYNY3/219-314-INEVA--------------------------------------------------------------------------
YWQF_BACSU/197-292-INEIS--------------------------------------------------------------------------
EPSD_RALSL/211-303-ANELS--------------------------------------------------------------------------
WECC_METJA/202-293-ANEFA--------------------------------------------------------------------------
CAPL_STAAU/196-290-MNELA--------------------------------------------------------------------------
WECC_ECOLI/205-297-ANELS--------------------------------------------------------------------------
O29659_ARCFU/243-338-ANEIG--------------------------------------------------------------------------
O07248_MYCTU/203-300-INAIS--------------------------------------------------------------------------
O26924_METTH/203-298-ANELA--------------------------------------------------------------------------
UDG_RICPR/197-292-INEMA--------------------------------------------------------------------------
ALGD_PSESH/203-300-ANEIG--------------------------------------------------------------------------
ALGD_PSEAE/203-300-ANEIG--------------------------------------------------------------------------
TUAD_BACSU/198-293-INDIA--------------------------------------------------------------------------
UGDH_CAEEL/220-317-INSIS--------------------------------------------------------------------------
P72381_STAAU/197-289-ANELT--------------------------------------------------------------------------
Y1054_METJA/198-295-INELA--------------------------------------------------------------------------

PF01450

ILVC_METTH/183-328.LINTA..........................................................................
ILVC_HAEIN/210-486.LIQYGWETITEALKQGGITLMMDRLSNSAKLRAFELAEQIKESLGFLYYKHMDDIISGHFSATMMADWANGDKDLFAWR
ILVC_METJA/184-329.LIKAA..........................................................................
ILVC_SYNY3/184-329.LIKAG..........................................................................
ILVC_RHIME/184-329.LIRAG..........................................................................
ILVC_MYCAV/181-326.LVKAG..........................................................................
O94135_9FUNG/200-347.CFKAQ..........................................................................
ILVC_BUCAP/209-485.LIQYGWETITESLKHGGITLMMDRLSNPSKIKAFKISKKIKKILSPLFKKHMDDIISGSFSKEMMIDWHNNDKKLLNWR
ILV5_SCHPO/255-402.LFLAQ..........................................................................
ILVC_ARCFU/185-330.MIKMS..........................................................................
ILVC_HELPY/186-330.IVRMG..........................................................................
ILVC_STRAW/184-329.LVKAG..........................................................................
ILVC_RHOMO/184-329.LIQYG..........................................................................
ILVC_LEUMC/184-329.LIEAG..........................................................................
ILV5_SPIOL/308-593NTVECITGVISKTISTKGMLALYNSLSEEGKKDFQAAYSASYYPSMDILYECYEDVASGSEIRSVVLAGRRFYEKEGLPA
ILVC_BACSU/183-328.LVKAG..........................................................................
ILVC_AQUAE/184-328.LIKAG..........................................................................
ILVC_CORGL/185-330.LVKVG..........................................................................
ILV5_YEAST/248-395.MFLAQ..........................................................................

PF08125

YN073_YEAST/229-475LGYLAGYTYIHEVVNDPTI-------------------------------------------------------------
MTLD_BACSU/147-345VGYQRGLKTVKEAIDHPEI-------------------------------------------------------------
MTLK_RHOSH/208-451PSALMDIQLVHAAMAHPLI-------------------------------------------------------------
UXAB_ECOLI/203-459VAFQAGLDTVGEAMNDAEI-------------------------------------------------------------
O08355_PSEFL/220-465LGFLKGYRFVHETMNDPLF-------------------------------------------------------------
YEIQ_ECOLI/216-462LGYLSGFAHISDCMQDRAF-------------------------------------------------------------
MTLD_ECOLI/148-374LGKLAGHQTIRDAILDEKI-------------------------------------------------------------
DALD_KLEPN/195-439AGTLIGQQYIHESTLTDVI-------------------------------------------------------------
YDFI_ECOLI/213-460LGYLAGYQHINDCMEDEHY-------------------------------------------------------------
UXUB_ECOLI/216-463LGYLGGYETIADTVTNPAY-------------------------------------------------------------
MTLD_GEOSE/149-374LGYYKKLQTIQEAMCDQEI-------------------------------------------------------------
O68111_RHOCA/209-452PGGLADIAFVHEAMADPQI-------------------------------------------------------------
MTLD_MYCPN/135-355LGFQQKLKYVHETLQVKSN-------------------------------------------------------------
MTLD_ENTFA/148-371TGALLGYQTIDEAMQDALV-------------------------------------------------------------
MTLD_CLOAB/148-373LGYLKGYKYIHEAIKDKEI-------------------------------------------------------------
MTLD_STRMU/151-374TGAYFGAKTVLEALKDQQV-------------------------------------------------------------

PF00393

A9CIZ2_AGRT5/180-470ADKKAFIADLESALLAAKV-------------------------------------------------------------
6PGD_SHEEP/180-470GDKKSFLEDIRKALYASKI-------------------------------------------------------------
6PGD_SYNE7/179-471GDRQAFIDSVRDALYCSKI-------------------------------------------------------------
O32911_MYCLE/189-478TDRETFIEDVRQALYASKI-------------------------------------------------------------
Q6WAT4_TRYCR/180-474SPNAPEIRQLYHAVSIAII-------------------------------------------------------------
O66227_ECOLX/179-467GDKAEFIEKVRRALYLGKI-------------------------------------------------------------
O22111_SOYBN/184-478VDKQKLIDDVRKALYAAKI-------------------------------------------------------------
Q836Q9_ENTFA/179-470GDKKELIEKIREALYFSKL-------------------------------------------------------------
Q83G38_TROWT/177-468LKEAEFIDAVRNALYLAKI-------------------------------------------------------------
6PGD_BUCBP/178-467LNRDDFIEKIRQALYLGKI-------------------------------------------------------------
Q8YLM3_NOSS1/179-469GDTKEFINKVRDALYCSKI-------------------------------------------------------------
Q8SAQ6_CHLRE/182-474VDKAQLINDVRAALYASKI-------------------------------------------------------------
6PGD_TREPA/179-475QQREELVSALEDALYCAKI-------------------------------------------------------------
Q8G729_BIFLO/181-475EDKAAFVEDVRKALFASKV-------------------------------------------------------------
Q6LS71_PHOPR/196-486GDKKEWVDALRQALLASKI-------------------------------------------------------------
Q8A8E5_BACTN/188-478YNKAELVKEIFSALYASKL-------------------------------------------------------------
Q6HPK6_BACHK/178-469VEKAELIEAVRQALYMSKI-------------------------------------------------------------
6PGD_BACSU/177-467LDKDTWIEYVRQALYMGKV-------------------------------------------------------------
Q8SRX1_ENCCU/178-458GRREMSLDAARRGFYLARM-------------------------------------------------------------
Q8SAQ8_PHYIN/182-472VDKQQLIDDVRQALYASKI-------------------------------------------------------------
Q7VC99_PROMA/179-471GSPSNGMSPIMDAVVLSTI-------------------------------------------------------------
Q6A799_PROAC/184-473EDRQTFLTDVRDALWSAKV-------------------------------------------------------------
Q8CXN9_OCEIH/178-468ESKEELIEAIRQALYMSKI-------------------------------------------------------------
O51509_BORBU/175-464FELSDWILDLYYALLVSKI-------------------------------------------------------------
6PGD_CERCA/180-468EDLPKFLNHIKHALYCSKI-------------------------------------------------------------
Q7SFZ4_NEUCR/212-510GDKEQFLEDLEQALYASKI-------------------------------------------------------------
6PGD_CUNEL/182-472GDKKTFIAQLGQALYAAKI-------------------------------------------------------------
6PGD_CANAX/204-504TDKKQFIDDLEQALYASKI-------------------------------------------------------------
Q8SAQ5_PORYE/41-338EEKAALVAAVRSALYASKI-------------------------------------------------------------
6PGD_DICDI/183-480GDKEQVIEAVRQALFASKL-------------------------------------------------------------
Q6UA37_9ENTR/194-483LNHEDFIENIRRSLYLGKI-------------------------------------------------------------
Q7Y248_ORYSJ/168-466VDKKMLVDRVRQALYASKI-------------------------------------------------------------
Q71ZU4_LISMF/178-468GDKKAFVESVRRALYFSKI-------------------------------------------------------------
6PGD_SYNY3/189-481GDVEAWIPKVRDALYCSKM-------------------------------------------------------------
6PGD_CAEEL/179-471QDKRVFIKQISKALYASKI-------------------------------------------------------------
Q7VRX5_BLOFL/180-472ENIDIFVEKARKALYLSKI-------------------------------------------------------------
Q6TUM2_LEIME/182-476SPNSPEAKQLFHAVSLSII-------------------------------------------------------------
Q6MEF8_PARUW/181-471GNREEFIQAIREALYSSKI-------------------------------------------------------------
Q826E4_STRAW/181-471SEAAAFADRVEQALYASKI-------------------------------------------------------------
Q6NHC5_CORDI/183-476IDKDQFVEDVRRALYASKL-------------------------------------------------------------
Q98GH7_RHILO/180-470GDKDALLKDLELALFAGKI-------------------------------------------------------------
Q8TA04_TRIVA/158-442FDIKVTIDDLEKALYAVKI-------------------------------------------------------------
Q893F9_CLOTE/178-468IEKEEFAELVRRSLYLSKI-------------------------------------------------------------
6PGD_BUCAI/178-467KDKNSFIEEVRRALYLGKI-------------------------------------------------------------
Q7V1T5_PROMP/179-471GEISNGMKPLFDAVVLATI-------------------------------------------------------------
6PGD_CHLTR/180-472QEASAFIEDVREALYAAKI-------------------------------------------------------------
Q7NLK6_GLOVI/192-482GEKKQFIDAVRDALYCAKI-------------------------------------------------------------
6PGD_SCHPO/183-479GDKKQLIDDLEDALYASKI-------------------------------------------------------------
Q8EFR5_SHEON/206-499NQKANLIDALESALYCAKV-------------------------------------------------------------
Q823H8_CHLCV/180-472RDPHLFIEDVFQALYASKI-------------------------------------------------------------
Q6ADQ1_LEIXX/183-473EDLAAFADDVSKALYASKI-------------------------------------------------------------
6PGD_CHLPN/178-470HDPSVFIQDVFHALYASKI-------------------------------------------------------------
Q8SAQ4_PORYE/75-372GNAADFIEAVRQALYASKI-------------------------------------------------------------
6PGD_STAAS/178-466GDKKDFLEKIRKALYMSKI-------------------------------------------------------------
Q7M451_ASCSS/181-470GDRKQFLEDLKQALYASKI-------------------------------------------------------------
Q9SME1_9PHAE/183-473VPKAQLIEDMKAALYCSKI-------------------------------------------------------------
Q74H97_LACJO/176-459KAPKDLVDQLAKALYLAMA-------------------------------------------------------------
Q8FXG6_BRUSU/180-469ANQTRFLSDLEQGLLAGKI-------------------------------------------------------------

PF07479

O51341_BORBU/184-347-----------------------------------------------FLFSISLN-------------NIKDIAMELGGR
GPDA_DROEZ/194-343-----------------------------------------------AVIRLGLM-------------EMIRFVDVFYPG
GPDA_RABIT/192-342-----------------------------------------------AVIRLGLM-------------EMIAFAKLFCSG
GPDA_MYCLE/190-341-----------------------------------------------TIITRGLA-------------EIIRLGMALGAQ
GPD2_YEAST/282-432-----------------------------------------------AIQRLGLG-------------EIIKFGRMFFPE
GPDA_SYNY3/159-303-----------------------------------------------ALITRALP-------------EITRVGLHFGAQ
GPDA_ARCFU/180-331-----------------------------------------------VIATRAIN-------------EMAELIEILGGD
GPDA_TRYBB/191-335-----------------------------------------------ALISRGLL-------------EIRDLTLALGGT
GPDA_TAKRU/193-344-----------------------------------------------AVIRLGLM-------------EMIAFARIFCTA
GPDA_CHLPN/180-324-----------------------------------------------GLVTRGLH-------------EMRKLAAIMDCK
GPDA_TREPA/194-353-----------------------------------------------MLLAAGLN-------------EIQTIGKQLGST
GPDA_STRCO/182-326-----------------------------------------------SLITRGLA-------------ETTRLGVALGAD
GPDA_METTH/174-309-----------------------------------------------SLLTLCFR-------------EMNLILNEMGYG
GPDA_CHLTR/180-324-----------------------------------------------GLVTRGLH-------------EIRKFATIMGCR
GPDA_SHIFL/183-327-----------------------------------------------ALITRGLA-------------EMSRLGAALGAD
GPDA2_MYCTU/183-327-----------------------------------------------LVIARALR-------------EMTKLGVAMGGK
GPDA_LEIME/198-342-----------------------------------------------ALIMRGLL-------------EIRDLTAALGGD
GPDA_BACSU/180-324-----------------------------------------------ALITRGLA-------------EIARLGTKMGGN
O22216_ARATH/273-432-----------------------------------------------VYFAHCTS-------------EMIFITHLLAEE
GPDA_CUPLA/213-364-----------------------------------------------AIMRIGLR-------------EMKAFSKLLFPS
GPDH2_CAEEL/236-385-----------------------------------------------AVIRLGLM-------------ETTKFVEHYYPG
GPD2_SCHPO/224-373-----------------------------------------------AVMRIGLL-------------EMQKFGRMFFDC
GPD1_SCHPO/220-369-----------------------------------------------AIMRRGLL-------------EMQKFATTFFDS
O61368_APIME/194-343-----------------------------------------------AVMRLGLM-------------EIIKFVNIFFPG
O96558_LOCMI/194-343-----------------------------------------------AVIRLGLM-------------EMIKFVDIFFPG
GPDA_HAEIN/183-327-----------------------------------------------ALITRGIA-------------EITRLGISLGAN
GPDA_HELPY/165-305-----------------------------------------------SLLSRGLV-------------EMQRFGAFFGGK

PF00725

HCDH_HUMAN/216-313-----------------------------------------------RLYERGDA-------------SKEDIDTAMKLG
HBD_THETC/184-280-----------------------------------------------GILADGVA-------------TAEDIDEAMKLG
CRYL1_RABIT/192-283-----------------------------------------------RLVEEGIV-------------SPSDLDLVMSDG
ECHP_HUMAN/478-582-----------------------------------------------FLLEEG.S-------------KPEEVDQVLEE.
ECHP_CAVPO/481-585-----------------------------------------------FLLEDG.S-------------KPEDIDQALEE.
Q9YBW6_AERPE/198-292-----------------------------------------------LLVERGGY-------------TVVQVDATAKYL
Q9HQ61_HALSA/191-286-----------------------------------------------WLVHDDEA-------------TIAEVDSTTKYD
FADB_ECOLI/496-592-----------------------------------------------QLLRDG.A-------------DFRKIDKVMEKQ
O17612_CAEEL/535-630-----------------------------------------------RLLQEG.V-------------EPSELDKLTTK.
O29956_ARCFU/188-278-----------------------------------------------DDVEKGVA-------------TKEEIDATMMYK
MFPA_CUCSA/495-588-----------------------------------------------LLAEHG.V-------------DPYQIDRAISK.
HBD_CLODI/183-279-----------------------------------------------GIYADGVA-------------SKEEIDEAMKLG
Q9ZBJ9_STRCO/502-598-----------------------------------------------KMVQEHYA-------------TLDDIDAAMKLG
Q9Y1C5_APIME/7-98-----------------------------------------------RLVADGIL-------------NAKDVDAVMSEG
Q9I300_PSEAE/499-599-----------------------------------------------AMLGEG.V-------------SAAMIDNQARQ.
Q9HU01_PSEAE/190-281-----------------------------------------------LMLLEG.A-------------LPYQVDRALQA.
LCDH_PSEAE/188-280-----------------------------------------------HLVNDGVA-------------TTGEIDDAIRFG
HBD_CLOAB/184-280-----------------------------------------------GILAEGIA-------------SVEDIDKAMKLG
Q9KIE3_STRHY/181-277-----------------------------------------------RIVQEGTA-------------SVEDVDALMTGC
Q9HY36_PSEAE/415-510-----------------------------------------------DIAQQGIA-------------SVEHIDLAVRLG
Q9F9V1_AZOEV/190-287-----------------------------------------------RVLAEHEA-------------EPATLDAILREG
FADJ_VIBCH/497-590-----------------------------------------------QVLMAG.E-------------PIEKLDAALLD.
O53872_MYCTU/508-607-----------------------------------------------AMLGEG.V-------------EPASIEQAGSQ.
O28011_ARCFU/200-294-----------------------------------------------AILEKGIA-------------TPEEVDATVRR.
Q9RZ10_DEIRA/239-335-----------------------------------------------ELVVKGIA-------------DPQTVDKTWMIA
HCDH2_CAEEL/211-308-----------------------------------------------RLYERGDA-------------SMEDIDVAMKLG
O29143_ARCFU/183-276-----------------------------------------------RLLEEG.F-------------KPEQIDAAVKYR
O84980_PSEPU/190-287-----------------------------------------------RLLQEGAA-------------DCASLDALLRDA
Q988C8_RHILO/184-282-----------------------------------------------DLVERGVI-------------DPEDLDTCVSWG
ECHA_HUMAN/544-639-----------------------------------------------RILQEG.V-------------DPKKLDSLTTS.
O88051_STRCO/206-302-----------------------------------------------RMFESGIA-------------SREDIDNGMEMG
Q97VU5_SULSO/190-286-----------------------------------------------ILVEKKVA-------------DYREVDAVARYK
O30218_ARCFU/190-288-----------------------------------------------WAVEMGEG-------------TIEEIDSAVKYR
Q99WZ1_STAAM/189-287-----------------------------------------------YRAEQHKL-------------SIVDVDALTGQA
O57660_CHICK/551-646-----------------------------------------------RVLQEG.I-------------DPKKVDAISTA.
Q98BD2_RHILO/509-606-----------------------------------------------KMLIEG.V-------------PAPMIENAAKA.
Q9UX37_SULSF/193-287-----------------------------------------------NLVDEGVA-------------TVEDIDKVMTAA
Q9RUA4_DEIRA/490-582-----------------------------------------------KIVEEG.A-------------RPEDVDAAMNA.
O29237_ARCFU/186-280-----------------------------------------------AVVEAENL-------------TPEEVDAAFRK.
O44608_CAEEL/202-299-----------------------------------------------RMLERGDA-------------TKEDIDTAMRFG
Q9HY36_PSEAE/189-286-----------------------------------------------RILGEGVA-------------PVAAIDEVLREG
Q98EK7_RHILO/475-561-----------------------------------------------ALLLEG.A-------------TPSQIDKAFTD.
Q9HJM0_THEAC/219-314-----------------------------------------------DLLDSGVA-------------SAEDIDTAMKKG
Q9KGA8_BACHD/186-281-----------------------------------------------HMLQEGVA-------------SAEDIDKAVRLG
Q98LG2_RHILO/186-278-----------------------------------------------RLVADGYA-------------SVEDVDIGIRDG
Q9X7N8_STRCO/504-604-----------------------------------------------AMVGEG.I-------------EPASVEQAAAQ.
Q9LDF5_ARATH/187-283-----------------------------------------------HTLYTGVA-------------TKEDIDSGMKHG
Q9ZBJ9_STRCO/196-292-----------------------------------------------AMYEANYA-------------SREDIDAAMRLG
Q97UX0_SULSO/186-280-----------------------------------------------MLVEKGIC-------------EYTAIDAVARYK
FADB_PSEFR/497-592-----------------------------------------------KLVSAG.V-------------DFVRIDKVMEK.
AIM1_ARATH/492-585-----------------------------------------------MLANLG.V-------------DLFRIDSVITS.
HBD_BACSU/186-282-----------------------------------------------YCVYEGVA-------------KPEAIDEVMKLG
FADB2_MYCTU/190-286-----------------------------------------------RMVEAGFA-------------TVEDVDKAVVAG
Q97AH0_THEVO/189-285-----------------------------------------------RSAEQGVA-------------TRKDIDAMTKMA
O29062_ARCFU/188-281-----------------------------------------------NLVYQGIA-------------TPEEIDVAVKYG
Q9XA30_STRCO/413-504-----------------------------------------------DAVAKGVA-------------APEDVDTAMRLG
O29090_ARCFU/181-277-----------------------------------------------YCLL.Y.S-------------RPEEIDAALRN.
Q9I394_PSEAE/414-509-----------------------------------------------DIAQQGIA-------------SVEDIDQAVHLG
O29815_ARCFU/186-282-----------------------------------------------LMVQEGVA-------------TPQDIDIGMMLG
HCDH1_CAEEL/199-296-----------------------------------------------RMYERGDA-------------SMTDIDEAMKLG
Q9VXI1_DROME/191-282-----------------------------------------------RLVEAGIL-------------NVKDIDSVMSNG
Q9ABZ4_CAUCR/482-579-----------------------------------------------EMLADG.I-------------APAIIDNVGRA.
O29077_ARCFU/192-288-----------------------------------------------RLFEIGIA-------------GIKEIDEMCKLA
PAAH_ECOLI/188-285-----------------------------------------------RALEEQVA-------------APEVIDAALRDG
Q53926_STRCH/176-278-----------------------------------------------HLVLEGVV-------------TVEELDRIVTDS
FADJ_ECOLI/492-586-----------------------------------------------RMLTQG.E-------------RVEHIDAALVK.
Q9V397_DROME/556-651-----------------------------------------------RLLQEG.V-------------DPKDLDQYTKK.
FAD3_RICPR/193-295-----------------------------------------------HKAIAQNL-------------NFVTIDQIFSRC
Q97UK9_SULSO/186-281-----------------------------------------------REVEDGEA-------------TIEEVDSAARNG
Q9HRI4_HALSA/190-285-----------------------------------------------RAFDEGVA-------------SKDDIDTGMKLG
Q9ADL9_SORCE/196-292-----------------------------------------------FLVQDQVA-------------SAADVDRIFKGC
Q978T2_THEVO/186-280-----------------------------------------------LVLDKGIA-------------KPEEVDRFARS.
Q979P5_THEVO/219-314-----------------------------------------------KMLDYGIA-------------TEKDIDIAMKKG
Q9K4C6_STRCO/186-282-----------------------------------------------KLYESGVA-------------TAEDIDLACKLG
Q9KBD3_BACHD/187-283-----------------------------------------------KLLEEGVA-------------SAEDIDKAVTLG
Q9XA30_STRCO/190-287-----------------------------------------------AAYEARAA-------------DPATVDAVLRES
Q9A3L4_CAUCR/483-581-----------------------------------------------KLILEG.A-------------MPWDVDRVLYD.

PF00984

Q56812_XANCA/203-296-----------------------------------------------NIAERVGA-------------DVEHVRNGIGSD
P72132_PSEAI/211-307-----------------------------------------------IVADRMGI-------------DIFEVVDAAATK
VIPA_SALTI/201-295-----------------------------------------------IIFNRLNI-------------DTEAVLRAAGSK
YTCA_BACSU/196-291-----------------------------------------------RICEAYQS-------------DISDISRAIGLD
ALGD_AZOVI/203-300-----------------------------------------------NIAKAAGV-------------DGREVMEVVCMD
Q54365_STRLN/196-291-----------------------------------------------WLAAHLGA-------------DPQVVARLLKAD
O31279_GLUXY/206-301-----------------------------------------------DLCEKVGA-------------NVNDVARSIGLD
UGDH_DROME/209-306-----------------------------------------------AVCEATGA-------------DVSEVARAVGLD
UDG_STRPY/197-290-----------------------------------------------TYAESRKL-------------NSHMIIQGISYD
UGDH_SOYBN/209-306-----------------------------------------------ALCEATGA-------------NVQQVSYSVGTD
P72834_SYNY3/219-314-----------------------------------------------NICDRVGA-------------DVTQVAQGIGLD
YWQF_BACSU/197-292-----------------------------------------------NICEKVGA-------------DIEAVAYGMGQD
EPSD_RALSL/211-303-----------------------------------------------MICDEIGV-------------NVWELISVANRH
WECC_METJA/202-293-----------------------------------------------KIAEEIGI-------------NVWEAIELANKH
CAPL_STAAU/196-290-----------------------------------------------IIFDKLDI-------------DTNEVLKASGTK
WECC_ECOLI/205-297-----------------------------------------------LICADQGI-------------NVWELIRLANRH
O29659_ARCFU/243-338-----------------------------------------------NICKKLRI-------------DVYKVFEGVGLD
O07248_MYCTU/203-300-----------------------------------------------EVCEAAGA-------------DVSQLADALGYD
O26924_METTH/203-298-----------------------------------------------VICEALGI-------------DAINAIEAANHH
UDG_RICPR/197-292-----------------------------------------------DLCEKIGA-------------NIKDLSQGVGLD
ALGD_PSESH/203-300-----------------------------------------------NIAKAVGV-------------DGREVMDVVCQD
ALGD_PSEAE/203-300-----------------------------------------------NIAKAVGV-------------DGREVMDVICQD
TUAD_BACSU/198-293-----------------------------------------------NICERVGA-------------DVSKVADGVGLD
UGDH_CAEEL/220-317-----------------------------------------------AVCEATGA-------------EISEVAHAVGYD
P72381_STAAU/197-289-----------------------------------------------KICNNLNI-------------NVLVVIEMANKH
Y1054_METJA/198-295-----------------------------------------------KLSDKVKA-------------DIKTISYAMGLD

PF01450

ILVC_METTH/183-328.............................................FKTLVRAGYQ.PEIAYFETCHE.LKLIVDLIYERG
ILVC_HAEIN/210-486EATGKTAFENAPK.YDGKISEQEYFDNGVLMI...AMVKAGVELAFDAMVASGIY.EESAYYESLHE.LPLIANTIARKR
ILVC_METJA/184-329.............................................FETLVEAGYA.PEMAYFETCHE.LKLIVDLIYQKG
ILVC_SYNY3/184-329.............................................FDTLVEAGYQ.PELAYFECLHE.VKLIVDLIVEGG
ILVC_RHIME/184-329.............................................FETLVEAGYA.PEMAYFECLHE.VKLIVDLIYEGG
ILVC_MYCAV/181-326.............................................FDVMVESGYP.PEMAYFEVLHE.LKLIVDLMYEGG
O94135_9FUNG/200-347.............................................FEVLIANGHT.PSEAFSETVEEATQSLYPLIGKDG
ILVC_BUCAP/209-485EDTKKTPFEKNILSYSEKISEQEYYDHGTLMV...SILKSGIELAFETMINTGII.NESAYYESLHE.LPLIANTIARKK
ILV5_SCHPO/255-402.............................................YQVLRERGHS.PAEAFNETVEEATQSLYPLIGKYG
ILVC_ARCFU/185-330.............................................FETLVEAGYQ.PEIAYFEVLHE.LKLIVDLIYEGG
ILVC_HELPY/186-330.............................................FETLIKAGYP.EELAYFECVHE.VKLVADLLHYKG
ILVC_STRAW/184-329.............................................FETLTEAGYQ.PEIAYFECLHE.LKLIVDLMYEGG
ILVC_RHOMO/184-329.............................................FETLVEAGYA.PEMAYFECLHE.VKLIVDLIYEGG
ILVC_LEUMC/184-329.............................................FNTLVEAGYS.PELAYFETSHE.MKMIVDLIFEGG
ILV5_SPIOL/308-593FPMGKIDQTRMWKVGEKVRSVRPAGDLGPLYPFTAGVYVALMMAQIEILRKKGHSYSEIINESVIEA.VDSLNPFMHARG
ILVC_BACSU/183-328.............................................FETLTEAGYQ.PELAYFECLHE.LKLIVDLMYEEG
ILVC_AQUAE/184-328.............................................FETLVNAGYQ.PEVAYFECLHE.LKLIVDLIYEHG
ILVC_CORGL/185-330.............................................FEVLTEAGYE.PEMAYFEVLHE.LKLIVDLMFEGG
ILV5_YEAST/248-395.............................................YDVLRENGHS.PSEAFNETVEEATQSLYPLIGKYG

PF08125

YN073_YEAST/229-475-----------------------------------------------NKYIRVLMREEVIPLLPKV...PGVDFEEYTAS
MTLD_BACSU/147-345-----------------------------------------------RRVVHSALLETGDYLVKSYG.FKQTEHEQYIKK
MTLK_RHOSH/208-451-----------------------------------------------AAFLHKVEVEEILPHVPPV...PDTSIPDYLTL
UXAB_ECOLI/203-459-----------------------------------------------CAFVEKAIYEEIIPVLDL....PRDELESFASA
O08355_PSEFL/220-465-----------------------------------------------VAYMRAYMDLDVTPNLAPV...PGIDLTDYKQT
YEIQ_ECOLI/216-462-----------------------------------------------RHAARTLMLDEQAPTLQI....KDVDLTQYADK
MTLD_ECOLI/148-374-----------------------------------------------RAVVKGAMEESGAVLIKRYG.FDADKHAAYIQK
DALD_KLEPN/195-439-----------------------------------------------YAIADRYVTEDVIPCLGD....NGIDLPTYRDV
YDFI_ECOLI/213-460-----------------------------------------------RYAAYGLMLQEQAPTLKV....QGVDLQDYANR
UXUB_ECOLI/216-463-----------------------------------------------RKAAFALMMQEQAPTLSMP...EGTDLNAYATL
MTLD_GEOSE/149-374-----------------------------------------------RSDVEKALHESGAVLVKKYG.WNENEHQSYIQK
O68111_RHOCA/209-452-----------------------------------------------RAFLNRVLTAEVLPIVPPV...PGQDLNDYKAL
MTLD_MYCPN/135-355-----------------------------------------------LTFVEKLAQQIIDALCAEYPEFNKNNLLSYGKN
MTLD_ENTFA/148-371-----------------------------------------------VAQLKSVLQETGKLLVAKWN.FDEQEHAAYIEK
MTLD_CLOAB/148-373-----------------------------------------------NKIIVGFHSEAVQALSEKHK.IDIQILKEYSNK
MTLD_STRMU/151-374-----------------------------------------------KEQVKAVLGEIRQLLMAKWQ.FKENDLKVYHDI

PF00393

A9CIZ2_AGRT5/180-470-----------------------------------------------GAYAQGFAIMSAASKEFNWNLPMPTIARIWRAG
6PGD_SHEEP/180-470-----------------------------------------------ISYAQGFMLLRQAATEFGWTLNYGGIALMWRGG
6PGD_SYNE7/179-471-----------------------------------------------CSYAQGMALLAKASQVYNYGLNLGELARIWKGG
O32911_MYCLE/189-478-----------------------------------------------VAYAQGFNHIQTGSTEFGWNITPGDLATIWRGG
Q6WAT4_TRYCR/180-474-----------------------------------------------ACYAQMFQCLRALDKVYDFGLDLPATIATFRAG
O66227_ECOLX/179-467-----------------------------------------------VSYAQGFSQLRAASDEYNWELNYGEIAKIFRAG
O22111_SOYBN/184-478-----------------------------------------------CSYAQGMNLIRAKSIEKGWDLKLGELARIWKGG
Q836Q9_ENTFA/179-470-----------------------------------------------MSYAQGFAQLRAASEEYGWDLPFGEIAKIWRAG
Q83G38_TROWT/177-468-----------------------------------------------LAYSQGFRIISVAAAKHDWGIDLSACARIWRAG
6PGD_BUCBP/178-467-----------------------------------------------ISYAQGFSQLNSASQKYNWNLKLGEISRIFQSG
Q8YLM3_NOSS1/179-469-----------------------------------------------CSYAQGMALLSTASATFNWNLNLSEMARIWKGG
Q8SAQ6_CHLRE/182-474-----------------------------------------------CSYAQGMNIIKAKSVEMKWNVDLGGLARIWKGG
6PGD_TREPA/179-475-----------------------------------------------VSYAQGFELLSHTAKRRGWTLDFSRIASLWRGG
Q8G729_BIFLO/181-475-----------------------------------------------VAYAQGLNEIQDGAKEYGWDINLSEVARIWRGG
Q6LS71_PHOPR/196-486-----------------------------------------------ISYAQGFMLIREASEENNWSLNYGNVALMWRGG
Q8A8E5_BACTN/188-478-----------------------------------------------VSYAQGFAVLQRASDSFGWNLDLASIARMWRGG
Q6HPK6_BACHK/178-469-----------------------------------------------CSYAQGFTQLKAASEEYDWNLDFGSISMLWRGG
6PGD_BACSU/177-467-----------------------------------------------CAYAQGFAQYKMSSELYGWNLPLKDIALIFRGG
Q8SRX1_ENCCU/178-458-----------------------------------------------VSCVQGFNLLMRARKKHGWPYTIEDISQVWSNG
Q8SAQ8_PHYIN/182-472-----------------------------------------------CSYAQGLNLIREAGVQMGWNVDLGECARIWKGG
Q7VC99_PROMA/179-471-----------------------------------------------ASYAQGMEILRLASEEYKYDLHMPSIAQIWKGG
Q6A799_PROAC/184-473-----------------------------------------------VAYAQGLDEIRTAAAEYNWEVDMGQIASIWRDG
Q8CXN9_OCEIH/178-468-----------------------------------------------VSYAQGFAQMRAASDEYDWNLSYGDIAMIWRGG
O51509_BORBU/175-464-----------------------------------------------VAYAQGFMMLKTASVNYGWDLNLGKISLVWREG
6PGD_CERCA/180-468-----------------------------------------------VSYAQGFMLMREAAKENNWNLNYGGIALMWRGG
Q7SFZ4_NEUCR/212-510-----------------------------------------------ISYAQGFMLMQEAAKEYNWKLNKPSIALMWRGG
6PGD_CUNEL/182-472-----------------------------------------------VSYAQGYMLMRQAAKDYEWKLNNAGIALMWRGG
6PGD_CANAX/204-504-----------------------------------------------ISYTQGFMLMNQAAKDYGWKLNNAGIALMWRGG
Q8SAQ5_PORYE/41-338-----------------------------------------------CSYAQGMNLIRAAGKEYGWGLDLGSISRIWKGG
6PGD_DICDI/183-480-----------------------------------------------VSYAQGFTMMKAAAKEYKWNLNYGNIALLWRGG
Q6UA37_9ENTR/194-483-----------------------------------------------ISYAQGFSQLKKASQVYHWNLNYSKIAKIFRAG
Q7Y248_ORYSJ/168-466-----------------------------------------------CSYAQGMNLLRAKSVEKGWNLNLAELARIWKGG
Q71ZU4_LISMF/178-468-----------------------------------------------ASYAQGFAQMRAASEENDWDLQYGEIAKIFRAG
6PGD_SYNY3/189-481-----------------------------------------------CSYAQGMALIAKASQEFGYDVNLPEIARIWKGG
6PGD_CAEEL/179-471-----------------------------------------------VSYAQGFMLLAEASKQFNWNLNFGAIALMWRGG
Q7VRX5_BLOFL/180-472-----------------------------------------------ILYAQGFYQLKISSMTYHWNLNYQKIAKIFRAG
Q6TUM2_LEIME/182-476-----------------------------------------------ASYAQMFQCLRELDKVYGFGLNLPATIATFRAG
Q6MEF8_PARUW/181-471-----------------------------------------------ISYTQGFMLMQQAAAEYKWQLNYGAIALMWRGG
Q826E4_STRAW/181-471-----------------------------------------------VSYTQGFHEIAAGSDEYDWNIDLGKIASIWRGG
Q6NHC5_CORDI/183-476-----------------------------------------------VAYAQGFDEIIAGSAEHNWDVDPRDLATIWRGG
Q98GH7_RHILO/180-470-----------------------------------------------AAYAQGFAVMSGASKEFNWNLPMPTIARIWRAG
Q8TA04_TRIVA/158-442-----------------------------------------------ICYAQGLSMIQKASAKMDYGVDISKCAKVWRGG
Q893F9_CLOTE/178-468-----------------------------------------------ACYAQGFQLLKVASKTYNWDLQYGNIARIFRGG
6PGD_BUCAI/178-467-----------------------------------------------ISYAQGFSQLKRASEKYHWNLKYGEIAKIFRAG
Q7V1T5_PROMP/179-471-----------------------------------------------ASYAQGMDILSEASSVYNYELNMPSIAQIWKGG
6PGD_CHLTR/180-472-----------------------------------------------ISYAQGFMLLKQVSQDKGWDLNLGELALIWRGG
Q7NLK6_GLOVI/192-482-----------------------------------------------CSYAQGMALLKAASHEYDYHLNLSELARIWKGG
6PGD_SCHPO/183-479-----------------------------------------------ISYAQGFMLMREAAKEYGWKLNNAGIALMWRGG
Q8EFR5_SHEON/206-499-----------------------------------------------CCYAQGFQLMAMTALEQKWQLDFAEIAKIWRAG
Q823H8_CHLCV/180-472-----------------------------------------------ISYAQGFMLLKQASEEHQWNLNFGELALLWRGG
Q6ADQ1_LEIXX/183-473-----------------------------------------------VAYAQGFDAIVAGAEKYGWKLDKDKIAKIWRGG
6PGD_CHLPN/178-470-----------------------------------------------ISYAQGFMLLGEASKEYNWGLDLGEIALMWRGG
Q8SAQ4_PORYE/75-372-----------------------------------------------VSYAQGYMLFREAAKEYNWNLNYGGIALMWRGG
6PGD_STAAS/178-466-----------------------------------------------CSYAQGFAQMRKASEDNEWNLKLGDLAMIWREG
Q7M451_ASCSS/181-470-----------------------------------------------ISYAQGFMLMREAAKQFNWNLNYGGIALMWRGG
Q9SME1_9PHAE/183-473-----------------------------------------------CSYAQGMNLIKAASEHFEWGVDLGECARIWKGG
Q74H97_LACJO/176-459-----------------------------------------------VSYGQGFEQLTMAAKAYNWRLHYSTIAQNWEAG
Q8FXG6_BRUSU/180-469-----------------------------------------------AAYAQGFAVMEAASREHGWNIPLATTARIWRAG

PF07479

O51341_BORBU/184-347NIE...TFLFLSGSGDLDVTCRSMFGRNRRFGNEIVSKNILESFLSIDDLISN.IEKIGYLPEGVLAAKSIFFFFKQLNR
GPDA_DROEZ/194-343SKL..STFFESCGVADLITTCYG..GRNRRVSEAFVTSG..KTIEELEKEM.....LNGQKLQGPPTAEEVNYMLKNKGL
GPDA_RABIT/192-342PVSP.ATFLESCGVADLITTCYG..GRNRKVAEAFARTG..KSIEQLEKEM.....LNGQKLQGPETARELHSILQHKGL
GPDA_MYCLE/190-341VT....TLAGLAGVGDLVATCTSPHSRNRSLGERLGRG...EIMQSILHGMDGSDGGDGYVVEGVTSCASVLALASSYDV
GPD2_YEAST/282-432SKVE.TYYQESAGVADLITTCSG..GRNVKVATYMAKTG..KSALEAEKEL.....LNGQSAQGIITCREVHEWLQTCEL
GPDA_SYNY3/159-303PD....TFWGLAGLGDLLATCSSMLSRNYRVGYGLSKG...QSLEEILANL.......GGTAEGVNTTDVLIKIANREKI
GPDA_ARCFU/180-331RE....TAFGLSGFGDLIATFRG..GRNGMLGELLGKG...LSIDEAMEELE...RRGVGVVEGYKTAEKAYRLSSKINA
GPDA_TRYBB/191-335GE....AVFGLPGLGDLLLTCSSELSRNFTVGMKLGQG...ISLEEIKRTS.......KAVAEGVATAEPLERLAKKHNA
GPDA_TAKRU/193-344GPVSSATFLESCGVADLITTCYG..GRNRKVAKAFVKTG..KSIEELEKEM.....LEGQKLQGPATAAEVYRILKHKNL
GPDA_CHLPN/180-324PE....TLNGLAGLGDLCVTCFSESSRNLRFGHLLAQG...LTFEQAKAKI.......GMVVEGAYTALSAYQVAKHHKI
GPDA_TREPA/194-353HPE...TFTSLAGIGDLDVTCRSAYGRNRRFGRDIVHKGILDSFSGIQDLVSR.LPEVGYLAEGVVACMHVQRLAERDRL
GPDA_STRCO/182-326PL....TFSGLAGLGDLVATCSSPLSRNHTFGTNLGKG...MTLEETNAVT.......KQTAEGVKSCESVLDLARRHGV
GPDA_METTH/174-309E.....LHDRFCGFGDFLLTSTTDKSRNRTLGLMLGKK...MRLSEDSTIT..........IESLRSIRAIRELTEGLEL
GPDA_CHLTR/180-324PD....TLNGLAGLGDLCTTSFSAFSRNTLFGKLLAEG...LTPEQAKTKI.......GMVVEGVYTALSAHQIATHHRI
GPDA_SHIFL/183-327PA....TFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQG...MDVQSAQEKI.......GQVVEGYRNTKEVRELAHRFGV
GPDA2_MYCTU/183-327SE....TFPGLAGLGDLIVTCTSQRSRNRHVGEQLGAG...KPIDEIIASM.......SQVAEGVKAAGVVMEFANEFGL
GPDA_LEIME/198-342GS....AVFGLAGLGDLQLTCSSELSRNFTVGKKLGKG...LPIEEIQRTS.......KAVAEGVATADPLMRLAKQLKV
GPDA_BACSU/180-324PL....TFSGLTGVGDLIVTCTSVHSRNWRAGNLLGKG...YKLEDVLEEM.......GMVVEGVRTTKAAYQLSKKYDV
O22216_ARATH/273-432PEKLAGPL.....LADTYVTLLK..GRNAWYGQMLAKGEINRDMGDSISGK........GMIQGVSAVGAFYQLLSQSSL
GPDA_CUPLA/213-364VKD..TTFFESCGVADLITTCLG..GRNRKVAEAFAKNGGKRSFDDLEAEM.....LRGQKLQGVSTAKEVYEVLGHRGW
GPDH2_CAEEL/236-385SNL..QTFFESCGIADLITTCYG..GRNRKVCEAFVKTG..KSMAEVEKEL.....LNGQSAQGPLTAEEVYLMMHKTGL
GPD2_SCHPO/224-373KPL..TMSEESCGIADLITTCLG..GRNHKCAVAFVKTG..KPMHVVEQEL.....LDGQKLQGAATAKEVYEFLDNQNK
GPD1_SCHPO/220-369DPR..TMVEQSCGIADLVTSCLG..GRNNRCAEAFVKTG..KSLETLEKEL.....LGGQLLQGAATSKDVHEFLLTKDM
O61368_APIME/194-343GKK..TTFFESCGVADLIATCYG..GRNRKICEAFVKTG..KKISELEKEM.....LNGQKLQGPFTAEEVNYMLKAKNM
O96558_LOCMI/194-343SRL..STFFESCGVADLITTCFG..GRNRRVGEAFIKTG..KSIEVLEKEL.....LNGQKLQGPITAAEVNFMLKNRGM
GPDA_HAEIN/183-327TN....TFMGMSGLGDLVLTCTDNQSRNRRFGLMLGKG...LDAQMAMENI.......GQVVEGFYNTKEAYLLAQRQGV
GPDA_HELPY/165-305TE....TFLGLSGAGDLFLTANSILSRNYRVGLGLAQN...KPLEVVLEEL.......GEVAEGVKTTNAIVEIARKYGI

PF00725

HCDH_HUMAN/216-313AGY---P.MGPFELLDY------------------------VGLDTTKFIVD.......GWHEMDAEN..PLHQ------
HBD_THETC/184-280ANH---P.IGPLALSDL------------------------IGNDVVLAIMN.......VLYEEYGDS...KYR------
CRYL1_RABIT/192-283LGM---R.YAFIGPLET------------------------MHLNAEGMLS.........YCDRYSEG...MKR------
ECHP_HUMAN/478-582FGF---K.MGPFRVSDL------------------------AGLDVGWKSRKGQGLTGPTLLPGTPARKRGNRR------
ECHP_CAVPO/481-585FGF---R.MGPFRVSDL------------------------AGLDVGWKIRKGQGLTGPSLQGTAPARKRGNAR------
Q9YBW6_AERPE/198-292LGL---P.MGVFELADY------------------------SGIDVFYYVFE.......AMSRR.GFR...SAK------
Q9HQ61_HALSA/191-286MGL---P.MGAFELADQ------------------------VGIDVSHDVLD........YMQDVLGT...AYE------
FADB_ECOLI/496-592FGW---P.MGPAYLLDV------------------------VGIDTAHHAQA.......VMAAGFPQRMQKDYR------
O17612_CAEEL/535-630FGF---P.VGAATLADE------------------------AGLDVAEHVAR.......YLGTALGPRVHGGSV------
O29956_ARCFU/188-278YGF---P.MGPIELSDF------------------------VGLDILYHAS..........QQWDIVP...QSK------
MFPA_CUCSA/495-588FGM---P.MGPFRLCDL------------------------VGFGVAAATAS.......QFVQAFPER...TYK------
HBD_CLODI/183-279ANH---P.MGPLALGDL------------------------IGLDVVLAIMN.......VLYTEFGDT...KYT------
Q9ZBJ9_STRCO/502-598GGY---P.MGPFELLDV------------------------VGLDVSLAIEK.......VLHREFRDP...GLA------
Q9Y1C5_APIME/7-98LGM---R.YAFLGAFEA------------------------AHLNAEGMKK.........YCETYKNS...IYD------
Q9I300_PSEAE/499-599AGM---P.VGPLAISDE------------------------VSLSLMTHIRNQTARDLEAEGKALPTH..PAFA------
Q9HU01_PSEAE/190-281FGF---A.MGPFRMYDV------------------------VGIDLEWRARE........LAGVGQDQ..PAVQ------
LCDH_PSEAE/188-280AGL---R.WSFMGTFLT------------------------YTLAGGNAGMR.......HFMAQ.FGP...ALQ------
HBD_CLOAB/184-280ANH---P.MGPLELGDF------------------------IGLDICLAIMD.......VLYSETGDS...KYR------
Q9KIE3_STRHY/181-277LGH---P.TGPLRTADL------------------------IGIDNLVDALW.......VLHKRTGDE...RSR------
Q9HY36_PSEAE/415-510LGY---P.LGPLEWGDR------------------------LGAGRVLRILE.......RLHALSGDP...RYR------
Q9F9V1_AZOEV/190-287CGF---A.MGPFELMDL------------------------IGHDVNFAVTK......SVFEAYFCDR...RFA------
FADJ_VIBCH/497-590FGF---P.VGPITLLDE------------------------VGVDIGAKIM.......PILVKELGPR....FQ------
O53872_MYCTU/508-607AGY---P.APPLQLSDE------------------------LNLELMHKIAVAT...RKGVEDAGGTYQPHPAE------
O28011_ARCFU/200-294LGL---P.MGPFELVDY------------------------TGVDILYNALK........YYAQTISP...DYE------
Q9RZ10_DEIRA/239-335TGA---P.RGPFAFLDV------------------------IGLTTPYNINM.......ASAETNPGS...AAA------
HCDH2_CAEEL/211-308AGY---P.MGPFELSDY------------------------VGLDTCKFIMD.......GWHAQYPEE..VAFT------
O29143_ARCFU/183-276AGL---P.MGLFEVVDF------------------------SGVDTVYNVLN......EVRKRGFEVE...VPG------
O84980_PSEPU/190-287GGF---R.MGAFELTDL------------------------IGHDVNYAVTC......SVFDAFYGDF...RFQ------
Q988C8_RHILO/184-282IGY---K.IAVIGPMAL------------------------LDMAGLDIYKSV....SSFLNADLSNR..DDVA------
ECHA_HUMAN/544-639FGF---P.VGAATLVDE------------------------VGVDVAKHVAE.......DLGKVFGERFGGGNP------
O88051_STRCO/206-302CAH---P.MGPLKLADL------------------------IGLDTVASVA.......YSMYEEYKEP...LYA------
Q97VU5_SULSO/190-286LGF---P.MGVFELIDY------------------------TGVDVAYYVSK........SREELGIR..DDIP------
O30218_ARCFU/190-288LGL---P.MGLFELHDV------------------------LGGGSVDVSYHV....LEYYRQTLGES....YR------
Q99WZ1_STAAM/189-287IGR---PKTGTYALSDL------------------------VGLDIAVSVIK.......GMQQVPEET..PYFH------
O57660_CHICK/551-646FGF---P.VGAATLIDE------------------------VGVDVATHVAE.......DLGKAFGERFGGGSI------
Q98BD2_RHILO/509-606AGM---P.VGPLALTDE------------------------TAIDLAQKIMKQTI.RDLGDKAVDPEQ...MAL------
Q9UX37_SULSF/193-287IGL---R.WAFMGPFLT------------------------YHLGGGEGGIE......YFFSKGFGYG...ANE------
Q9RUA4_DEIRA/490-582LGL---P.MGPFQMSDM------------------------AGLDIGYSIRQ.......HQAKVRGEP...EPD------
O29237_ARCFU/186-280AGY---P.MGPFELADY------------------------VGIDVNYNAAR........YFARAVSP...EYE------
O44608_CAEEL/202-299TSY---P.MGPIELCDY------------------------VGLDVLQSTLK.......IFRETIPGD..ARFA------
Q9HY36_PSEAE/189-286AGF---R.MGPFELFDL------------------------VGLDVSLPVME......SIYRQYYEEP...RYR------
Q98EK7_RHILO/475-561FGW---P.MGPFQMGDL------------------------AGLDIGWRNR..........KAR.GLT....AV------
Q9HJM0_THEAC/219-314AGF---P.MGPLELADM------------------------IGIDVVVDVME.......VLERAYGER...YKT------
Q9KGA8_BACHD/186-281LNF---P.MGPLELADL------------------------VGLDARLNNLR.......YLHETLGEK....YR------
Q98LG2_RHILO/186-278LAL---R.WSFMGPFET------------------------IDLNAPGGVRD........YVDRYQGI...YSN------
Q9X7N8_STRCO/504-604AGY---P.AKVLSLMDE------------------------LTLTLPRKIREET..KRAVEEAGGTWA..AHPA------
Q9LDF5_ARATH/187-283TNH---P.MGPLELADL------------------------IGLDVCLSVMK.......VLHEGLGDS...KYA------
Q9ZBJ9_STRCO/196-292CGL---P.MGPLALLDL------------------------VGVDTARTVLE.......AMYAASRDR...LHA------
Q97UX0_SULSO/186-280LGF---P.MGIFELVDY------------------------TGVDVNYYVSS.......AMMER.GFK...AYP------
FADB_PSEFR/497-592FGW---P.MGPAYLMDV------------------------VGIDTGHHGRD.......VMAEGFPDRMKDDRR------
AIM1_ARATH/492-585FGL---P.LGPFQLGDL------------------------AGHGIGLAVG.......PIYAKVYGDR...MFR------
HBD_BACSU/186-282MNH---P.MGPLALADF------------------------IGLDTCLSIME.......VLHSGLGDS...KYR------
FADB2_MYCTU/190-286LSH---P.MGPLRLSDL------------------------VGLDTLKLIAD.......KMFEEFKEP...HYG------
Q97AH0_THEVO/189-285FGF---P.MGPFELMDI------------------------IGIDTVYHIAT.......YLYEETGDP...QFI------
O29062_ARCFU/188-281PGI---R.WAITGVYLT------------------------YHLGGGQGGMK........YFLEFFDD...HYR------
Q9XA30_STRCO/413-504VNY---P.LGPFEWSRR------------------------LGDTWAYYLL..........ADVHEWE..PSGR------
O29090_ARCFU/181-277LGM---R.YGFFETIDL------------------------IGLDVAKDVLE.......SFREYYGDKYRGIRA------
Q9I394_PSEAE/414-509LGY---P.HGPLEWGDR------------------------LGPRRLLSILQ.......RLQALTGDP...RYR------
O29815_ARCFU/186-282YGY---S.MGPIETGDL------------------------VGLDTRLRIYE.......AMFEATKDP...KWA------
HCDH1_CAEEL/199-296AGH---P.MGPFELADY------------------------IGLDTVKFVMD.......GWAAKYPEV..QLFE------
Q9VXI1_DROME/191-282LGP---R.YAFLGPLET------------------------AHLNAEGMAN.........YFERYSNT...IYA------
Q9ABZ4_CAUCR/482-579TGM---P.RGPLEMNDD------------------------VALDLGYKVTQQT...KKDLGDKFEDR...PFA------
O29077_ARCFU/192-288FGF---P.MGPFELMDL------------------------IGLDTALHIAE.......YLYNETKEP...HYA------
PAAH_ECOLI/188-285AGF---P.MGPLELTDL------------------------IGQDVNFAVTC......SVFNAFWQER...RFL------
Q53926_STRCH/176-278IGL---R.WSTIGPFHA------------------------FHLGGGPGGLRKW...LEHLGSGLEQGWRGLGQ------
FADJ_ECOLI/492-586FGF---P.VGPIQLLDE------------------------VGIDTGTKII.......PVLEAAYGER...FSA------
Q9V397_DROME/556-651FGF---P.VGAATLADE------------------------VGIDVGSHIAV.......DLAKAFGERFSGGNL------
FAD3_RICPR/193-295LGL---PNTGIFGLYDL------------------------IGHDVMKLIS.S....SLISALPKSDDYHRIYT------
Q97UK9_SULSO/186-281LKL---P.MGIFELSDY------------------------VGIDVAVDLWN.......VIVSSGTAQ...DVK------
Q9HRI4_HALSA/190-285TNV---P.MGPLELADH------------------------IGLDVCLDASE.......TLHEELGDR....YK------
Q9ADL9_SORCE/196-292FEH---K.MGPLETADL------------------------IGLDTILYSIE.......VLYESFNDD...KYR------
Q978T2_THEVO/186-280QGL---P.MGPYELMDY------------------------VGIDTVYHSLE.......YYAKELSPD...YAK------
Q979P5_THEVO/219-314AGF---P.MGPFELADM------------------------IGIDVVKDVMN.......VFEKTYGDQ...YKT------
Q9K4C6_STRCO/186-282FGH---A.MGPLATADL------------------------TGVDILLHAT.......GNIYTESQDE...KFA------
Q9KBD3_BACHD/187-283LNY---P.MGPFTLQDY------------------------AGVDIGLHVME.......YFQQEFNDP...RFT------
Q9XA30_STRCO/190-287GGF---R.MGAFELTDL------------------------IGQDVNESVTH......SVWQSFFQDV...RFT------
Q9A3L4_CAUCR/483-581FGL---P.MGPFAMSDL------------------------AGLDIGWDPAKTS...SSTVREVLCEM...DRR------

PF00984

Q56812_XANCA/203-296------PRIG....WHF------------------------IYPVPATARASRRCAGARKTAHEYGMQ------------
P72132_PSEAI/211-307------PFGF...TPYY------------------------PGPGLGGHCIPIDPFYLTWKAREYGLH------------
VIPA_SALTI/201-295------WNFL....PFR------------------------PG.LVGGHCIGVDPYYLTHKSQGIGYY------------
YTCA_BACSU/196-291------PRIG..KHFLQ------------------------AGIGYGGSCFPKDLQALQFAAQEKNTE------------
ALGD_AZOVI/203-300------NKLNLSQYYMR------------------------PGLAFGGSCLPKDVSALSYRAHLWDIE------------
Q54365_STRLN/196-291------PRVAD.AAPLL------------------------PGAAFSGATLRRDLVALSRIGAKWGRP------------
O31279_GLUXY/206-301------GRIG..KKFLH------------------------PSPGFGGSCFPKDTRALTAIGRNAGSP------------
UGDH_DROME/209-306------SRIG..SKFLQ------------------------ASVGFGGSCFQKDILNLIYICENLNLP------------
UDG_STRPY/197-290------DRIG..MHYNN------------------------PSFGYGGYCLPKDTK..QLLANYNNIP------------
UGDH_SOYBN/209-306------SRIG..PKFLN------------------------ASVGFGGSCFQKDILNLVYICECNGLP------------
P72834_SYNY3/219-314------SRIG..SKFLN------------------------AGIGWGGSCFPKDVSALIHTAKDYGYT------------
YWQF_BACSU/197-292------KRIG..SQFLK------------------------AGIGYGGSCFPKDTNALVQIAGNVEHD------------
EPSD_RALSL/211-303------PRVN....ILQ------------------------PGPGVGGHCIAVDPWFIVDAAP...ES------------
WECC_METJA/202-293------PRVN....ILK------------------------PGPGVGGHCISIDPWFIVEKS....KN------------
CAPL_STAAU/196-290------WNFL....NFK------------------------PG.LVGGHCIGVDPYYLTHKAQEVGHH------------
WECC_ECOLI/205-297------PRVN....ILQ------------------------PGPGVGGHCIAVDPWFIVAQNP...QQ------------
O29659_ARCFU/243-338------HRIN..PSFFR------------------------AGIGFGGSCFPKDVRALIRKSEELGEN------------
O07248_MYCTU/203-300------PRIG..RQCLN------------------------AGLGFGGGCLPKDIRAFMARAGELGAD------------
O26924_METTH/203-298------PRVN....IHT------------------------PGPGVGGHCLSIDPYFIVEMAERKGVP------------
UDG_RICPR/197-292------QRIG..RNFLN------------------------AGPGFGGSCFPKDILALNNLVENHKID------------
ALGD_PSESH/203-300------KALNLSQYYMR------------------------PGFAFGGSCLPKDVRALTYRASSLDVE------------
ALGD_PSEAE/203-300------HKLNLSRYYMR------------------------PGFAFGGSCLPKDVRALTYRASQLDVE------------
TUAD_BACSU/198-293------SRIG..RKFLK------------------------AGIGFGGSCFPKDTTALLQIAKSAGYP------------
UGDH_CAEEL/220-317------TRIG..SKFLQ------------------------ASVGFGGSCFQKDVLSLVYLCESLNLP------------
P72381_STAAU/197-289------PRVN....IHQ------------------------PGPGVGGHCLAVDPYFIIAKDP...EN------------
Y1054_METJA/198-295------PRIG..NKFLN------------------------AGIGYGGSCFHPDEVLFIDRGRGLECI------------

PF01450

ILVC_METTH/183-328FRGMWHNVSNTAEFGGL------------TRRGRIITEETEKEMDEILKEIQNGKFAKEWALENRAGAPM..LK------
ILVC_HAEIN/210-486LYEMNVVISDTAEYGNY------------LFSN....VATPILAKEIIPNLQKGDLGEP.TPAVEVDNIT..LR------
ILVC_METJA/184-329LQGMWENVSNTAEYGGL------------TRRARVINEESRKAMKEILKEIQDGRFAKEWSLEREAGFPH..LN------
ILVC_SYNY3/184-329LAKMRDSISNTAEYGDL------------TRGPRIVTEETKAEMRQILDEIQSGQFAREFVLENQAGKPG..FT------
ILVC_RHIME/184-329IANMNYSISNTAEWGEY------------VTGPRIITEDTKAEMKRVLKDIQTGKFTSEWMQEYRSGAAR..FK------
ILVC_MYCAV/181-326IARMNYSVSDTAEFGGY------------LSGPRVIDAGTKDRMREILRDIQNGDFVKKLVANVEGGNKQ..LE------
O94135_9FUNG/200-347MDWMYDNCSTTARRGAL------------DWMDKF.YAATKPVFEELYESVRNGTEAENTLVANSKPDYRENLA------
ILVC_BUCAP/209-485LYEMNIVISDTAEYGSY------------LFSE....AAYPIL.KDFIMSLEKNVLGLS.LPNTKIDNIE..LY------
ILV5_SCHPO/255-402LDYMFAACSTTARRGAI------------DWTPRFL.EANKKVLNELYDNVENGNEAKRSLEYNSAPNYRELYD------
ILVC_ARCFU/185-330IYNMWSAVSETAKYGGM------------TRGKRIFTEQTREEMRKILKEIQTGEFAREWILENMAGRPV..YN------
ILVC_HELPY/186-330VEGLRKHISNTAEFGAI------------.KAREPMGKLLKKRMQKILKKIQNGSFAKDFLLEKSLNYPR..LN------
ILVC_STRAW/184-329LEKMRWSISETAEWGDY------------VTGPRIITDATKAEMKKVLAEIQDGTFAQAWMDEYHGGLKK..YN------
ILVC_RHOMO/184-329IANMRYSISNTAEYGDY------------VTGSRIITEATKAEMKRVLADIQSGRFVRDWMLECKAGQPS..FK------
ILVC_LEUMC/184-329FEKMRHDCSNTCEYGEM------------LNGPRIITEESKQGMRDVLKDIQDGTYAKKWLAEYNSGLKD..LE------
ILV5_SPIOL/308-593VSFMVDNCSTTARLGSR------------KWAPRFD....YILSQQALVAVDNGAPINQDLISNFLSDPVHEAI------
ILVC_BACSU/183-328LAGMRYSISDTAQWGDF------------VSGPRVVDAKVKESMKEVLKDIQNGTFAKEWIVENQVNRPR..FN------
ILVC_AQUAE/184-328ISGMRYSISDTAKYGDV------------TRGERIY.KVVKPVMEKTLEEIQKGEFAREWILENKAGRPV..YY------
ILVC_CORGL/185-330ISNMNYSVSDTAEFGGY------------LSGPRVIDADTKSRMKDILTDIQDGTFTKRLIANVENGNTE..LE------
ILV5_YEAST/248-395MDYMYDACSTTARRGAL------------DWYPIF.KNALKPVFQDLYESTKNGTETKRSLEFNSQPDYREKLE------

PF08125

YN073_YEAST/229-475VLE---RFSNPAIQDTVARICLMGSGKMPKYVLPSIYEQLRKPDGKYK-----LLAVCVAGWFRYLTGVDMNGKPFEIED
MTLD_BACSU/147-345IIG---RFENPFISDDVTRVARS.....PLRKLGENDRLVG...PAKK-----IKE.....PNALAEGIAAALRFDFTGD
MTLK_RHOSH/208-451IES---RFSNPEIADTTRRLCLDGSNRQPKFIVPSLRDNLAA.GTVPK-----GLVLLSALWCRYCFGTTDSGVVVEPND
UXAB_ECOLI/203-459VTG---RFRNPYIKHQLLSIALNGMTKFRTRILPQLLAGQKANGTLPA-----RLTFALAALIAFYRGERNGETYPVQDD
O08355_PSEFL/220-465LVD---RFSNQAIADQLERVCSDGSSKFPKFTVPTINRLIAD.GRETE-----RAALVVAAWALYLKGVDENGVSYTIPD
YEIQ_ECOLI/216-462LIA---RFANPALKHKTWQIAMDGSQKLPQRMLAGIRIHQGR.ETDWS-----LLALGVAGWMRYVSGVDDAGNAIDVRD
MTLD_ECOLI/148-374ILG---RFENPYLKDDVERVGRQ.....PLRKLSAGDRLIK...PLLG-----TLEYG.LPHKNLIEGIAAAMHFRSEDD
DALD_KLEPN/195-439VLK---RFTNPYIQDTNQRVAADGFSKIPAMIAPTLQECYQR.GVRPE-----ATAMLPALFFVFMEQWHKGTLPYQYQD
YDFI_ECOLI/213-460LIA---RYSNPALRHRTWQIAMDGSQKLPQRMLDSVRWHLAH.DSKFD-----LLALGVAGWMRYVGGVDEQGNPIEISD
UXUB_ECOLI/216-463LIE---RFSNPSLRHRTWQIAMDGSQKLPQRLLDPVRLHLQN.GGSWR-----HLALGVAGWMRYTQGVDEQGNAIDVVD
MTLD_GEOSE/149-374IIQ---RFINPSISDEVVRVARS.....PIRKLGANDRLIG...PATQ-----YYDLFGQVPHGLVKGIAALLLFDYEND
O68111_RHOCA/209-452IIE---RFSNPEVADTVRRLCLDGSNRQPKFIIPSIRDRIAT.GGSFD-----GLVLLSALWCRYCFGTTESGAEIAPND
MTLD_MYCPN/135-355NLV---RFANPKIQDLNTRLIRE.....PLRKLNQNERFYA....IYK-----LFKKNKIALNNILQVYLMVLKTNITDD
MTLD_ENTFA/148-371IIQ---RFQNKYISDAITRVART.....PIRKLGAQERFIR...PIRE-----LQERN.LVSPHLLAMIGIVFNYHDPED
MTLD_CLOAB/148-373LLK---RFENEYLKDDVSRVGRD.....PMRKLSSNDRLIT...PLKL-----CCDLK.IDFTNILFGVASGYLFNYKED
MTLD_STRMU/151-374IIS---RFENPYIVDDVTRVART.....PIRKLGYDERFIR...PIRE-----LKDRG.LSYEYLLQTVAYVFHYKDSND

PF00393

A9CIZ2_AGRT5/180-470CII---R--SEF.LDEITSAFTKDPHVANLIVTPAFSAIVKDTDAPLRRVVS.YAVLSGLPVSALASALGYFDAYRRGRG
6PGD_SHEEP/180-470CII---R--SVF.LGKIKDAFDRNPGLQNLLLDDFFKSAVENCQDSWRRAIS.TGVQAGIPMPCFTTALSFYDGYRHAML
6PGD_SYNE7/179-471CII---R--AGF.LNKIKQAYDADPTLANLLLAPEFRQTILDRQLAWRRVIA.IAAERGIPVPAFSASLDYFDSYRRDRL
O32911_MYCLE/189-478CII---R--AKF.LNRIKEAFDAAPDLASLIVAPYFRSAVESAIDSWRRVVS.TATQLGIPNPGFSSALSYYDALRTERL
Q6WAT4_TRYCR/180-474CIL---K--GYL.LQPMTEAFAKNVNLSNLMCA..FEKEITEGLQSYRDILGFITSKTALTLPVLSASLVYVNGMFTPTL
O66227_ECOLX/179-467CII---R--AQF.LQKITDAYAQKAGIANLLLAPYFKQIADDYQQALRDVVA.YAYQNGIPVPTFSAAIAYYDSYRSAVL
O22111_SOYBN/184-478CII---R--AIF.LDRIKQAYERNPNLANLLVDPEFAKEIIDYQSAWRRVVC.LAINSGISTPGMSASLAYFDTYRRERL
Q836Q9_ENTFA/179-470CII---R--AQF.LQKITDAYEKNPALENLLLDEYFVEITKKYQQAVREVVA.IAVQAGVPVPTFSSAIAYYDSYRSDRL
Q83G38_TROWT/177-468CII---R--AVF.LDKVAHEYSKNPDLTSLMCSPGFSDELVGRLRFLREVVA.SAARLAIPAPVFSSLLSYIDALASDRL
6PGD_BUCBP/178-467CII---R--AKL.LKNITQEYSSNNNFVNLLLTPYFREIANTYHSSLREIVS.ISVKYGIPIPALSSAISYFDSYRSAFL
Q8YLM3_NOSS1/179-469CII---R--AGF.LNKIKKAFNENPALPNLLLAPEFKQTILDRQAAWREVII.TAAKLGIPVPAFSASLDYFDSYRRDRL
Q8SAQ6_CHLRE/182-474CII---R--AQF.LDRIRVAYERNPELPSLLVDPDFAKELTAAEASWRRVAA.LSITHGVPIPSMTSSLGYFDTYRRERL
6PGD_TREPA/179-475CII---R--SGF.LSKISAAFAQQHDLENLVLAPFFAEELKRACPGWRTIVA.ESVRQALPVPALSAALAWFDGFTGAAL
Q8G729_BIFLO/181-475CII---R--AQFLLDRITEAFRGDNPPASLLFDPYFEKIIGESQDAWRRVIV.RAVEAGIPTPVFSSSLAYYDGLRSKRL
Q6LS71_PHOPR/196-486CII---R--SAF.LGNIRDAYEATPDIKFLGTDPYFKDILVDSLPAWRKVAA.KAMEVGLPMPTMTSALTFLDGYTTGRL
Q8A8E5_BACTN/188-478CII---R--SIF.LNDIAAAFEAADKPKHLLLAPYFREEIKSLLPGWKNLVA.EAMKEELPVPAFSSALNYFYSLTSDNL
Q6HPK6_BACHK/178-469CII---R--AAF.LQNIKEAYETNTDLPNLLLDPYFKEIVESYQGGLRQIIS.MAVQQGIPIPAFSAAISYYDSYRTAKL
6PGD_BACSU/177-467CII---R--ADF.LNVISEAFSEQPNLANLLIAPYFTDKLHAYQTGLRKVVC.EGISTGISFPCLTTALSYYDGYRTGRS
Q8SRX1_ENCCU/178-458CIL---R--GKL.LDVVRSMGKERQD..DFELTSEFVSLCNEYYQDLKEMVL.YSTECEVPTPTISSCLMYLNGMKKEEG
Q8SAQ8_PHYIN/182-472CII---R--AKF.LDRIKSAYTKDASLISLLVDPDFAAELQARQYSWRRVVS.LAVASGIPAPSFSGSLNYYDTFRRERL
Q7VC99_PROMA/179-471CII---R--STL.LQRIQDAFNNEPQLTNLLMDPWFAEQIKNRLPGLTKTVA.VAAQTGVPVPCFSSTLDYINSYRTARL
Q6A799_PROAC/184-473CII---R--ARL.LQRIRDEYAAG.DLVSLLEAPSVKAELARCQQAWRRVVA.CAVEAGVPVPGFSSALGYYDQVRAPRL
Q8CXN9_OCEIH/178-468CII---R--AKF.LQKIKDAYDRDSQLPNLMLDPYFKEIVEGYQSSLRKVVS.LAVAHGIAVPTFSSAIAYYDSYRSEDL
O51509_BORBU/175-464CII---R--SSF.LDKIKLAYDKNPHLINLLFDDYFLDLLKNNHKSLRRIIS.KASEIGIPLPAFYASLSFLDSYSTNYL
6PGD_CERCA/180-468CII---R--SVF.LGNIKDAYTRNPQLSNLLLDDFFKKAIEVGQNSWRQVVA.NAFLWGIPVPALSTALSFYDGYRTEKL
Q7SFZ4_NEUCR/212-510CII---R--SVF.LKDITAAYRKNPDLENLLFDDFFNKAIHKAQPGWRDVVA.KAALLGLPTPAFSTALSWFDGYRTKDL
6PGD_CUNEL/182-472CII---R--SVF.LGKIRDAYTKNPELENLLFDDFFKDATAKAQDAWRNVTA.QAVLMGIPTPALSTALNFYDGLRHEIL
6PGD_CANAX/204-504CII---R--SVF.LAEITAAYRKKPDLENLLLYPFFNDAITKAQSGWRASVG.KAIQYGIPTPAFSTALAFYDGLRSERL
Q8SAQ5_PORYE/41-338CII---R--AVF.LDRIKAAYDVDAELASLLVDPGFASELASAQSAWRSVVT.TAINAGVSVPAMSGSLAYYDTYRRTVL
6PGD_DICDI/183-480CII---R--STF.LGEIKGAFDKNPQLDNLLTDCWFRDKLAAAQDGWRQVAS.ISVLHGIPTPAFTSALSYYDSYRCAKL
Q6UA37_9ENTR/194-483SII---R--ADF.LKEIIHAYQKSNGLENLLLAPYFIKISKEYQNSLRKIVS.YSVMHGIPIPAFSAAISYYDSYRSPIL
Q7Y248_ORYSJ/168-466CII---R--AKF.LDRIKKAYDRNPELANLIVDREFAREMVQRQNAWRWVVA.RAVEAGISTPGMSASLSYFDTYRCSRL
Q71ZU4_LISMF/178-468CII---R--ARF.LQKITDAYNKDKNLKNLLLDPYFKDIAHNYQGDLRTVVA.EAVKAGIPVPTFTAAISYYDSYRSEVL
6PGD_SYNY3/189-481CII---R--AGF.LDKIKKAFKDNPQLPNLLLAPEFKQSILDRQGPWREVLM.LANEMGIAVPAFSSSLDYFDSYRRAVL
6PGD_CAEEL/179-471CII---R--SRF.LGDIEHAFQKNKQLSNLLLDDFFTKAITEAQDSWRVVVC.AAVRLGIPVPAFSSALAFYDGYTSEVV
Q7VRX5_BLOFL/180-472CII---R--SNF.LQEIINIYSKTPKIENLLLDSYCVNIINNYQQDLRDIVT.IGIDHGIPMPALSAAISYYDGFRSLML
Q6TUM2_LEIME/182-476CIL---Q--GYL.LGPMTKAFEENPNLPNLMDA..FTKEIAAGLNDCRQILARLTVNTAVSLAGMMASLSYINAMYTEIL
Q6MEF8_PARUW/181-471CII---R--SQF.LGKIKEAFKLNPNLKSLLLDEYFLQEIQKRQKGWRKVVS.KSVELGIATPCFNTALVFYDGYRTAKL
Q826E4_STRAW/181-471CII---R--AAF.LDRIREAYDARADLPSLLSDDTFAQEIAAAQDDWREVLI.AATRQGVPTPGFAAALAYYDALRAERL
Q6NHC5_CORDI/183-476CII---R--AKF.LNRIVEAYDANPELPSLLLDPYFKTELESLIDSWRRVVV.AATQLGLPVPVFASSLSYYDSLRAERL
Q98GH7_RHILO/180-470CII---R--SQM.LDTMAEAFSSGGASTNLLMAPAFISLMQEAHPSLRRIVA.KASEAGAPVPALSSALAYFDSYRQGRG
Q8TA04_TRIVA/158-442CII---R--ANF.LNDVSAYYTN..ETKNLLTIDFFRTAVEERVQSWRKVCA.LSTIQGYPIPLYSSCLAYFDSYGSDVL
Q893F9_CLOTE/178-468CII---Q--ARF.LKDIISAYEENNNACNLMITKVFSKVINEYDKSLRKTIS.IAINQGIPVTAMSSALGYMDTYRSYNL
6PGD_BUCAI/178-467CII---R--ANF.LQKITDEYTQNKNVVNLLLTPYFSKIANEYENSLRNIVM.YAIKYGISTPTFSAAISYYDSYRALYL
Q7V1T5_PROMP/179-471CII---R--SKL.LKKIQDAYQKDPNLKNLIFDDWFNNEISTRIDNLASVVS.SSTKAGIPVPCLSSTLDYLNSYRTNRL
6PGD_CHLTR/180-472CII---Q--SAF.LDKIHQGFENSPEAHSLILQDYFKKVLFDSETGFRRAVL.HAIGSGVAIPCLSSALSFYDGYRTVDS
Q7NLK6_GLOVI/192-482CII---R--AIF.LDKIKNAFLRDPALTNLLIDSEFSGDIQARQANWRYAVQ.TAAQLGIPAYATGASLAYYDAYRTAQL
6PGD_SCHPO/183-479CII---R--SVF.LKDITEAFREDPNLESILFHPFFTNGVEKAQAGWRRVVA.QAAMLGIPVPATSTGLSFYDGYRSAVL
Q8EFR5_SHEON/206-499CII---R--ATF.LQSITQAYQADANLSCLLMADTFASTLSEKQTEWRIAVA.AAIMQGIPVPCISSALAYYDSYRSETL
Q823H8_CHLCV/180-472CII---Q--SAF.LDAIHKGFENEPEAPSLILQTYFKSTLQNSESGWRRTVA.YAVGSGYPVPCLAAALTFYDGYRTKDS
Q6ADQ1_LEIXX/183-473CII---R--AQF.LGRIADAYEENADIATLLEAPYFADALREGEAAWRRIVA.TAALSGVPVPGFGAALSYYDSLASGRL
6PGD_CHLPN/178-470CII---Q--SAF.LDVIHKGFAANPENTSLIFQEYFRGALRHAEMGWRRTVV.TAIGAGLPIPCLAAAITFYDGYRTASS
Q8SAQ4_PORYE/75-372CII---R--SAF.LGDIRDAFTNDPELENLLLSPYFKKEVAGCSEGWREAVA.VAARQGVPIPAFMTALAFFDGYRSATL
6PGD_STAAS/178-466CII---R--AQF.LQKIKDAYDNNPGLQNLLLDPYFKNIVTEYQDALRDVVA.TGVQNGVPTPGFSSSINYYDSYRAADL
Q7M451_ASCSS/181-470CII---R--SVF.LGKIQEAFDKNPHLTNLLLDDFFKNAIQNAQAGWRKVVA.TAVTNGVPTPCLSTALSFFDGYRMEKV
Q9SME1_9PHAE/183-473CII---R--AAF.LDDIKNAYIKNADLDNLLVDPFITSQILERQAAWRRVVT.LCVASGIAAPAMTASLSYFDSYRRARL
Q74H97_LACJO/176-459CII---R--SQM.LHDIKFAYNADKDLPNLFKAPFFDKVKKENIGALRDVVK.IAADAGVPTPTLSAALNYLESIFNPRL
Q8FXG6_BRUSU/180-469CII---R--SQL.LDDIAQAFE.GNESRNLLMAPAFVPRMETSVKSLRQIVA.QAALASLPLPALGSALSYFDSYTQALG

PF07479

O51341_BORBU/184-347D............LNPNSLLSVIYKILN----------KELEPKSVIEYM-----
GPDA_DROEZ/194-343E.............DKFPLFTAIHKICT----------NQLKPKDLIDCI-----
GPDA_RABIT/192-342V.............DWFPLFMAVYKVCY----------QGQPVGEFIRCL-----
GPDA_MYCLE/190-341...............EMPLTDAVHRVCH----------KGLSVEKAMALL-----
GPD2_YEAST/282-432T.............QEFPLFEAVYQIVY----------NNVRMEDLPEMI-----
GPDA_SYNY3/159-303...............AVPITRQVYRLLH----------GKITPPQAVEAL-----
GPDA_ARCFU/180-331...............DTKLLDSIYRVLY----------EGLKVEEVLFEL-----
GPDA_TRYBB/191-335...............DLPICHEVYNVLY----------ANGCAKRSFKKL-----
GPDA_TAKRU/193-344I.............DKFPLFNAVYQICY----------QGHPVSEFISCL-----
GPDA_CHLPN/180-324...............DMPITTGIYRVLY----------ENLDLKEGIALL-----
GPDA_TREPA/194-353...............KVPICAGLYAILN----------REKGADTFMQEI-----
GPDA_STRCO/182-326...............DMPITETVVAIVH----------EGKSPVVAVKEL-----
GPDA_METTH/174-309.................PVLEMVYQTM.----------..QEPENVNLYI-----
GPDA_CHLTR/180-324...............DMPITTSVYRVLY----------ENLDIQEGIAQL-----
GPDA_SHIFL/183-327...............EMPITEEIYQVLY----------CGKNAREAALTL-----
GPDA2_MYCTU/183-327...............NMPIAREVDAVIN----------HGSTVEQAYRGL-----
GPDA_LEIME/198-342...............KMPLCHQIYEIVY----------KKKNPRDALADL-----
GPDA_BACSU/180-324...............KMPITEALHQVLF----------NGQKVETAVESL-----
O22216_ARATH/273-432SILPSEEKKPVAPVESCPILKTLYKILI----------TREQSTQAILQA-----
GPDA_CUPLA/213-364L.............ELFPLFSTVHEIST----------GRLPPSAIVEYS-----
GPDH2_CAEEL/236-385D.............AKFPLFTAVHKICA----------GEMKPAELVDCL-----
GPD2_SCHPO/224-373V.............SEFPLFTAVYRIVY----------EGLPPNKLLEAI-----
GPD1_SCHPO/220-369V.............KDFPLFTAVYNISY----------EDMDPKDLIIVL-----
O61368_APIME/194-343E.............NRFPLFTTVHRICI----------GETMPMELIENL-----
O96558_LOCMI/194-343E.............ARFPLMTAVHRICT----------GEMKAADLLDHV-----
GPDA_HAEIN/183-327...............EMPITEQIYQMLF----------CGKSAQDVAISL-----
GPDA_HELPY/165-305...............YTPIASELALLL.----------...KGKSVLESM-----

PF00725

HCDH_HUMAN/216-313---------------PSPSLNKLVAENK----------FGKKTGEGFYKY-----
HBD_THETC/184-280---------------PHPLLKKMVRGGL----------LGRKTGKGFFEY-----
CRYL1_RABIT/192-283---------------...VLKSFGSIPE----------FSGATVEKVNQA-----
ECHP_HUMAN/478-582---------------YCPIPDVLCELGR----------FGQKTGKGWYQY-----
ECHP_CAVPO/481-585---------------YSPIADMLCELGR----------FGQKTGQGWYKY-----
Q9YBW6_AERPE/198-292---------------.CSIFEEKFKAGE----------YGVKAGKGIYSY-----
Q9HQ61_HALSA/191-286---------------PCPVLVDHVEAGD----------LGRKSGAGFYDY-----
FADB_ECOLI/496-592---------------..DAIDALFDANR----------FGQKNGLGFWRY-----
O17612_CAEEL/535-630---------------..DLLSELVRAGH----------KGRKTSKGIFVY-----
O29956_ARCFU/188-278---------------...LLEEKFKANE----------LGMKTGKGFYDW-----
MFPA_CUCSA/495-588---------------.SMLIPLMQEDKN----------AGESTRKGFYVY-----
HBD_CLODI/183-279---------------AHPLLAKMVRANQ----------LGRKTKIGFYDY-----
Q9ZBJ9_STRCO/502-598---------------PAPLLEHLVAAGC----------LGRKTGRGFREH-----
Q9Y1C5_APIME/7-98---------------...VSMTFGPVPK----------FEGEMAEKISNE-----
Q9I300_PSEAE/499-599---------------..VIDLMVNEYKR----------PGKAAGAGFYDY-----
Q9HU01_PSEAE/190-281---------------...VDNRLCEMGR----------FGQKSGAGYYRY-----
LCDH_PSEAE/188-280---------------...LPWTYLPAPE----------LTEALIDRVVEG-----
HBD_CLOAB/184-280---------------PHTLLKKYVRAGW----------LGRKSGKGFYDY-----
Q9KIE3_STRHY/181-277---------------PCDLLLGKVREGH----------HGRKTGRGFYEY-----
Q9HY36_PSEAE/415-510---------------PSPWLRRRAQLG.----------LSLRQPDSPLAS-----
Q9F9V1_AZOEV/190-287---------------PSPFQQELVAAGR----------LGRKSGRGIYEY-----
FADJ_VIBCH/497-590---------------GPDVFDVLLKDNR----------KGRKSGKGFYTY-----
O53872_MYCTU/508-607---------------A..VVEKMIELGR----------SGRLKGAGFYEY-----
O28011_ARCFU/200-294---------------PPKFLEEMVKANK----------LGRKTGQGFYDW-----
Q9RZ10_DEIRA/239-335---------------AKYIKENYIDKGK----------LGTATGEGFYKY-----
HCDH2_CAEEL/211-308---------------PSPLLNSLVDSGK----------NGRKSGEGFYKY-----
O29143_ARCFU/183-276---------------...LLERMVLEGR----------LGMKTGKGFYEY-----
O84980_PSEPU/190-287---------------PSLVQKELVDAGR----------LGRKTGQGFYSY-----
Q988C8_RHILO/184-282---------------..PMVLEKTSASK----------FGIKSGEGMFCY-----
ECHA_HUMAN/544-639---------------..ELLTQMVSKGF----------LGRKSGKGFYIY-----
O88051_STRCO/206-302---------------APPLLQRMVDAGR----------LGRKSGSGFYAY-----
Q97VU5_SULSO/190-286---------------ICSLIEQKFKNNE----------LGVKTGKGFYTY-----
O30218_ARCFU/190-288---------------PSPLFERLFKAGH----------YGKKTGKGFYDW-----
Q99WZ1_STAAM/189-287---------------DVKIVNTLFDNGA----------LGRKTKQGFYKK-----
O57660_CHICK/551-646---------------..GLFKLMVQKGF----------LGRKAGKGFYIY-----
Q98BD2_RHILO/509-606---------------...INTMVDDHGR----------FGRKNGKGFYDY-----
Q9UX37_SULSF/193-287---------------...WMHTLAKWDK----------FPYTAVKKVLEQ-----
Q9RUA4_DEIRA/490-582---------------..GWLDRIVKTGR----------KGQKTQGGIYDY-----
O29237_ARCFU/186-280---------------PPERVRKMVEEGR----------LGRKTGRGWYDW-----
O44608_CAEEL/202-299---------------PIPLMDKLVAEGK----------LGRKTKQGFYTY-----
Q9HY36_PSEAE/189-286---------------PHPLLRQMLAAGR----------LGRKSGQGFYRY-----
Q98EK7_RHILO/475-561---------------...IADTLCEQGR----------FGQKTGRGFYLY-----
Q9HJM0_THEAC/219-314---------------.SVILRRMREANR----------LGRKTRIGFYKY-----
Q9KGA8_BACHD/186-281---------------PAPLLEKLVKAGR----------LGRKTKQGIYKY-----
Q98LG2_RHILO/186-278---------------...IFPQMLRRVD----------WAGEVMATVEAE-----
Q9X7N8_STRCO/504-604---------------EALIDRMVDEFGR----------PGRSGGAGFYEY-----
Q9LDF5_ARATH/187-283---------------PCPLLVQYVDAGR----------LGRKRGVGVYDY-----
Q9ZBJ9_STRCO/196-292---------------PAPILRQLSEAGL----------TGRKAGRGFYTY-----
Q97UX0_SULSO/186-280---------------.CKTLEEMTKKGD----------LGVKSGKGFYTY-----
FADB_PSEFR/497-592---------------..SAIDALYEAKR----------LGQKNGKGFYAY-----
AIM1_ARATH/492-585---------------.SPMTELLLKSGR----------NGKINGRGYYIY-----
HBD_BACSU/186-282---------------PCPLLRKYVKAGW----------LGKKSGRGFYDY-----
FADB2_MYCTU/190-286---------------PPPLLLRMVEAGQ----------LGKKSGRGFYTY-----
Q97AH0_THEVO/189-285---------------PPISLKQMVLNGY----------IGDKKVKFGSKG-----
O29062_ARCFU/188-281---------------..RLWSDLANWSE----------YPEGSFDAILKS-----
Q9XA30_STRCO/413-504---------------...CAPSLALHRH----------AEAAEDREGAAS-----
O29090_ARCFU/181-277---------------MDFFMEKMVEWGK----------LGKKSGEGFYKW-----
Q9I394_PSEAE/414-509---------------PSPWLRRRAQLG.----------MSLRAGETAAVD-----
O29815_ARCFU/186-282---------------PPKLLVQLVDAGY----------LGDPSLKPGSKG-----
HCDH1_CAEEL/199-296---------------ASPLVDKLVAEGK----------LGRKTGDGFYSY-----
Q9VXI1_DROME/191-282---------------...VSETMGPTPK----------MEGPVAVEVAKQ-----
Q9ABZ4_CAUCR/482-579---------------.PIIEKMVVELQR----------FGRKNGKGFYDY-----
O29077_ARCFU/192-288---------------APNTLKKLVLSGY----------VGRKPGSRGGWY-----
PAAH_ECOLI/188-285---------------PSLVQQELVIGGR----------LGKKSGLGVYDW-----
Q53926_STRCH/176-278---------------.PALTPQAVEALV----------AQTEAAYGHRPY-----
FADJ_ECOLI/492-586---------------PANVVSSILNDDR----------KGRKNGRGFYLY-----
Q9V397_DROME/556-651---------------..EVMNDLVLAGF----------LGRKSGKGIFLY-----
FAD3_RICPR/193-295---------------NTKVFDKMIEHNL----------IGRKGEGGFYRL-----
Q97UK9_SULSO/186-281---------------.CEMYKRKFEAKE----------LGVKTGKGFYNY-----
Q9HRI4_HALSA/190-285---------------PAYLLQRKVDAGD----------LGKKTGAGFYTY-----
Q9ADL9_SORCE/196-292---------------PCPLLKKMVDAGL----------HGRKSGRGFYTY-----
Q978T2_THEVO/186-280---------------.CQVYNKLYNEKK----------LGLKTGEGFYKW-----
Q979P5_THEVO/219-314---------------.SQLIRRMSEAGK----------LGRKTKEGFYKY-----
Q9K4C6_STRCO/186-282---------------PPELMRRMVDAGD----------IGRKSGQGFYKH-----
Q9KBD3_BACHD/187-283---------------PPLLLKQLVRAGR----------LGKKVGAGFYDY-----
Q9XA30_STRCO/190-287---------------PSLAQRRLVESGR----------LGRKSGQGWYDY-----
Q9A3L4_CAUCR/483-581---------------GQKNGKGFYDYDE----------NRNAKPSPVVEE-----

PF00984

Q56812_XANCA/203-296--------------PT..LLNAVESVNN----------AQ---------------
P72132_PSEAI/211-307--------------TRFIELSGEVNQAM----------PE---------------
VIPA_SALTI/201-295--------------PEIILAGRRLNDNM----------GN---------------
YTCA_BACSU/196-291--------------TF..LLRAVQHIND----------TQ---------------
ALGD_AZOVI/203-300--------------AP..LISSLMRSNA----------AQ---------------
Q54365_STRLN/196-291--------------EF...FDTVLTVND----------RH---------------
O31279_GLUXY/206-301--------------VR..LIETTVAVNE----------QR---------------
UGDH_DROME/209-306--------------EVAAYWQQVIDMNE----------YQ---------------
UDG_STRPY/197-290--------------QT..LIEAIVSSNN----------VR---------------
UGDH_SOYBN/209-306--------------EVAEYWKQVIKIND----------YQ---------------
P72834_SYNY3/219-314--------------TS..ILNAVVEVNQ----------VQ---------------
YWQF_BACSU/197-292--------------FE..LLKSVIKVNN----------NQ---------------
EPSD_RALSL/211-303--------------ARLIRTAREVNDAK----------PH---------------
WECC_METJA/202-293--------------AKLIRTARELNDSM----------PL---------------
CAPL_STAAU/196-290--------------PEVILAGRRINDNM----------AK---------------
WECC_ECOLI/205-297--------------ARLIRTAREVNDHK----------PF---------------
O29659_ARCFU/243-338--------------PK..ILKAVMEVNE----------RQ---------------
O07248_MYCTU/203-300--------------QALTFLREVDSINM----------RR---------------
O26924_METTH/203-298--------------ARLIRTAREVNESM----------PL---------------
UDG_RICPR/197-292--------------CK..ILKSVIKSNK----------LR---------------
ALGD_PSESH/203-300--------------AP..LLNSLMRSNT----------SQ---------------
ALGD_PSEAE/203-300--------------HP..MLGSLMRSNS----------NQ---------------
TUAD_BACSU/198-293--------------FK..LIEAVIETNE----------KQ---------------
UGDH_CAEEL/220-317--------------QVADYWQGVININN----------WQ---------------
P72381_STAAU/197-289--------------AKLIQTGREINNSM----------PA---------------
Y1054_METJA/198-295--------------TFKELFELEDKDNV----------KI---------------

PF01450

ILVC_METTH/183-328---------------RMRKLESELEIEE----------VGSKLRKLCGLEK----
ILVC_HAEIN/210-486---------------DVNDAIRNHPVEL----------IGQELRGYMTDMK----
ILVC_METJA/184-329---------------ALRRLEKEHLIEK----------VGKELRKMCGLEK----
ILVC_SYNY3/184-329---------------AMRRRESEELIEE----------VGKDLRAMFSWLK----
ILVC_RHIME/184-329---------------GIRRVNDSHQIEE----------VGAKLRAMMPWIG----
ILVC_MYCAV/181-326---------------QLRKENVEHPIEV----------VGKRLRDLMSWVD----
O94135_9FUNG/200-347---------------KELKELRESQMWQ----------TAVTVRSLRPENQ----
ILVC_BUCAP/209-485---------------KINEEIRNHPIEI----------VGKKLRKHMKEMK----
ILV5_SCHPO/255-402---------------KELEEIRNLEIWK----------AGEVVRSLRPEHN----
ILVC_ARCFU/185-330---------------KLLQMEREHPIEK----------IGKELRAMMPWLK----
ILVC_HELPY/186-330---------------TERKALKETKIEQ----------IGEILRAPFNHKK----
ILVC_STRAW/184-329---------------EYKTQDENHLLET----------TGKELRKLMSWVN----
ILVC_RHOMO/184-329---------------ATRRIQXEHVIEV----------VGEKLRGMMPWIS----
ILVC_LEUMC/184-329---------------KMRTEYKSGLYEQ----------TGKKVRAMMPWIS----
ILV5_SPIOL/308-593---------------GVCAQLRPSVDIS----------VTADADFVRPELR----
ILVC_BACSU/183-328---------------AINASENEHQIEV----------VGRKLREMMPFVK----
ILVC_AQUAE/184-328---------------ALLERDREHLVEK----------VGEELRKMMPWLG----
ILVC_CORGL/185-330---------------GLRASYNNHPIEE----------TGAKLRDLMSWVK----
ILV5_YEAST/248-395---------------KELDTIRNMEIWK----------VGKEVRKLRPENQ----

PF08125

YN073_YEAST/229-475PMAPTLKA........AAVKGGKDPHEL----------LNIEVLFSPEIRDNKEF
MTLD_BACSU/147-345PEAVELQA....................----------............LIEEK
MTLK_RHOSH/208-451PNWTALQD........RARRAKETPAEW----------LAMTEVYG.DLAQNDLL
UXAB_ECOLI/203-459AHWLERYQQLWSQHRDRVIGTQELVAIV----------LAEKDHWEQDLTQVPGL
O08355_PSEFL/220-465PRAEFCQG........LVSDDALISQRL----------LAVEEIFGTAIPNSPEF
YEIQ_ECOLI/216-462PLSDKIREL......VAGSSSEQRVTAL----------LSLREVFGDDLPDNPHF
MTLD_ECOLI/148-374PQAQELAA..........LIADKGPQAA----------LAQISGLDANSEVVSEA
DALD_KLEPN/195-439GILDAQAV........HEMFEAQDPVAV----------FARDKALFGDLANNADF
YDFI_ECOLI/213-460PLLPVIQKA.....VQSSAEGKARVQSL----------LAIKAIFGDDLPDNSLF
UXUB_ECOLI/216-463PMLAEFQKI......NAQYQGADRVKAL----------LGLSGIFADDLPQNADF
MTLD_GEOSE/149-374EEAVALQK..........TIQETGVEGA----------LYQYSQLEKDHPLVIAI
O68111_RHOCA/209-452PNWERLVA........VAQAAKDRPAAW----------LEMEDIYAEVGRN.PAV
MTLD_MYCPN/135-355TESQQIAK..........LI.NEKAWTE----------LAKLSSLEESEWNLIKQ
MTLD_ENTFA/148-371EQSRQLQE..........MLDQESVDTV----------IAEVTGIE.DPETVKNI
MTLD_CLOAB/148-373EKAQGIQN..........IITKEGIKKA----------ISNVSQIKEGDYLNNMI
MTLD_STRMU/151-374EQSVQLKL..........LLQEKSLKAV----------VKEVTGLT.DAALIEEI

PF00393

A9CIZ2_AGRT5/180-470S.ANLIQA-------QRDFFGAHGFERT..........DGVDK..PHGPWG----
6PGD_SHEEP/180-470P.ANLIQA-------QRDYFGAHTYELL..........AKPGQ.FIHTNWT----
6PGD_SYNE7/179-471P.QNLTQA-------QRDYFGAHTYERT..........DRSGS..FHAQWF----
O32911_MYCLE/189-478P.AALTQA-------QRDFFGAHSYGRV..........DARGK..FHTLWS----
Q6WAT4_TRYCR/180-474RYGQLVSL-------QRDVFGRHGYERL..........DKEGR..ESHQWP----
O66227_ECOLX/179-467P.ANLIQA-------QRDYFGAHTYKRT..........DKEGV..FHTEWL----
O22111_SOYBN/184-478P.ANLVQA-------QRDYFGAHTYERV..........DIEGS..YHTEWF----
Q836Q9_ENTFA/179-470P.ANLIQA-------QRDYFGAHTYERT..........DKEGI..YHYSWY----
Q83G38_TROWT/177-468P.ACLIQA-------QRDDFGAHTYRRV..........DVPGI..FHTLWS----
6PGD_BUCBP/178-467P.SNLIQA-------QRDFFGAHTYKRI..........DKSGI..FHTNWY----
Q8YLM3_NOSS1/179-469P.QNLTQA-------QRDYFGAHTYLRT..........DKAGA..FHTEWV----
Q8SAQ6_CHLRE/182-474P.ANLVQA-------QRDFFGSHTYQRF..........DKEGW..YHTVWD----
6PGD_TREPA/179-475P.ANLLQA-------QRDYFGAHTYERT..........DAPRGEFFHTNWT----
Q8G729_BIFLO/181-475P.TALTQS-------QRDFFGAHTYGRV..........DKPGV..FHTLWA----
Q6LS71_PHOPR/196-486P.ANMIQA-------QRDYFGAHTYERL..........DQPRGQFFHTNWT----
Q8A8E5_BACTN/188-478P.ANLVQA-------QRDYFGAHTFERK..........DELRGQFFHENWT----
Q6HPK6_BACHK/178-469P.ANLLQA-------QRDYFGAHTYKRV..........DKEGT..FHTKWI----
6PGD_BACSU/177-467N.ANLLQA-------QRDYFGAHTYERT..........DMDGV..FHTNWS----
Q8SRX1_ENCCU/178-458G.GNMIQA-------MRDYFGAHMVTMK..........GEDEA..VHVRWN----
Q8SAQ8_PHYIN/182-472P.ANLTQA-------QRDFFGGHTYERT..........DREGL..YHCAWS----
Q7VC99_PROMA/179-471P.QNLVQA-------MRDCFGSHTYERI..........DKEGS..FHTEWI----
Q6A799_PROAC/184-473N.AALTQG-------LRDLFGAHTYRRV..........DDEGS..WHLNWS----
Q8CXN9_OCEIH/178-468P.ANLIQA-------QRDYFGAHTYERK..........DKDGI..FHSQWF----
O51509_BORBU/175-464P.SNLIQA-------QRDFFGAHSFERL..........DSKRGEFFHSAWQ----
6PGD_CERCA/180-468P.ANLLQA-------QRDYFGAHTYELL..........GAEGK.FVHTNWT----
Q7SFZ4_NEUCR/212-510P.ANLLQA-------QRDYFGAHTFLVKPEY....ANEKYPEGKYIHVNWT----
6PGD_CUNEL/182-472P.ANLLQA-------QRDYFGAHTYELL..........HTPGK.WVHTNWT----
6PGD_CANAX/204-504P.ANLLQA-------QRDYFGAHTFKVLPGQENELLKKDE....WIHINWT----
Q8SAQ5_PORYE/41-338PSAQMVQS-------QRDFFGSHTYKRL..........DKDGV..YHTRWS----
6PGD_DICDI/183-480S.ANLVQA-------QRDYFGAHTFQLL..........DDPKGAPVHVNWT----
Q6UA37_9ENTR/194-483P.ANLLQA-------QRDYFGAHTYSRI..........DKKGT..FHTNWI----
Q7Y248_ORYSJ/168-466P.ANLIQA-------QRDLFGAHTYERI..........DRPGS..FHTEWT----
Q71ZU4_LISMF/178-468S.ANLIQA-------QRDYFGAHTYERV..........DKPGV..FHTEWP----
6PGD_SYNY3/189-481P.QNLTQA-------QRDYFGAHTYERT..........DKPRGEFFHTEWL----
6PGD_CAEEL/179-471P.ANLLQA-------QRDYFGAHTYELL..........AKPGT.WVHTNWT----
Q7VRX5_BLOFL/180-472P.ANLIQA-------QRDCFGSHTYKRI..........DKSGV..FHTRWL----
Q6TUM2_LEIME/182-476PYGQLVSL-------QRDVFGRHGYERT..........DRDGR..ESFEWP----
Q6MEF8_PARUW/181-471P.ANLLQA-------QRDFFGAHTYERG..........DRARGQYFHTDWS----
Q826E4_STRAW/181-471P.AALTQG-------QRDFFGAHTYRRT..........DREGS..FHTLWG----
Q6NHC5_CORDI/183-476P.AALIQG-------QRDFFGAHTYRRT..........DKDGS..FHTLWS----
Q98GH7_RHILO/180-470T.SNLIQA-------QRDFFGAHGFERI..........DEQGA..FHGPWG----
Q8TA04_TRIVA/158-442P.ANLIQG-------LRDFFGAHTYERV..........DKEGK..FHTEWE----
Q893F9_CLOTE/178-468G.ANLIQA-------QRDYFGAHTFQRI..........DKEGN..FHYDWV----
6PGD_BUCAI/178-467P.ANLIQA-------QRDYFGSHTYQRT..........DQTGY..FHTNWS----
Q7V1T5_PROMP/179-471P.QNLVQA-------MRDCFGSHTYERV..........DKEGS..FHTEWM----
6PGD_CHLTR/180-472S.LFLVQG-------LRDYFGAHGYERR..........DCPRGEFYHTDWL----
Q7NLK6_GLOVI/192-482P.LNLTQA-------QRDYFGAHTYERI..........DKEGV..FHTEWF----
6PGD_SCHPO/183-479P.ANLLQA-------QRDYFGAHTFRVLPEAADKSLPADKD....IHINWT----
Q8EFR5_SHEON/206-499P.ANLLQG-------QRDFFGAHTFERL..........DKPAGEKYHLDWS----
Q823H8_CHLCV/180-472S.IALAQG-------LRDYFGAHSYERK..........DRPRGEFYHTDWI----
Q6ADQ1_LEIXX/183-473P.AALVQG-------QRDFFGAHTYKRV..........DKDGT..FHTLWS----
6PGD_CHLPN/178-470S.MSLAQG-------LRDYFGAHTYERN..........DRPRGEFYHTDWV----
Q8SAQ4_PORYE/75-372P.ANLLQA-------QRDYFGAHTYERV..........DKKVGEYFHTNWT----
6PGD_STAAS/178-466P.ANLIQA-------QRDYFGAHTYERK..........DKEGV..FHTQWI----
Q7M451_ASCSS/181-470P.ANLIQA-------QRDYFGAHTYELL..........SDPGK.FHHTNWT----
Q9SME1_9PHAE/183-473P.ANLVQA-------QRDFFGAHTYERV..........DKEGV..FHCLWD----
Q74H97_LACJO/176-459P.QNIIQG-------QRDYFGAHTYQRN..........DRPGT..FHTEWY----
Q8FXG6_BRUSU/180-469T.ANLIQG-------QRDFFGSHGFKRI..........DKEGD..FHGPWG----

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window