Sequence alignment for CL0111

PF10131

Q0AV03_SYNWW/415-1038------------------FRYWAPLPYYALAAL---------RG---------LC.GDIFTAGN-----LYIYL------
Q5JIL5_THEKO/62-622------------------LRFYPPLSYLIGAFL---------GI---------LL.GSDIRGYA-----ATLML------
Q97FZ3_CLOAB/258-879------------------FRYWAPFSYYLLAAC---------EF---------LVRGNVSGAYL-----IFISL------
Q0AV07_SYNWW/2-631------------------VQYYPPLSYFLLAPV---------QM---------LF.GNIMITFK-----FAVFF------
Q8TXR3_METKA/68-665------------------LTYYGSLGYLLGAAV---------DA---------IV.KDPVRTFV-----VCLIV------
A0LQQ1_SYNFM/80-828------------------LNYF.PFPFFIMSLL---------AA---------AV..PLQVAFK-----LVTLL------
Q97FY2_CLOAB/253-873------------------FRYWAPFPYYIFALL---------EF---------LTGGNVSQAYI-----MFIGL------
Q97G45_CLOAB/90-699------------------YRYWAPFPYYILAVI---------NM---------FT.NNMITTFD-----VFVEL------
R5JZI7_9CLOT/75-690------------------FRYWGPLSYYIMAGL---------MF---------LTSGDLLLAYR-----LIAFV------

PF09586

A4VYG6_STRSY/15-836------------------S.FLIPLTIISIVLAFQGIWWGSDTT---------ILASDGFHQYVI....FNQTL------
Q1WT54_LACS1/18-862------------------S.FFGPIVIMLAYFIARHMYPFGSST---------ILTVDLGQQYVD....FFAFF------
Q8DRZ1_STRMU/67-904------------------A.FCLPMLVMAVVFAVMKLYPFGKET---------LMSGDYTLQYIP....LYRAL------
Q74LA0_LACJO/18-861------------------S.FGITIAIFLIVSSLANCNPFLGGV---------LWGGDLPDEYLS....FFQYL------
Q74LA1_LACJO/22-868------------------S.CLTTIVLFFLLSTLTDCNPIFGGV---------LYSGDLPNQYLS....FFQYY------
Q03YY3_LEUMM/16-848------------------S.FWIPFLVLIGYFAYRKMAPFGSNS---------ILTVDLGQQYID....QFAAF------
Q8DRQ9_STRMU/18-837------------------S.FLLPSFIMFLVLFSKNIYWGSSTT---------ILASDGFHQYVI....FDALF------
Q03G85_PEDPA/13-851------------------S.GCIPACIMLAYFVYRGFAPFGTSS---------LLTVDMGQQYVA....FYEYF------
A5VKU5_LACRD/18-849------------------S.FLLPVILMACYFAYRQMTPFGKSS---------LLTVDLGQQYVD....FFSYL------
Q8DRY9_STRMU/26-950------------------S.TLLPMMIMLVVWYFMDTFPFGRNT---------LMAVDFGQQYIG....LYGFL------
Q38WC5_LACSS/15-827------------------S.FGLPLVLVLIGFAMMGLVPFGNHN---------LLFSDLGTQYMP....FLAEF------
Q8DWP3_STRA5/16-839------------------S.FLLPFIIIVCILFTKNIYWGSPTT---------ILASDGFHQYVI....FNQAL------
Q03NT2_LACBA/19-858------------------S.FLIPVILMLIYYIYRKMVPFGGSS---------LLTVDLGQQYID....FFSYF------
Q38VZ4_LACSS/17-848------------------S.FLLPFAIIFIYGLSRHVFPFGGQT---------IMTVDLGQQYID....FFAYF------
Q03RN6_LACBA/20-858------------------A.FLVPFILMTGYFIYRQMAPFGTSS---------LLTVDLGQQYID....FFAYL------
Q5FIZ5_LACAC/21-848------------------S.FILPGLIFFSYFFYTK......NG---------VLTVDLGQQYVD....FLAFF------
Q839W8_ENTFA/19-846------------------S.FFIPFLIMAIIYLSIGIYPGSSRS---------VLASDAFSQFSN....FHASF------
Q5M231_STRT2/16-841------------------A.FFLPVLIMIDVLYSQKIYPGSERT---------ILTSDGFHQYVI....FATEL------
Q82ZW8_ENTFA/12-828------------------S.FFLPFLLLLLVWMTLQLAPFGDNN---------LLVSDLGTQYMP....FLSFL------
Q5HPU9_STAEQ/10-840------------------LLITLSLIGHSYIIF..RFHHDGVLS---------TGPNDGMEQMIP....IQMYL------
Q5WFJ9_BACSK/12-844------------------ASIVVAVLAHALFFY...ETAAGRFM---------VGLNDGLGQILP....FKHFL------
Q74IE5_LACJO/19-843------------------S.FLLPTCIFASYFLYRG......QE---------ILTVDLGQQYID....FLSFY------
Q03HY9_PEDPA/14-831------------------S.FILPITIVIIAYASNGIYWGSAHS---------ILASDAFTQGAN....FLASF------
Q038D6_LACC3/14-842------------------S.FLLPGLLVGLYFAIRGTFPFGSSS---------VLTVDLGQQYID....FFAYL------
Q3XYV7_ENTFC/19-847------------------S.FLIPFLILALVYLSIGIYPGSSRS---------ILASDAFSQFSN....FHASF------
Q814J9_BACCR/15-862------------------TLIIIPLLIICAFAFHYFFLKSDNVF---------SSTGDALSQFSF....FTFLL------
Q03TF4_LACBA/23-880------------------A.FLIPLIIMCLAFWHLRITPFGNRN---------LLLSDMGTQYIP....ILENL------
Q5WJL1_BACSK/14-845------------------GSVLFAAAAHAFFFY...QSANGQFM---------VGPNDGTAQMLP....FKQFL------
Q65M97_BACLD/11-842------------------ASIAVSVAAHSFFLY...EWAHDRYM---------TGNGDGLAQMII....FKSFL------
Q04EK1_OENOB/16-850------------------S.FALPALIMLFYFYYRKMAPFGNSS---------ILTVDLGQQYVD....MFSGM------
Q03QV8_LACBA/14-985------------------MFMILVVALYGIFLL......TGKSF---------IWEGDGLAQHYP....ILEKF------
Q03A73_LACC3/16-850------------------S.FSMTFTISLIVFAALKMAPFGSSS---------ILANDSAVQYVD....FFTYL------
A8FB68_BACP2/11-842------------------MCLILALLGHSFFLY...EYTQGRYM---------TGDGDGISQMLP....FKKLL------
Q03TW7_LACBA/17-837------------------A.TLLALMMMVTLFALRGITPFGNHN---------LLIGDLGVQYTP....FFTDF------
Q2FZ40_STAA8/20-851------------------S.VILTLILFSTHIY..DYIVNGTVF---------SGAGDGFRQMMP....FQMYL------
Q8DMX0_STRR6/15-831------------------..LIIPVVIMSGVYLSQGIYWNSDNS---------PLLGDGFHQYVI....FDVAL------
Q99XH1_STRP1/14-837------------------S.FLFPLSIIFIILLSMGIYYNSDKT---------ILASDAFHQYVI....FAQNF------
Q9CHA3_LACLA/14-855------------------S.FFIPLLLMVIVLAMTGIYWGSSRS---------ILAGDAYHQYVA....IHSLY------
R6NFF7_9CLOT/15-832------------------...VMPGVLLLSVYIALGVYPFGQRS---------LLITDMSQLYVD....FYSYL------
R7DCE3_9FIRM/22-900------------------..YTIAFAGIALFLY.MRFYLNGKSL---------IWSHDGVPQHLNSLAYYGRYL------

PF05007

GPI14_YEAST/127-386--------------------------------------------------------------------------------
GPI14_SCHPO/112-368--------------------------------------------------------------------------------
PIGM_TRYB2/134-410--------------------------------------------------------------------------------
PIGM_RAT/140-408--------------------------------------------------------------------------------
Q17515_CAEEL/146-405--------------------------------------------------------------------------------
Q9W2E4_DROME/177-450--------------------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379------------------PALLATKLAF...GFSKLP.DAVRYDHQL...................SSPLTSFS------
Q5CYY5_CRYPI/10-436------------------IISILIKLSF...FILVEHDLEDYTNGFF...................GILGQNFG------
B6AHL5_CRYMR/12-437------------------ILLVIIRILTLQYYASD...PNIYTDPLN...................VIPGYTFR------
B9RC32_RICCO/30-452------------------ASALILRLIL...IYFSQN.LNLSSRPEV...................STPLTSLR------
B9GKM7_POPTR/14-432------------------IASVMLRLIL...IYLPKT.FNLASRPEV...................STPLVSLR------
A9TIH7_PHYPA/73-514------------------TLGICVRFLL...VVMGSL.SLLDRRVEV...................VSPVTSLS------
B4N1B7_DROWI/10-386------------------LLGGAVRLYF...SRTPLA.SLIGDRVEF...................ATPLNSYK------
B4KI55_DROMO/10-386------------------LLGGAVRLYF...SQTSLA.PLIGNRVEF...................ATPLNSFK------
Q16H22_AEDAE/9-388------------------LLGAALRYLL...MHSHYG.VTIQNRVEV...................ATPLNSWK------
B0W4N5_CULQU/8-388------------------FVGALVRYLL...MSSEYS.GLIRGRVEV...................ATPLNSWK------
Q7Q3W6_ANOGA/8-396------------------GVAAAVRFLL...MNSRYS.HGIQNRVEV...................STPINSWK------
B7QL74_IXOSC/11-391------------------TSGFLLRLAL...IYTSIG.KRISDRVEV...................STPLNSWR------
Q4RLI5_TETNG/10-394------------------ILAVTIRAAL...YRSNLA.DLIAERVEV...................VSPLTAWK------
Q28CK0_XENTR/10-394------------------LVAVTVRAIL...FRSSLA.EFISERVEV...................VSPLNSWK------
A7S3Y0_NEMVE/14-406------------------LASTAVRLIF...MYSPAR.EWFRDRIEL...................STPLTDWK------
Q54T45_DICDI/55-469------------------FSAILIRIIL...FYQGFD.QLFSNRNEI...................TTPLTSFK------
Q758M8_ASHGO/10-356------------------IACVGSRLLISL.AFPSLQ.QQLDNAVEF...................STPVTSFR------
C5DB98_LACTC/10-356------------------FACLASRFGAAA.VFPLLQ.QQLDRSVEF...................STPVTSFR------
Q6CPH2_KLULA/10-358------------------WACFASRLAVSY.LFPSLQ.QQLDRTVEF...................STPVTSYR------
C5DUS6_ZYGRC/10-359------------------VGCVVVRLAVSL.LFPSLQ.TQLDKSVEL...................STPMSSYR------
A7TF02_VANPO/11-360------------------LAGFTVRLLLSI.GFSGLQ.SSLDNSVEF...................STPFTSFK------
Q6FSI7_CANGA/9-374------------------VICGALRLLISA.TFPSLR.SQLDNTVEF...................STPFTSFK------
C5MHK2_CANTT/9-395------------------IIGGLIRFILPT.LFPQII.TKLDSSVEF...................STPISSFK------
Q5AGH5_CANAL/13-440------------------IIGGLIRFLLPTIIFPQLT.SILDSSILL...................STPITSFK------
A5E2K6_LODEL/111-490------------------LIGGLVRFLLPL.LVPSIV.PVLGSIVEI...................TTPITSFK------
Q6BPY5_DEBHA/9-390------------------LIGALIRFVLPT.SLPSLP.LDLSSSIEI...................ATPLTSFK------
A3LVF4_PICST/9-390------------------VLGALVRFVVPS.VLPQVT.DVLSSIVEI...................STPVNSFK------
C4Y9V1_CLAL4/8-389------------------ASGFALRFAVPT.LLPHIS.HSLAATPQI...................STPIDSFR------
C5FSQ4_ARTOC/12-388------------------GAAFALRLILIL.LFPGLP.DLLTGRVEV...................STPISSFK------
B6H480_PENRW/12-387------------------GAAFMLRLLLTC.LFPSLP.DLLTGRVEV...................STPVNSFK------
A2QI87_ASPNC/12-388------------------GGALALRLLLSV.LFPSLP.DLLTGRVEV...................STPVTSFK------
B6QEM6_TALMQ/12-390------------------AAAVAVRLFLFV.AFPSLP.DLLTSRVEV...................STPVSSFK------
B2WBA6_PYRTR/13-388------------------GAAAAVRLLLFT.VFPALP.DLLAGRVEV...................STPVTSFK------
B2A9S5_PODAN/16-388------------------AGAAVLRLAIFT.LLPDLP.DLLTGRVEI...................STPVTSFK------
Q6C5L4_YARLI/7-382------------------ACGAIARIVVYH.LFPSVP.ATLDGHVEI...................STPVTSFK------
B0D118_LACBS/9-373------------------PALVVARLFV...ALSSLP.DVLKHNHQL...................SSPLTSFS------
PIGU_SCHPO/10-372------------------LGLLSISFFLQWYLANTWIAEFLYRRIEV...................STPVSGFL------
B6K154_SCHJY/14-372------------------LLYVSIHIVLHTLDFS....SILEKRIEI...................STPASSFL------
Q22672_CAEEL/31-382------------------SAAIAVRAVCASYS......DLFEERVEL...................TSVVYSFE------
A8X654_CAEBR/27-380------------------SAAIAVRAASFAYS......DYFEERVEF...................TSTVYSFE------
Q01AL0_OSTTA/12-375------------------LTLTLARVVALAFIVPESAREALERRIEL...................SSATDSVR------
C1EBB5_MICCC/13-406------------------AAGVLARVLL...AILGWT.ESASERLEL...................ASPVDALA------
C1MV77_MICPC/13-431------------------LASVLLRFVL...AARGWG.EILHARPEL...................SSAVDAAT------
C5L3N8_PERM5/23-419------------------LLGFLLRLLLFAALGSPLL...LRSSPEL...................NSPINDYE------
Q4YTZ9_PLABA/82-516------------------LEQYFQTNKRYNKNIKQCIFKSDSMYYSF...................NSDIYNMK------
Q8IE19_PLAF7/127-560------------------LELYFQKNKRYN.NLRSFLLKNDYMHYLF...................NTDIYNLK------
B3L8S4_PLAKH/95-534------------------LQEYFQRNKRNG.KIKQFLLKNDSMHYSF...................NSDLYNLK------
A0DGJ7_PARTE/1-357------------------MYRIILILKCLLWYFGKWD.VDLTWLPYF...................SNPYTQYS------
B8C4L2_THAPS/71-579------------------LTQLLGRGILPSIRAAVLDPIHTWSHLEEACFWKDNAPSLWMDVAVAHSTVGNSAD------
B4Q6V7_DROSI/10-386------------------LLGAAVRFYF...CRTPLA.PMIGNRVEF...................ATPLNSHK------
G3HAP2_CRIGR/11-394------------------.VAVTVRAAL...FRSSLA.EFISERVEV...................VSPLSSWK------
J4TTL1_SACK1/11-359------------------.GCIAIRLAVIC.LFPSLQ.QQLDQSVEF...................STPVTSFR------
Q5KP79_CRYNJ/19-375------------------IVGAVLRMALF..SLPEVV.IALQRRPEL...................STPLTSFR------
Q7SFC3_NEUCR/18-392------------------..AAVLRLALFT.LFPGLP.DLLTGRVEI...................STPVTSFK------
Q94K70_ARATH/25-442------------------.ASTIFRLFL...IFSPAN.INLSSRPEV...................STPHTSLR------
A0A125YKP3_TOXGV/76-514------------------.VGVALRLFLYS...VGLT.LSESTEPLV...................SPASASFS------

PF09594

PIME_MYCS2/91-321--------------------------------------------------------------------------------
A0JZG9_ARTS2/73-321--------------------------------------------------------------------------------
Q73YN6_MYCPA/82-326--------------------------------------------------------------------------------
E0TET4_PARBH/112-335--------------------------------------------------------------------------------
Q1QK36_NITHX/92-360--------------------------------------------------------------------------------
Q1DFL5_MYXXD/100-338--------------------------------------------------------------------------------
Q1LAW9_CUPMC/87-313--------------------------------------------------------------------------------
Q2J8W8_FRASC/88-337--------------------------------------------------------------------------------
Q9HN16_HALSA/81-322--------------------------------------------------------------------------------
Q6N414_RHOPA/73-354--------------------------------------------------------------------------------
Q8KF88_CHLTE/91-313--------------------------------------------------------------------------------
Q82C69_STRAW/73-314--------------------------------------------------------------------------------
A6W4J4_KINRD/75-318--------------------------------------------------------------------------------
Q8NNL7_CORGL/75-325--------------------------------------------------------------------------------
A6LI36_PARD8/70-300--------------------------------------------------------------------------------
Q0S7Q3_RHOJR/72-303--------------------------------------------------------------------------------
Q0S430_RHOJR/96-330--------------------------------------------------------------------------------
AFTC_MYCS2/90-325--------------------------------------------------------------------------------
Q8KF86_CHLTE/520-743--------------------------------------------------------------------------------
A4X3Z6_SALTO/69-305--------------------------------------------------------------------------------
A5FWG6_ACICJ/133-359--------------------------------------------------------------------------------
Q8EXK5_LEPIN/120-368--------------------------------------------------------------------------------
Q6NG43_CORDI/98-348--------------------------------------------------------------------------------
A4F662_SACEN/84-314--------------------------------------------------------------------------------
A4YMG5_BRASO/52-323--------------------------------------------------------------------------------
Q8FNR9_COREF/132-368--------------------------------------------------------------------------------
Q8FNS1_COREF/85-333--------------------------------------------------------------------------------
Q2IKA8_ANADE/104-327--------------------------------------------------------------------------------
Q8NNL6_CORGL/93-341--------------------------------------------------------------------------------
A7I755_METB6/60-298--------------------------------------------------------------------------------
Q1AS45_RUBXD/75-307--------------------------------------------------------------------------------
Q0SHP5_RHOJR/98-332--------------------------------------------------------------------------------
A1TAY8_MYCVP/79-323--------------------------------------------------------------------------------
Q0KDP9_CUPNH/92-320--------------------------------------------------------------------------------
Q7MTZ4_PORGI/65-295--------------------------------------------------------------------------------
A4XDG1_SALTO/368-608--------------------------------------------------------------------------------
Q73W67_MYCPA/92-327--------------------------------------------------------------------------------
A0JZG6_ARTS2/141-392--------------------------------------------------------------------------------
Q2G5A3_NOVAD/106-326--------------------------------------------------------------------------------
Q8A2B6_BACTN/67-296--------------------------------------------------------------------------------
Q0C0G8_HYPNA/93-341--------------------------------------------------------------------------------
Q1ITA1_KORVE/92-336--------------------------------------------------------------------------------
Q4JVC2_CORJK/78-310--------------------------------------------------------------------------------
Q5Z2C4_NOCFA/88-323--------------------------------------------------------------------------------
Q0S1F1_RHOJR/88-319--------------------------------------------------------------------------------
Q5YR74_NOCFA/76-310--------------------------------------------------------------------------------
Q82B65_STRAW/52-287--------------------------------------------------------------------------------
A6WEV4_KINRD/63-293--------------------------------------------------------------------------------
Q6A9X9_PROAC/81-311--------------------------------------------------------------------------------
B2U6Q0_RALPJ/105-334--------------------------------------------------------------------------------
Q8A2B7_BACTN/70-300--------------------------------------------------------------------------------
A1K2E7_AZOSB/76-322--------------------------------------------------------------------------------
Q1LQN5_CUPMC/107-328--------------------------------------------------------------------------------
Q82AJ1_STRAW/66-309--------------------------------------------------------------------------------
A4F642_SACEN/68-304--------------------------------------------------------------------------------
Q6NEL0_CORDI/90-330--------------------------------------------------------------------------------
Q89QR1_BRADU/100-368--------------------------------------------------------------------------------
Q4JVV2_CORJK/84-315--------------------------------------------------------------------------------
Q5YTA9_NOCFA/80-311--------------------------------------------------------------------------------
Q73WN6_MYCPA/105-337--------------------------------------------------------------------------------
Q8FNS2_COREF/71-313--------------------------------------------------------------------------------
A4Z0F4_BRASO/98-322--------------------------------------------------------------------------------
Q1AX69_RUBXD/44-303--------------------------------------------------------------------------------
Q5YQC7_NOCFA/78-313--------------------------------------------------------------------------------
Q8FPI8_COREF/95-327--------------------------------------------------------------------------------
B2U6P6_RALPJ/116-345--------------------------------------------------------------------------------
Q4JU29_CORJK/82-316--------------------------------------------------------------------------------
A6LBC6_PARD8/70-301--------------------------------------------------------------------------------
Q20YY7_RHOPB/103-326--------------------------------------------------------------------------------
Q1LQN6_CUPMC/104-332--------------------------------------------------------------------------------
A1R1N0_ARTAT/81-341--------------------------------------------------------------------------------
Q2K4Q8_RHIEC/84-305--------------------------------------------------------------------------------
A4YMG3_BRASO/104-327--------------------------------------------------------------------------------
Q82GI4_STRAW/88-314--------------------------------------------------------------------------------
A7I7Y5_METB6/97-335--------------------------------------------------------------------------------
Q3L9S4_RHOE4/54-285--------------------------------------------------------------------------------
A4FR42_SACEN/78-325--------------------------------------------------------------------------------
Q9CBX0_MYCLE/105-336--------------------------------------------------------------------------------
A4FGU5_SACEN/82-312--------------------------------------------------------------------------------
Q82NJ1_STRAW/66-299--------------------------------------------------------------------------------
Q6NF60_CORDI/70-290--------------------------------------------------------------------------------
A4X4Q2_SALTO/67-302--------------------------------------------------------------------------------
A4XDF7_SALTO/84-339--------------------------------------------------------------------------------
B1W388_STRGG/68-304--------------------------------------------------------------------------------
B2HGU8_MYCMM/80-324--------------------------------------------------------------------------------
B4EGA7_BURCJ/104-332--------------------------------------------------------------------------------
B4EQ62_BURCJ/118-340--------------------------------------------------------------------------------
C5B043_METEA/93-315--------------------------------------------------------------------------------
AFTC_MYCTU/94-327--------------------------------------------------------------------------------
PIME_MYCTU/103-334--------------------------------------------------------------------------------
Q63I86_BURPS/104-334--------------------------------------------------------------------------------
Q63I87_BURPS/118-340--------------------------------------------------------------------------------
Q7AQD6_MYCLE/80-324--------------------------------------------------------------------------------
Q8NNL3_CORGL/89-325--------------------------------------------------------------------------------
R6X3N6_9PORP/49-278--------------------------------------------------------------------------------

PF13231

Q65D63_BACLD/64-222--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRADU/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
Q89IJ6_BRADU/52-213--------------------------------------------------------------------------------
Q5ZVN3_LEGPH/45-205--------------------------------------------------------------------------------
A5ULR9_METS3/66-231--------------------------------------------------------------------------------
Q2IKZ1_ANADE/72-232--------------------------------------------------------------------------------
Q2KCI5_RHIEC/48-207--------------------------------------------------------------------------------
Q6NCW5_RHOPA/88-248--------------------------------------------------------------------------------
Q82U54_NITEU/408-568--------------------------------------------------------------------------------

PF02366

PMT3_YEAST/62-306--------------I--IFTVLGMFTRMYK-IGRN-------------------NHVVWDEAHFGKFGSYYLRH------
POMT1_HUMAN/20-289--------------V--ALTGMGLLSRLWR-LTYP-------------------RAVVFDEVYYGQYISFYMKQ------
P73015_SYNY3/18-249--------------V--AIFLFSLVIRFWN-LGQF-------------------NQLVFDEVYYAKFASDYWLG------
Y1220_AQUAE/1-229--------------M--MKKFLLVLIPVLI-LYFY-------------------NLGYNAVWMPNES..FYADS------
ARNT_SALTY/3-237--------------S--IRYYLAFAAFIAL-YYVI-------------------PVNSRLLWQPDET..RYAEI------
P73065_SYNY3/8-275--------------K--SWGVPLLLAMVWL-GSNG-------------------LDRLWLGMDQTVPAWDQSNH------
PMT1_YEAST/54-297--------------A--CLAVFTAVIRLHG-LAWP-------------------DSVVFDEVHFGGFASQYIRG------
PMT1_CANAL/70-313--------------S--SLLLIAFYVRMYN-LSNP-------------------NSVVFDEVHFGGFARKYILG------
PMT1_SCHPO/38-284--------------I--FLTVVAFCVRAQR-LMNP-------------------AKVVFEELRYYNYAVDYVNN------
PMT2_YEAST/69-313--------------V--IFTALALFTRMYK-IGIN-------------------NHVVWDEAHFGKFGSYYLRH------
POMT2_HUMAN/62-306--------------A--LVTLLSFATRFHR-LDEP-------------------PHICWDETHFGKMGSYYINR------
PMT5_YEAST/50-293--------------G--CLLIFTAIVRLHN-ISLP-------------------NSVVFGENEVGTFVSQYVNN------
P73712_SYNY3/7-243--------------N--SSRRLISVIIYLT-IFIR-------------------VLTLGLYAVADRTEARYAEI------
POMT1_DROME/178-421--------------W--TLFLLAFGTRFYK-LATP-------------------PHIVFDELHYGKYISMYMRN------
PMT4_YEAST/57-305--------------T--IVTLLAFAARFYK-IWYP-------------------KEVVFDEVHFGKFASYYLER------
PMT4_SCHPO/63-310--------------V--LITVLSFITRFWN-LNLP-------------------GEVVFDEVHFGKFASYYLQG------
ARNT_ECOLI/3-237--------------S--VRYLIGLFAFIAC-YYLL-------------------PISTRLLWQPDET..RYAEI------
PMT6_YEAST/70-314--------------L--LLTITSFYLRFQH-IDQN-------------------NYVVWDEAHFGKFGSYYIKH------
PMT6_CANAL/97-357--------------.--ILTAISSFVRLYR-IDVA-------------------NSVVWDEAHFGKFGSQYLKR------

PF11028

A3U548_CROAH/37-215-----------------------------------------------------------------DAGEYIATA------
R6XIR1_9BACT/37-217-----------------------------------------------------------------DCGEFIASS------
F6GE14_LACS5/37-214-----------------------------------------------------------------DAGEYILTS------
I6ZS60_MELRP/34-208-----------------------------------------------------------------DCGEFIASS------
H8KSF5_SOLCM/35-209-----------------------------------------------------------------DCGEFVASV------
A0LXN9_GRAFK/37-215-----------------------------------------------------------------DAGEYIATS------
U5Q8D9_9BACT/37-212-----------------------------------------------------------------DCGEFIASS------
R5I514_9BACT/37-217-----------------------------------------------------------------DCGEFIASS------
Q2S0T5_SALRD/34-225-----------------------------------------------------------------DPGERIASA------
I0K9H0_9BACT/35-227-----------------------------------------------------------------DCGEFIACA------
X5D9M2_9BACT/35-209-----------------------------------------------------------------DCGEFITTA------
X5DZV9_9BACT/35-212-----------------------------------------------------------------DCGEFITSA------
H1XP16_9BACT/34-208-----------------------------------------------------------------DCGEFIACS------
B3ENQ9_CHLPB/34-209-----------------------------------------------------------------DCGEFIATA------
H1YCC6_9SPHI/34-214-----------------------------------------------------------------DCGEFISCA------
H8KSF6_SOLCM/35-213-----------------------------------------------------------------DCGEFISSA------
F4KRQ6_HALH1/35-218-----------------------------------------------------------------DCGEFILGA------
F4C302_SPHS2/34-214-----------------------------------------------------------------DCGEFIAAA------
E4T8Q1_PALPW/35-213-----------------------------------------------------------------DCPEFIASA------
H1Y2D3_9SPHI/34-214-----------------------------------------------------------------DCGEFISCA------
A4CGC2_ROBBH/37-215-----------------------------------------------------------------DAGEYISTS------
I3YTY0_AEQSU/37-215-----------------------------------------------------------------DAGEYIATS------
F3ZQH0_9BACE/35-214-----------------------------------------------------------------DCGEFILSS------
G8TAS2_NIAKG/34-222-----------------------------------------------------------------DCGEFVSSA------
D3IE17_9BACT/35-214-----------------------------------------------------------------DCPEFITTG------
F4C4U7_SPHS2/36-216-----------------------------------------------------------------DCGEFIAAA------
G8R038_OWEHD/36-216-----------------------------------------------------------------DCGEYISTA------
A6GWD8_FLAPJ/36-224-----------------------------------------------------------------DCGEYIATA------
T2KIW2_9FLAO/37-215-----------------------------------------------------------------DAGEYILTS------
I3KW99_ORENI/21-184-----------------------------------------------------------------DSGELITTA------
F4KMK4_PORAD/39-231-----------------------------------------------------------------DCPEFILSA------
I0AH06_IGNAJ/35-227-----------------------------------------------------------------DSGELALAQ------
C3L447_AMOA5/43-223-----------------------------------------------------------------DCSEYIAAA------
H8XP42_FLAIG/37-215-----------------------------------------------------------------DCGEYIATA------
Q74D30_GEOSL/39-214-----------------------------------------------------------------DSGEFITAI------
R5BN47_9BACE/50-226-----------------------------------------------------------------DCGEFIASS------
F0S690_PSESL/34-213-----------------------------------------------------------------DCGEFISAA------
A9AXK7_HERA2/53-215-----------------------------------------------------------------DSGELATAL------
R6SBD9_9BACE/36-215-----------------------------------------------------------------DCPEFITTG------
B3EAC9_GEOLS/36-209-----------------------------------------------------------------DSGEFVTAV------
L7W9H4_NONDD/36-210-----------------------------------------------------------------DAGEYIATS------
B5EH69_GEOBB/37-210-----------------------------------------------------------------DSGEFITAI------
A1ARZ9_PELPD/68-243-----------------------------------------------------------------DSGEFLTAI------
G1PIZ8_MYOLU/52-215-----------------------------------------------------------------DAGELITAA------
A5G4Z0_GEOUR/37-209-----------------------------------------------------------------DSGEFITAI------
C9RN70_FIBSS/36-216-----------------------------------------------------------------DCGEFVACA------
I0AM95_IGNAJ/32-228-----------------------------------------------------------------DSGELAAVQ------
D3BML5_POLPA/98-270-----------------------------------------------------------------DAGELIINA------
W8FBF7_9BACT/35-222-----------------------------------------------------------------DCGEFIACS------
W0EVP7_9BACT/34-220-----------------------------------------------------------------DCGEFVSTA------
L7W937_NONDD/38-203-----------------------------------------------------------------DSPEFAFAG------
E4RU44_LEAB4/34-214-----------------------------------------------------------------DCGEFIACA------
I0AN08_IGNAJ/34-208-----------------------------------------------------------------DCGEFIAAS------
A6LGG9_PARD8/35-214-----------------------------------------------------------------DCGEFISSA------
A4AMM0_MARSH/37-215-----------------------------------------------------------------DAGEYIATS------
C1A3K8_GEMAT/56-227-----------------------------------------------------------------DASEYIAAA------
R6SBV2_9BACE/35-216-----------------------------------------------------------------DCPEFILSA------
I0I530_CALAS/46-211-----------------------------------------------------------------DAGEFQFAA------
G8X584_FLACA/36-214-----------------------------------------------------------------DCGEYISTS------
W0RJK7_9BACT/57-227-----------------------------------------------------------------DTSEYIAAA------
D0LFQ9_HALO1/25-195-----------------------------------------------------------------DAPEFVAAS------
R5W9J1_9BACT/35-214-----------------------------------------------------------------DCAEFIATS------
K4IB40_PSYTT/37-215-----------------------------------------------------------------DAGEYIATS------
E6X4M4_CELAD/37-216-----------------------------------------------------------------DAGEYITTS------
D0MDF1_RHOM4/34-225-----------------------------------------------------------------DSGEFIASV------
I3ZYA9_ORNRL/34-223-----------------------------------------------------------------DCGEYIVSS------
R7F5J7_9BACT/37-217-----------------------------------------------------------------DCGEFIIQA------
G8TQ81_NIAKG/34-212-----------------------------------------------------------------DCGEFISTA------
A2TXJ8_9FLAO/37-215-----------------------------------------------------------------DVGEYIATS------
I0AH07_IGNAJ/47-229-----------------------------------------------------------------DSGELAAVQ------
Q8KAY9_CHLTE/41-217-----------------------------------------------------------------DCGEVIATS------
C6W6V6_DYAFD/35-215-----------------------------------------------------------------DCGEFIACA------
F0NYC1_WEEVC/36-224-----------------------------------------------------------------DCGEYIVSS------
B4S581_PROA2/34-210-----------------------------------------------------------------DCGEFIATA------
B3QWD0_CHLT3/33-211-----------------------------------------------------------------DCGEFIATA------
Q39VU9_GEOMG/36-207-----------------------------------------------------------------DSGEFITAI------
C6Y1Y3_PEDHD/35-207-----------------------------------------------------------------DCGEFIAAS------
C7M410_CAPOD/37-223-----------------------------------------------------------------DCGEYIATS------
R5P289_9BACT/43-218-----------------------------------------------------------------DCGEFITTS------
G2Z4K2_FLABF/39-217-----------------------------------------------------------------DCGEYIATA------
R6AGR2_9BACT/35-214-----------------------------------------------------------------DCPEFITTA------
B4SC86_PELPB/34-212-----------------------------------------------------------------DCGEFIATA------
F4AVR9_DOKS4/37-216-----------------------------------------------------------------DAGEYISTS------
Q7MT47_PORGI/37-226-----------------------------------------------------------------DCAEFIVCV------
I4AKN9_FLELS/34-232-----------------------------------------------------------------DCGEFIAVS------
I2EW61_EMTOG/35-215-----------------------------------------------------------------DCGEFIACS------
D6D6N6_9BACE/37-216-----------------------------------------------------------------DCPEFISCA------
R7DIG7_9PORP/35-214-----------------------------------------------------------------DCGEFISSA------
C1A7V9_GEMAT/57-227-----------------------------------------------------------------DTSEYIAAA------
R5B2K5_9BACE/47-228-----------------------------------------------------------------DCPEFILQA------
C0R1J1_BRAHW/121-297-----------------------------------------------------------------DNGELTTAA------
H1Z8K4_MYROD/37-215-----------------------------------------------------------------DPGEYIATS------
R5RQ99_9BACE/43-220-----------------------------------------------------------------DCGEFIASS------
W5MZF0_LEPOC/41-204-----------------------------------------------------------------DSGELITAA------
F9YU79_CAPCC/36-215-----------------------------------------------------------------DCGEYIATS------
C7PKN8_CHIPD/34-212-----------------------------------------------------------------DCGEFISSA------
H6LAI5_SAPGL/35-215-----------------------------------------------------------------DCGEFISAA------
J9R805_RIEAN/38-218-----------------------------------------------------------------DCGEYISSA------
B6YRJ5_AZOPC/37-217-----------------------------------------------------------------DCSEFITSA------
C6Y0P2_PEDHD/34-214-----------------------------------------------------------------DCGEFIASA------
R5GFJ4_9BACT/35-214-----------------------------------------------------------------DCPEFITTA------
TM260_DICDI/139-313-----------------------------------------------------------------DAGELIVVA------
R5G4M3_9PORP/37-222-----------------------------------------------------------------DCPEFITTF------
C6X5R1_FLAB3/37-217-----------------------------------------------------------------DTGEYIASA------
D2QNX1_SPILD/35-215-----------------------------------------------------------------DCGEFIACS------
E4TV18_MARTH/50-230-----------------------------------------------------------------DCAEFIASA------
R7HQZ6_9BACT/35-215-----------------------------------------------------------------DCGEFISQG------
F2I9U5_FLUTR/34-221-----------------------------------------------------------------DCGEYITAA------
I3Z145_BELBD/35-215-----------------------------------------------------------------DPGEFIAVA------
Q11YB8_CYTH3/35-214-----------------------------------------------------------------DCGEFISTS------
R6CJ33_9BACT/35-214-----------------------------------------------------------------DCPEFITTA------

PF02516

STT3A_HUMAN/17-484--------------L--LKLLILSMAAVLS-FSTR.....---------....LFAVLRFESVIHEFDPYFNYR------
STT3_CAEEL/19-506--------------L--LTIVVLALAWFVG-FASR.....---------....LFAIVRFESIIHEFDPWFNYR------
STT3_YEAST/15-475--------------I--LKLVIFVAIFGAA-ISSR.....---------....LFAVIKFESIIHEFDPWFNYR------
STT3_SCHPO/23-509--------------P--LKVLILICIAVAS-VSSR.....---------....LFSVIRYESIIHEFDPWFNFR------
O29867_ARCFU/18-493--------------V--IAALISVKLRILN-PWNS.....---------....VFTWTVRLGG...NDPWYYYR------
O27660_METTH/24-582--------------F--YIRAEASNIGGVP-ADAK.....---------...KFYEDADGLPYFSEMDSYYNYR------
O27928_METTH/21-478--------------F--FSRIETAELKGMN-TADR.....---------...AYFTDENGLPYMYEPDSYYNYR------
O27920_METTH/13-461--------------V--IFVFGFSIRMLNA-GYDD.....---------...PLYTDDDGLQYFQESDSYYNYR------
Y1525_METJA/33-650--------------M--LMFVSFQLRAQTA-DMKFAQDNE---------FLKDMFSDEHGRMYLLALDPYYYLR------
PGLB_CAMJE/11-477--------------.--.YLVLFAMIVLAY-VFSV.....---------.....FCRFYWVWWASEFNEYFFNN------

PF03901

SMP3_YEAST/6-401--------------W--WLYLVYAIGLMLC-LGPS--------------------------YI..HPDEHFQCI------
GPI10_SCHPO/4-414--------------W--FWLAILVFRWWNA-LWVK--------------------------TFF.QPDEFYQSL------
ALG9_SCHPO/16-438--------------W--TFSILAVLRLTSA-SFRV--------------------------ID..DCDEVYNYW------
ALG9_ARATH/48-451--------------L--PFIALCYLRYMSA-TSNI--------------------------IH..DCDEVFNYW------
ALG9_YEAST/10-414--------------L--LLLLFLTRVYIQP-TFSL--------------------------IS..DCDETFNYW------
ALG12_CAEEL/6-405--------------W--IVIIVTIIHIILA-PGT.--------------------------....KVEESFNVQ------
GPI10_YEAST/16-484--------------Q--IFWVFLAFRVLNA-VLTR--------------------------TFF.QADEFWQAL------
SMP3_SCHPO/9-412--------------I--IYTFLLILRFWFS-Q..G--------------------------SSYIHPDEHLQSF------
Q9VBV8_DROME/75-498--------------T--AFKTFVSARLCSA-IWAY--------------------------IA..DCDETFNYW------
PIGB_HUMAN/62-449--------------Y--LLLFTIALRILNC-FLVQ--------------------------TSF.VPDEYWQSL------
PIGB_DROME/5-396--------------Y--VFLLILAVRLASV-FVVQ--------------------------TYY.VPDEYWQSL------
ALG9_MOUSE/60-482--------------T--AFKCLLSARLCAA-LLSN--------------------------IS..DCDETFNYW------
PIGZ_DROME/18-541--------------S--TYFCFAAVRLLLV-FVPQ--------------------------LGYVHPDEFFQSV------
YTH3_CAEEL/55-472--------------S--VFKMLLSIRISGA-IWGI--------------------------IN..DCDEVYNYW------
F4K887_ARATH/41-451--------------.--IFLFCLAFRVVNA-LLIQ--------------------------TYF.NPDEHWQSL------
GPI10_TRYB2/4-432--------------W--LISLTFIYRLFLC-ATIR--------------------------TVE.APDEWWQST------

PF09852

Q119E7_TRIEI/30-487--------------R--HLLFQ......ST-AF--------------------------------EMGIYDQVT------
Q1CZA2_MYXXD/39-471--------------L--QAAQV.....CFP-NF--------------------------------DLGIYSQAV------
Q7U446_SYNPX/31-511--------------R--SWVL.......LA-SY--------------------------------DQGIFQQVL------
A5GS07_SYNR3/40-521--------------R--LWSL.......SA-TY--------------------------------DQGIFNQVL------
Q119E6_TRIEI/27-490--------------R--HAFFC......ST-GF--------------------------------DLGIYDQVV------
Q82RR9_STRAW/82-508--------------L--HQRML......TT-GY--------------------------------DLGIFEQAV------
Q4J6X7_SULAC/32-488--------------R--LYDLL......SG-AF--------------------------------DLGLFMQEF------
A5URL3_ROSS1/78-571--------------L--FFGLTFKYVHWAQ-GY--------------------------------DQIDYQQSI------
Q4J7K9_SULAC/43-493--------------V--LYNLN......YS-SY--------------------------------NLSMFIQEL------
Q9HK92_THEAC/39-557--------------K--YVSLN......AT-AY--------------------------------DLGIYVSIL------
A5GNZ8_SYNPW/38-520--------------K--SWVL.......LA-GY--------------------------------DQGIFQQVA------
Q4J7K8_SULAC/16-462--------------R--LYDLY......SG-AF--------------------------------DLGIFLQEL------
A5GR01_SYNR3/37-521--------------R--IYTL.......TA-TF--------------------------------DQGLFLQEI------
Q8F2H0_LEPIN/76-512--------------A--LDSLF......LG-DL--------------------------------DYTAQLRMI------
P73520_SYNY3/35-464--------------R--HWLFQ......ST-AL--------------------------------DLGFFDQAI------
Q7U443_SYNPX/37-518--------------R--MQSL.......TA-SM--------------------------------DQGILMQVL------
Q7VDJ5_PROMA/39-469--------------R--HFLLQ......SN-AF--------------------------------DLGLFDQWV------
A5V1J1_ROSS1/34-511--------------R--YMGFN......AG-VL--------------------------------DLGTMYQAI------
Q7U444_SYNPX/29-448--------------R--HALLH......SN-AY--------------------------------DLGLFDQWV------
Q10XG3_TRIEI/32-516--------------R--YYSF.......YA-SY--------------------------------DQGIFNQVF------
Q7V4G7_PROMM/40-520--------------R--LESL.......TA-TY--------------------------------DQALFLQEL------
Q7V4G8_PROMM/29-457--------------R--HALLQ......SN-AY--------------------------------DLGLFDQWI------

PF09913

Q1MP06_LAWIP/21-414--------------F..FWGVIFLFLIPPF-QAPD------------------------------EQVHFPRVF......
A4VVV9_STRSY/36-414--------------I..PFLLISIFVMPVT-KVPD------------------------------EATHAFMSW......
A0LS06_ACIC1/16-395--------------F..GITALWAVTTPKY-AAPD------------------------------EPAHAVKAA......
Q5Z3D8_NOCFA/116-537--------------LATLFGAVFAVITPPF-WGHD------------------------------EITQFGRAY......
Q5M3E5_STRT2/28-432--------------F..FVGILSIFFRHPM-SWYD------------------------------EQVHYARVITYSNDL
A5UMR8_METS3/71-461--------------I..IFGIISLFLTPIY-DVSD------------------------------ETEHFVRSE......
A1W3H2_ACISJ/39-436--------------V..CVGMAMCFLSPAL-NAPD------------------------------EVYHWQRAV......
Q6AGK9_LEIXX/24-391--------------L..LVFGAWALSSPPG-SSPD------------------------------DDFHQTSIW......
A5UN71_METS3/84-467--------------I..LFGLLMVFFAPPM-SFPD------------------------------EAIHFARAE......
Q01XM3_SOLUE/38-442--------------L...MALAFAVVMPPF-QVPD------------------------------EDGHFIRAY......
Q83H24_TROWT/46-427--------------F..ISLAGWALSSPIG-SSPD------------------------------DDFHLASAW......
Q9CIZ8_LACLA/68-463--------------L..FLGIGISFIKPVQ-FGVD------------------------------EETHLRWTI......
Q2JAW9_FRASC/81-503--------------L..LLVAAWVATNPPG-FGPD------------------------------EPAHFVKAVGAGTGQ
Q0RGM1_FRAAA/18-412--------------L...LLAAWVGSNAPG-FGPD------------------------------EPANFVKEVGAGTGQ
A5G180_ACICJ/39-445--------------C....GLRLVYATPMG-EVAD------------------------------EPSHIARAA......
Q97N14_CLOAB/17-411--------------L..FFGVLFAVINAPF-QDPD------------------------------EPIHFYRAY......
A5UKJ8_METS3/70-455--------------I..IFGLLTVFASPLL-VAPD------------------------------EVEHFARSD......
Q9A0F5_STRP1/71-454--------------L..VFGTISAIISPIN-DIPD------------------------------EYVHYSRTV......

PF02364

FKS1_YEAST/808-1631-----------------FFPRDSEAERRIS-FFAQSLSTP---------IPEP.LPVDNMPTFTVLTPHYAERILLSLRE
G0WGB2_NAUDC/693-1553-----------------FFPAKSEAKRRIS-FFAQSLSTP---------ITEP.LLVESMPTFSVLIPHYGEKILLNLKE
BGS4_SCHPO/872-1706-----------------FFPANSEAERRLS-FFAQSLATP---------IPEP.VPVDNMPTFTVLIPHYAEKILLSLRE
A5DFP6_PICGU/617-1414-----------------YFPQLGEAKRRIS-YFAQSLSSP---------LCNADFTTDACPAFTVLIPHYSESILLSIEE
D8R536_SELML/856-1616-----------------.VPHNLEARRRIS-FFSNSLFMT---------MPRA.PQVEKMLSFSVLTPYYSESVLYTKNE
G3BF86_CANTC/689-1496-----------------YITMGKEAQRRIS-FFAQSLTSP---------ISEP.IPTTAIPSFTVLIPHYSEKILLSLKE
S2JMJ1_MUCC1/751-1581-----------------YYPQKSEAGRRMQ-FFAQSLTTP---------MPES.LPVPNMPTFTVMTPHYGEKIILSLRE
Q6C549_YARLI/838-1663-----------------FFPRNSEAERRIS-FFAQSLSTP---------IPEP.LPVDNMPTFSVLVPHYSEKILLSLRE
BGS2_SCHPO/844-1666-----------------YFPAHSEAERRLS-FFAQSLATP---------IPEP.IPVDAMPTFTVLVPHYGEKILLSLKE
C5DDB6_LACTC/685-1519-----------------FFPENSEAERRIS-FFAQSLSTP---------ISEP.IPVECMPTFTVLIPHYSEKILLSLKE
C5DVI4_ZYGRC/728-1590-----------------FFPSNSEAKRRIS-FFAQSLSTP---------ITEP.VPVECMPTFTVLVPHYSEKILLSLKE
G8BP05_TETPH/703-1537-----------------FFFSDSEAQRRIS-FFAQSLSTP---------ISEP.LPVECMPTFTVLVPHYSETILLSLQE
F4RFS0_MELLP/756-1575-----------------FFPPGSEAERRIS-FFAQSLTTS---------IPEP.LPVDAMPTFTVLTPHYSEKILLSLRE
A7TG32_VANPO/694-1542-----------------FFPIDSEAKRRIS-FFAQSLSTP---------ITEP.VPVECMPTFTVLIPHYSEKILLTLKE
B9RVZ7_RICCO/412-1177-----------------NIPKNVEAKRRLA-FFSNSLLMN---------MPRA.PKVEKMMAFSVLTPYNDEEVLYSRHQ
E6ZX94_SPORE/765-1584-----------------FFPKGSEAERRIS-FFAQSLTTA---------LPEP.LPIDAMPTFTVLVPHYSEKILLSLRE
F0XEB1_GROCL/867-1692-----------------FFPSYSEAERRIS-FFAQSLSTP---------IPEP.LPVDNMPTFTVFIPHYGEKILLSLRE
A3GFC1_PICST/627-1453-----------------FFYPKGEAERRIS-FFAQSLATP---------LLDP.YPTRALPSFTVLVPHYSEKIILGLKE
H2B091_KAZAF/695-1551-----------------FFPSNSEAKRRIS-FFAQSLSTP---------IAEP.IPVECMPTFTVLVPHYSEKILLSLRE
K0KXK3_WICCF/839-1738-----------------FFPPKSEAARRIS-FFAQSVSTP---------IPEP.TLVQSMPIFTVLIPHYGEKIILSLKE
G0VE27_NAUCC/691-1546-----------------FFPPNSEAERRIS-FFAQSLSTP---------VTEP.LLVESMPTFTVIVPHYNEKIILSLKE
M0Z2P0_HORVD/795-1572-----------------.VPKNLEARRRIA-FFSNSLFMN---------IPRA.TQVEKMMAFSVLTPYYNEEVLYNKDQ
Q5K6T7_CRYNJ/779-1594-----------------FFPKGSEAERRIC-FFAQSLTTS---------VPAP.IPVDAMPTFTVLVPHYSEKILLSLRE
I1MEJ0_SOYBN/899-1668-----------------NVPLNLEARRRIA-FFTNSLFMN---------IPRA.PYVEKMMAFSVLTPYYDEEVLYSKEA
Q75EM6_ASHGO/644-1429-----------------VFKKSAEARRRLG-FFSKSLSCP---------MPEP.YPTSEMPMFSVLIPHFKEKIILSIKD
A3GH41_PICST/602-1410-----------------.FYEQSEAQRRIT-FFAQSLSTP---------MPEV.NPINSMPTFSVLIPHYSEKITLSLRE
C5M4K6_CANTT/600-1409-----------------MFQDQSEAQRRIT-FFAQSLSTP---------MPEV.SPVHLMPSFTVLIPHYSEKITLSLRE
G3AGW3_SPAPN/626-1428-----------------FFTIGKECERRIT-FFAQSLSSP---------LPEP.FEVVAIPTFTVLIPHYNEKILINLEE
G8B602_CANPC/590-1379-----------------YIKIEEEWERRIT-FFAQSLSSP---------LPDP.FPVVSMPAFTVLIPHYSEKILLGLKD
L8WXK6_THACA/691-1484-----------------FLPPGSEAERRIS-FFAQSLTAS---------FPEP.ISVECMPTFTVLVPHYSEKILLSLRE
W1QEZ3_OGAPD/758-1567-----------------VLDPNSEASRRLT-FFAHSLSTP---------IPKP.LPIDQMPTFSVLIPHHSEKITLSLQE
S2JUI0_MUCC1/639-1467-----------------YFPQSGEAERRIH-FFAQSLTTP---------MPPP.HPVECMPTFTVLTPHYGEKILLSLRE
A9RK32_PHYPA/857-1633-----------------YVPKGLEARRRIS-FFSNSLFMT---------MPRA.PQVERMLAFSVLTPYYNEEVIFSKHQ
I1IFT6_BRADI/1065-1817-----------------.VPTNLDARRRIS-FFANSLFME---------MPRA.PKVRHMLPFSVLTPYYKEGVLFSSQA
Q6BYS5_DEBHA/725-1546-----------------FFTASKEAERRIS-FFAQSLSSP---------LPEP.FPILAIPAFTVLIPHYSEKIILSLRE
K4B948_SOLLC/878-1645-----------------.VPKNKEARRRIA-FFSNSLFMN---------MPRA.PQVEKMMAFSVLTPYYDEEVLFGKES
CALSB_ARATH/870-1637-----------------NVPKNIEARERLA-FFSNSLFMT---------MPQA.PSVEKMMAFSVLTPYYDEEVMYRQEM
K5X5R3_AGABU/768-1585-----------------FFPPGSEAERRIS-FFAQSLTIA---------IPEP.LPVHAMPTFTVLTPHYSEKTLLSLRE
Q6CDD3_YARLI/840-1684-----------------VFDSQTEGERRLS-FFAQSLATP---------IPDN.YVIDEMPTFTVLVPHYNEKILLSLKE
W1PHJ3_AMBTC/904-1670-----------------.IPRNLEARRRIA-FFSNSLFMN---------MPRA.PQVERMLAFSVLTPYYDEDVIYNKEQ
A5DBZ8_PICGU/697-1497-----------------.FDGHSEAERRIT-FFAQSLSTP---------MRPA.NNVESTPSFCCLVPHFEEKTILSLKE
J7RLI4_KAZNA/694-1544-----------------FFSANSEAQRRIS-FFAQSLSTP---------IAEP.TPVECMPTFTVLVPHYAEKIMLELRE
B9I122_POPTR/880-1647-----------------.VPKNIEARRRIA-FFSNSVFMN---------MPHA.PNVEKMMAFSVLTPYYEEDVCFGKQD
Q4WLT4_ASPFU/845-1663-----------------FFPPGSEAERRIS-FFAQSLSTP---------MPEP.LPVDNMPTFTVLIPHYSEKILLSLRE
K2RW51_MACPH/795-1619-----------------YFPPNGEAQRRIS-FFGQSLSTP---------IPEP.VPVDNMPTFTVMVPHYGEKVLLSLRE
FKS3_YEAST/694-1542-----------------FFPSNSEAKRRIS-FFAQSLATP---------ISEP.VPVDCMPTFTVLVPHYSEKILLGLKE
B6K1V9_SCHJY/528-1348-----------------LFPPNSEAARRIS-FFAQSLAQV---------VPKP.CTVDAMPTFTVLVPHYGEKVLLSLRE
C4R051_KOMPG/700-1508-----------------LFKGHKEAERRIT-FFAQTLSTP---------IPES.IGIEKMPSFSVLIPHYAEKISLSLRE
F8QGW8_SERL3/687-1503-----------------FFPAGGEAERRIS-FFASSLTTA---------LPEP.LPVDAMPTFTVLVPHYSEKILLSLRE
Q5A9Y9_CANAL/588-1367-----------------FIKIEKEWERRIT-FFAQSLSSP---------LPEP.FPVVSTPTFTVLIPHYSEKILLSLQD
CALSC_ARATH/876-1645-----------------SVPVNLEARRRIA-FFSNSLFMN---------MPHA.PQVEKMMAFSVLTPYYSEEVVYSKEQ
A9TZ19_PHYPA/865-1623-----------------.VPKGLEARRRIS-FFSNSLFMT---------MPRA.PQVDRMLAFSVLTPYYTEEVIFSSKQ
W1QB78_OGAPD/694-1512-----------------FFVPNSEAERRIS-FFAQSLSTP---------IPEP.IPVEAMPTFTVLIPHYSEKILLGLKE
G8Y1P4_PICSO/734-1542-----------------LFYEQSEAQRRIT-FFAQSLSTP---------MPEI.GSTNSMPSFTVLIPHYSEKITLSLRE
M7P3D9_PNEMU/884-1710-----------------FFPSHSEAERRIS-FFAQSLSTP---------IPEP.LPVDNMPTFTVLVPHYGEKILYSLRE
Q751P2_ASHGO/697-1537-----------------FFPRNSEAQRRLS-FFAQSLSTP---------IIDP.IPVECMPTFTVLIPHYAEKLMLKLKE
C4QVL3_KOMPG/679-1490-----------------.....SEAERRVS-FFAQSLSTP---------LPEP.VSTQAMPIFTVLVPHYGEKILFSLKE
G8ZYC9_TORDC/696-1542-----------------FFPKNSEAKRRIS-FFAQSLSTP---------INEP.VPVECMPTFTVLIPHYSEKILLTLKE
K7M2P2_SOYBN/849-1612-----------------.IPVNLEARRRIS-FFTNSLFMN---------MPHA.PQVEKMMAFSVLTPYYSEEVVYSKEQ
Q6FIJ9_CANGA/752-1597-----------------FFPSNSEAKRRIS-FFAQSLSTP---------LLDP.VPVECMPTFTVLIPHYTEKILLGLRE
S9X5V3_SCHCR/777-1593-----------------YFLATSEAERRIS-FFSQSLAAN---------LPEA.MPVPKMPSFTVLVPHYSEKILLSLRE
B6K096_SCHJY/781-1599-----------------YFPKNSEAERRIS-FFAQSLSCR---------MPAT.TSVAEMPTFTVLIPHYGEKILLSLRE
C7ZN13_NECH7/785-1607-----------------YFPKNGEAERRIS-FFAQSLSTP---------IPEP.MPVDSMPTFTVMIPHYSEKILFSLRE
G8JPJ3_ERECY/666-1455-----------------.FGKSAEAKRRLG-FFAKSLSCP---------IPDL.VPISEMPMFTVLIPHFKEKIILSIKD
Q6CTB0_KLULA/691-1518-----------------FFPRNSEARRRIS-FFAQSLSTP---------ITEP.IPVECMPTFTVLIPHYAEKILLSLRE
G3BBN7_CANTC/598-1405-----------------.FYGQSEAQRRIT-FFAQSLSTP---------MREI.GPTGSMPSFTVLVPHYKEKITLSLRE
G8YKZ4_PICSO/698-1523-----------------FFTTSKEAERRIS-FFAQSLSCP---------LPEP.IPIMALPSFTVLVPHYSEKIILNLKE
I1HRP2_BRADI/889-1659-----------------.VPKNPEARRRIT-FFSNSLFMN---------MPRA.PPVEKMVAFSVLTPYYNEDVLYSKDQ

PF04602

V9XJW7_9NOCA/21-675RTARIVAIVSG...LLGFVLALTLPFLPVR-QETGELEWPQNGS.....IDSVEAPLVTYAPLTLRVSVPCAAA------
H6MU20_GORPV/33-681RTWSIVAVVAG...LVAVVAAVLTPFLPVT-AHTATITWPQPQ......SLSVTAPLVAQTPSNLDVTVDCRVL------
Q5Z3F6_NOCFA/13-659..YRLIALVSG...LLGFVLALLSPLLPVR-QDRATLDWPQPDT......ASVTAPLVSYVPLRLDASLPCSVL------
W5T763_9NOCA/25-694RTARLIAVITG...VLGALFAIATPFLPVQ-QTTAEVNWPQSGT.....VGNVEAPLMSQVPVDLRASIPCSAI------
D0LC62_GORB4/25-672RWVKIAAVVTG...LLGFLAAVLTPLLPVN-QTTAELRWPQGDT.....VSDVAAPLVSYVPIDMDMTVPCVLA------
F5YU82_MYCSD/4-645RTTRLVAIIAG...LVGFLLSVATPLLPVV-QTTATLNWPQHGE.....LHSVTAPLISQTPISMSVKAPCALV------
A4FLJ6_SACEN/6-630RRARLRAVLAGGSAAVALLCAVAFPFAPVH-QPVISYHWPGE.......PGASAVPLMPYQPVSLRASWSCAAI------
EMBB_MYCLE/22-673RVARWVAAIAG...LIGFVSSVVTPLLPVV-QTTATLNWPQNGQ.....LNSVTAPLISLTPVDITATVPCAVV------
E9T230_RHOHA/21-668RTARLVAIVTG...LLGAILALATPFLPVQ-QDAASISWPQNGS.....LTNVEAPLVSYTPQQLHVSIPCTAV------
A4F676_SACEN/36-675..LKLFAAITG...LLGTVLALALPFLPVN-HEVTTLKWPTAQG.....TKPVSAPLVSFSPVWLNANVSCETA------
D6ZA32_SEGRD/18-683..ARAVALIAG...VLAVLGAIAVPFLPVK-ERTAELQWPSRV......VGNTNAPLVSYFPESFDLSVPCRAV------
EMBC_MYCTU/27-682RIARYVAVVAG...LLGAVLAIATPLLPVN-QTTAQLNWPQNGT.....FASVEAPLIGYVATDLNITVPCQAA------
W5T6N4_9NOCA/11-663..IRLAALLSG...LIAVVLAVLTPLLPVR-EDRTSLDWPQPQS......VPVTAPLVSYVPLQLDASVPCAAF------
B1VE75_CORU7/37-709SRITTLAIVSG...LLGFLLFIATPFLPVN-QQQSSFSWPQNGD.....LSSVTAPLISYSPESLDLSIPLSEV------
W5WNE4_9CORY/27-693RRIKLISIISG...FLGFFLFLSIPFLPVK-QEQASFSWPQGGD.....LTSVTAPLMSYVPQDLDISLPIEET------
V9XEG0_9NOCA/30-675..TRLWAVLAA...VVGIVASIAMPFLPVT-QTTATIDWPQSES.....NAGISAPLVSYAPVDLDATIECRSV------
B1MEM1_MYCA9/17-667NIARWTATVFG...LLGFVLSVSIPLLPVK-VSTATLDWPQQGR.....LNNVTAPLISQTPMDMTVIVPCAVV------
F8DYG1_CORRG/20-684..LKLVSIVSG...LVGLLLFLSLPFLPVK-QESAEFNWPQGGD.....LRSVTAPLISYVPQDLDITLPLQEA------
U3GXX2_9CORY/12-670.GIQLAAIISG...IAGFILFVLTPFMPVN-QVQSEVSWPQEE......VGSLTSPLISYAPVTWSADIPLRDV------
A1TGU6_MYCVP/6-653..ARLVAVIAG...LLGMLLCGLAPLLPVK-QSTATITWPQSVNAEGF.VSDITAPLVSGAPHALDVTIPCPAV------
F6EEB9_HOYSD/14-665RVARIVALLTG...LAGFLLAVATPLLPVH-QTTTTISWPQDDQ.....ATSIEAPLISYLPVEVSATIPCAVF------
Q5YYW4_NOCFA/29-683.WARPVALLAA...LIGALCAVAVPLLPVR-VDAATLTWPQNGA.....PDSVEAPLIGYAPLTFDATVPCAAI------
D5UMC1_TSUPD/6-651RTARIVAVVTG...LVGLLLALATPLLPIK-QTAVTIDWPQAGS.....PASVTAPLTMYKPLDMQATVPCALI------
Q745M3_MYCPA/11-658RVTRWVATIAG...LIGFVLSVATPLLPVV-QTTATLNWPQGGQ.....LNSVTAPLISLTPVDLTATVPCSSV------
V9XIW6_9NOCA/28-673RTARLVAVVAG...LLGMILALATPFLPVR-VTEATMSWPQDAA.....ATDVELPLMSQVPLQLRATVPCSAV------
J9S8T7_9ACTN/54-705GTARVVAMAAG...VVGILLALLSPFLPVD-YTKAELTWPQQGS.....VGNVAAPNVSFVPVSMDVAVPCALG------
C4LG43_CORK4/44-710RRTKIVAAVTG...IAAFLLFILTPLLPVK-QTQSSIDWPQNDN.....INSVVAPLISYSPESLDFTVPLSLA------
A0R614_MYCS2/24-675RIARWVATIAG...LLGFVLSVSIPLLPVT-QTTATLNWPQQGR.....LDNVTAPLISQAPLELTATVPCSVV------
C0ZLV7_RHOE4/28-666RTARLIAIVTG...LLGLLLALATPFLPVK-QEAASIDWPQGGT.....VNSVSSPLISYSPTSLDISIPCSTL------
V5X6X3_MYCNE/4-651RTIRLVAIIAG...LVGMVLCALAPLLPVR-QSTATIQWPQTAGAEGF.ISDVTAPLVSGAPRELDVTIPCQAI------
H6MU24_GORPV/10-674..AKLVAIITG...LLGLFLALATPFMPVN-QTTAQITWPQDGQ.....INSVTAPLISYVPIDLDVSVPCSAV------
W5XXY2_9CORY/8-674TTLVRVALISG...LIGMFLFILTPFMPVN-QVQSSLSWPQNGS.....LQSVNAPLESYTPVSMDVAIPLAAL------
H6RD31_NOCCG/25-671..ARPVAIVAA...LIGALCALAVPFLPVR-MDAATITWPQDDA.....ARSVAAPLVSYAPIGLTAEVPCAAI------
H5X1D6_9PSEU/4-623..HRWVIAGLG...TLSALTAVLFVLAPVE-QDVTTYEWPSGPD.....TSSTALPLFPYEPDRMDVTVRCADV------
D5UNZ8_TSUPD/31-682TVARLIAVAAG...VLGLLLCLLTPLLPVK-QSTAGLDWPQAGPGAT..SVDITASLVTQSPATLTVTVPCRVL------
D5UNZ7_TSUPD/12-675RRTAWTAAVTG...VLGVLFAVLTPFMPVN-QSTAALDWPQRGS.....LESVTAPLVSYVPDRIDIAVPCTAV------
W5TDC8_9NOCA/23-685RWAQPIALIAG...LLGALCAIAVPLLPVQ-VDRTTLSWPQQGS.....VRGIDAPLVSYAPLTFDATVPCAAV------
Q745M2_MYCPA/11-679RIPRSVAAVAG...IAGLLLCLAVPLLPVR-QTTATVLWPQGTV.DGH.VSQITAPLVSGAPRALDISIPCPAV------
F6EEB8_HOYSD/16-671RAARIVALLTG...LAGFLLAVATPLLPVH-QTTTTISWPQDDQ.....ATSIEAPLISYLPVEVSATIPCAVF------
D0LC64_GORB4/31-681RRWALAAVFGG...IVAVIAAILTPLLPVT-EHTARIDWPQAT......GTAVTASLAAQTPAGLDIAVPCSTL------
D5UNZ9_TSUPD/37-686..WRIVAAVAG...LLGFVLAILTPFLPVK-ETTASVNWPQNGK.....VANVDAPLVSYVPIRLDVTLPCSLV------
E9T231_RHOHA/29-674RNARLIAVVTG...LVGLLLALATPFLPVT-QTAASVSWPENGV.....AANVEAPLMSQVPTSLSATIPCRAV------
L0J7Q5_9MYCO/5-653KVARWTATIAG...LIGFILSVATPLLPVV-QTTATLNWPQGAQ.....LNNVTAPLISQVPVTMTVTVPCDVI------
K0ELF6_9NOCA/24-672RRLRLFAIVSG...LIAVLAAVSLPFLPVQ-QDQASVSWPQAAA.....VTSVTAPLITYAPMDLSAEIPCAAF------
H6MU21_GORPV/21-696RIARIVAVVAG...LIGIVLALAMAVLPVT-YTKVQIKWPQPTSQNASGVENILAPNVSYTPTNLDLSVPCRLA------
L0J471_9MYCO/5-652RIARLIAVIAG...VAGVVLCGLVPLLPVT-QTTATIAWPQAPGPDGL.VTDITAPLVSGAPQALDVSIPCRTI------
D7WBK3_9CORY/39-680RNLALTAMMSG...LLAFIFFALLPFLPVK-QVQSSFDWPQNGS.....LNSVNAPLISLAPESLELTIPISVL------
C1A0M7_RHOE4/26-667..ARIVAIVAS...ILGIVLCGSVPFLPIE-QDTAVVNWPQAGS.....TKSVEAPLVSYTPLRMEASIPCASI------
Q6NK78_CORDI/12-664..IKWAAILSG...VIGFVLFIITPLMPVN-QVQSSVSWPQNGS.....LNSVSAPLMSYTPISFDAKIPVASV------
D6ZD22_SEGRD/22-677..WRLVAVVAG...LIAFVCAVLSPILPLN-QKTVTIDWPQNGT.....LGSVTAPLDSFVAESMRAEVPCSLA------
H6R7H1_NOCCG/16-659RTARLIALVAG...VLGALFALATPFLPVT-QTTATLSWPQHGS.....LDNVQAPLMSQVPIELRATIPCAAV------
G8RNM8_MYCRN/11-660GSARLIAVVAG...IAGLLLCGLVPLLPVQ-QTTATILWPQASGPDGL.ITDITAPLVSGAPLALDLSIPCQAI------
A0R613_MYCS2/6-652RIARLIAVVAG...IAGVLLCGLVPLLPVE-ETTATVLWPQGVGADGN.VTELTAPLVAGAPRALDVTIPCRAV------
EMBA_MYCLE/11-678RIIRLIAVGAG...ITGLLLCAVVPLLPVK-QTTATIRWPQSATRDGW.VTQITAPLVSGTPRALDISIPCSAM------
B1MEM2_MYCA9/16-665R.ARLISLAAA...TIGVLLCVLVPLLPVR-QSTVDINWPQGAGADGN.ITGITAPLVSGAPLSFEAHIPCTAV------
Q0S9C1_RHOJR/40-687RTARLIAIVTG...LIGFVLAVATPFMPVQ-QTTAAVNWPENGV.....VGDLEAPLMSQVPVDLSAAIPCSAV------
E9SYL2_RHOHA/31-680RRARLIAIVAG...VLGVLSAVAVPLLPVN-QEQSTLSWPQGGS.....TGSVEAPLVSYAPFTFDARIPCATA------
D0LC65_GORB4/7-654RIAKLVAVIAG...AIGVLLALAAPFLPVT-YTKAELNWPQQGS.....VQNVAAPNVSYVPVSVDIAVPCTLA------
J9S5V1_9ACTN/37-692RTVALVAAVAG...VVAVVAGVLTPFLPVS-TSTASITWPQQTGE....SASVTAPLVAQTARDLAISIPCRVL------
W5TPG9_9NOCA/25-684..VRPLALIAG...LIGALCAIAVPLLPVK-VDHTTLSWPQQDS.....ARSVNAPLVTYSPLTFDATIPGRAM------
Q0SFU9_RHOJR/35-682RSTRLLAIIAS...VFGVLLTLSLPFLPVE-QDNATLSWPQNGS.....TGSVEAPLVTYAPLSLDVRIPCSAV------
D0LC63_GORB4/10-666..ARLVAIVAG...VLGVVLCALTPLLPVK-ATDATFDWPQDQPLSAQ.TSSVTAPLIAQTPRSLDIRIPCATL------
C3PJ41_CORA7/15-655..LRLTAIIAG...FIGFLCFVATPLLPVN-QTQSSFDWPQQGS.....LQSINAPLISVAPEEIDAEIPLEAV------
A0R612_MYCS2/13-668RTARLVAIIAG...LLGTLMAIATPLLPVE-QTTAELNWPQNGV.....WQSVDAPLIGYVATDLTVTVPCQAA------
Q0S9C0_RHOJR/14-655RTSRLIAIVTG...LIGFVLALATPFLPVK-QDAASIDWPQDGT.....LNSVEAPLVSYTPLDMQVTVPCSVF------
B1MEM5_MYCA9/31-682RKARLLAIVTG...FLGALLAIATPLLPVR-QDTAQLNWPQNNT.....LASVDAPLIGYVPTDLTITVPCAAA------
D0LC66_GORB4/32-701RRAKLVAIIAG...LAGLFLALATPLMPVK-QTTAEITWPQQNA.....ISSVAAPLISYVPIDLDISIPCTAV------

PF04188

GPI18_YEAST/2-433--------------IVG..LTLYFVLFRSI-QYLLVFLT--------------------------PIRQFDTST------
PIGV_HUMAN/8-493--------------RKE..VLRFAVSCRIL-TLMLQALF--------------------------N.AIIPDHH------
Q6NKT6_ARATH/13-489--------------.KETILIKYAIFSRLL-VLFLTILW--------------------------RSLLQPYDT------

PF05208

M4B3B6_HYAAE/47-400-----------------WLLLLLEAGVGYM.IIQKVP......YTE-------I---DWS-TYMQQVEL.FKH.------
ALG3_SCHPO/28-384-----------------SRLLLLEIPFVFA.IISKVP......YTE-------I---DWI-AYMEQVNS.FLL.------
C1N7Z4_MICPC/3-383-----------------RVLVVLDALLSVA.IVRRVA......YTN-------I---DWN-AYMGEARG.YAS.------
G3B1L9_CANTC/44-430-----------------.IIAIVTSIGTKV.IIAKVP......YTE-------I---DFN-TYMQQIEV.VND.------
H2B2E5_KAZAF/49-418-----------------PTLLFMESAALKI.IIKNVA......YTE-------I---DYK-AYMEQIET.IVYY------
K7J227_NASVI/23-385-----------------VLFIILEVVINIV.VIEKVP......YTE-------I---DWK-AYMQEVEG.VLN.------
S8AK53_DACHA/26-392-----------------YALLCFDGILSYA.ILRMIP......YTE-------I---DWE-AYMEQVGQ.YRA.------
D2A6B4_TRICA/38-438-----------------FLLFLFEIILNIF.IIERVN......YTE-------I---DWK-AYMQEVEG.FMN.------
E9IW57_SOLIN/49-411-----------------KLFIVLEIVLNVV.VIQTVP......YTE-------I---DWR-AYMQEVEG.FLN.------
N1PIB4_DOTSN/28-383-----------------......DAVLCVL.IIYTIP......YTE-------I---DWH-TYMQQIHL.YTL.------
E3LRP4_CAERE/25-392-----------------AILMIIEACLSHI.VILKVK......YTE-------I---DWS-TYMQQVEC.YVNK------
M0RYH3_MUSAM/65-429-----------------SALLVLDSILVAL.IIAYVP......YTK-------I---DWD-AYMTQVDG.FLG.------
C8VQM2_EMENI/22-377-----------------PILNIADGLLCAF.IIWKVP......YTE-------I---DWT-TYMQQVKL.YLS.------
E3QV49_COLGM/32-397-----------------PLLLVLDAVLCGL.IIWKVP......YTE-------I---DWV-AYMEQVSQ.FVS.------
B2AMZ6_PODAN/32-391-----------------PALFLADAVLCAL.VIRLIP......YTE-------I---DWK-AYMEQVSQ.FVS.------
Q5TWR0_ANOGA/52-490-----------------ILILAAELVLNVF.VVQNVR......YTE-------I---DWK-AYMQECEG.FLN.------
M3JDA4_CANMX/610-996-----------------.VIVCLASILTKI.IISKVP......YTE-------I---DFK-TYMQQIEL.INQ.------
K0KP51_WICCF/61-446-----------------PILLVVESIAVKL.IKGFIS......YTE-------I---DYT-AYMEQVTI.INS.------
X6LVN7_RETFI/23-432-----------------CAVVLFELTVSLA.ITKVVA......YTE-------I---DWI-AYMQEVRG.FLQ.------
N1JDU5_BLUG1/30-393-----------------PVLILADALLCGL.IISHTA......YTE-------I---DWK-AYMEQVEQ.IVQ.------
K5XHY8_AGABU/29-387-----------------SFVLIGDVVLTEI.IIKFIS......YTE-------I---DWE-TYMIQTEL.YIK.------
C5M8N0_CANTT/50-438-----------------.IIICIASILTKI.VINKIP......YTE-------I---DFK-TYMQQIEL.INK.------
H3ATY3_LATCH/48-407-----------------AGLWLAEIGINVW.AIHRVA......YTE-------I---DWK-AYMDEVEG.VIN.------
C5DQX2_ZYGRC/29-403-----------------PMLLAFESALLKL.IIWKVP......YTE-------I---DYK-AYMEQIDI.IKS.------
T1KW27_TETUR/32-391-----------------ALLIIFEIFLNVY.IVQRIK......YTE-------I---DWS-TYMQQVKC.FLN.------
E5QCI3_CAEEL/25-392-----------------ALLMIAEAVLSHL.VILKVN......YTE-------I---DWS-TYMQQVEC.YVNK------
A4S939_OSTLU/24-393-----------------VALIAFELALCAV.IIAKVA......YTE-------I---DWI-AYMEEVHG.YAR.------
A4HP72_LEIBR/7-391-----------------..ALAAETVVIII.VILVVP......YTE-------I---DWR-AYMEEVEG.FLN.------
K1XMH6_MARBU/34-397-----------------SLLLLTDALLTSL.IIWKVP......YTE-------I---DWS-TYMQQVEL.YIK.------
B4NMK9_DROWI/51-467-----------------ILIVLAEAVINLV.VINRVP......YTE-------I---DWI-AYMQECEG.FIN.------
U7Q833_SPOS1/49-412-----------------.GLFALDAVLCAL.VIWKVP......YTE-------I---DWI-AYMEQIGQ.FVA.------
E3JZB5_PUCGT/28-389-----------------.LVLLSELVLNTA.IIKYVR......YTE-------I---DWI-AYMQQIRS.YSL.------
B6Q4R6_TALMQ/22-377-----------------PLLVLVDAVLSAL.IIKKVS......YTE-------I---DWT-TYMQQIAL.YQA.------
ALG3_ASPCL/84-439-----------------PLLILGDAVLCAL.IIWRVP......YTE-------I---DWT-TYMQQVSL.YLS.------
S3EFY4_GLAL2/34-397-----------------PLLLLFDALLTSA.IIYKVS......YTE-------I---DWK-AYMEQIQQ.YVD.------
F1P0T5_CHICK/46-406-----------------ACLCLAEGGVNLW.VIRRVP......YTE-------I---DWQ-AYMQEVEG.FAN.------
G8JVY1_ERECY/53-420-----------------IVLFLFELVLVHL.IIRFIP......YTE-------I---DYL-AYMEQIWT.IKN.------
J7RGJ6_KAZNA/49-415-----------------PILLLGESMALKF.ITKQIP......YTE-------I---DYE-AYMEQIDM.IVKD------
F9XK44_ZYMTI/23-383-----------------.LQLLADAVLCGA.VILKIP......YTE-------I---DWS-TYMQQIEL.YLS.------
R4X949_TAPDE/11-374-----------------..LLALDAILCAL.IILRVN......YTE-------I---DWT-AYMQQVAQ.FLG.------
I2FPC0_USTH4/26-382-----------------.ALAIVSAALSQV.VLRRIS......FTE-------I---DFQ-TYVGQAAL.FLQ.------
ALG3_KLULA/54-427-----------------PVLILLESIAMKF.IQNKVS......YTE-------I---DYT-AYMEQIWM.IQN.------
G3PQJ8_GASAC/14-373-----------------SVLWFMEIGINVW.VIQKVA......YTE-------I---DWK-AYMDEVEG.VIN.------
K4CV67_SOLLC/31-394-----------------IAILIADAILVAL.IIAYVP......YTK-------I---DWD-AYMSQVTG.FLE.------
M1VU16_CLAP2/32-396-----------------WALWLGDAVLCSL.IIWKIP......YTE-------I---DWT-AYMQQVAQ.FVE.------
U5HGX6_USTV1/69-433-----------------GLLFVFDVALLTL.IIRFIP......YTE-------I---DFS-TYMQQSSL.FIG.------
K9G3P7_PEND2/24-384-----------------PLLILGDALLCAL.VIWKIACKIASRYTE-------I---DWS-TYMQQVSL.FIS.------
T1IB96_RHOPR/32-396-----------------ILLLIGELVLSVL.IVQNVK......YTE-------I---DWV-AYMQEVEG.FLN.------
B6K873_SCHJY/24-379-----------------.SVLLAEFPLVMA.IIARVP......YTE-------I---DWT-AYMEQVQL.FLS.------
ALG3_DEBHA/45-438-----------------PVVIVLTSLLSKA.IIYKVP......YTE-------I---DFR-TYIQQIQI.IND.------
B4KQ14_DROMO/49-491-----------------LLIVLAEAVINVL.VIQHVP......YTE-------I---DWV-AYMQECEG.FLN.------
E9FQN9_DAPPU/50-398-----------------ILLLVGELFVNVL.VIQRVP......YTE-------I---DWI-AYMQEVEG.VVN.------
ALG3_PICST/52-442-----------------PVIILLTSIITKV.IITKVP......YTE-------I---DFV-TYMQQIQL.VNQ.------
S2JIL9_MUCC1/51-411-----------------.LFLFGEFVLSTL.IILKVP......YTE-------I---DWI-AYMQEVEG.FIL.------
T1FMM7_HELRO/35-390-----------------VLFFFLEIFVNVF.VIHNIK......YTE-------I---DWK-AYMQEVEG.VIN.------
B7QF54_IXOSC/55-405-----------------PFLLIMEFVLNIV.VIDKVP......YTE-------I---DWK-AYMQEVEG.VLN.------
V5GAA3_BYSSN/22-377-----------------PLLWVADAFLCAL.IIWKIP......YTE-------I---DWT-TYMQQVSL.FLD.------
D7FLD1_ECTSI/36-398-----------------...VLAEIALCGI.IIARIA......YTE-------I---DWV-AYMQEVKG.FLD.------
E7K994_YEASA/48-417-----------------PLLILFESMLCKI.IIKKVA......YTE-------I---DYK-AYMEQIEM.IQLD------
G8BZ82_TETPH/53-422-----------------FLLIMFESMALKI.IVSKIA......YTE-------I---DYK-AYVEQIEM.IND.------
C5GLF5_AJEDR/22-377-----------------PLLLLAELFLCTV.IVWKVP......YTE-------I---DWS-TYMQQVSL.FLS.------
J3K1V3_COCIM/22-377-----------------PLLLLAESVLCSL.IVWKIP......YTE-------I---DWS-TYMQQVSI.FLS.------
Q4E4B0_TRYCC/8-370-----------------.ALLAAEVLISLI.VVLFVP......YTE-------I---DWN-AYMQEVKG.FLE.------
Q4Q1L8_LEIMA/8-391-----------------...LAAEAVVIIT.VILTVP......YTE-------I---DWK-AYMEEVEG.FLA.------
G4VF09_SCHMA/25-373-----------------PVLIILEILCGFI.IIDKVP......FTE-------I---DWV-AYMQQVSG.FIN.------
G0VFQ4_NAUCC/49-421-----------------PILLLLESIALKV.IVKRVA......YTE-------I---DYR-AYMEQVEM.ITDE------
ALG3_PICGU/60-451-----------------PILVVFTSIACKI.VIANVK......YTE-------I---DFK-TYMQQIDM.IND.------
D6RKR7_COPC7/33-391-----------------TLVILGDAFLTRL.IVAYVP......YTE-------I---DWE-TYMVQTNV.FLK.------
C7Z6Q8_NECH7/32-396-----------------VALWLADAVLCGL.IIWKIP......YTE-------I---DWV-AYMEQVSQ.FVS.------
F2U0U1_SALR5/24-375-----------------TLVFAAEIALLWA.IIHFVS......YTE-------I---DWK-AYMDEVEG.FLN.------
Q59QZ3_CANAL/67-487-----------------PIIICLSSILTKI.VINKIS......YTE-------I---DFI-TYMQQIKL.INQ.------
K3XI42_SETIT/33-396-----------------AFLVLADAALVAL.IIAFVP......YTK-------I---DWD-AYMSQVDT.FLE.------
C1E6U6_MICCC/1-365-----------------..LLLGECVLCGL.IVWKVP......YTE-------I---DWR-AYMDEVGG.YLG.------
M7UJ49_BOTF1/42-405-----------------ALILLFESFLCSA.IIYFIP......YTE-------I---DWK-AYMEQISQ.YAS.------
H9GEH2_ANOCA/2-363-----------------..LCLSQLLLAFSSCIHHIQ......NTE-------I---DWK-AYMDEVEG.VVN.------
F4PBM6_BATDJ/69-446-----------------.SLLVGEALLTMA.IIARVK......YTE-------I---DWQ-TYMQQVSS.FMD.------
ALG3_ASHGO/46-411-----------------PVLVAWECVLLKL.IVKHVP......YTE-------I---DYL-AYMEQIWQ.INN.------
ALG3_NEUCR/38-404-----------------PALFLVDALLCGL.IIWKVP......YTE-------I---DWA-AYMEQVSQ.ILS.------
W5JA52_ANODA/54-487-----------------VIILAIDFVLNVL.IVQNVP......YTE-------I---DWK-AYMQECEG.FLN.------
G2QLH4_MYCTT/46-410-----------------PLVFLADALLCAL.IIWKVP......YTE-------I---DWN-AYMEQVAQ.ILS.------
E0VE58_PEDHC/46-408-----------------CFLLLAEIFINFF.IVNYIN......YTE-------I---DWK-AYMQEVEG.FLN.------
L8G9R9_PSED2/26-389-----------------PILLVVDALLCLV.IIWKVP......YTE-------I---DWE-AYMQQVAQ.FLS.------
I3N142_ICTTR/47-406-----------------SCLCLAEVGITFW.VIHRVA......YTE-------I---DWK-AYMAQVEG.VIN.------
B0D3E3_LACBS/29-387-----------------SLVIIGDVILTEL.VIRFIP......YTE-------I---DWE-TYMIQTEL.YIN.------
G6D7P8_DANPL/38-461-----------------FLILIAELIINIL.VVERVP......YTE-------I---DWK-AYMQECEG.FLN.------
A0A0D2U908_CAPO3/41-396-----------------GLLLLAEIAINAL.IIWRVP......YTE-------I---DWK-AYMDEVKG.AID.------
B4MDV8_DROVI/49-475-----------------VLIVLAEAVINVL.VIQRVP......YTE-------I---DWQ-AYMQECEG.FLN.------
S9XFL7_SCHCR/33-388-----------------.RILWLEIPFVIL.IISNVP......YTE-------I---DWI-AYMEQISG.FLS.------
G3AUB5_SPAPN/46-435-----------------.IIVSLSSVVVKL.IIANVN......YTE-------I---DFS-TYMQQIRL.VNE.------
R9P1A8_PSEHS/26-382-----------------.TLVISSAVLSET.IIRRIS......FTE-------I---DFQ-TYLGQAAL.FLD.------
T5AE24_OPHSC/31-395-----------------PALWLVDAALCCL.VIWKVQ......YTE-------I---DWV-AYMEQVAQ.FVS.------
V5ENX1_KALBG/26-382-----------------.ALTISTLALSQA.VIRRIS......FTE-------I---DFQ-TYIAQAAL.FLD.------
G0RBH9_HYPJQ/25-389-----------------.GLWLADAVLCGL.IIWKVP......YTE-------I---DWV-AYMEQVTQ.FVH.------
A7TI38_VANPO/47-414-----------------PLLLMLESAALKL.IIAKVQ......YTE-------I---DYT-AYMEQIDM.IKN.------
S7ZPA3_PENO1/24-378-----------------SLLFLGDAALCAL.VIWKIA......YTE-------I---DWT-TYMQQISI.YLA.------
I4Y5F8_WALMC/28-386-----------------..VIALESILTPL.IVKYVP......YTE-------I---DWK-AYMQQVKM.FRE.------
M9LSR1_PSEA3/61-417-----------------.ALAIASAVLSQA.VVRRIS......FTE-------I---DFQ-TYIAQASL.FLK.------
G3J6N9_CORMM/40-406-----------------VALWLADAVLTCL.IIWKIP......YTE-------I---DWV-AYMEQITQ.FVH.------
G0SZN6_RHOT2/81-458-----------------TAVLLWESVLSVG.VVNYIK......YTE-------I---DFS-TYMQQAQA.FLD.------
E3RP57_PYRTT/27-387-----------------PLLLIADAALCGV.VIEKIP......YTE-------I---DWS-TYMQQIAI.FLK.------
H2YCK3_CIOSA/39-392-----------------.LMWSVEVVLNLY.VINRVK......FTE-------I---DWK-AYMQEVEG.FIN.------
ALG3_KOMPG/40-432-----------------PLLWLADSIVIKV.IIGTVS......YTD-------I---DFS-SYMQQIFK.IRQ.------
I1NB48_SOYBN/44-418-----------------LALLFADAVLVSL.IIAFVP......YTK-------I---DWD-AYMSQITG.FLG.------
V2XSY5_MONRO/23-381-----------------LLVVVGDAILTEG.IVKFVP......YTE-------I---DWE-TYIIQVQQ.FLK.------
S3D164_OPHP1/66-445-----------------PALLILDAVLCVY.ILSQVP......YTE-------I---DWV-AYMEQVAQ.FVG.------
D8PWW0_SCHCM/28-385-----------------FLALLGDAVLTQL.IIRFVP......YTE-------I---DWD-TYMRQVKI.YIE.------
G4MX55_MAGO7/32-396-----------------PMLLAFDGLLCGL.IIKKVP......YTE-------I---DWT-TYMQQIKQ.YVT.------
ALG3_CANGA/46-411-----------------PLMFLLESVLLKY.VIAAIP......YTE-------I---DYK-AYMEQVEM.IYEE------
U9SRB0_RHIID/43-401-----------------SCILIGEALLNIL.IIKYVS......YTE-------I---DWK-AYMQEVSG.FLN.------
A9S9E9_PHYPA/15-380-----------------..LLVLDALLTAV.IIARVP......YTK-------I---DWD-AYMSQVTG.FLA.------
A0A0D1DTA4_USTMA/26-382-----------------.ALTIVSAVLSEA.VIRRVS......FTE-------I---DFQ-TYLGQAAL.YLD.------
R9A916_WALI9/668-1026-----------------..VIALEVLLTHF.IIQFVP......YTE-------I---DWK-AYMQQAKM.FKE.------
A8WH14_XENTR/49-408-----------------VFLCLAEVGVTHW.VIQRVP......YTE-------I---DWK-AYMDEVEG.VLN.------
F0X8A8_GROCL/32-398-----------------VALLALDAVLCCL.IIWKIP......YTE-------I---DWV-AYMEQVGQ.FVA.------
G0WBV5_NAUDC/62-452-----------------PILLLIESIVLKY.IIFKIP......YTE-------I---DYK-AYMEQIEM.ITYD------
E4ZQ47_LEPMJ/110-470-----------------PLLLVADAALCGV.IIDRIP......YTE-------I---DWS-TYMQQIAV.YLK.------
W1QI94_OGAPD/44-429-----------------VLLTVAESLLLKA.VIHFVP......YTE-------I---DYS-TYMQQIDQ.IEA.------
Q17I48_AEDAE/60-492-----------------WLILAAELVLNVF.VVRKVP......YTE-------I---DWK-AYMQECEG.FLN.------
J9JKC3_ACYPI/34-397-----------------.IVIAIEFVLNLY.IIQKVR......YTE-------I---DWK-AYMQEVEGVVVN.------
ALG3_ARATH/37-401-----------------FALILADAILVAL.IIAYVP......YTK-------I---DWD-AYMSQVSG.FLG.------
F4QBL4_DICFS/50-404-----------------LILFLGEIALNYL.IVTKRA......YTN-------I---DWE-AYMEQIDL.FVN.------
E2BFG0_HARSA/50-411-----------------.SFVLLEVVLNIL.IIKNVS......YTE-------I---DWK-AYMQEVEG.FIN.------
K2RJR1_MACPH/22-381-----------------PLLLVADAALCGL.IIWKVP......YTE-------I---DWK-AYMEQVAQ.YLA.------
A0A0C4DNJ3_MAGP6/32-396-----------------PALLALDVVLCAL.IILKVP......YTE-------I---DWE-AYMEQISQ.YVS.------
K5UZ89_PHACS/35-392-----------------VLVVLGDTVLTQL.IIRFVP......YTE-------I---DWE-TYMYQLEL.YLK.------
B7FU52_PHATC/1-358-----------------..LLIMELGLNVV.VIRKVA......YTE-------I---DWE-AYMQEVEF.WLD.------
E1FRZ8_LOALO/22-398-----------------IFLWTFDAILCTL.VVRTVP......YTE-------I---DWS-TYIQQVNC.YEQ.------
G8YQ30_PICSO/46-439-----------------PIIIALTSIITKI.IISKVN......YTE-------I---DFK-TYMQQIEL.VND.------
I2H2F8_TETBL/47-416-----------------PVLLLFESIFLKL.IIKNIP......YTE-------I---DYE-AYMEQIAM.IEID------
Q38AV3_TRYB2/9-364-----------------..VLTVELCMSII.AFHLVH......FTG-------I---DWN-AYMQEVKG.FLD.------
R0IS40_SETT2/23-383-----------------PLLLVADAALSGV.IIEKIP......YTE-------I---DWS-TYMEQISI.YLK.------
B8C606_THAPS/2-402-----------------..LIVVEVILTTL.IVIRVP......YTE-------I---DWV-AYMQEVTT.YQN.------
NT56_DROME/50-470-----------------LFVLLAELVINVV.VIQRVP......YTE-------I---DWV-AYMQECEG.FLN.------
F1QAD8_DANRE/41-400-----------------AVLWFLEIAINIW.VIQKVS......YTE-------I---DWK-AYMDEVEG.VIN.------
E2AE79_CAMFO/50-412-----------------TLFILAEIVVNIL.IIEKVS......YTE-------I---DWR-AYMQEVAG.FLN.------
M2RJ12_CERS8/31-389-----------------ALVIIGDVLLTQA.IVHLVP......YTE-------I---DWE-TYMYQTEL.YLE.------
M7NVY2_PNEMU/31-392-----------------LSLLFLDAFFCLV.ILLKIP......YTE-------I---DWN-TYMSQVSI.YLS.------
K1PJL2_CRAGI/29-393-----------------FVLLIAELVVNIL.VIKKIK......YTE-------I---DWT-AYMQEVEG.VVN.------
K3WI15_PYTUL/49-402-----------------LALLLADAVLGYL.IIQYIP......YTE-------I---DWK-AYMQQVEM.FKA.------
G3YDP3_ASPNA/22-377-----------------PLLVLGDAFLCAL.IIWKVP......YTE-------I---DWA-TYMQQISL.YLS.------
G8ZRL4_TORDC/46-409-----------------PLLLVVESLALKI.ITAKVP......YTE-------I---DYK-AYMEQIEM.ITMD------
B4J870_DROGR/49-472-----------------VLIVLAEALINVF.VIRRVP......YTE-------I---DWV-AYMQECEG.FLN.------
F9FME8_FUSOF/32-396-----------------IALWLVDALGCGL.IIWKIP......YTE-------I---DWV-AYMQQISQ.FVS.------
A7RPJ4_NEMVE/13-362-----------------LLLLLAEVVVNIA.VIWKIK......YTE-------I---DWE-AYMSEVEG.FLN.------
G4TDK5_SERID/21-386-----------------VLILAGDALLTLL.IIHFVA......YTE-------I---DFE-TYIVQADK.VQQ.------
S8FYD7_FOMPI/36-394-----------------ALVLVGDALLTQL.IIRFVP......YTE-------I---DWE-TYIYQLEL.YLK.------
M2MJW6_BAUCO/22-383-----------------PLLLLADTALCGV.VVWKIP......YTE-------I---DWK-AYMQQVSQ.YVS.------
F2PUQ0_TRIEC/23-378-----------------PLLLTFDACLCAA.IILKVP......YTE-------I---DWS-TYMQHIHL.FLS.------
ALG3_CRYNJ/40-416-----------------FLLFLGEVALSLL.VIWKIP......YTK-------I---DWP-AYMQQVDM.FLA.------
B9I9T5_POPTR/29-388-----------------LALIFMDALLVAL.IIAYVP......YTK-------I---DWD-AYMSQVTG.FLG.------
E6ZW66_SPORE/26-382-----------------.ALAIASAVLSEA.VIRRIS......FTE-------I---DFQ-TYVAQAAL.FLN.------
C4YB28_CLAL4/53-446-----------------PIVVSVASILCKI.VISKVN......YTE-------I---DFS-TYMQQIEL.VNA.------
U4KZB6_PYROM/25-385-----------------.PLLLADALLSTA.VVLKVP......YTE-------I---DWK-AYMEQVTQ.YLG.------
G7DY72_MIXOS/36-395-----------------TLLLLGELILSIF.IVRYVK......YTE-------I---DWS-TYMQQVAL.YQS.------
C5DE51_LACTC/56-423-----------------PLVVVIEFLALEW.IVAHVE......YTE-------I---DYK-AYMEQIWA.IQA.------

PF14897

D0MGT8_RHOM4/10-327------------------KVIAGGVILLLS-LIAIFR------G.S-------VGT.DTA.TYERLVTR.IDTW------
A6L8S3_PARD8/36-371------------------VRLICIVFFVLF-YGLRGF------V.G-------W...DWQ.GYYPSFEL.IDTL------
F0R6C6_BACSH/27-352------------------LYFIVIVALILF-AGLRYK------V.G-------M...DYN.MYNENFTN.LK..------
C6W3U8_DYAFD/27-360------------------KAIYITMCIIFV-MISGLR------W.N-------TGN.DWK.PYYSFFTR.....------
C6WZX9_FLAB3/31-373------------------RVFVWVAAILII-IAVGLR------L.E-------VGA.DYP.VYRMLFSG.FAIY------
F0NZQ8_WEEVC/30-359------------------YYQLTLAVMMLT-AGLGYN------L.S-------P...DWL.AYYNAFYA.SGEL------
Q5L9T0_BACFN/34-354------------------YFSVVIVGILLS-ITAGFR------NVG-------GVDTDYA.IYKNHYNG.ELGS------
Q6AIA7_DESPS/40-375------------------IWYMITLFYTLT-IGTREN------V.G-------I...DYL.SYKYHFLL.VESS------
D2QJN3_SPILD/45-378------------------NLIGLIILYSFV-VGCRYY------V.G-------I...DYK.VYVEIFLE.LKET------
D6D462_9BACE/28-360------------------RKIVWLWVCILT-VFWGIR------W.N-------CGT.DWD.NFYDVFQG.SD..------
E3HB27_ILYPC/34-350------------------LKFFNFLILILL-FGFTHE------M.G-------T...DNT.LYERHYYS.ANYQ------
C7PMN8_CHIPD/32-372------------------LYSVAFIILTCF-AGLRYH------T.G-------A...DWP.NYELHYDT.ILPR------
Q5L965_BACFN/30-358------------------LLFFLSFILILF-VGTRFE------T.G-------D...DWG.EYTKVFDK.IPLV------
Q1WTE3_LACS1/26-359------------------NFMLCILFMFIA-LHNPYL------T.G-------T...DGR.SYRAYFKT.HIPT------
A0KM85_AERHH/26-353------------------VLLPPFIIYFLI-SALQYN------V.G-------S...DYF.SYLYIYEN.QWVL------
A9NH20_ACHLI/15-352------------------NLLLVILILILG-VGVTNN------F..-------....DYE.AYSMSY.......------
A6GZ52_FLAPJ/21-343------------------KTLFVLFFLSMW-GLFGWN------YSN-------A...DFH.MYKGMYSV.PLSE------
D8IGG5_LACFC/21-364------------------RIVGFLGMGVLA-YLSGAA------N.P-------LTTLDYP.VYLQHYQL.LGWE------
Q03WA2_LEUMM/21-358------------------KWIGLISILLSV-LFIAYI------PID-------T.VQDTR.IYYSSYYS.DS..------
A6TBF0_KLEP7/23-340------------------NSLFLITGGFYV-LNFGFG------Y..-------....DWM.NYYDSYLN.INTP------
A5G608_GEOUR/41-362------------------IICIVVFGTILI-ATAGLQ------LFG-------PSA.DYY.AYQEMVID.KTNV------
C6X1R8_FLAB3/21-351------------------KLLSVVLIVVLA-LFAGSR------Y.Y-------IDS.DYS.LYYNYFIY.TEKS------
E0SFU5_DICD3/23-330------------------IIFYMILIPGFT-FLVGDK------NIN-------RWV.DHQ.TYENYFFL.AT..------
Q6FFU5_ACIAD/13-316------------------FSYYFIFIPILI-FLVGLK------DNS-------IWL.DYY.VYVDYFNQ.ASAS------
E4TIN4_CALNY/56-394------------------DYIDYILVIFIS-FFAGLK------R.P-------FSC.DLI.GYKWMFEN.....------
Q8A831_BACTN/29-353------------------LILYLFVIVLLS-LLAGLR------YDN-------A...DYE.NYLEIFKN.PWE.------
C7M7Z9_CAPOD/10-347------------------TIVFLLVSLLVA-FIVGNR------G..-------.DTRDTI.VYYSVFKY.IDV.------
Q8A715_BACTN/26-366------------------LVLLRCVILFIA-CMVGFR------Y.N-------IGA.DWE.TYVIIYNR.Q...------
C7RFF5_ANAPD/29-361------------------NILAGLMFFIMF-VFAGVR------..G-------SGDADYY.NYLWFVKD.LGVD------
Q5LH99_BACFN/15-335------------------IKIVFIIWLYIF-LCFGYM------T.G-------S...DWR.AYELQYQS.AD..------
D3SAJ3_THISK/38-360------------------LFLGMVASAPLV-LLLAFR------T.D-------VGT.DYD.AYVRIYNA.....------
C6X0C5_FLAB3/28-350------------------NLPALLAVGILI-AFAGLR------NVN-------VGT.DTG.NYVGIYYG.....------
C4ZJE6_THASP/44-373------------------SLVWPIQTLVLT-IVIGLR------F.E-------VGT.DWY.GYVSIYES.LY..------
D6E918_9ACTN/24-356------------------KVCVTLIGIQLF-LLLALR------AES-------YGP.DAE.IYAAGYRY.ISSL------
F0SY68_SYNGF/34-364------------------KLFVFLAFLVVA-LPSAFR------Y.E-------VGL.DYT.TYTTIYDI.IVG.------
A6L9H3_PARD8/32-354------------------YFYRTIVFLSIV-IPASIR------K.G-------IGT.DYW.AYVGLYDW.YRTN------
A1A378_BIFAA/27-350------------------VLPFAIVFLILF-TISGFR------Y.G-------VGT.DYFFTYVPTYKQ.IYNG------
E0RX92_BUTPB/42-359------------------HVTCLIIFVLLF-AVSSLR------L.N-------VGN.DYL.NYVELMHL.AYSR------
Q8XN60_CLOPE/30-345------------------LYFSIFAILILA-LIAGLR------W..-------.GIGDTP.AYVHLYSL.IEPG------
C4L730_EXISA/28-346------------------AWFVSFATIQWI-VLSGFR------DVT-------VGA.DTA.QYKALFLQ.SQTL------
C7M4A6_CAPOD/29-353------------------KYLLLSTYLLSV-FLVGLR------W.R-------TGT.DWE.PYKEVFEN.ISEY------
Q39W09_GEOMG/33-369------------------FILFSASTFFMS-AIIAFR------W.E-------IGT.DWN.SYYEYFVG.IKNG------
E4RNL6_HALHG/27-346------------------KILLFISYLFLW-FFAAFR------Y.D-------VGS.DYF.SYIRMYNK.IGSR------
C4Z668_EUBE2/44-362------------------IIYFVLIFIPMW-VLIAFR------NIS-------VGT.DTGITYYRIFQH.SLNG------
E0S0Y2_BUTPB/32-367------------------VNSCLLPCAFLC-VIAGFR------ALD-------VGK.DNY.SYTRYFLG.MTIN------
D2RIR8_ACIFV/29-352------------------FLLALAFLGSTF-FLSAFR------AET-------VGN.DTI.RYVDFFRS.FFYV------
D5EVG6_PRER2/7-324------------------ERWFNVSYFLMT-VMATFR------YGQ-------M..DDYF.NYYINYEH.PEIY------
A6QAG6_SULNB/27-344------------------LLVWIPTWIVYT-LYIGLR------H.E-------VGS.DWF.NYLAMFNRDVPSM------
Q0A657_ALKEH/27-342------------------LAAWCLIGLFFA-LAIGLR------H.E-------VGG.DWG.SYLAYLKR.AGEM------
Q8DJL9_THEEB/21-349------------------RWYGFFLFFTYV-LFIGLR------F.E-------VGA.DWE.SYIYILEA.AKSQ------
A7HKI9_FERNB/29-353------------------KLIKTVIFVFLL-LFIGLR------H.E-------VGG.DWD.TYLWWYKD.IAVN------
E3I7S4_RHOVT/25-342------------------RALFPIVALFLF-AFVAFR------Y.E-------VGC.DWS.GYRTNYDL.AQYL------
Q5QWV6_IDILO/29-338------------------VALIGCVILALL-FIYGFR------F.E-------VGV.DWF.NYIRVYER.DVAN------
Q1QWW7_CHRSD/27-347------------------SVLFYCAVSFLF-YMASFL------RWD-------VGT.DWD.GYYRFYGK.LDN.------
A6LBP7_PARD8/27-381------------------WTHYRIAVTLLI-LVAGLR------W.R-------VGS.DTV.SYASDFYF.SHDL------
E6UEJ4_RUMA7/36-384------------------VFFSVIALFIPS-LLAGVR------ADT-------VGK.DVL.EYAVRTFD.LANS------
E4RXS3_LEAB4/31-353------------------GIFGFILFFSLL-GGLRDT------SIG-------I...DLR.VYGVEYFY.YALF------
C4K321_HAMD5/34-350------------------IFVSLLLIIIYV-TLFGLR------DYS-------IGS.DTR.DYVENFLY.NN..------
C8WKZ6_EGGLE/32-357------------------MVFRTVVVLSPA-VLIGLR------GLN-------V...GYD.TEAMTYLL.FSGP------
A6L4H4_BACV8/26-363------------------...LLLSCLILS-LFAGFR------DKN-------IGS.DTD.FYPHWYIS.EIRY------
D9S910_FIBSS/29-351------------------.ITFAILLIFLV-CQEGFR------W.Q-------IGT.DWL.PYYRMFEY.NLS.------
F5WT29_ERYRF/24-344------------------...FYLATVPLF-IIVIFR------V.G-------VGT.DYF.SYEYLYNL.QNVT------
G8PTM7_PSEUV/31-346------------------..VLASFAIALS-AFIGFR------F.E-------VGK.DWI.QYNYIFKL.ITEL------
Q1G8I7_LACDA/49-398------------------...VSLSALPIL-LISCFR------Y.G-------VGT.DYFHTYVPQFLS.IVNG------
R5KIX9_9CLOT/31-383------------------...LIVTFGVLI-LVASLR------DPS-------VGT.DLAGHYAKRFNM.IGDY------
R7EM48_9BACE/29-344------------------.VTAFVWVLLMT-LFVGSQ------D.G-------IGT.DHS.NYIAQIES.PWV.------

PF03155

L8G8K2_PSED2/15-492------------------ATAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
Q5TNL1_ANOGA/16-506------------------GLFLRAAISL.H-SYSGQNQ.....PPK.......Y..GDYE-AQRHWQEV-TVNL------
D8UDK3_VOLCA/12-511------------------ATACKLLL....-............VPT.......YRSTDFE-VHRNWLAI-THNL------
Q29NI9_DROPS/12-462------------------AVSLRSIVSL.Y-SFSGFDS.....PPM.......Y..GDYE-AQRHWQEV-TINL------
T1K7S4_TETUR/16-504------------------VTCLKFLL....-............MPS.......YYSTDFE-VHRNWLAI-TNNK------
G2RBR7_THITE/15-492------------------AAALKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
M7PD45_PNEMU/13-491------------------SIFIKILL....-............FPA.......YRSTDFE-VHRNWMAL-TYSL------
D3BMH9_POLPA/36-529------------------CTALKLLL....-............IPT.......YTSTDFE-VHRNWLAI-TSSL------
A5DZN5_LODEL/28-537------------------TLALKLLL....-............MVG.......YHSTDFD-VHRNWLAV-THNL------
F6ZU35_CIOIN/22-490------------------SILLRLCVSL.G-PYSGKGK.....SPM.......Y..GDYE-AQRHWQEI-TFNL------
S9W0G5_SCHCR/14-492------------------STFMKILL....-............FPC.......YRSTDFE-VHRNWLAI-THSL------
K1XC57_MARBU/15-492------------------ATAFKLLL....-............LPA.......YKSTDFE-VHRNWLAI-TNSL------
G0W812_NAUDC/80-564------------------AIIIRCAVGL.G-PYSGFNT.....PPM.......F..GDFE-AQRHWMEI-TQYL------
C1E537_MICCC/36-567------------------VTALKVLL....-............VPC.......YRSTDFE-VHRNWLAV-THSL------
D7TT36_VITVI/40-494------------------AFLVRVAVSF.H-PYSGAGN.....PPK.......Y..GDYE-AQRHWMEI-TLNL------
E9GMP9_DAPPU/11-491------------------..FGKLLF....-............IPS.......YRSTDFE-VHRNWLAV-THSL------
F2UCB2_SALR5/15-489------------------GVCLRALVGL.G-GHSGFGN.....PPM.......H..GDFE-AQRHWMEI-TYHT------
H2Z9N9_CIOSA/19-515------------------VTVFKLLL....-............VPA.......YTSTDFE-VHRNWLAI-THSL------
G3NV34_GASAC/14-486------------------ALVVRWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNL------
G8BYL8_TETPH/49-563------------------SLFLKLLL....-............IPG.......YYSTDFD-VHRNWLAI-TSNL------
I7LWJ3_TETTS/163-672------------------ASFIRILAGI.G-PYSGYKD.....APT.......Y..GDYE-AQRHWMEL-TLHT------
A3LPA6_PICST/60-509------------------AILLRAAIGL.G-GYSGKAT.....PPM.......F..GDFE-AQRHWMEL-TIHL------
J7SB75_KAZNA/38-553------------------SLFLKLLL....-............VPD.......YYSTDFD-VHRNWLAI-TNAL------
M4BE27_HYAAE/29-565------------------SVCIKLLL....-............LPS.......YTSTDFE-VHRNWLSL-THTL------
A0A087ZQU5_APIME/41-513------------------VTCFKVLL....-............IPV.......YRSTDFE-VHRNWLAI-THSL------
G7YSM9_CLOSI/17-476------------------GFALRSSVLL.H-PHSGQAK.....PPM.......Y..GDYE-AQRHWMEV-TTNL------
F4X5Y5_ACREC/45-518------------------ITCIKILL....-............IPT.......YRSTDFE-VHRNWLAI-TYSL------
J9K2E7_ACYPI/9-490------------------ITCVKLLL....-............LPS.......YFSTDFE-VHRNWLAT-TYSL------
R7YRL9_CONA1/15-485------------------AAALKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSL------
ALG8_YEAST/51-565------------------TLFLKLLL....-............IPD.......YFSTDFD-VHRNWLAI-TNKL------
E2BLU2_HARSA/14-512------------------AILLRCCVTF.H-PHSGEGK.....PPM.......Y..GDYE-AQRHWQEI-ALNL------
C0NWB8_AJECG/15-495------------------ATAFKVTL....-............FPA.......YKSTDFE-VHRNWLAI-THSL------
I3IT66_DANRE/14-487------------------GLTSRWAVSF.H-SYSGAGK.....PPM.......F..GDYE-AQRHWQEL-TYNL------
G3BFJ8_CANTC/32-544------------------SVFLKLLL....-............SIG.......YHSTDFE-VHRNWLAI-TYNL------
ALG8_CAEEL/14-494------------------LISFKCLL....-............IPA.......YVSTDFE-VHRNWMAV-TWQR------
W5GB91_WHEAT/20-508------------------ATCVKLLL....-............VPT.......YRSTDFD-VHRYWLAL-THTL------
H2SHL1_TAKRU/16-505------------------.SFLKCLL....-............INA.......YLSTDFE-VHRNWLAV-THSL------
F1A4M3_DICPU/24-508------------------SLLARYLVSL.N-SYSGQGK.....PPM.......F..GDYE-AQRHWMEI-TTKL------
M3BZ39_SPHMS/15-495------------------ATALKVLL....-............WPA.......YKSTDFE-VHRNWLAI-TNTL------
B5RU50_DEBHA/74-567------------------AIILRSAVGL.G-SFSGQGE.....KPI.......N..GDFE-AQRHWMEL-TIHL------
R1GPQ5_BOTPV/17-493------------------ATALKLLL....-............LPA.......YKSTDFE-VHRNWLAL-THSL------
ALG6_SCHPO/35-484------------------LVFMQWLISI.G-PYSGYNT.....PPM.......Y..GDFE-AQRHWMEL-TLHT------
B3S4W0_TRIAD/22-470------------------ALLIRWCISL.N-PYSGKGK.....PPM.......Y..GDYE-AQRHWMEL-TTNL------
B0CY11_LACBS/39-528------------------STALKLLL....-............FPS.......YRSTDFE-VHRNWLAI-THTL------
M3K587_CANMX/31-541------------------SLALKILL....-............FIG.......YHSTDFD-VHRNWLAI-TNKL------
N4VMS5_COLOR/17-495------------------..ALKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
I1LX18_SOYBN/37-486------------------ALLVRVAVSL.H-PYSGAGN.....PPK.......F..GDYE-AQRHWMEI-TINL------
M9PB91_DROME/12-464------------------GLAVRSIISL.Y-SYSGFDS.....PPM.......H..GDYE-AQRHWQEI-TVNL------
ALG8_SCHPO/14-492------------------STFVKVFL....-............FPS.......YRSTDFE-VHRNWLAI-THSL------
ALG8_ASHGO/44-558------------------STALKLLL....-............MPG.......YYSTDFE-VHRNWLAV-THRL------
H2M3G8_ORYLA/14-482------------------GVVVRWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNL------
A0A068XBV5_HYMMI/13-510------------------AVAFKSLL....-............FSA.......YHSTDFE-VHRNWLSI-TYST------
D7MJY5_ARALL/49-511------------------ALLIRSAVSM.Y-PYSGAGI.....PPK.......F..GDFE-AQRHWMEI-TTNL------
M7UBV6_BOTF1/15-495------------------ATAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
B8C862_THAPS/6-526------------------..SVKYLL....-............IPS.......YFSTDFD-VHRNWLAI-THHL------
D5G5Y1_TUBMM/57-510------------------SILFRWAVGL.G-PYSGMAA.....PPM.......H..GDFE-AQRHWMEV-TTNL------
B6JZC1_SCHJY/14-495------------------SAFVKILL....-............FPC.......YRSTDFE-VHRNWLAI-THSL------
B4JPP0_DROGR/12-469------------------ALSLRAIISM.N-SFSGYNK.....APM.......F..GDYE-AQRHWQEV-TVNL------
A0A0K0IZP2_BRUMA/20-473------------------AFTLQIALSL.G-SYSGHAT.....PPM.......Y..GDYE-AQRHWMEI-TYHL------
G8ZP39_TORDC/40-554------------------SLALKLLL....-............MPD.......YFSTDFD-VHRNWLAI-TNEL------
G8BGI3_CANPC/69-539------------------SIILRTAVGL.G-GHSGYKN.....PPM.......Y..GDFE-AQRHWMEL-TIHL------
ALG6_HUMAN/14-488------------------GLTVRWTVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEI-TFNL------
B6Q2U6_TALMQ/15-493------------------AAAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
ALG6_CHICK/14-488------------------ALTVRWTVSL.G-SYSGAGK.....PPM.......Y..GDYE-AQRHWQEV-TYNL------
C3XSJ3_BRAFL/15-487------------------AVFVRWAVSL.N-SYSGMGK.....PPM.......Y..GDYE-AQRHWMEI-TTSL------
I1KRW2_SOYBN/28-527------------------ATCIKVLL....-............FPS.......YRSTDFE-VHRNWLAL-THSL------
A0A068XHI1_HYMMI/18-474------------------GLVLRSATLL.H-PYSGKAS.....PPM.......Y..GDYE-AQRHWMEV-TVNL------
C5DTD9_ZYGRC/51-531------------------AVIIRCAIGL.G-PYSGQSV.....KPM.......H..GDFE-AQRHWLEI-TQHL------
I2GX66_TETBL/28-529------------------ALMLKLLL....-............IPD.......YFSTDFD-VHRNWLAI-TNKL------
A7S144_NEMVE/15-467------------------AIVQRWSVSL.G-PYSGAGK.....KPM.......F..GDYE-AQRHWQEI-TYNL------
A0A0J9XRE5_BRUMA/37-513------------------.FTIKFLL....-............VPC.......YHSTDFE-VHRNWMAI-THTL------
Q6C8U0_YARLI/72-529------------------ALIIRAAVAL.G-PYSGFQQ.....PPM.......H..GDFE-AQRHWMEI-TTAL------
A7RNB8_NEMVE/17-518------------------.SFFKLLF....-............LRT.......YHSTDFE-VHRNWLAI-THSL------
U7Q3L8_SPOS1/16-494------------------AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
A8WP54_CAEBR/14-530------------------LIAFKCLL....-............IPS.......YTSTDFE-VHRNWMAV-TWNR------
F6PL55_ORNAN/15-493------------------GLTVRWTVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEI-TFNL------
F1NPY2_CHICK/24-512------------------.SFLKCLL....-............IPT.......YHSTDFE-VHRNWLAI-THNL------
C5M3Q6_CANTT/80-532------------------AVILRTAVGL.G-GHSGYHV.....PPM.......F..GDFE-AQRHWMEL-TINL------
G9NL14_HYPAI/15-495------------------AAAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
C5DJM6_LACTC/29-543------------------STALKLLL....-............IPA.......YVSTDFD-VHRNWLAI-TNKL------
M2TGW6_COCH5/15-493------------------ATALKVLL....-............FPA.......YKSTDFE-VHRNWLAL-THSL------
A0A068XUS9_ECHMU/14-510------------------..AFKSLL....-............FGA.......YHSTDFE-VHRNWLAI-TYCT------
N1PRH1_DOTSN/15-493------------------AAALKVLL....-............WPA.......YRSTDFE-VHRNWLAI-TNSL------
W5KCM7_ASTMX/22-513------------------.SFIKCLL....-............INA.......YHSTDFE-VHRNWLAV-THSL------
A8XHZ8_CAEBR/37-475------------------LICFQIAISL.N-PHSGESQ.....PPM.......Y..GDYE-AQRHWMEI-TFNL------
W5KTC4_ASTMX/14-487------------------GLTTRWAVSF.S-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNL------
F0ZUK5_DICPU/35-551------------------ITTIKLLL....-............IPS.......YFSTDFE-VHRNWLAI-TSSL------
A0A068Y0H1_ECHMU/19-476------------------GLCLRSLGIL.Y-PYSGMSS.....PPM.......F..GDYE-AQRHWMEI-TVNL------
ALG8_HUMAN/21-510------------------VTLLKCLL....-............IPT.......YHSTDFE-VHRNWLAI-THSL------
G3AHF0_SPAPN/67-518------------------AVLLRSAVGL.G-GHSGYHT.....PPT.......F..GDFE-AQRHWMEL-TINL------
G7DT66_MIXOS/306-809------------------SFIIRATVSL.G-PYSGYVV.....APM.......Y..GDLE-AQRHWMAV-TYHL------
E4XPJ7_OIKDI/15-474------------------.FLLRWVVSL.G-PYSGKNT.....SPL.......F..GDYE-AQRHWMEL-TLHQ------
K0KJ73_WICCF/57-557------------------ATILKVLL....-............FDT.......YHSTDFD-VHRNWLAI-TNKL------
Q6CSG6_KLULA/71-550------------------ALIIRCAVGL.G-GYSGMNT.....PPM.......F..GDFE-AQRHWMEI-TQHL------
S8A5I1_DACHA/15-491------------------ATALKLLL....-............IPA.......YRSTDFE-VHRNWLAI-THSL------
J7S8J5_KAZNA/67-547------------------LLIIKSAIGL.G-SYSGFQT.....PPM.......F..GDFE-AQRHWMEI-TQHL------
G8YLJ6_PICSO/71-564------------------AIILRAAVGL.A-PYSGMGE.....KPI.......N..GDFE-AQRHWMEL-TIHL------
ALG8_CANGA/21-535------------------SLLLKLLL....-............IPD.......YYSTDFD-VHRNWLAI-TNKL------
U5GCU1_POPTR/44-501------------------SLLLRVAVSL.H-SYSGAGT.....PPK.......F..GDFE-AQRHWMEI-TTNL------
B4L518_DROMO/13-481------------------.SALKVLL....-............FPA.......YYSTDFE-VHRNWLAI-THSL------
C4XYN7_CLAL4/28-542------------------SLALKALL....-............AVG.......YHSTDFD-VHRNWLAI-TYNL------
S9VWR7_SCHCR/35-484------------------IIFMQWLISI.G-SYSGRNS.....PPM.......Y..GDFE-AQRHWMEL-TLHS------
C4Y8Y1_CLAL4/65-544------------------AVMLRSAVGL.G-PYSGQGE.....KPI.......N..GDFE-AQRHWMEI-TSHL------
U4LQP8_PYROM/53-504------------------AFLFRWAVGL.G-SYSGMAA.....PPM.......H..GDFE-AQRHWMEI-TTKL------
ALG6_DICDI/25-502------------------SLLARYLVSL.N-GYSGQSK.....PPM.......F..GDYE-AQRHWMEI-TTNL------
W1PIJ5_AMBTC/36-490------------------AFFLRILVSL.H-PYSGARR.....PPM.......F..GDYE-AQRHWMEI-TINI------
H0V4T9_CAVPO/14-492------------------GLTVRWTVSL.H-SYSGAGK.....PPL.......F..GDYE-AQRHWQEV-TLNL------
F6UCU7_XENTR/38-526------------------VSLLKCLL....-............LPT.......YHSTDFE-VHRNWLAI-THSL------
F9FE00_FUSOF/15-493------------------AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSL------
B4MG56_DROVI/12-467------------------GLALRSIISM.N-SYSGFNQ.....APM.......F..GDYE-AQRHWQEV-TTNL------
M5ECX9_MALS4/12-500------------------GTALKVLL....-............WPA.......YHSTDME-VHRNWLAI-THQL------
R4G404_RHOPR/9-494------------------ATCFKILL....-............IKT.......YYSTDFE-VHRHWLAL-TSSR------
A8J4X2_CHLRE/2-518------------------.TAVKLLL....-............LPT.......YRSTDFE-VHRNWLAI-THSL------
I7LUU2_TETTS/10-489------------------..LIKLLL....-............VFA.......YHSTDFE-VHRNWLRI-TYNL------
Q7Q2B4_ANOGA/11-482------------------..GVKLLF....-............IPA.......YRSTDFE-VHRNWLAI-THSL------
T1G1F7_HELRO/12-479------------------AVVVRWLISL.H-DYSGYGK.....PPL.......F..GDFE-AQRHWMEI-TYNL------
D8Q0E0_SCHCM/162-611------------------TTLLKLAIGT.G-SYSGQAT.....PPM.......F..GDYE-AQRHWMEL-TVHL------
Q176C2_AEDAE/15-501------------------GILLRAAISL.H-SYSGENR.....PPM.......F..GDFE-AQRHWQEV-TVNL------
V2XYC4_MONRO/48-546------------------STTLKLLL....-............FPA.......YRSTDFE-VHRNWLAI-THSL------
K5WXZ7_AGABU/56-542------------------STMLKLLL....-............YPA.......YRSTDFE-VHRNWLAI-THTL------
F6GVE0_VITVI/26-508------------------AACIKLLL....-............IPS.......YHSTDFE-VHRNWLAL-THSL------
G8YVD8_PICSO/37-547------------------TLVLKLLV....-............SIG.......YRSTDFE-VHRNWLAI-TYHL------
F9X7N4_ZYMTI/15-491------------------ATALKVLL....-............WPA.......YKSTDFE-VHRNWLAI-TNSL------
B4I046_DROSE/12-481------------------ATGLKILL....-............IPA.......YHSTDFE-VHRNWLAI-THSL------
H6CAF2_EXODN/46-523------------------ATALKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSL------
E4V433_ARTGP/15-494------------------AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSL------
ALG6_YEAST/46-528------------------AVILRCTIGL.G-PYSGKGS.....PPL.......Y..GDFE-AQRHWMEI-TQHL------
C5DEQ3_LACTC/41-520------------------ALVIRCAVGL.G-SFSGEAT.....VPM.......H..GDFE-AQRHWMEL-TTNL------
Q17GG0_AEDAE/11-473------------------..AIKMMF....-............LPS.......YRSTDFE-VHRNWLAI-THSR------
M0ZN96_SOLTU/61-545------------------ATCIKFLL....-............IPA.......YHSTDFE-VHRNWLAI-THSL------
A5E0J5_LODEL/108-572------------------SLLLRTAVGL.G-GHSGFGK.....PPM.......Y..GDFE-AQRHWMEI-TNHL------
C4R675_KOMPG/51-560------------------STLLKVLL....-............YPA.......YHSTDFD-VHRNWLAI-TNKL------
T5AJ86_OPHSC/15-492------------------AAAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TSSL------
D2UZR6_NAEGR/31-501------------------GILFRIVLAFYQ-PHSGKST.....PPM.......F..GDFE-AQRHWIEV-TSNL------
D8PR27_SCHCM/33-514------------------STTFKLLL....-............FPT.......YRSTDFE-VHRNWLAI-THSL------
E6ZL14_SPORE/61-583------------------STAVKLLL....-............FPT.......YHSTDFE-VHRNWLAI-TRTL------
F4NSW2_BATDJ/10-461------------------TLLIKWAVSL.H-SHSGLNT.....PPM.......F..GDFE-AQRHWMEL-TTHL------
G3J5X8_CORMM/17-489------------------.AAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSL------
T1JIW9_STRMM/20-486------------------...LKILL....-............IPS........KSTDFE-VHRNWLAI-THTF------
H2VDX9_TAKRU/14-486------------------GVVVRWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNL------
G8JSX9_ERECY/78-592------------------STVLKLLL....-............MPD.......YFSTDLE-VHRNWLAL-TNKL------
U4KWQ6_PYROM/15-499------------------ATAFKLLL....-............LPA.......YKSTDFE-VHRNWLAL-THSL------
E3KWU5_PUCGT/17-510------------------STAIKLIL....-............LPT.......YRSTDFE-VHRNWLAI-TYSL------
I3JQF2_ORENI/14-486------------------AIIARWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNL------
K4A8J1_SETIT/40-498------------------ALLVRVLVSM.G-PYSGQGA.....APK.......F..GDYE-AQRHWMEL-TLHL------
B3MJG1_DROAN/12-464------------------GLAVRSIISL.H-SYSGHNS.....PPM.......Y..GDYE-AQRHWQEV-TINL------
X1WNC6_ACYPI/31-488------------------AVLFRWFVSL.H-DYSGKSK.....TPM.......Y..GDYE-AQRHWMEV-TVSL------
Q75CA8_ASHGO/68-547------------------ALIIRLAVGL.G-GYSGMGK.....PPM.......F..GDFE-AQRHWMEV-TQHI------
D0N326_PHYIT/34-510------------------LVLVRWIVGL.H-SYSGEHT.....PPM.......F..GDYE-AQRHWMEI-TINL------
Q6FVE1_CANGA/52-532------------------AMIIRCAIGL.G-PYSGYKD.....GPM.......H..GDFE-AQRHWMEI-TQHL------
H3CLG0_TETNG/1-489------------------...LKCLF....-............INA.......YHSTDFE-VHRNWLAI-THSL------
U5FSQ0_POPTR/25-525------------------STCVKLLL....-............IPS.......YHSTDFE-VHRNWLAI-THSL------
A7TDS1_VANPO/94-608------------------SLCLKLLL....-............FPD.......YYSTDFD-VHRNWMAI-TNAL------
X6MDM2_RETFI/80-636------------------AVFVRLCVGV.G-SYSGMHK.....PPM.......Y..GDFE-AQRHWMEI-TSG.------
D2A4Q9_TRICA/20-523------------------AVLLRACTTL.H-PYSGAGS.....PPM.......Y..GDYE-AQRHWMEI-TTNL------
F6PKN9_XENTR/14-490------------------ALYVRWTVSL.G-PYSGAHK.....PPM.......F..GDYE-AQRHWQEI-TFSL------
G8ZY47_TORDC/46-526------------------ALIIGCAVGH.G-SYSGQFS.....PPM.......F..GDFE-AQRHWMEI-TQHL------
H2AU41_KAZAF/49-563------------------SLFLKLLL....-............VPD.......YFSTDFD-VHRNWLAI-TNGM------
F8QIP1_SERL3/1-475------------------...MKLLL....-............FPS.......YRSTDFE-VHRNWLAI-THSL------
A5DBI4_PICGU/24-536------------------SLAIKALL....-............SIG.......YHSTDFD-VHRNWLAI-TYNL------
S8A6B8_DACHA/57-532------------------AFIFRWAVTY.G-PYSGEHA.....PPM.......F..GDFE-AQRHWMEI-TIHL------
G0VHP8_NAUCC/41-555------------------SFALKLLL....-............IPD.......YYSTDFD-VHRNWLAV-TNKL------
ALG8_KLULA/37-549------------------ATVLKVLL....-............FPG.......YYSTDFD-VHRNWLAI-TNKL------
A3GH90_PICST/41-554------------------SLTLKVLL....-............VIG.......YHSTDFD-VHRNWLAI-TNKL------
D8SCH8_SELML/18-458------------------AVLIRLLTGL.H-SYSGAGN.....PPK.......Y..GDYE-AQRHWMEL-TINL------
M0SWI1_MUSAM/15-472------------------ALLVRVLVSL.G-SYSGQGT.....PPT.......Y..GDYE-AQRHWMEI-TLHT------
E9HIJ0_DAPPU/14-464------------------TVIIKLGVSL.F-PYSGKNN.....PPM.......F..GDYE-AQRHWMEI-TVNL------
G8JQX3_ERECY/54-533------------------ALIVRLAVGL.G-GYSGKGK.....GPL.......F..GDFE-AQRHWMEI-TTCL------
E3LGX2_CAERE/56-494------------------LLCFQIVISL.N-PHSGESQ.....PPM.......F..GDYE-AQRHWMEI-TLNL------
G1KHE7_ANOCA/14-488------------------GLIIRWTVSL.G-SYSGAGK.....PPM.......Y..GDYE-AQRHWQEI-TYNL------
M3ZXK5_XIPMA/20-507------------------..LFKCLF....-............INA.......YHSTDFE-VHRNWLAI-TYSL------
M1AYF5_SOLTU/40-493------------------AILVRIAVSI.H-PYSGAGT.....PPK.......Y..GDYE-AQRHWMEI-TLNL------
G0WC59_NAUDC/39-554------------------SLALKILL....-............FPD.......YYSTDFD-VHRNWLAI-TNKL------
Q566T2_DANRE/20-507------------------.SFLKCLL....-............INA.......YHSTDFE-VHRNWLAL-THSL------
S7ZR44_PENO1/15-489------------------AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSL------
B5Y5E2_PHATC/28-512------------------LVLLRVLVGY.H-PHSGQDNYHGLHSAY.......G..GDFE-AQRHWMEL-TLHL------
I2H6P2_TETBL/49-543------------------AIIIRCAISL.G-SYSGKGT.....PPM.......F..GDFE-AQRHWMEI-TQHL------
A9RXF0_PHYPA/16-505------------------ATCVKVLL....-............VPA.......YHSTDFE-VHRHWLAI-THSL------
S8ECT2_FOMPI/45-533------------------STCLKLLL....-............FPA.......YRSTDFE-VHRNWLAI-TNTL------
K5X935_PHACS/65-548------------------STCLKLLL....-............FPA.......YHSTDFE-VHRNWLAI-THSL------
ALG6_CAEEL/56-491------------------LLCFQLAISL.N-PHSGESQ.....PPM.......Y..GDYE-AQRHWMEI-TVNL------
C4R109_KOMPG/50-531------------------AILIRLAVGL.G-SYSGFNT.....PPM.......Y..GDFE-AQRHWMEI-TQHL------
G3BBW3_CANTC/58-534------------------AIIIRSAVGL.G-SFSGFQE.....NPI.......N..GDFE-AQRHWMEI-TTHL------
H2ANJ3_KAZAF/67-548------------------ALIIRCAIGL.G-SYSGMGH.....SPM.......F..GDFE-AQRHWMEI-TQHL------
M4C591_HYAAE/34-510------------------LILVRWLVGL.H-LYSGEHV.....PPM.......F..GDYE-AQRHWMEI-TFNV------
M2MQ53_BAUCO/15-492------------------GTAFKVLL....-............WPA.......YRSTDFE-VHRNWLAI-THSL------
W1NV46_AMBTC/11-495------------------ATCIKILL....-............IPS.......YRSTDFE-VHRHWLAL-THSL------
S2JJH6_MUCC1/40-480------------------.SLIRWIVAL.N-PYSGYNA.....PPM.......F..GDYE-AQRHWMEI-TTHL------
I3JKF5_ORENI/18-505------------------..LLKCFF....-............ISA.......YRSTDFE-VHRNWLAI-THSL------
G8BYB6_TETPH/62-543------------------ALIIRCAIGL.G-PYSGMNE.....APM.......F..GDFE-AQRHWMEI-TQHL------
H2Y782_CIOSA/7-450------------------SILLRLCVSL.A-PYSGKGK.....PPM.......F..GDYE-AQRHWQEV-TYNL------
G4VBL6_SCHMA/19-502------------------GIALRSSTSL.H-SYSGENK.....PPM.......Y..GDYE-AQRHWMEI-TVNL------
F4P9K6_BATDJ/14-479------------------ALCIKLLL....-............VPS.......YHSTDFE-VHRNWLAI-TSSL------
A2QEY3_ASPNC/67-535------------------..LFRWAVSL.W-GYSGFGV.....PPM.......H..GDFE-AQRHWMEI-TTHL------
E2BUL4_HARSA/38-509------------------VTCIKMLL....-............IPT.......YHSTDFE-VHRNWLAI-TYNL------
ALG8_DEBHA/34-545------------------SLALKLLL....-............SVG.......YHSTDFD-VHRNWLAI-TYNL------
A0A0D2X4J7_CAPO3/36-488------------------ALLVRAAVGL.Y-PHSGQAT.....PPM.......Y..GDYE-AQRHWMEI-TLHL------
K3WJX2_PYTUL/33-498------------------LLLLRWLVGL.H-SYSGAQT.....PPM.......F..GDYE-AQRHWMEI-TLNL------
C5DNU1_ZYGRC/30-544------------------SLVLKILL....-............IPD.......YFSTDFD-VHRNWLAI-THNL------
F0YK69_AURAN/94-544------------------..VARHGCSL.H-PYSGEAT.....PPR.......F..GDYE-AHRHWMEV-TIHK------
B0WBY1_CULQU/17-503------------------GILLRATVSL.Y-SYSGHGK.....RPM.......F..GDFE-AQRHWQEV-TVNL------
B3RIR0_TRIAD/15-519------------------ASLFKSLL....-............IPS.......YRSTDFE-VHRNWLAI-THSL------
G8BJG1_CANPC/35-543------------------SLALKLLL....-............MVG.......YHSTDFD-VHRNWLAI-TSKL------
B6K4U3_SCHJY/35-468------------------VILIQWLVSI.G-SYSGKGA.....PPM.......F..GDFE-AQRHWMEL-TLHV------
K3X7Z1_PYTUL/28-566------------------SVALKLLL....-............LPS.......YTSTDFE-VHRNWLAL-TNAL------
G7XVM6_ASPKW/15-493------------------ATAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSL------
D7LLP2_ARALL/19-500------------------ATAVKLLL....-............IPS.......YRSTDFE-VHRNWLAI-TNSL------
G3AQ92_SPAPN/42-557------------------SFTLKALL....-............VVG.......YHSTDFD-VHRNWLAI-THNL------
G4TH15_SERID/87-576------------------GTVIKLLL....-............FPA.......YRSTDFE-VHRNWMAI-TNSL------
B4KK01_DROMO/12-467------------------AISLRSIISM.S-SYSGFNK.....PPM.......F..GDYE-AQRHWQEV-TFNL------
A8PTB3_MALGO/18-506------------------STAMKVLL....-............WPA.......YHSTDME-VHRNWLAV-TYSL------
B0CVP2_LACBS/18-494------------------SVLVRLVMGL.A-SYSGWNT.....PPM.......F..GDYE-AQRHWMEI-TLHL------
F4WJE6_ACREC/14-512------------------AILLRCCITY.H-SHSGEGK.....PPM.......Y..GDYE-AQRHWQEI-TLNL------
R4XHB2_TAPDE/18-493------------------STALKLLL....-............IPA.......YRSTDFE-VHRNWLAL-THSL------
W1Q7Q7_OGAPD/16-525------------------STLLKILL....-............FPA.......YYSTDFD-VHRNWLSI-TKLL------
B4MJ94_DROWI/18-488------------------ATAFKTLL....-............FPA.......YYSTDFE-VHRNWLAI-THSL------
F4RT20_MELLP/38-527------------------STCIKLLL....-............FPA.......YHSTDFE-VHRNWLAI-THSL------
ALG8_CANAL/51-572------------------SLALKILL....-............FIG.......YHSTDFD-VHRNWLAI-TNKL------
K0KKM0_WICCF/47-534------------------AIIIRSAIGF.G-SYSGHAI.....PPM.......F..GDFE-AQRHWLEI-TQHL------
K7H4J1_CAEJA/18-503------------------.LSFKIIL....-............IPA.......YVSTDFE-VHRNWMAV-TWNR------
B4JLV7_DROGR/13-480------------------.SALKVLL....-............IPA.......YYSTDFE-VHRNWLAI-THSL------
A7TJW9_VANPO/47-530------------------ALIVRCAIGL.G-SYSGMGN.....PPM.......F..GDFE-AQRHWMEI-TQHL------
A0DD77_PARTE/10-454------------------SISLRIYVAF.G-GYSGMND.....PPQ.......Y..GDFE-AQRHWMEL-TSHL------
N1JGC6_BLUG1/16-499------------------.TAFKILL....-............LPAPEDSEYHSQSTDFE-VHRNWLAI-TNSL------

PF04922

D6W779_TRICA/29-405-----------------TARLIIDEEFHFQ-LGEAYC------RYE-------FD..KWH--------------------
K5XCQ6_PHACS/29-416-----------------VIEPYMDEPFHVP-QAQAYC------IGN-------YS..YWD--------------------
T1G2P1_HELRO/32-429-----------------QSEPYMDEIFHVS-QARQYC------NGN-------FS..HWD--------------------
H2T3E9_TAKRU/31-424-----------------QRNPYMDEILHVP-QAQKYC------HGK-------FN..EWD--------------------
ALG10_CANGA/63-455-----------------VPYEFIDEQFHIG-QTITYL------KGH-------WF..TWD--------------------
I1N2G0_SOYBN/25-459-----------------VPEPYMDEIFHIP-QAQQYC------KGN-------FG..SWD--------------------
E0V9V1_PEDHC/31-428-----------------QKYPYIDEIFHIP-QAQTYC------SNN-------WT..EWN--------------------
M0THQ1_MUSAM/25-461-----------------VPDPYMDEIFHIP-QAQRYC------RRD-------FG..TWD--------------------
F4R3Q7_MELLP/33-444-----------------VPEPYMDEIFHVK-QARTYC------QGQ-------WL..EWD--------------------
R4GKH2_CHICK/31-425-----------------LREPYMDEIFHVP-QAQAYC------QGR-------FL..QWD--------------------
G8ZYL6_TORDC/61-452-----------------VPYTFIDEQFHVG-QTLKYV------GGH-------WT..HWD--------------------
C6H8G6_AJECH/46-531-----------------LPDPYLDEVFHVR-QAQAYW------KHR-------WR..QWD--------------------
ALG10_DEBHA/27-407-----------------VKDPFIDEIFHLR-QCQTYC------ALR-------FD..IWD--------------------
E3RDG0_PYRTT/32-497-----------------VPDDYLDEFFHVP-QAKKYC------EGD-------YS...WD--------------------
F6RK69_MONDO/31-424-----------------LREPYMDEIFHLP-QAQRYC------WGS-------F...QWD--------------------
F6YIJ5_CIOIN/30-422-----------------QPTAFIDEIFHVP-QAQKFC------DGH-------FN..EWD--------------------
Q7QC28_ANOGA/28-387-----------------TSQQVIDEEFHLR-QGDHYC------HGR-------FQ..VWD--------------------
R0ILV6_SETT2/32-500-----------------VPEPYLDEFFHVP-QAQKYC------KGD-------YS...WD--------------------
U9SYH3_RHIID/26-420-----------------VPDPYMDEVFHVS-QAKQYC------EGN-------YY..DWN--------------------
B3S3F0_TRIAD/21-412-----------------HSMSYMDEIFHIP-QAQRYC------RYN-------FH..EWD--------------------
C5GWH0_AJEDR/43-528-----------------LPDPYLDEVFHVR-QAQAYW------AHR-------WR..QWD--------------------
W4XA33_STRPU/31-418-----------------QPLPYMDEVFHIP-QAQKYC------NGS-------FG..EWD--------------------
E7FEB7_DANRE/31-427-----------------QRDPYMDEIFHVP-QAQKYC------EGK-------FT..EWD--------------------
E3KTL2_PUCGT/33-453-----------------VPDPYMDEIFHVE-QAKTYC------AGQ-------WT..TWN--------------------
C4QYK4_KOMPG/29-433-----------------VRKPFIDEIFHIP-QARQYC------RGR-------FD..VWD--------------------
M4CND4_BRARP/25-460-----------------VPEPYMDEIFHVP-QAQQYC------KGN-------LR..SWD--------------------
C3ZVK1_BRAFL/29-413-----------------QPEPYMDEIFHIP-QAQKYC------QGR-------FT..EWD--------------------
G8BJE7_CANPC/39-409-----------------VAQPFVDEIFHLR-QCQTYC------ASR-------FD..KWD--------------------
A9TQ25_PHYPA/25-459-----------------VPEVYMDEMFHIP-QAQEYC------KGD-------FH..KWD--------------------
A7TEV5_VANPO/69-460-----------------VPYLFIDEFFHVN-QTIKYI------KND-------WF..TWD--------------------
E5R4I1_LEPMJ/32-494-----------------VPEPYLDEFFHIP-QAQRYC------SGD-------YS...WD--------------------
S2JIR9_MUCC1/22-407-----------------VPEPYMDEIFHVP-QAQQYC------HGD-------YY..TWD--------------------
F6W8Z6_XENTR/31-423-----------------QRDPYMDESFHIP-QAQLYC------QGH-------FN..QWD--------------------
M7P9N4_PNEMU/25-418-----------------VLVPYMDEIFHVN-QMQEYC------KGN-------YL..KWN--------------------
K7J4C0_NASVI/51-442-----------------QFHFFIDEKFHIP-QTIKYC------EGK-------FF..EWD--------------------
B4L183_DROMO/27-402-----------------TAEYIIDEEFHIP-QGLAFC------RKQ-------FD..VWD--------------------
ALG10_SCHPO/27-398-----------------VPNPYLDEIFHIA-QAQRFC------RKD-------WD...WD--------------------
M2MM25_BAUCO/23-505-----------------VPEPYLDEVFHVR-QAQSYC------NGR-------FD..IWD--------------------
U4KUC8_PYROM/26-429-----------------IPEPYLDEVFHIP-QAQAYC------RNA-------FD..VWD--------------------
G1KUP0_ANOCA/31-425-----------------QRAPYMDEAFHVA-QAQAYC------EGR-------FQ..QWD--------------------
C5DSA6_ZYGRC/68-459-----------------VPYEFIDEKFHVG-QTIEYI------TGH-------WR..SWN--------------------
H2AQR8_KAZAF/62-454-----------------IPYLFIDEKFHIN-QTITYI------KGD-------WA..QWD--------------------
U5H039_USTV1/30-435-----------------GPTPYMDEMIHIP-QARAYC------RGD-------FG..FWD--------------------
W5NGQ4_LEPOC/1-392-----------------.....MDEIFHVP-QAQKYC------EGR-------FN..EWD--------------------
G2QLA0_MYCTT/27-468-----------------VPEPYLDEVFHIP-QAQKYC------AGH-------FR..DWD--------------------
AG10B_RAT/31-428-----------------LREPYMDEIFHLP-QAQRYC------EGR-------FSLSQWD--------------------
S8EM30_FOMPI/28-420-----------------VTEPYMDEPFHVP-QAQAYC------RGD-------YW..AWD--------------------
H9JJA8_BOMMO/32-432-----------------TTRTVIDELFHIP-QGLSYC------RRN-------FM..HWD--------------------
ALG10_DROME/27-402-----------------TSDYVIDEEFHIP-QGLAFC------RKE-------FD..VWD--------------------
ALG10_ASHGO/57-447-----------------VPYPFIDEKFHVG-QTVRYL------AGR-------WR..EWD--------------------
G0S7Z5_CHATD/97-541-----------------VCCLGFDEIFHIP-QAQTYC------EGR-------YG..EWD--------------------
A0DAU3_PARTE/15-377-----------------...PLQDEEFHLD-QMQHYL------DSD-------FA..YWN--------------------
K3Y6Q6_SETIT/25-460-----------------VPEPYMDEIFHVP-QAQQYC------RGD-------FL..TWD--------------------
C5DDK7_LACTC/53-443-----------------VPYQFIDEVFHVK-QTIQYI------GGN-------WK..TWD--------------------
A0A0E1RWP6_COCIM/38-522-----------------VPDPYLDEAFHVR-QAQAYW------RHQ-------WR..EWD--------------------
F8PP28_SERL3/26-407-----------------VTEPYMDEPFHVP-QALAYC------RGE-------WT..SWD--------------------
D2VB91_NAEGR/36-412-----------------VPNPYMDEIFHIP-QAIKFV------QNR-------FT..EWD--------------------
B0CP31_LACBS/23-410-----------------VDEPYMDEPFHIP-QAQAYC------SGD-------FM..RWD--------------------
H3AZ27_LATCH/33-427-----------------QKDPYMDEVFHVP-QAQKYC------EGK-------FN..QWD--------------------
W1QI63_OGAPD/28-389-----------------VNYTFIDEIFHVN-QVKEYW------NGN-------FD..SWD--------------------
ALG10_ARATH/25-461-----------------VPEPYMDEIFHVP-QAQQYC------NGN-------FR..SWD--------------------
U5G642_POPTR/25-462-----------------VPEPYMDEIFHIP-QAQQYC------KGN-------FA..SWD--------------------
E1ZJK4_CHLVA/29-455-----------------APDPYMDEPFHVP-QTQRYC------AGH-------WR..EWE--------------------
A3LRZ3_PICST/40-418-----------------VKNPYIDEYFHIR-QCQKYC------QHK-------FH..EWD--------------------
G3B8T7_CANTC/34-406-----------------VKGPFIDEIFHLR-QCETYC------RYE-------FG..VWD--------------------
E9G0X2_DAPPU/10-399-----------------QPVPYLDEIYHVP-QAQEYC------RGN-------FS..YWD--------------------
T1KW23_TETUR/49-426-----------------VQEPYMDEIFHIQ-QVRSYC------VHN-------FT..YWN--------------------
B4N5D4_DROWI/27-400-----------------TSDYIIDEEFHIP-QGLAFC------RKQ-------FD..VWD--------------------
A5DZP8_LODEL/41-412-----------------LQDPFIDEIFHLR-QCQVYC------AYN-------FS..IWD--------------------
K5XJ27_AGABU/23-409-----------------INEPYMDEPFHIP-QAQAYC------RGD-------FT..TWD--------------------
ALG10_KLULA/84-474-----------------LPYVFIDEKFHVD-QTLRYL------RGK-------WY..SWN--------------------
K1R9X9_CRAGI/8-410-----------------QQSPYMDEIFHIR-QAKHYC------HGN-------FT..VWD--------------------
M3JE22_CANMX/36-392-----------------IPEPYIDEFFHLR-QCQTYC------DYN-------FT..HWD--------------------
J7S1V6_KAZNA/74-466-----------------VPYQFIDEKFHIG-QTLTYL------NGK-------WS..QWD--------------------
H2Z276_CIOSA/25-431-----------------QPTPFIDEIFHIP-QAQKFC------NGH-------FS..EWD--------------------
J9LAG9_ACYPI/57-491-----------------.DEYYIDEEFHVP-QAQHYC------RAA-------FH..KWD--------------------
M1AHM2_SOLTU/25-464-----------------VTEPYMDEIFHIP-QAQQYC------KGN-------FR..SWD--------------------
G8YR70_PICSO/63-445-----------------VTSPFIDEIFHLR-QCQKYC------QYK-------FQ..EWD--------------------
G7E9B0_MIXOS/25-410-----------------VPKPYMDEIFHVP-QAQAYC------SGN-------WQ..AWD--------------------
U3KM68_RABIT/35-431-----------------LREPYMDEIFHLP-QAQRYC------EGR-------FSLSQWD--------------------
N1PN61_DOTSN/24-512-----------------VTEPYLDEVFHVR-QAQHYC------QNH-------WH..VWD--------------------
M7WKK8_RHOT1/28-438-----------------VDEPYMDEIFHVP-QAQAYC------RGE-------WT..YWD--------------------
B4GZN2_DROPE/27-402-----------------TSNYIIDEEFHIP-QGLAFC------RKQ-------FD..VWD--------------------
E2C163_HARSA/25-409-----------------QPHYFIDEAFHIP-QTLRYC------AWN-------FT..EWD--------------------
D5GMM3_TUBMM/58-479-----------------VPEPYLDEVFHIP-QAQAYC------RNA-------FK..TWD--------------------
B4J2W4_DROGR/27-402-----------------TADYIIDEEFHIP-QGMAFC------RKQ-------FD..VWD--------------------
H2MXS0_ORYLA/31-430-----------------QREAYMDEIFHVP-QAQKYC------QGK-------FSLEQWD--------------------
G3Q5J3_GASAC/31-430-----------------QREPYMDEIFHVP-QAQKYC------HGK-------FNLPQWD--------------------
A0A068XAK8_HYMMI/1-361-----------------.....MDEEFHVV-QTLTYI------KGD-------WR..SWN--------------------
I1G516_AMPQE/28-420-----------------VPSPYMDEIFHVP-QAQQYC------RNN-------FS..HWD--------------------
B4LC57_DROVI/27-402-----------------TAEYIIDEEFHIP-QGLAFC------RKQ-------FD..VWD--------------------
G4TLE7_SERID/31-425-----------------VWEPYMDEPFHVP-QAQAYC------EGQ-------WD..VWD--------------------
C5MA37_CANTT/36-393-----------------IPEPYIDEIFHLR-QCQTYC------DYK-------FT..QWD--------------------
H6BMA7_EXODN/33-480-----------------VPVPYLDEFFHVP-QVQAYW------LGK-------WT..QWD--------------------
G3AQ79_SPAPN/26-394-----------------VQQPFIDEIFHLR-QCQVYC------NYN-------FT..HWD--------------------
K0KGY8_WICCF/63-454-----------------VTEPFIDEIFHIP-QTIQYF------NGD-------FK..TWD--------------------
M2PXH0_CERS8/29-421-----------------VTEPYMDEPFHVP-QAQAYC------NGD-------YW..AWD--------------------
M3ZWU8_XIPMA/31-428-----------------QRDPYMDEIFHVP-QAQRYC------KGK-------FK..EWD--------------------
C5FIZ5_ARTOC/29-525-----------------LPDPYLDEVFHVR-QAQAYW------DHR-------WK..QWD--------------------
G0W9V3_NAUDC/65-461-----------------IPYEFIDEKFHIN-QTLTYL------NGH-------WT..QWD--------------------
I2GZK7_TETBL/25-415-----------------VPFDFIDEKFHVN-QTIEYI------KGN-------WF..NWD--------------------
Q54Z56_DICDI/36-464-----------------QIEPYVDEIFHIP-QTIKYC------EFK-------FK..EWD--------------------
D7THP5_VITVI/25-464-----------------VPHPYMDEIFHIP-QAQEYC------RAN-------FR..SWD--------------------
B2AS64_PODAN/95-577-----------------VPEPYLDEFFHIP-QAQVYC------EGR-------YR..QWD--------------------
L8G022_PSED2/46-496-----------------VPSPYMDEVFHIP-QAQQYC------ASD-------FY..TWD--------------------
S6DZ28_ZYGB2/63-454-----------------TPHEFIDEKFHVA-QTLNYV------AGN-------WT..SWD--------------------
G7YEG4_CLOSI/35-428-----------------QPEAYMDEIFHVR-QSLSYL------SGN-------WS..SWD--------------------
E4UQE0_ARTGP/54-531-----------------LPDPYLDEVFHVR-QAQAYW------DHR-------WQ..QWD--------------------
S9XAR5_SCHCR/40-407-----------------VNIPYMDEIFHVS-QTQRYC------NQD-------WE...WD--------------------
B0WRU3_CULQU/28-412-----------------TSKQVIDEEFHLR-QGEHYC------RGR-------FH..IWD--------------------
ALG10_YARLI/35-468-----------------QPTPYIDEIFHIP-QTQQYC------KGH-------WN..AWD--------------------
B3M3X6_DROAN/27-402-----------------TSEYVIDEEFHIP-QGLAFC------QQK-------FD..VWD--------------------
E3M395_CAERE/43-392-----------------VPDPYMDEFFHIS-QTRLYC------AGN-------YT...WN--------------------
M2QYS3_COCSN/32-490-----------------VPKPYLDEFFHVP-QAQKYC------EGD-------YS...WD--------------------
V2X8L4_MONRO/23-410-----------------VDKPYMDEPFHIP-QAQAYC------RGE-------FD..YWD--------------------
B7PY71_IXOSC/28-414-----------------QPAPYMDEIFHVP-QAQSYC------SYN-------FT..YWD--------------------
K1WSG6_MARBU/64-554-----------------AQDPYLDEVFHIP-QAQAYC------NGR-------YE..VWD--------------------
ALG10_CANAL/39-418-----------------LTQPYIDEIFHLR-QCQTYC------QYN-------FH..HWD--------------------
T1IQU4_STRMM/35-428-----------------QPTPYMDETFHIP-QAQKYC------DGK-------FQ..EWN--------------------
G8JPI5_ERECY/57-447-----------------VPHPFIDEIFHLN-QTVKYI------GGH-------WG..TWD--------------------
W5KCZ3_ASTMX/32-428-----------------QREPYMDEIFHIP-QAQKYC------QGK-------FN..QWD--------------------
D8PKT8_SCHCM/23-405-----------------VTEPYMDEPFHVP-QAQAYC------AGN-------FS..HWD--------------------
M7ZBL2_TRIUA/25-435-----------------VPDPYMDEIFHVP-QAQHYC------RGD-------FL..TWD--------------------
J3LZC5_ORYBR/25-460-----------------VPDPYMDEIFHIP-QVQRYC------RGD-------FL..TWD--------------------
D8RLA5_SELML/25-447-----------------VPDPYMDEIFHVP-QAQRYC------KRD-------FY..TWD--------------------
ALG10_YEAST/66-458-----------------VPYEFIDEKFHVG-QTLTYL------KGK-------WT..QWD--------------------
G8BNV4_TETPH/64-455-----------------VPYLFIDEVFHVT-QTIRYI------KGD-------WF..YWD--------------------
A5DGH1_PICGU/27-396-----------------VRAPFIDEIFHLR-QCIKYC------NND-------FY..NWD--------------------
G0VGC7_NAUCC/66-459-----------------IPYQFIDEKFHVG-QTLTYL------QGD-------WF..NWD--------------------
W5JWB9_ANODA/28-387-----------------TSQLVIDEEFHLR-QGDHYC------RGR-------FQ..KWD--------------------
Q170T5_AEDAE/28-413-----------------TSKVVVDEEFHLR-QGEHYC------HGR-------FD..VWD--------------------
C4XWR1_CLAL4/27-397-----------------VPLPFIDEYFHLR-QAQAYC------ASD-------YA..VWD--------------------

PF10131

Q0AV03_SYNWW/415-1038--------------------------------------------------------------------------------
Q5JIL5_THEKO/62-622--------------------------------------------------------------------------------
Q97FZ3_CLOAB/258-879--------------------------------------------------------------------------------
Q0AV07_SYNWW/2-631--------------------------------------------------------------------------------
Q8TXR3_METKA/68-665--------------------------------------------------------------------------------
A0LQQ1_SYNFM/80-828--------------------------------------------------------------------------------
Q97FY2_CLOAB/253-873--------------------------------------------------------------------------------
Q97G45_CLOAB/90-699--------------------------------------------------------------------------------
R5JZI7_9CLOT/75-690--------------------------------------------------------------------------------

PF09586

A4VYG6_STRSY/15-836--------------------------------------------------------------------------------
Q1WT54_LACS1/18-862--------------------------------------------------------------------------------
Q8DRZ1_STRMU/67-904--------------------------------------------------------------------------------
Q74LA0_LACJO/18-861--------------------------------------------------------------------------------
Q74LA1_LACJO/22-868--------------------------------------------------------------------------------
Q03YY3_LEUMM/16-848--------------------------------------------------------------------------------
Q8DRQ9_STRMU/18-837--------------------------------------------------------------------------------
Q03G85_PEDPA/13-851--------------------------------------------------------------------------------
A5VKU5_LACRD/18-849--------------------------------------------------------------------------------
Q8DRY9_STRMU/26-950--------------------------------------------------------------------------------
Q38WC5_LACSS/15-827--------------------------------------------------------------------------------
Q8DWP3_STRA5/16-839--------------------------------------------------------------------------------
Q03NT2_LACBA/19-858--------------------------------------------------------------------------------
Q38VZ4_LACSS/17-848--------------------------------------------------------------------------------
Q03RN6_LACBA/20-858--------------------------------------------------------------------------------
Q5FIZ5_LACAC/21-848--------------------------------------------------------------------------------
Q839W8_ENTFA/19-846--------------------------------------------------------------------------------
Q5M231_STRT2/16-841--------------------------------------------------------------------------------
Q82ZW8_ENTFA/12-828--------------------------------------------------------------------------------
Q5HPU9_STAEQ/10-840--------------------------------------------------------------------------------
Q5WFJ9_BACSK/12-844--------------------------------------------------------------------------------
Q74IE5_LACJO/19-843--------------------------------------------------------------------------------
Q03HY9_PEDPA/14-831--------------------------------------------------------------------------------
Q038D6_LACC3/14-842--------------------------------------------------------------------------------
Q3XYV7_ENTFC/19-847--------------------------------------------------------------------------------
Q814J9_BACCR/15-862--------------------------------------------------------------------------------
Q03TF4_LACBA/23-880--------------------------------------------------------------------------------
Q5WJL1_BACSK/14-845--------------------------------------------------------------------------------
Q65M97_BACLD/11-842--------------------------------------------------------------------------------
Q04EK1_OENOB/16-850--------------------------------------------------------------------------------
Q03QV8_LACBA/14-985--------------------------------------------------------------------------------
Q03A73_LACC3/16-850--------------------------------------------------------------------------------
A8FB68_BACP2/11-842--------------------------------------------------------------------------------
Q03TW7_LACBA/17-837--------------------------------------------------------------------------------
Q2FZ40_STAA8/20-851--------------------------------------------------------------------------------
Q8DMX0_STRR6/15-831--------------------------------------------------------------------------------
Q99XH1_STRP1/14-837--------------------------------------------------------------------------------
Q9CHA3_LACLA/14-855--------------------------------------------------------------------------------
R6NFF7_9CLOT/15-832--------------------------------------------------------------------------------
R7DCE3_9FIRM/22-900--------------------------------------------------------------------------------

PF05007

GPI14_YEAST/127-386--------------------------------------------------------------------------------
GPI14_SCHPO/112-368--------------------------------------------------------------------------------
PIGM_TRYB2/134-410--------------------------------------------------------------------------------
PIGM_RAT/140-408--------------------------------------------------------------------------------
Q17515_CAEEL/146-405--------------------------------------------------------------------------------
Q9W2E4_DROME/177-450--------------------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379--------------------------------------------------------------------------------
Q5CYY5_CRYPI/10-436--------------------------------------------------------------------------------
B6AHL5_CRYMR/12-437--------------------------------------------------------------------------------
B9RC32_RICCO/30-452--------------------------------------------------------------------------------
B9GKM7_POPTR/14-432--------------------------------------------------------------------------------
A9TIH7_PHYPA/73-514--------------------------------------------------------------------------------
B4N1B7_DROWI/10-386--------------------------------------------------------------------------------
B4KI55_DROMO/10-386--------------------------------------------------------------------------------
Q16H22_AEDAE/9-388--------------------------------------------------------------------------------
B0W4N5_CULQU/8-388--------------------------------------------------------------------------------
Q7Q3W6_ANOGA/8-396--------------------------------------------------------------------------------
B7QL74_IXOSC/11-391--------------------------------------------------------------------------------
Q4RLI5_TETNG/10-394--------------------------------------------------------------------------------
Q28CK0_XENTR/10-394--------------------------------------------------------------------------------
A7S3Y0_NEMVE/14-406--------------------------------------------------------------------------------
Q54T45_DICDI/55-469--------------------------------------------------------------------------------
Q758M8_ASHGO/10-356--------------------------------------------------------------------------------
C5DB98_LACTC/10-356--------------------------------------------------------------------------------
Q6CPH2_KLULA/10-358--------------------------------------------------------------------------------
C5DUS6_ZYGRC/10-359--------------------------------------------------------------------------------
A7TF02_VANPO/11-360--------------------------------------------------------------------------------
Q6FSI7_CANGA/9-374--------------------------------------------------------------------------------
C5MHK2_CANTT/9-395--------------------------------------------------------------------------------
Q5AGH5_CANAL/13-440--------------------------------------------------------------------------------
A5E2K6_LODEL/111-490--------------------------------------------------------------------------------
Q6BPY5_DEBHA/9-390--------------------------------------------------------------------------------
A3LVF4_PICST/9-390--------------------------------------------------------------------------------
C4Y9V1_CLAL4/8-389--------------------------------------------------------------------------------
C5FSQ4_ARTOC/12-388--------------------------------------------------------------------------------
B6H480_PENRW/12-387--------------------------------------------------------------------------------
A2QI87_ASPNC/12-388--------------------------------------------------------------------------------
B6QEM6_TALMQ/12-390--------------------------------------------------------------------------------
B2WBA6_PYRTR/13-388--------------------------------------------------------------------------------
B2A9S5_PODAN/16-388--------------------------------------------------------------------------------
Q6C5L4_YARLI/7-382--------------------------------------------------------------------------------
B0D118_LACBS/9-373--------------------------------------------------------------------------------
PIGU_SCHPO/10-372--------------------------------------------------------------------------------
B6K154_SCHJY/14-372--------------------------------------------------------------------------------
Q22672_CAEEL/31-382--------------------------------------------------------------------------------
A8X654_CAEBR/27-380--------------------------------------------------------------------------------
Q01AL0_OSTTA/12-375--------------------------------------------------------------------------------
C1EBB5_MICCC/13-406--------------------------------------------------------------------------------
C1MV77_MICPC/13-431--------------------------------------------------------------------------------
C5L3N8_PERM5/23-419--------------------------------------------------------------------------------
Q4YTZ9_PLABA/82-516--------------------------------------------------------------------------------
Q8IE19_PLAF7/127-560--------------------------------------------------------------------------------
B3L8S4_PLAKH/95-534--------------------------------------------------------------------------------
A0DGJ7_PARTE/1-357--------------------------------------------------------------------------------
B8C4L2_THAPS/71-579--------------------------------------------------------------------------------
B4Q6V7_DROSI/10-386--------------------------------------------------------------------------------
G3HAP2_CRIGR/11-394--------------------------------------------------------------------------------
J4TTL1_SACK1/11-359--------------------------------------------------------------------------------
Q5KP79_CRYNJ/19-375--------------------------------------------------------------------------------
Q7SFC3_NEUCR/18-392--------------------------------------------------------------------------------
Q94K70_ARATH/25-442--------------------------------------------------------------------------------
A0A125YKP3_TOXGV/76-514--------------------------------------------------------------------------------

PF09594

PIME_MYCS2/91-321--------------------------------------------------------------------------------
A0JZG9_ARTS2/73-321--------------------------------------------------------------------------------
Q73YN6_MYCPA/82-326--------------------------------------------------------------------------------
E0TET4_PARBH/112-335--------------------------------------------------------------------------------
Q1QK36_NITHX/92-360--------------------------------------------------------------------------------
Q1DFL5_MYXXD/100-338--------------------------------------------------------------------------------
Q1LAW9_CUPMC/87-313--------------------------------------------------------------------------------
Q2J8W8_FRASC/88-337--------------------------------------------------------------------------------
Q9HN16_HALSA/81-322--------------------------------------------------------------------------------
Q6N414_RHOPA/73-354--------------------------------------------------------------------------------
Q8KF88_CHLTE/91-313--------------------------------------------------------------------------------
Q82C69_STRAW/73-314--------------------------------------------------------------------------------
A6W4J4_KINRD/75-318--------------------------------------------------------------------------------
Q8NNL7_CORGL/75-325--------------------------------------------------------------------------------
A6LI36_PARD8/70-300--------------------------------------------------------------------------------
Q0S7Q3_RHOJR/72-303--------------------------------------------------------------------------------
Q0S430_RHOJR/96-330--------------------------------------------------------------------------------
AFTC_MYCS2/90-325--------------------------------------------------------------------------------
Q8KF86_CHLTE/520-743--------------------------------------------------------------------------------
A4X3Z6_SALTO/69-305--------------------------------------------------------------------------------
A5FWG6_ACICJ/133-359--------------------------------------------------------------------------------
Q8EXK5_LEPIN/120-368--------------------------------------------------------------------------------
Q6NG43_CORDI/98-348--------------------------------------------------------------------------------
A4F662_SACEN/84-314--------------------------------------------------------------------------------
A4YMG5_BRASO/52-323--------------------------------------------------------------------------------
Q8FNR9_COREF/132-368--------------------------------------------------------------------------------
Q8FNS1_COREF/85-333--------------------------------------------------------------------------------
Q2IKA8_ANADE/104-327--------------------------------------------------------------------------------
Q8NNL6_CORGL/93-341--------------------------------------------------------------------------------
A7I755_METB6/60-298--------------------------------------------------------------------------------
Q1AS45_RUBXD/75-307--------------------------------------------------------------------------------
Q0SHP5_RHOJR/98-332--------------------------------------------------------------------------------
A1TAY8_MYCVP/79-323--------------------------------------------------------------------------------
Q0KDP9_CUPNH/92-320--------------------------------------------------------------------------------
Q7MTZ4_PORGI/65-295--------------------------------------------------------------------------------
A4XDG1_SALTO/368-608--------------------------------------------------------------------------------
Q73W67_MYCPA/92-327--------------------------------------------------------------------------------
A0JZG6_ARTS2/141-392--------------------------------------------------------------------------------
Q2G5A3_NOVAD/106-326--------------------------------------------------------------------------------
Q8A2B6_BACTN/67-296--------------------------------------------------------------------------------
Q0C0G8_HYPNA/93-341--------------------------------------------------------------------------------
Q1ITA1_KORVE/92-336--------------------------------------------------------------------------------
Q4JVC2_CORJK/78-310--------------------------------------------------------------------------------
Q5Z2C4_NOCFA/88-323--------------------------------------------------------------------------------
Q0S1F1_RHOJR/88-319--------------------------------------------------------------------------------
Q5YR74_NOCFA/76-310--------------------------------------------------------------------------------
Q82B65_STRAW/52-287--------------------------------------------------------------------------------
A6WEV4_KINRD/63-293--------------------------------------------------------------------------------
Q6A9X9_PROAC/81-311--------------------------------------------------------------------------------
B2U6Q0_RALPJ/105-334--------------------------------------------------------------------------------
Q8A2B7_BACTN/70-300--------------------------------------------------------------------------------
A1K2E7_AZOSB/76-322--------------------------------------------------------------------------------
Q1LQN5_CUPMC/107-328--------------------------------------------------------------------------------
Q82AJ1_STRAW/66-309--------------------------------------------------------------------------------
A4F642_SACEN/68-304--------------------------------------------------------------------------------
Q6NEL0_CORDI/90-330--------------------------------------------------------------------------------
Q89QR1_BRADU/100-368--------------------------------------------------------------------------------
Q4JVV2_CORJK/84-315--------------------------------------------------------------------------------
Q5YTA9_NOCFA/80-311--------------------------------------------------------------------------------
Q73WN6_MYCPA/105-337--------------------------------------------------------------------------------
Q8FNS2_COREF/71-313--------------------------------------------------------------------------------
A4Z0F4_BRASO/98-322--------------------------------------------------------------------------------
Q1AX69_RUBXD/44-303--------------------------------------------------------------------------------
Q5YQC7_NOCFA/78-313--------------------------------------------------------------------------------
Q8FPI8_COREF/95-327--------------------------------------------------------------------------------
B2U6P6_RALPJ/116-345--------------------------------------------------------------------------------
Q4JU29_CORJK/82-316--------------------------------------------------------------------------------
A6LBC6_PARD8/70-301--------------------------------------------------------------------------------
Q20YY7_RHOPB/103-326--------------------------------------------------------------------------------
Q1LQN6_CUPMC/104-332--------------------------------------------------------------------------------
A1R1N0_ARTAT/81-341--------------------------------------------------------------------------------
Q2K4Q8_RHIEC/84-305--------------------------------------------------------------------------------
A4YMG3_BRASO/104-327--------------------------------------------------------------------------------
Q82GI4_STRAW/88-314--------------------------------------------------------------------------------
A7I7Y5_METB6/97-335--------------------------------------------------------------------------------
Q3L9S4_RHOE4/54-285--------------------------------------------------------------------------------
A4FR42_SACEN/78-325--------------------------------------------------------------------------------
Q9CBX0_MYCLE/105-336--------------------------------------------------------------------------------
A4FGU5_SACEN/82-312--------------------------------------------------------------------------------
Q82NJ1_STRAW/66-299--------------------------------------------------------------------------------
Q6NF60_CORDI/70-290--------------------------------------------------------------------------------
A4X4Q2_SALTO/67-302--------------------------------------------------------------------------------
A4XDF7_SALTO/84-339--------------------------------------------------------------------------------
B1W388_STRGG/68-304--------------------------------------------------------------------------------
B2HGU8_MYCMM/80-324--------------------------------------------------------------------------------
B4EGA7_BURCJ/104-332--------------------------------------------------------------------------------
B4EQ62_BURCJ/118-340--------------------------------------------------------------------------------
C5B043_METEA/93-315--------------------------------------------------------------------------------
AFTC_MYCTU/94-327--------------------------------------------------------------------------------
PIME_MYCTU/103-334--------------------------------------------------------------------------------
Q63I86_BURPS/104-334--------------------------------------------------------------------------------
Q63I87_BURPS/118-340--------------------------------------------------------------------------------
Q7AQD6_MYCLE/80-324--------------------------------------------------------------------------------
Q8NNL3_CORGL/89-325--------------------------------------------------------------------------------
R6X3N6_9PORP/49-278--------------------------------------------------------------------------------

PF13231

Q65D63_BACLD/64-222--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRADU/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
Q89IJ6_BRADU/52-213--------------------------------------------------------------------------------
Q5ZVN3_LEGPH/45-205--------------------------------------------------------------------------------
A5ULR9_METS3/66-231--------------------------------------------------------------------------------
Q2IKZ1_ANADE/72-232--------------------------------------------------------------------------------
Q2KCI5_RHIEC/48-207--------------------------------------------------------------------------------
Q6NCW5_RHOPA/88-248--------------------------------------------------------------------------------
Q82U54_NITEU/408-568--------------------------------------------------------------------------------

PF02366

PMT3_YEAST/62-306--------------------------------------------------------------------------------
POMT1_HUMAN/20-289--------------------------------------------------------------------------------
P73015_SYNY3/18-249--------------------------------------------------------------------------------
Y1220_AQUAE/1-229--------------------------------------------------------------------------------
ARNT_SALTY/3-237--------------------------------------------------------------------------------
P73065_SYNY3/8-275--------------------------------------------------------------------------------
PMT1_YEAST/54-297--------------------------------------------------------------------------------
PMT1_CANAL/70-313--------------------------------------------------------------------------------
PMT1_SCHPO/38-284--------------------------------------------------------------------------------
PMT2_YEAST/69-313--------------------------------------------------------------------------------
POMT2_HUMAN/62-306--------------------------------------------------------------------------------
PMT5_YEAST/50-293--------------------------------------------------------------------------------
P73712_SYNY3/7-243--------------------------------------------------------------------------------
POMT1_DROME/178-421--------------------------------------------------------------------------------
PMT4_YEAST/57-305--------------------------------------------------------------------------------
PMT4_SCHPO/63-310--------------------------------------------------------------------------------
ARNT_ECOLI/3-237--------------------------------------------------------------------------------
PMT6_YEAST/70-314--------------------------------------------------------------------------------
PMT6_CANAL/97-357--------------------------------------------------------------------------------

PF11028

A3U548_CROAH/37-215--------------------------------------------------------------------------------
R6XIR1_9BACT/37-217--------------------------------------------------------------------------------
F6GE14_LACS5/37-214--------------------------------------------------------------------------------
I6ZS60_MELRP/34-208--------------------------------------------------------------------------------
H8KSF5_SOLCM/35-209--------------------------------------------------------------------------------
A0LXN9_GRAFK/37-215--------------------------------------------------------------------------------
U5Q8D9_9BACT/37-212--------------------------------------------------------------------------------
R5I514_9BACT/37-217--------------------------------------------------------------------------------
Q2S0T5_SALRD/34-225--------------------------------------------------------------------------------
I0K9H0_9BACT/35-227--------------------------------------------------------------------------------
X5D9M2_9BACT/35-209--------------------------------------------------------------------------------
X5DZV9_9BACT/35-212--------------------------------------------------------------------------------
H1XP16_9BACT/34-208--------------------------------------------------------------------------------
B3ENQ9_CHLPB/34-209--------------------------------------------------------------------------------
H1YCC6_9SPHI/34-214--------------------------------------------------------------------------------
H8KSF6_SOLCM/35-213--------------------------------------------------------------------------------
F4KRQ6_HALH1/35-218--------------------------------------------------------------------------------
F4C302_SPHS2/34-214--------------------------------------------------------------------------------
E4T8Q1_PALPW/35-213--------------------------------------------------------------------------------
H1Y2D3_9SPHI/34-214--------------------------------------------------------------------------------
A4CGC2_ROBBH/37-215--------------------------------------------------------------------------------
I3YTY0_AEQSU/37-215--------------------------------------------------------------------------------
F3ZQH0_9BACE/35-214--------------------------------------------------------------------------------
G8TAS2_NIAKG/34-222--------------------------------------------------------------------------------
D3IE17_9BACT/35-214--------------------------------------------------------------------------------
F4C4U7_SPHS2/36-216--------------------------------------------------------------------------------
G8R038_OWEHD/36-216--------------------------------------------------------------------------------
A6GWD8_FLAPJ/36-224--------------------------------------------------------------------------------
T2KIW2_9FLAO/37-215--------------------------------------------------------------------------------
I3KW99_ORENI/21-184--------------------------------------------------------------------------------
F4KMK4_PORAD/39-231--------------------------------------------------------------------------------
I0AH06_IGNAJ/35-227--------------------------------------------------------------------------------
C3L447_AMOA5/43-223--------------------------------------------------------------------------------
H8XP42_FLAIG/37-215--------------------------------------------------------------------------------
Q74D30_GEOSL/39-214--------------------------------------------------------------------------------
R5BN47_9BACE/50-226--------------------------------------------------------------------------------
F0S690_PSESL/34-213--------------------------------------------------------------------------------
A9AXK7_HERA2/53-215--------------------------------------------------------------------------------
R6SBD9_9BACE/36-215--------------------------------------------------------------------------------
B3EAC9_GEOLS/36-209--------------------------------------------------------------------------------
L7W9H4_NONDD/36-210--------------------------------------------------------------------------------
B5EH69_GEOBB/37-210--------------------------------------------------------------------------------
A1ARZ9_PELPD/68-243--------------------------------------------------------------------------------
G1PIZ8_MYOLU/52-215--------------------------------------------------------------------------------
A5G4Z0_GEOUR/37-209--------------------------------------------------------------------------------
C9RN70_FIBSS/36-216--------------------------------------------------------------------------------
I0AM95_IGNAJ/32-228--------------------------------------------------------------------------------
D3BML5_POLPA/98-270--------------------------------------------------------------------------------
W8FBF7_9BACT/35-222--------------------------------------------------------------------------------
W0EVP7_9BACT/34-220--------------------------------------------------------------------------------
L7W937_NONDD/38-203--------------------------------------------------------------------------------
E4RU44_LEAB4/34-214--------------------------------------------------------------------------------
I0AN08_IGNAJ/34-208--------------------------------------------------------------------------------
A6LGG9_PARD8/35-214--------------------------------------------------------------------------------
A4AMM0_MARSH/37-215--------------------------------------------------------------------------------
C1A3K8_GEMAT/56-227--------------------------------------------------------------------------------
R6SBV2_9BACE/35-216--------------------------------------------------------------------------------
I0I530_CALAS/46-211--------------------------------------------------------------------------------
G8X584_FLACA/36-214--------------------------------------------------------------------------------
W0RJK7_9BACT/57-227--------------------------------------------------------------------------------
D0LFQ9_HALO1/25-195--------------------------------------------------------------------------------
R5W9J1_9BACT/35-214--------------------------------------------------------------------------------
K4IB40_PSYTT/37-215--------------------------------------------------------------------------------
E6X4M4_CELAD/37-216--------------------------------------------------------------------------------
D0MDF1_RHOM4/34-225--------------------------------------------------------------------------------
I3ZYA9_ORNRL/34-223--------------------------------------------------------------------------------
R7F5J7_9BACT/37-217--------------------------------------------------------------------------------
G8TQ81_NIAKG/34-212--------------------------------------------------------------------------------
A2TXJ8_9FLAO/37-215--------------------------------------------------------------------------------
I0AH07_IGNAJ/47-229--------------------------------------------------------------------------------
Q8KAY9_CHLTE/41-217--------------------------------------------------------------------------------
C6W6V6_DYAFD/35-215--------------------------------------------------------------------------------
F0NYC1_WEEVC/36-224--------------------------------------------------------------------------------
B4S581_PROA2/34-210--------------------------------------------------------------------------------
B3QWD0_CHLT3/33-211--------------------------------------------------------------------------------
Q39VU9_GEOMG/36-207--------------------------------------------------------------------------------
C6Y1Y3_PEDHD/35-207--------------------------------------------------------------------------------
C7M410_CAPOD/37-223--------------------------------------------------------------------------------
R5P289_9BACT/43-218--------------------------------------------------------------------------------
G2Z4K2_FLABF/39-217--------------------------------------------------------------------------------
R6AGR2_9BACT/35-214--------------------------------------------------------------------------------
B4SC86_PELPB/34-212--------------------------------------------------------------------------------
F4AVR9_DOKS4/37-216--------------------------------------------------------------------------------
Q7MT47_PORGI/37-226--------------------------------------------------------------------------------
I4AKN9_FLELS/34-232--------------------------------------------------------------------------------
I2EW61_EMTOG/35-215--------------------------------------------------------------------------------
D6D6N6_9BACE/37-216--------------------------------------------------------------------------------
R7DIG7_9PORP/35-214--------------------------------------------------------------------------------
C1A7V9_GEMAT/57-227--------------------------------------------------------------------------------
R5B2K5_9BACE/47-228--------------------------------------------------------------------------------
C0R1J1_BRAHW/121-297--------------------------------------------------------------------------------
H1Z8K4_MYROD/37-215--------------------------------------------------------------------------------
R5RQ99_9BACE/43-220--------------------------------------------------------------------------------
W5MZF0_LEPOC/41-204--------------------------------------------------------------------------------
F9YU79_CAPCC/36-215--------------------------------------------------------------------------------
C7PKN8_CHIPD/34-212--------------------------------------------------------------------------------
H6LAI5_SAPGL/35-215--------------------------------------------------------------------------------
J9R805_RIEAN/38-218--------------------------------------------------------------------------------
B6YRJ5_AZOPC/37-217--------------------------------------------------------------------------------
C6Y0P2_PEDHD/34-214--------------------------------------------------------------------------------
R5GFJ4_9BACT/35-214--------------------------------------------------------------------------------
TM260_DICDI/139-313--------------------------------------------------------------------------------
R5G4M3_9PORP/37-222--------------------------------------------------------------------------------
C6X5R1_FLAB3/37-217--------------------------------------------------------------------------------
D2QNX1_SPILD/35-215--------------------------------------------------------------------------------
E4TV18_MARTH/50-230--------------------------------------------------------------------------------
R7HQZ6_9BACT/35-215--------------------------------------------------------------------------------
F2I9U5_FLUTR/34-221--------------------------------------------------------------------------------
I3Z145_BELBD/35-215--------------------------------------------------------------------------------
Q11YB8_CYTH3/35-214--------------------------------------------------------------------------------
R6CJ33_9BACT/35-214--------------------------------------------------------------------------------

PF02516

STT3A_HUMAN/17-484--------------------------------------------------------------------------------
STT3_CAEEL/19-506--------------------------------------------------------------------------------
STT3_YEAST/15-475--------------------------------------------------------------------------------
STT3_SCHPO/23-509--------------------------------------------------------------------------------
O29867_ARCFU/18-493--------------------------------------------------------------------------------
O27660_METTH/24-582--------------------------------------------------------------------------------
O27928_METTH/21-478--------------------------------------------------------------------------------
O27920_METTH/13-461--------------------------------------------------------------------------------
Y1525_METJA/33-650--------------------------------------------------------------------------------
PGLB_CAMJE/11-477--------------------------------------------------------------------------------

PF03901

SMP3_YEAST/6-401--------------------------------------------------------------------------------
GPI10_SCHPO/4-414--------------------------------------------------------------------------------
ALG9_SCHPO/16-438--------------------------------------------------------------------------------
ALG9_ARATH/48-451--------------------------------------------------------------------------------
ALG9_YEAST/10-414--------------------------------------------------------------------------------
ALG12_CAEEL/6-405--------------------------------------------------------------------------------
GPI10_YEAST/16-484--------------------------------------------------------------------------------
SMP3_SCHPO/9-412--------------------------------------------------------------------------------
Q9VBV8_DROME/75-498--------------------------------------------------------------------------------
PIGB_HUMAN/62-449--------------------------------------------------------------------------------
PIGB_DROME/5-396--------------------------------------------------------------------------------
ALG9_MOUSE/60-482--------------------------------------------------------------------------------
PIGZ_DROME/18-541--------------------------------------------------------------------------------
YTH3_CAEEL/55-472--------------------------------------------------------------------------------
F4K887_ARATH/41-451--------------------------------------------------------------------------------
GPI10_TRYB2/4-432--------------------------------------------------------------------------------

PF09852

Q119E7_TRIEI/30-487--------------------------------------------------------------------------------
Q1CZA2_MYXXD/39-471--------------------------------------------------------------------------------
Q7U446_SYNPX/31-511--------------------------------------------------------------------------------
A5GS07_SYNR3/40-521--------------------------------------------------------------------------------
Q119E6_TRIEI/27-490--------------------------------------------------------------------------------
Q82RR9_STRAW/82-508--------------------------------------------------------------------------------
Q4J6X7_SULAC/32-488--------------------------------------------------------------------------------
A5URL3_ROSS1/78-571--------------------------------------------------------------------------------
Q4J7K9_SULAC/43-493--------------------------------------------------------------------------------
Q9HK92_THEAC/39-557--------------------------------------------------------------------------------
A5GNZ8_SYNPW/38-520--------------------------------------------------------------------------------
Q4J7K8_SULAC/16-462--------------------------------------------------------------------------------
A5GR01_SYNR3/37-521--------------------------------------------------------------------------------
Q8F2H0_LEPIN/76-512--------------------------------------------------------------------------------
P73520_SYNY3/35-464--------------------------------------------------------------------------------
Q7U443_SYNPX/37-518--------------------------------------------------------------------------------
Q7VDJ5_PROMA/39-469--------------------------------------------------------------------------------
A5V1J1_ROSS1/34-511--------------------------------------------------------------------------------
Q7U444_SYNPX/29-448--------------------------------------------------------------------------------
Q10XG3_TRIEI/32-516--------------------------------------------------------------------------------
Q7V4G7_PROMM/40-520--------------------------------------------------------------------------------
Q7V4G8_PROMM/29-457--------------------------------------------------------------------------------

PF09913

Q1MP06_LAWIP/21-414.EL.SC...GKI......LLSKGEKVGGSNLPTS-------------IQAF....-------------------------
A4VVV9_STRSY/36-414.NILFD............SPTSRDTEAMNELR..-------------........-------------------------
A0LS06_ACIC1/16-395.ANVRGEFRG........TPQPADHIPYEAFTVP-------------ATL.....-------------------------
Q5Z3D8_NOCFA/116-537.QV.AH...GGF......LPTEIEDDRGVAYGGV-------------IPPGIDDL-------------------------
Q5M3E5_STRT2/28-432GST.SE...GSI......EKGEQELIN.......-------------........-------------------------
A5UMR8_METS3/71-461.IV.ST...GELSTNYVPIPNTTANGY.......-------------........-------------------------
A1W3H2_ACISJ/39-436.QV.SH...GQF......LADRREEQDYGGEIDV-------------AALE....-------------------------
Q6AGK9_LEIXX/24-391..................CADGIVKGTCDAGSRS-------------GHYTV...-------------------------
A5UN71_METS3/84-467.SI.TE...GVL......YPVKTPNGY.......-------------........-------------------------
Q01XM3_SOLUE/38-442.LI.SR...GEF......VGRGAPRVPGTVVLSM-------------MRYPEMGE-------------------------
Q83H24_TROWT/46-427..................CALGDRPGLCESSGIK-------------DAKKVPTT-------------------------
Q9CIZ8_LACLA/68-463.RL.AD...GQL......FTREQEKQPDWDTVEK-------------Y.......-------------------------
Q2JAW9_FRASC/81-503WTGTPGRLAHPSFGNGPGRAERIDWINRNSRVFA-------------LPAGL...-------------------------
Q0RGM1_FRAAA/18-412WSGTPGRLAHPAFGAQPGAPERIDWINRNSRVFR-------------LPAGL...-------------------------
A5G180_ACICJ/39-445.GLLDFDILGHR......AVIGHTQVSGLFVNDG-------------........-------------------------
Q97N14_CLOAB/17-411.QI.ST...GQM......FEQKNNSGIGGYLPQN-------------LIKT....-------------------------
A5UKJ8_METS3/70-455.LT.SE...GGL......IPNYHENQGYF.....-------------........-------------------------
Q9A0F5_STRP1/71-454.YI.SE...GDI.....NLTNNNKKL........-------------........-------------------------

PF02364

FKS1_YEAST/808-1631IIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKI.............LAEETAAY.........................
G0WGB2_NAUDC/693-1553IIKEESFSNRMTVLEYLKLLYPSDWKCFIRDTKL.............VDKQLEAD.........................
BGS4_SCHPO/872-1706IIREEDQLSRVTLLEYLKQLHPVEWDCFVKDTKI.............LVEENAPY.........................
A5DFP6_PICGU/617-1414VIRRS.KQTQITLLDYLKSLSSSDWTNFVRDTRVADDEKFGCRFPIPLTSEGTTD.........................
D8R536_SELML/856-1616LLDENEEG..VSILFYLQKIFPDEWINFLERMSS.............LGIK.ESD.........................
G3BF86_CANTC/689-1496IIKED.KGSKVSILDYLKLLNKSDWNAFVQDTKI.............LTNIPDRP.........................
S2JMJ1_MUCC1/751-1581IIREEDKNARITLLEYLKQLHPFEWDNFVKDTKV.............LADEEGQE.........................
Q6C549_YARLI/838-1663IIREDDQFSRVTLLEYLKQLHPVEWDCFVKDTKI.............LAEETAGF.........................
BGS2_SCHPO/844-1666IIREQDKLSRVTLLEYLKQLHANEWKCFVRDTKI.............LAEEDALS.........................
C5DDB6_LACTC/685-1519IIKEESTKSRITLLEYLKYLYPTEWECFVRDTKL.............IAVENCSI.........................
C5DVI4_ZYGRC/728-1590IIKEESSKSKITVLEYLKQLHPLEWDCFVRDTKL.............LNIEKNAV.........................
G8BP05_TETPH/703-1537IIREESSKTKISTLEYLKHLYSEEWDCFIKDTKL.............LKMEKDAL.........................
F4RFS0_MELLP/756-1575IIREEDQNARVTLLEYLKQLHPVEWDNFVRDTKI.............LAEEANVF.........................
A7TG32_VANPO/694-1542IIKEESSKARITVLEYLKQLHSTEWNCFVRDTKL.............LKTEKDAI.........................
B9RVZ7_RICCO/412-1177LWTENEDG..ISMLYYLQTIYDDEWKNFMERMRR.............EGMVNDKE.........................
E6ZX94_SPORE/765-1584IIREEDQNTRVTLLEYLKQLHPVEWDNFVKDTKI.............LAEESQGF.........................
F0XEB1_GROCL/867-1692IIREDEPYSRVTQLEYLKQLHPHEWDCFVKDTKI.............LADETAQF.........................
A3GFC1_PICST/627-1453IIKED.KDSKLSLLEYLKQLHPNDWECFVQDSKV.............LQQISSAN.........................
H2B091_KAZAF/695-1551IIKEESSKSRITILEYLKQLHPTEWNCFVRDTKL.............LNQERNSS.........................
K0KXK3_WICCF/839-1738IIREDNANSRITLMEYLKQLYPTEWDCFVKDTKL.............LATNNGSLPDTYVKYDLTNRWKNDLGGPLDYRV
G0VE27_NAUCC/691-1546VIKEESPSNKLTVLEYLKQLYPSEWLNFVRDTKS.............LNKPSFKK.........................
M0Z2P0_HORVD/795-1572LYKENEDG..ISILYYLKQIYPDEWEFFVERMKR.............EGMSDMKE.........................
Q5K6T7_CRYNJ/779-1594IIREEDQNTRVTLLEYLKQLHPVEWDNFVRDTKI.............LAEESDAF.........................
I1MEJ0_SOYBN/899-1668LRKENEDG..ITTLFYLQKIYEDEWKNFMERMHR.............EGLKDEEA.........................
Q75EM6_ASHGO/644-1429IVKGENDSTHVILLEYLKLLYADDWKTFIQETGS.............LYNDDDEK.........................
A3GH41_PICST/602-1410IIREEEQYSHVTMLEYLKSLHPLEWSCFVRDTKL.............LAEEFDTE.........................
C5M4K6_CANTT/600-1409IIREEEQYSHVTMLEYLKSLHPLEWSCFVKDTKM.............LAEEFETD.........................
G3AGW3_SPAPN/626-1428LISHS.ALSKLTLLDYLKQLYPSEWEAFVKDSKM.............LETIDIDD.........................
G8B602_CANPC/590-1379LIKEQ.SFSKLTLLEYLKQLHSKEWSSFVKDSKM.............IQSLDDDD.........................
L8WXK6_THACA/691-1484IIREEDQNTRVTLLEYLKQLHPLEWDNFVRDTKI.............LAEEVDVP.........................
W1QEZ3_OGAPD/758-1567IIKKEDEYSNVTLLEYLKQLYPLEWHNFVRDTKL.............LAKESELN.........................
S2JUI0_MUCC1/639-1467IIREEDTSTRVTLLEYLKQLHAVEWENFVKDTKM.............LVDDDDRR.........................
A9RK32_PHYPA/857-1633LKEENEDG..VTILFYLQRIFPEDWLNFLERMKK.............LELN.ESE.........................
I1IFT6_BRADI/1065-1817LEDQNEDG..VSVLFYLQKIYPDEWKNFLERVEC.............KTEEELRE.........................
Q6BYS5_DEBHA/725-1546IIKED.KHSKVSLLEYLKSLHSTDWELFVEDTKI.............LSLVSSQP.........................
K4B948_SOLLC/878-1645LRSPNEDG..VSTIFYLQKIYNDEWENFMERMRT.............EGMKDERE.........................
CALSB_ARATH/870-1637LRAENEDG..ISTLFYLQRIYEDEWVNFLERMRR.............EGAENEND.........................
K5X5R3_AGABU/768-1585IIREEDQNTRVTLLEYLKQLHPVEWENFVKDTKI.............LAEESAMF.........................
Q6CDD3_YARLI/840-1684IIKEDGENSRVTLLEYLKQLHANEWDNFVCDSKL.............MHDFMHNN.........................
W1PHJ3_AMBTC/904-1670LHIENEDG..ISILFYLQRIFPDEWLNFLERMRR.............EGMKDQGE.........................
A5DBZ8_PICGU/697-1497IIKESDMYSHVTMLEYLKSLHPREWESFVCDTKM.............LAEEYDSE.........................
J7RLI4_KAZNA/694-1544IIKEESLKSKMPVLEYLKQLHPKEWECFIRDTKL.............LMSELNIS.........................
B9I122_POPTR/880-1647IRTPNEDG..ISIIFYLQKIYEDEWNNFMERMRR.............EGTENENE.........................
Q4WLT4_ASPFU/845-1663IIREDEPYSRVTLLEYLKQLHPHEWDCFVKDTKI.............LADETSQF.........................
K2RW51_MACPH/795-1619IIREDDPYSRVTLLEYLKQLYPHEWDCFVKDTKI.............LAEESTGV.........................
FKS3_YEAST/694-1542IIREESPKSKITVLEYLKHLHPTEWECFVKDTKL.............LSMEKSFL.........................
B6K1V9_SCHJY/528-1348IIREEDQLSRVTLLEYLKQLYPVEWKNFVADTKM.............LAEESKGS.........................
C4R051_KOMPG/700-1508IIKEEDENSQLTLLEYLKQLHPAEWVNFVEDTKI.............LAEEINSS.........................
F8QGW8_SERL3/687-1503IIREEDQNTRVTLLEYLKQLHPVEWDNFVKDTKI.............LAEESDVV.........................
Q5A9Y9_CANAL/588-1367LIKEQ.SFSKLTLLDYLKQLHSKEWDSFVQDSKM.............IQTIKEMD.........................
CALSC_ARATH/876-1645LRNETEDG..ISTLYYLQTIYADEWKNFKERMHR.............EGIKTDSE.........................
A9TZ19_PHYPA/865-1623LKEENEDG..ITILFYLQRIFPEDWLNFLERMKK.............KGLL.ELN.........................
W1QB78_OGAPD/694-1512IIKED.PSSKISLLEYLKHMLPHEWDYFVRDTKI.............ISYSEGEK.........................
G8Y1P4_PICSO/734-1542IIREEDQYSHVTMLEYLKQLHQLEWACFVKDTKM.............LAEEFDTD.........................
M7P3D9_PNEMU/884-1710IIREDDQLSRVTLLEYLKQLHPVEWDCFVKDTKI.............LAEETSLY.........................
Q751P2_ASHGO/697-1537IIKEESPKSRITLLEYLKHLHPTEWECFVHDTKL.............LAIEKSAR.........................
C4QVL3_KOMPG/679-1490IIKED.QNSRLTLLEYLKQIYPIEWGCFVNDTKL.............MAHATGDY.........................
G8ZYC9_TORDC/696-1542VIKEESNKSKITVLEYLKQLHSAEWDSFVRDTKL.............LSMEKDAT.........................
K7M2P2_SOYBN/849-1612LRVGNEDG..ISTLYYLQTIYDDEWKNFMERMKR.............EGMNNERD.........................
Q6FIJ9_CANGA/752-1597IIREESQSSKITVLEYLKYLHPEEWDCFVKDTKI.............LSAEKKAD.........................
S9X5V3_SCHCR/777-1593IIREQDPMSRITLLEYLKQLYPHDWNCFVQDTKL.............MAGETGPL.........................
B6K096_SCHJY/781-1599IIREQDPMSRITLLEYLKQLYPNEWEYFVRDTKL.............LAGEMDAD.........................
C7ZN13_NECH7/785-1607IIREEDQYSRLTMLEYLKQLHPHEWSCFVRDTKA.............LAGEDEPP.........................
G8JPJ3_ERECY/666-1455IVKGESDSTHVILLEYLKLLYADDWKTFIQETGS.............LYNEDEEK.........................
Q6CTB0_KLULA/691-1518IIKEESPNSKITLLEYLKQLHPTEWECFVRDSKL.............LAIENGHL.........................
G3BBN7_CANTC/598-1405IIREEQQYSNITMLEYLKKLHPLEWSCFIKDTRL.............LAEEFDTD.........................
G8YKZ4_PICSO/698-1523IIKED.KKSKVSQLEYLKKLHKTDWELFVEDTKL.............LTLISSQQ.........................
I1HRP2_BRADI/889-1659LRRENEDG..ISILFYLQKIYEDDWANFLERMRR.............EGMVNDDG.........................

PF04602

V9XJW7_9NOCA/21-675--------------------------------------------------------------------------------
H6MU20_GORPV/33-681--------------------------------------------------------------------------------
Q5Z3F6_NOCFA/13-659--------------------------------------------------------------------------------
W5T763_9NOCA/25-694--------------------------------------------------------------------------------
D0LC62_GORB4/25-672--------------------------------------------------------------------------------
F5YU82_MYCSD/4-645--------------------------------------------------------------------------------
A4FLJ6_SACEN/6-630--------------------------------------------------------------------------------
EMBB_MYCLE/22-673--------------------------------------------------------------------------------
E9T230_RHOHA/21-668--------------------------------------------------------------------------------
A4F676_SACEN/36-675--------------------------------------------------------------------------------
D6ZA32_SEGRD/18-683--------------------------------------------------------------------------------
EMBC_MYCTU/27-682--------------------------------------------------------------------------------
W5T6N4_9NOCA/11-663--------------------------------------------------------------------------------
B1VE75_CORU7/37-709--------------------------------------------------------------------------------
W5WNE4_9CORY/27-693--------------------------------------------------------------------------------
V9XEG0_9NOCA/30-675--------------------------------------------------------------------------------
B1MEM1_MYCA9/17-667--------------------------------------------------------------------------------
F8DYG1_CORRG/20-684--------------------------------------------------------------------------------
U3GXX2_9CORY/12-670--------------------------------------------------------------------------------
A1TGU6_MYCVP/6-653--------------------------------------------------------------------------------
F6EEB9_HOYSD/14-665--------------------------------------------------------------------------------
Q5YYW4_NOCFA/29-683--------------------------------------------------------------------------------
D5UMC1_TSUPD/6-651--------------------------------------------------------------------------------
Q745M3_MYCPA/11-658--------------------------------------------------------------------------------
V9XIW6_9NOCA/28-673--------------------------------------------------------------------------------
J9S8T7_9ACTN/54-705--------------------------------------------------------------------------------
C4LG43_CORK4/44-710--------------------------------------------------------------------------------
A0R614_MYCS2/24-675--------------------------------------------------------------------------------
C0ZLV7_RHOE4/28-666--------------------------------------------------------------------------------
V5X6X3_MYCNE/4-651--------------------------------------------------------------------------------
H6MU24_GORPV/10-674--------------------------------------------------------------------------------
W5XXY2_9CORY/8-674--------------------------------------------------------------------------------
H6RD31_NOCCG/25-671--------------------------------------------------------------------------------
H5X1D6_9PSEU/4-623--------------------------------------------------------------------------------
D5UNZ8_TSUPD/31-682--------------------------------------------------------------------------------
D5UNZ7_TSUPD/12-675--------------------------------------------------------------------------------
W5TDC8_9NOCA/23-685--------------------------------------------------------------------------------
Q745M2_MYCPA/11-679--------------------------------------------------------------------------------
F6EEB8_HOYSD/16-671--------------------------------------------------------------------------------
D0LC64_GORB4/31-681--------------------------------------------------------------------------------
D5UNZ9_TSUPD/37-686--------------------------------------------------------------------------------
E9T231_RHOHA/29-674--------------------------------------------------------------------------------
L0J7Q5_9MYCO/5-653--------------------------------------------------------------------------------
K0ELF6_9NOCA/24-672--------------------------------------------------------------------------------
H6MU21_GORPV/21-696--------------------------------------------------------------------------------
L0J471_9MYCO/5-652--------------------------------------------------------------------------------
D7WBK3_9CORY/39-680--------------------------------------------------------------------------------
C1A0M7_RHOE4/26-667--------------------------------------------------------------------------------
Q6NK78_CORDI/12-664--------------------------------------------------------------------------------
D6ZD22_SEGRD/22-677--------------------------------------------------------------------------------
H6R7H1_NOCCG/16-659--------------------------------------------------------------------------------
G8RNM8_MYCRN/11-660--------------------------------------------------------------------------------
A0R613_MYCS2/6-652--------------------------------------------------------------------------------
EMBA_MYCLE/11-678--------------------------------------------------------------------------------
B1MEM2_MYCA9/16-665--------------------------------------------------------------------------------
Q0S9C1_RHOJR/40-687--------------------------------------------------------------------------------
E9SYL2_RHOHA/31-680--------------------------------------------------------------------------------
D0LC65_GORB4/7-654--------------------------------------------------------------------------------
J9S5V1_9ACTN/37-692--------------------------------------------------------------------------------
W5TPG9_9NOCA/25-684--------------------------------------------------------------------------------
Q0SFU9_RHOJR/35-682--------------------------------------------------------------------------------
D0LC63_GORB4/10-666--------------------------------------------------------------------------------
C3PJ41_CORA7/15-655--------------------------------------------------------------------------------
A0R612_MYCS2/13-668--------------------------------------------------------------------------------
Q0S9C0_RHOJR/14-655--------------------------------------------------------------------------------
B1MEM5_MYCA9/31-682--------------------------------------------------------------------------------
D0LC66_GORB4/32-701--------------------------------------------------------------------------------

PF04188

GPI18_YEAST/2-433--------------------------------------------------------------------------------
PIGV_HUMAN/8-493--------------------------------------------------------------------------------
Q6NKT6_ARATH/13-489--------------------------------------------------------------------------------

PF05208

M4B3B6_HYAAE/47-400--------------------------------------------------------------------------------
ALG3_SCHPO/28-384--------------------------------------------------------------------------------
C1N7Z4_MICPC/3-383--------------------------------------------------------------------------------
G3B1L9_CANTC/44-430--------------------------------------------------------------------------------
H2B2E5_KAZAF/49-418--------------------------------------------------------------------------------
K7J227_NASVI/23-385--------------------------------------------------------------------------------
S8AK53_DACHA/26-392--------------------------------------------------------------------------------
D2A6B4_TRICA/38-438--------------------------------------------------------------------------------
E9IW57_SOLIN/49-411--------------------------------------------------------------------------------
N1PIB4_DOTSN/28-383--------------------------------------------------------------------------------
E3LRP4_CAERE/25-392--------------------------------------------------------------------------------
M0RYH3_MUSAM/65-429--------------------------------------------------------------------------------
C8VQM2_EMENI/22-377--------------------------------------------------------------------------------
E3QV49_COLGM/32-397--------------------------------------------------------------------------------
B2AMZ6_PODAN/32-391--------------------------------------------------------------------------------
Q5TWR0_ANOGA/52-490--------------------------------------------------------------------------------
M3JDA4_CANMX/610-996--------------------------------------------------------------------------------
K0KP51_WICCF/61-446--------------------------------------------------------------------------------
X6LVN7_RETFI/23-432--------------------------------------------------------------------------------
N1JDU5_BLUG1/30-393--------------------------------------------------------------------------------
K5XHY8_AGABU/29-387--------------------------------------------------------------------------------
C5M8N0_CANTT/50-438--------------------------------------------------------------------------------
H3ATY3_LATCH/48-407--------------------------------------------------------------------------------
C5DQX2_ZYGRC/29-403--------------------------------------------------------------------------------
T1KW27_TETUR/32-391--------------------------------------------------------------------------------
E5QCI3_CAEEL/25-392--------------------------------------------------------------------------------
A4S939_OSTLU/24-393--------------------------------------------------------------------------------
A4HP72_LEIBR/7-391--------------------------------------------------------------------------------
K1XMH6_MARBU/34-397--------------------------------------------------------------------------------
B4NMK9_DROWI/51-467--------------------------------------------------------------------------------
U7Q833_SPOS1/49-412--------------------------------------------------------------------------------
E3JZB5_PUCGT/28-389--------------------------------------------------------------------------------
B6Q4R6_TALMQ/22-377--------------------------------------------------------------------------------
ALG3_ASPCL/84-439--------------------------------------------------------------------------------
S3EFY4_GLAL2/34-397--------------------------------------------------------------------------------
F1P0T5_CHICK/46-406--------------------------------------------------------------------------------
G8JVY1_ERECY/53-420--------------------------------------------------------------------------------
J7RGJ6_KAZNA/49-415--------------------------------------------------------------------------------
F9XK44_ZYMTI/23-383--------------------------------------------------------------------------------
R4X949_TAPDE/11-374--------------------------------------------------------------------------------
I2FPC0_USTH4/26-382--------------------------------------------------------------------------------
ALG3_KLULA/54-427--------------------------------------------------------------------------------
G3PQJ8_GASAC/14-373--------------------------------------------------------------------------------
K4CV67_SOLLC/31-394--------------------------------------------------------------------------------
M1VU16_CLAP2/32-396--------------------------------------------------------------------------------
U5HGX6_USTV1/69-433--------------------------------------------------------------------------------
K9G3P7_PEND2/24-384--------------------------------------------------------------------------------
T1IB96_RHOPR/32-396--------------------------------------------------------------------------------
B6K873_SCHJY/24-379--------------------------------------------------------------------------------
ALG3_DEBHA/45-438--------------------------------------------------------------------------------
B4KQ14_DROMO/49-491--------------------------------------------------------------------------------
E9FQN9_DAPPU/50-398--------------------------------------------------------------------------------
ALG3_PICST/52-442--------------------------------------------------------------------------------
S2JIL9_MUCC1/51-411--------------------------------------------------------------------------------
T1FMM7_HELRO/35-390--------------------------------------------------------------------------------
B7QF54_IXOSC/55-405--------------------------------------------------------------------------------
V5GAA3_BYSSN/22-377--------------------------------------------------------------------------------
D7FLD1_ECTSI/36-398--------------------------------------------------------------------------------
E7K994_YEASA/48-417--------------------------------------------------------------------------------
G8BZ82_TETPH/53-422--------------------------------------------------------------------------------
C5GLF5_AJEDR/22-377--------------------------------------------------------------------------------
J3K1V3_COCIM/22-377--------------------------------------------------------------------------------
Q4E4B0_TRYCC/8-370--------------------------------------------------------------------------------
Q4Q1L8_LEIMA/8-391--------------------------------------------------------------------------------
G4VF09_SCHMA/25-373--------------------------------------------------------------------------------
G0VFQ4_NAUCC/49-421--------------------------------------------------------------------------------
ALG3_PICGU/60-451--------------------------------------------------------------------------------
D6RKR7_COPC7/33-391--------------------------------------------------------------------------------
C7Z6Q8_NECH7/32-396--------------------------------------------------------------------------------
F2U0U1_SALR5/24-375--------------------------------------------------------------------------------
Q59QZ3_CANAL/67-487--------------------------------------------------------------------------------
K3XI42_SETIT/33-396--------------------------------------------------------------------------------
C1E6U6_MICCC/1-365--------------------------------------------------------------------------------
M7UJ49_BOTF1/42-405--------------------------------------------------------------------------------
H9GEH2_ANOCA/2-363--------------------------------------------------------------------------------
F4PBM6_BATDJ/69-446--------------------------------------------------------------------------------
ALG3_ASHGO/46-411--------------------------------------------------------------------------------
ALG3_NEUCR/38-404--------------------------------------------------------------------------------
W5JA52_ANODA/54-487--------------------------------------------------------------------------------
G2QLH4_MYCTT/46-410--------------------------------------------------------------------------------
E0VE58_PEDHC/46-408--------------------------------------------------------------------------------
L8G9R9_PSED2/26-389--------------------------------------------------------------------------------
I3N142_ICTTR/47-406--------------------------------------------------------------------------------
B0D3E3_LACBS/29-387--------------------------------------------------------------------------------
G6D7P8_DANPL/38-461--------------------------------------------------------------------------------
A0A0D2U908_CAPO3/41-396--------------------------------------------------------------------------------
B4MDV8_DROVI/49-475--------------------------------------------------------------------------------
S9XFL7_SCHCR/33-388--------------------------------------------------------------------------------
G3AUB5_SPAPN/46-435--------------------------------------------------------------------------------
R9P1A8_PSEHS/26-382--------------------------------------------------------------------------------
T5AE24_OPHSC/31-395--------------------------------------------------------------------------------
V5ENX1_KALBG/26-382--------------------------------------------------------------------------------
G0RBH9_HYPJQ/25-389--------------------------------------------------------------------------------
A7TI38_VANPO/47-414--------------------------------------------------------------------------------
S7ZPA3_PENO1/24-378--------------------------------------------------------------------------------
I4Y5F8_WALMC/28-386--------------------------------------------------------------------------------
M9LSR1_PSEA3/61-417--------------------------------------------------------------------------------
G3J6N9_CORMM/40-406--------------------------------------------------------------------------------
G0SZN6_RHOT2/81-458--------------------------------------------------------------------------------
E3RP57_PYRTT/27-387--------------------------------------------------------------------------------
H2YCK3_CIOSA/39-392--------------------------------------------------------------------------------
ALG3_KOMPG/40-432--------------------------------------------------------------------------------
I1NB48_SOYBN/44-418--------------------------------------------------------------------------------
V2XSY5_MONRO/23-381--------------------------------------------------------------------------------
S3D164_OPHP1/66-445--------------------------------------------------------------------------------
D8PWW0_SCHCM/28-385--------------------------------------------------------------------------------
G4MX55_MAGO7/32-396--------------------------------------------------------------------------------
ALG3_CANGA/46-411--------------------------------------------------------------------------------
U9SRB0_RHIID/43-401--------------------------------------------------------------------------------
A9S9E9_PHYPA/15-380--------------------------------------------------------------------------------
A0A0D1DTA4_USTMA/26-382--------------------------------------------------------------------------------
R9A916_WALI9/668-1026--------------------------------------------------------------------------------
A8WH14_XENTR/49-408--------------------------------------------------------------------------------
F0X8A8_GROCL/32-398--------------------------------------------------------------------------------
G0WBV5_NAUDC/62-452--------------------------------------------------------------------------------
E4ZQ47_LEPMJ/110-470--------------------------------------------------------------------------------
W1QI94_OGAPD/44-429--------------------------------------------------------------------------------
Q17I48_AEDAE/60-492--------------------------------------------------------------------------------
J9JKC3_ACYPI/34-397--------------------------------------------------------------------------------
ALG3_ARATH/37-401--------------------------------------------------------------------------------
F4QBL4_DICFS/50-404--------------------------------------------------------------------------------
E2BFG0_HARSA/50-411--------------------------------------------------------------------------------
K2RJR1_MACPH/22-381--------------------------------------------------------------------------------
A0A0C4DNJ3_MAGP6/32-396--------------------------------------------------------------------------------
K5UZ89_PHACS/35-392--------------------------------------------------------------------------------
B7FU52_PHATC/1-358--------------------------------------------------------------------------------
E1FRZ8_LOALO/22-398--------------------------------------------------------------------------------
G8YQ30_PICSO/46-439--------------------------------------------------------------------------------
I2H2F8_TETBL/47-416--------------------------------------------------------------------------------
Q38AV3_TRYB2/9-364--------------------------------------------------------------------------------
R0IS40_SETT2/23-383--------------------------------------------------------------------------------
B8C606_THAPS/2-402--------------------------------------------------------------------------------
NT56_DROME/50-470--------------------------------------------------------------------------------
F1QAD8_DANRE/41-400--------------------------------------------------------------------------------
E2AE79_CAMFO/50-412--------------------------------------------------------------------------------
M2RJ12_CERS8/31-389--------------------------------------------------------------------------------
M7NVY2_PNEMU/31-392--------------------------------------------------------------------------------
K1PJL2_CRAGI/29-393--------------------------------------------------------------------------------
K3WI15_PYTUL/49-402--------------------------------------------------------------------------------
G3YDP3_ASPNA/22-377--------------------------------------------------------------------------------
G8ZRL4_TORDC/46-409--------------------------------------------------------------------------------
B4J870_DROGR/49-472--------------------------------------------------------------------------------
F9FME8_FUSOF/32-396--------------------------------------------------------------------------------
A7RPJ4_NEMVE/13-362--------------------------------------------------------------------------------
G4TDK5_SERID/21-386--------------------------------------------------------------------------------
S8FYD7_FOMPI/36-394--------------------------------------------------------------------------------
M2MJW6_BAUCO/22-383--------------------------------------------------------------------------------
F2PUQ0_TRIEC/23-378--------------------------------------------------------------------------------
ALG3_CRYNJ/40-416--------------------------------------------------------------------------------
B9I9T5_POPTR/29-388--------------------------------------------------------------------------------
E6ZW66_SPORE/26-382--------------------------------------------------------------------------------
C4YB28_CLAL4/53-446--------------------------------------------------------------------------------
U4KZB6_PYROM/25-385--------------------------------------------------------------------------------
G7DY72_MIXOS/36-395--------------------------------------------------------------------------------
C5DE51_LACTC/56-423--------------------------------------------------------------------------------

PF14897

D0MGT8_RHOM4/10-327--------------------------------------------------------------------------------
A6L8S3_PARD8/36-371--------------------------------------------------------------------------------
F0R6C6_BACSH/27-352--------------------------------------------------------------------------------
C6W3U8_DYAFD/27-360--------------------------------------------------------------------------------
C6WZX9_FLAB3/31-373--------------------------------------------------------------------------------
F0NZQ8_WEEVC/30-359--------------------------------------------------------------------------------
Q5L9T0_BACFN/34-354--------------------------------------------------------------------------------
Q6AIA7_DESPS/40-375--------------------------------------------------------------------------------
D2QJN3_SPILD/45-378--------------------------------------------------------------------------------
D6D462_9BACE/28-360--------------------------------------------------------------------------------
E3HB27_ILYPC/34-350--------------------------------------------------------------------------------
C7PMN8_CHIPD/32-372--------------------------------------------------------------------------------
Q5L965_BACFN/30-358--------------------------------------------------------------------------------
Q1WTE3_LACS1/26-359--------------------------------------------------------------------------------
A0KM85_AERHH/26-353--------------------------------------------------------------------------------
A9NH20_ACHLI/15-352--------------------------------------------------------------------------------
A6GZ52_FLAPJ/21-343--------------------------------------------------------------------------------
D8IGG5_LACFC/21-364--------------------------------------------------------------------------------
Q03WA2_LEUMM/21-358--------------------------------------------------------------------------------
A6TBF0_KLEP7/23-340--------------------------------------------------------------------------------
A5G608_GEOUR/41-362--------------------------------------------------------------------------------
C6X1R8_FLAB3/21-351--------------------------------------------------------------------------------
E0SFU5_DICD3/23-330--------------------------------------------------------------------------------
Q6FFU5_ACIAD/13-316--------------------------------------------------------------------------------
E4TIN4_CALNY/56-394--------------------------------------------------------------------------------
Q8A831_BACTN/29-353--------------------------------------------------------------------------------
C7M7Z9_CAPOD/10-347--------------------------------------------------------------------------------
Q8A715_BACTN/26-366--------------------------------------------------------------------------------
C7RFF5_ANAPD/29-361--------------------------------------------------------------------------------
Q5LH99_BACFN/15-335--------------------------------------------------------------------------------
D3SAJ3_THISK/38-360--------------------------------------------------------------------------------
C6X0C5_FLAB3/28-350--------------------------------------------------------------------------------
C4ZJE6_THASP/44-373--------------------------------------------------------------------------------
D6E918_9ACTN/24-356--------------------------------------------------------------------------------
F0SY68_SYNGF/34-364--------------------------------------------------------------------------------
A6L9H3_PARD8/32-354--------------------------------------------------------------------------------
A1A378_BIFAA/27-350--------------------------------------------------------------------------------
E0RX92_BUTPB/42-359--------------------------------------------------------------------------------
Q8XN60_CLOPE/30-345--------------------------------------------------------------------------------
C4L730_EXISA/28-346--------------------------------------------------------------------------------
C7M4A6_CAPOD/29-353--------------------------------------------------------------------------------
Q39W09_GEOMG/33-369--------------------------------------------------------------------------------
E4RNL6_HALHG/27-346--------------------------------------------------------------------------------
C4Z668_EUBE2/44-362--------------------------------------------------------------------------------
E0S0Y2_BUTPB/32-367--------------------------------------------------------------------------------
D2RIR8_ACIFV/29-352--------------------------------------------------------------------------------
D5EVG6_PRER2/7-324--------------------------------------------------------------------------------
A6QAG6_SULNB/27-344--------------------------------------------------------------------------------
Q0A657_ALKEH/27-342--------------------------------------------------------------------------------
Q8DJL9_THEEB/21-349--------------------------------------------------------------------------------
A7HKI9_FERNB/29-353--------------------------------------------------------------------------------
E3I7S4_RHOVT/25-342--------------------------------------------------------------------------------
Q5QWV6_IDILO/29-338--------------------------------------------------------------------------------
Q1QWW7_CHRSD/27-347--------------------------------------------------------------------------------
A6LBP7_PARD8/27-381--------------------------------------------------------------------------------
E6UEJ4_RUMA7/36-384--------------------------------------------------------------------------------
E4RXS3_LEAB4/31-353--------------------------------------------------------------------------------
C4K321_HAMD5/34-350--------------------------------------------------------------------------------
C8WKZ6_EGGLE/32-357--------------------------------------------------------------------------------
A6L4H4_BACV8/26-363--------------------------------------------------------------------------------
D9S910_FIBSS/29-351--------------------------------------------------------------------------------
F5WT29_ERYRF/24-344--------------------------------------------------------------------------------
G8PTM7_PSEUV/31-346--------------------------------------------------------------------------------
Q1G8I7_LACDA/49-398--------------------------------------------------------------------------------
R5KIX9_9CLOT/31-383--------------------------------------------------------------------------------
R7EM48_9BACE/29-344--------------------------------------------------------------------------------

PF03155

L8G8K2_PSED2/15-492--------------------------------------------------------------------------------
Q5TNL1_ANOGA/16-506--------------------------------------------------------------------------------
D8UDK3_VOLCA/12-511--------------------------------------------------------------------------------
Q29NI9_DROPS/12-462--------------------------------------------------------------------------------
T1K7S4_TETUR/16-504--------------------------------------------------------------------------------
G2RBR7_THITE/15-492--------------------------------------------------------------------------------
M7PD45_PNEMU/13-491--------------------------------------------------------------------------------
D3BMH9_POLPA/36-529--------------------------------------------------------------------------------
A5DZN5_LODEL/28-537--------------------------------------------------------------------------------
F6ZU35_CIOIN/22-490--------------------------------------------------------------------------------
S9W0G5_SCHCR/14-492--------------------------------------------------------------------------------
K1XC57_MARBU/15-492--------------------------------------------------------------------------------
G0W812_NAUDC/80-564--------------------------------------------------------------------------------
C1E537_MICCC/36-567--------------------------------------------------------------------------------
D7TT36_VITVI/40-494--------------------------------------------------------------------------------
E9GMP9_DAPPU/11-491--------------------------------------------------------------------------------
F2UCB2_SALR5/15-489--------------------------------------------------------------------------------
H2Z9N9_CIOSA/19-515--------------------------------------------------------------------------------
G3NV34_GASAC/14-486--------------------------------------------------------------------------------
G8BYL8_TETPH/49-563--------------------------------------------------------------------------------
I7LWJ3_TETTS/163-672--------------------------------------------------------------------------------
A3LPA6_PICST/60-509--------------------------------------------------------------------------------
J7SB75_KAZNA/38-553--------------------------------------------------------------------------------
M4BE27_HYAAE/29-565--------------------------------------------------------------------------------
A0A087ZQU5_APIME/41-513--------------------------------------------------------------------------------
G7YSM9_CLOSI/17-476--------------------------------------------------------------------------------
F4X5Y5_ACREC/45-518--------------------------------------------------------------------------------
J9K2E7_ACYPI/9-490--------------------------------------------------------------------------------
R7YRL9_CONA1/15-485--------------------------------------------------------------------------------
ALG8_YEAST/51-565--------------------------------------------------------------------------------
E2BLU2_HARSA/14-512--------------------------------------------------------------------------------
C0NWB8_AJECG/15-495--------------------------------------------------------------------------------
I3IT66_DANRE/14-487--------------------------------------------------------------------------------
G3BFJ8_CANTC/32-544--------------------------------------------------------------------------------
ALG8_CAEEL/14-494--------------------------------------------------------------------------------
W5GB91_WHEAT/20-508--------------------------------------------------------------------------------
H2SHL1_TAKRU/16-505--------------------------------------------------------------------------------
F1A4M3_DICPU/24-508--------------------------------------------------------------------------------
M3BZ39_SPHMS/15-495--------------------------------------------------------------------------------
B5RU50_DEBHA/74-567--------------------------------------------------------------------------------
R1GPQ5_BOTPV/17-493--------------------------------------------------------------------------------
ALG6_SCHPO/35-484--------------------------------------------------------------------------------
B3S4W0_TRIAD/22-470--------------------------------------------------------------------------------
B0CY11_LACBS/39-528--------------------------------------------------------------------------------
M3K587_CANMX/31-541--------------------------------------------------------------------------------
N4VMS5_COLOR/17-495--------------------------------------------------------------------------------
I1LX18_SOYBN/37-486--------------------------------------------------------------------------------
M9PB91_DROME/12-464--------------------------------------------------------------------------------
ALG8_SCHPO/14-492--------------------------------------------------------------------------------
ALG8_ASHGO/44-558--------------------------------------------------------------------------------
H2M3G8_ORYLA/14-482--------------------------------------------------------------------------------
A0A068XBV5_HYMMI/13-510--------------------------------------------------------------------------------
D7MJY5_ARALL/49-511--------------------------------------------------------------------------------
M7UBV6_BOTF1/15-495--------------------------------------------------------------------------------
B8C862_THAPS/6-526--------------------------------------------------------------------------------
D5G5Y1_TUBMM/57-510--------------------------------------------------------------------------------
B6JZC1_SCHJY/14-495--------------------------------------------------------------------------------
B4JPP0_DROGR/12-469--------------------------------------------------------------------------------
A0A0K0IZP2_BRUMA/20-473--------------------------------------------------------------------------------
G8ZP39_TORDC/40-554--------------------------------------------------------------------------------
G8BGI3_CANPC/69-539--------------------------------------------------------------------------------
ALG6_HUMAN/14-488--------------------------------------------------------------------------------
B6Q2U6_TALMQ/15-493--------------------------------------------------------------------------------
ALG6_CHICK/14-488--------------------------------------------------------------------------------
C3XSJ3_BRAFL/15-487--------------------------------------------------------------------------------
I1KRW2_SOYBN/28-527--------------------------------------------------------------------------------
A0A068XHI1_HYMMI/18-474--------------------------------------------------------------------------------
C5DTD9_ZYGRC/51-531--------------------------------------------------------------------------------
I2GX66_TETBL/28-529--------------------------------------------------------------------------------
A7S144_NEMVE/15-467--------------------------------------------------------------------------------
A0A0J9XRE5_BRUMA/37-513--------------------------------------------------------------------------------
Q6C8U0_YARLI/72-529--------------------------------------------------------------------------------
A7RNB8_NEMVE/17-518--------------------------------------------------------------------------------
U7Q3L8_SPOS1/16-494--------------------------------------------------------------------------------
A8WP54_CAEBR/14-530--------------------------------------------------------------------------------
F6PL55_ORNAN/15-493--------------------------------------------------------------------------------
F1NPY2_CHICK/24-512--------------------------------------------------------------------------------
C5M3Q6_CANTT/80-532--------------------------------------------------------------------------------
G9NL14_HYPAI/15-495--------------------------------------------------------------------------------
C5DJM6_LACTC/29-543--------------------------------------------------------------------------------
M2TGW6_COCH5/15-493--------------------------------------------------------------------------------
A0A068XUS9_ECHMU/14-510--------------------------------------------------------------------------------
N1PRH1_DOTSN/15-493--------------------------------------------------------------------------------
W5KCM7_ASTMX/22-513--------------------------------------------------------------------------------
A8XHZ8_CAEBR/37-475--------------------------------------------------------------------------------
W5KTC4_ASTMX/14-487--------------------------------------------------------------------------------
F0ZUK5_DICPU/35-551--------------------------------------------------------------------------------
A0A068Y0H1_ECHMU/19-476--------------------------------------------------------------------------------
ALG8_HUMAN/21-510--------------------------------------------------------------------------------
G3AHF0_SPAPN/67-518--------------------------------------------------------------------------------
G7DT66_MIXOS/306-809--------------------------------------------------------------------------------
E4XPJ7_OIKDI/15-474--------------------------------------------------------------------------------
K0KJ73_WICCF/57-557--------------------------------------------------------------------------------
Q6CSG6_KLULA/71-550--------------------------------------------------------------------------------
S8A5I1_DACHA/15-491--------------------------------------------------------------------------------
J7S8J5_KAZNA/67-547--------------------------------------------------------------------------------
G8YLJ6_PICSO/71-564--------------------------------------------------------------------------------
ALG8_CANGA/21-535--------------------------------------------------------------------------------
U5GCU1_POPTR/44-501--------------------------------------------------------------------------------
B4L518_DROMO/13-481--------------------------------------------------------------------------------
C4XYN7_CLAL4/28-542--------------------------------------------------------------------------------
S9VWR7_SCHCR/35-484--------------------------------------------------------------------------------
C4Y8Y1_CLAL4/65-544--------------------------------------------------------------------------------
U4LQP8_PYROM/53-504--------------------------------------------------------------------------------
ALG6_DICDI/25-502--------------------------------------------------------------------------------
W1PIJ5_AMBTC/36-490--------------------------------------------------------------------------------
H0V4T9_CAVPO/14-492--------------------------------------------------------------------------------
F6UCU7_XENTR/38-526--------------------------------------------------------------------------------
F9FE00_FUSOF/15-493--------------------------------------------------------------------------------
B4MG56_DROVI/12-467--------------------------------------------------------------------------------
M5ECX9_MALS4/12-500--------------------------------------------------------------------------------
R4G404_RHOPR/9-494--------------------------------------------------------------------------------
A8J4X2_CHLRE/2-518--------------------------------------------------------------------------------
I7LUU2_TETTS/10-489--------------------------------------------------------------------------------
Q7Q2B4_ANOGA/11-482--------------------------------------------------------------------------------
T1G1F7_HELRO/12-479--------------------------------------------------------------------------------
D8Q0E0_SCHCM/162-611--------------------------------------------------------------------------------
Q176C2_AEDAE/15-501--------------------------------------------------------------------------------
V2XYC4_MONRO/48-546--------------------------------------------------------------------------------
K5WXZ7_AGABU/56-542--------------------------------------------------------------------------------
F6GVE0_VITVI/26-508--------------------------------------------------------------------------------
G8YVD8_PICSO/37-547--------------------------------------------------------------------------------
F9X7N4_ZYMTI/15-491--------------------------------------------------------------------------------
B4I046_DROSE/12-481--------------------------------------------------------------------------------
H6CAF2_EXODN/46-523--------------------------------------------------------------------------------
E4V433_ARTGP/15-494--------------------------------------------------------------------------------
ALG6_YEAST/46-528--------------------------------------------------------------------------------
C5DEQ3_LACTC/41-520--------------------------------------------------------------------------------
Q17GG0_AEDAE/11-473--------------------------------------------------------------------------------
M0ZN96_SOLTU/61-545--------------------------------------------------------------------------------
A5E0J5_LODEL/108-572--------------------------------------------------------------------------------
C4R675_KOMPG/51-560--------------------------------------------------------------------------------
T5AJ86_OPHSC/15-492--------------------------------------------------------------------------------
D2UZR6_NAEGR/31-501--------------------------------------------------------------------------------
D8PR27_SCHCM/33-514--------------------------------------------------------------------------------
E6ZL14_SPORE/61-583--------------------------------------------------------------------------------
F4NSW2_BATDJ/10-461--------------------------------------------------------------------------------
G3J5X8_CORMM/17-489--------------------------------------------------------------------------------
T1JIW9_STRMM/20-486--------------------------------------------------------------------------------
H2VDX9_TAKRU/14-486--------------------------------------------------------------------------------
G8JSX9_ERECY/78-592--------------------------------------------------------------------------------
U4KWQ6_PYROM/15-499--------------------------------------------------------------------------------
E3KWU5_PUCGT/17-510--------------------------------------------------------------------------------
I3JQF2_ORENI/14-486--------------------------------------------------------------------------------
K4A8J1_SETIT/40-498--------------------------------------------------------------------------------
B3MJG1_DROAN/12-464--------------------------------------------------------------------------------
X1WNC6_ACYPI/31-488--------------------------------------------------------------------------------
Q75CA8_ASHGO/68-547--------------------------------------------------------------------------------
D0N326_PHYIT/34-510--------------------------------------------------------------------------------
Q6FVE1_CANGA/52-532--------------------------------------------------------------------------------
H3CLG0_TETNG/1-489--------------------------------------------------------------------------------
U5FSQ0_POPTR/25-525--------------------------------------------------------------------------------
A7TDS1_VANPO/94-608--------------------------------------------------------------------------------
X6MDM2_RETFI/80-636--------------------------------------------------------------------------------
D2A4Q9_TRICA/20-523--------------------------------------------------------------------------------
F6PKN9_XENTR/14-490--------------------------------------------------------------------------------
G8ZY47_TORDC/46-526--------------------------------------------------------------------------------
H2AU41_KAZAF/49-563--------------------------------------------------------------------------------
F8QIP1_SERL3/1-475--------------------------------------------------------------------------------
A5DBI4_PICGU/24-536--------------------------------------------------------------------------------
S8A6B8_DACHA/57-532--------------------------------------------------------------------------------
G0VHP8_NAUCC/41-555--------------------------------------------------------------------------------
ALG8_KLULA/37-549--------------------------------------------------------------------------------
A3GH90_PICST/41-554--------------------------------------------------------------------------------
D8SCH8_SELML/18-458--------------------------------------------------------------------------------
M0SWI1_MUSAM/15-472--------------------------------------------------------------------------------
E9HIJ0_DAPPU/14-464--------------------------------------------------------------------------------
G8JQX3_ERECY/54-533--------------------------------------------------------------------------------
E3LGX2_CAERE/56-494--------------------------------------------------------------------------------
G1KHE7_ANOCA/14-488--------------------------------------------------------------------------------
M3ZXK5_XIPMA/20-507--------------------------------------------------------------------------------
M1AYF5_SOLTU/40-493--------------------------------------------------------------------------------
G0WC59_NAUDC/39-554--------------------------------------------------------------------------------
Q566T2_DANRE/20-507--------------------------------------------------------------------------------
S7ZR44_PENO1/15-489--------------------------------------------------------------------------------
B5Y5E2_PHATC/28-512--------------------------------------------------------------------------------
I2H6P2_TETBL/49-543--------------------------------------------------------------------------------
A9RXF0_PHYPA/16-505--------------------------------------------------------------------------------
S8ECT2_FOMPI/45-533--------------------------------------------------------------------------------
K5X935_PHACS/65-548--------------------------------------------------------------------------------
ALG6_CAEEL/56-491--------------------------------------------------------------------------------
C4R109_KOMPG/50-531--------------------------------------------------------------------------------
G3BBW3_CANTC/58-534--------------------------------------------------------------------------------
H2ANJ3_KAZAF/67-548--------------------------------------------------------------------------------
M4C591_HYAAE/34-510--------------------------------------------------------------------------------
M2MQ53_BAUCO/15-492--------------------------------------------------------------------------------
W1NV46_AMBTC/11-495--------------------------------------------------------------------------------
S2JJH6_MUCC1/40-480--------------------------------------------------------------------------------
I3JKF5_ORENI/18-505--------------------------------------------------------------------------------
G8BYB6_TETPH/62-543--------------------------------------------------------------------------------
H2Y782_CIOSA/7-450--------------------------------------------------------------------------------
G4VBL6_SCHMA/19-502--------------------------------------------------------------------------------
F4P9K6_BATDJ/14-479--------------------------------------------------------------------------------
A2QEY3_ASPNC/67-535--------------------------------------------------------------------------------
E2BUL4_HARSA/38-509--------------------------------------------------------------------------------
ALG8_DEBHA/34-545--------------------------------------------------------------------------------
A0A0D2X4J7_CAPO3/36-488--------------------------------------------------------------------------------
K3WJX2_PYTUL/33-498--------------------------------------------------------------------------------
C5DNU1_ZYGRC/30-544--------------------------------------------------------------------------------
F0YK69_AURAN/94-544--------------------------------------------------------------------------------
B0WBY1_CULQU/17-503--------------------------------------------------------------------------------
B3RIR0_TRIAD/15-519--------------------------------------------------------------------------------
G8BJG1_CANPC/35-543--------------------------------------------------------------------------------
B6K4U3_SCHJY/35-468--------------------------------------------------------------------------------
K3X7Z1_PYTUL/28-566--------------------------------------------------------------------------------
G7XVM6_ASPKW/15-493--------------------------------------------------------------------------------
D7LLP2_ARALL/19-500--------------------------------------------------------------------------------
G3AQ92_SPAPN/42-557--------------------------------------------------------------------------------
G4TH15_SERID/87-576--------------------------------------------------------------------------------
B4KK01_DROMO/12-467--------------------------------------------------------------------------------
A8PTB3_MALGO/18-506--------------------------------------------------------------------------------
B0CVP2_LACBS/18-494--------------------------------------------------------------------------------
F4WJE6_ACREC/14-512--------------------------------------------------------------------------------
R4XHB2_TAPDE/18-493--------------------------------------------------------------------------------
W1Q7Q7_OGAPD/16-525--------------------------------------------------------------------------------
B4MJ94_DROWI/18-488--------------------------------------------------------------------------------
F4RT20_MELLP/38-527--------------------------------------------------------------------------------
ALG8_CANAL/51-572--------------------------------------------------------------------------------
K0KKM0_WICCF/47-534--------------------------------------------------------------------------------
K7H4J1_CAEJA/18-503--------------------------------------------------------------------------------
B4JLV7_DROGR/13-480--------------------------------------------------------------------------------
A7TJW9_VANPO/47-530--------------------------------------------------------------------------------
A0DD77_PARTE/10-454--------------------------------------------------------------------------------
N1JGC6_BLUG1/16-499--------------------------------------------------------------------------------

PF04922

D6W779_TRICA/29-405--------------------------------------------------------------------------------
K5XCQ6_PHACS/29-416--------------------------------------------------------------------------------
T1G2P1_HELRO/32-429--------------------------------------------------------------------------------
H2T3E9_TAKRU/31-424--------------------------------------------------------------------------------
ALG10_CANGA/63-455--------------------------------------------------------------------------------
I1N2G0_SOYBN/25-459--------------------------------------------------------------------------------
E0V9V1_PEDHC/31-428--------------------------------------------------------------------------------
M0THQ1_MUSAM/25-461--------------------------------------------------------------------------------
F4R3Q7_MELLP/33-444--------------------------------------------------------------------------------
R4GKH2_CHICK/31-425--------------------------------------------------------------------------------
G8ZYL6_TORDC/61-452--------------------------------------------------------------------------------
C6H8G6_AJECH/46-531--------------------------------------------------------------------------------
ALG10_DEBHA/27-407--------------------------------------------------------------------------------
E3RDG0_PYRTT/32-497--------------------------------------------------------------------------------
F6RK69_MONDO/31-424--------------------------------------------------------------------------------
F6YIJ5_CIOIN/30-422--------------------------------------------------------------------------------
Q7QC28_ANOGA/28-387--------------------------------------------------------------------------------
R0ILV6_SETT2/32-500--------------------------------------------------------------------------------
U9SYH3_RHIID/26-420--------------------------------------------------------------------------------
B3S3F0_TRIAD/21-412--------------------------------------------------------------------------------
C5GWH0_AJEDR/43-528--------------------------------------------------------------------------------
W4XA33_STRPU/31-418--------------------------------------------------------------------------------
E7FEB7_DANRE/31-427--------------------------------------------------------------------------------
E3KTL2_PUCGT/33-453--------------------------------------------------------------------------------
C4QYK4_KOMPG/29-433--------------------------------------------------------------------------------
M4CND4_BRARP/25-460--------------------------------------------------------------------------------
C3ZVK1_BRAFL/29-413--------------------------------------------------------------------------------
G8BJE7_CANPC/39-409--------------------------------------------------------------------------------
A9TQ25_PHYPA/25-459--------------------------------------------------------------------------------
A7TEV5_VANPO/69-460--------------------------------------------------------------------------------
E5R4I1_LEPMJ/32-494--------------------------------------------------------------------------------
S2JIR9_MUCC1/22-407--------------------------------------------------------------------------------
F6W8Z6_XENTR/31-423--------------------------------------------------------------------------------
M7P9N4_PNEMU/25-418--------------------------------------------------------------------------------
K7J4C0_NASVI/51-442--------------------------------------------------------------------------------
B4L183_DROMO/27-402--------------------------------------------------------------------------------
ALG10_SCHPO/27-398--------------------------------------------------------------------------------
M2MM25_BAUCO/23-505--------------------------------------------------------------------------------
U4KUC8_PYROM/26-429--------------------------------------------------------------------------------
G1KUP0_ANOCA/31-425--------------------------------------------------------------------------------
C5DSA6_ZYGRC/68-459--------------------------------------------------------------------------------
H2AQR8_KAZAF/62-454--------------------------------------------------------------------------------
U5H039_USTV1/30-435--------------------------------------------------------------------------------
W5NGQ4_LEPOC/1-392--------------------------------------------------------------------------------
G2QLA0_MYCTT/27-468--------------------------------------------------------------------------------
AG10B_RAT/31-428--------------------------------------------------------------------------------
S8EM30_FOMPI/28-420--------------------------------------------------------------------------------
H9JJA8_BOMMO/32-432--------------------------------------------------------------------------------
ALG10_DROME/27-402--------------------------------------------------------------------------------
ALG10_ASHGO/57-447--------------------------------------------------------------------------------
G0S7Z5_CHATD/97-541--------------------------------------------------------------------------------
A0DAU3_PARTE/15-377--------------------------------------------------------------------------------
K3Y6Q6_SETIT/25-460--------------------------------------------------------------------------------
C5DDK7_LACTC/53-443--------------------------------------------------------------------------------
A0A0E1RWP6_COCIM/38-522--------------------------------------------------------------------------------
F8PP28_SERL3/26-407--------------------------------------------------------------------------------
D2VB91_NAEGR/36-412--------------------------------------------------------------------------------
B0CP31_LACBS/23-410--------------------------------------------------------------------------------
H3AZ27_LATCH/33-427--------------------------------------------------------------------------------
W1QI63_OGAPD/28-389--------------------------------------------------------------------------------
ALG10_ARATH/25-461--------------------------------------------------------------------------------
U5G642_POPTR/25-462--------------------------------------------------------------------------------
E1ZJK4_CHLVA/29-455--------------------------------------------------------------------------------
A3LRZ3_PICST/40-418--------------------------------------------------------------------------------
G3B8T7_CANTC/34-406--------------------------------------------------------------------------------
E9G0X2_DAPPU/10-399--------------------------------------------------------------------------------
T1KW23_TETUR/49-426--------------------------------------------------------------------------------
B4N5D4_DROWI/27-400--------------------------------------------------------------------------------
A5DZP8_LODEL/41-412--------------------------------------------------------------------------------
K5XJ27_AGABU/23-409--------------------------------------------------------------------------------
ALG10_KLULA/84-474--------------------------------------------------------------------------------
K1R9X9_CRAGI/8-410--------------------------------------------------------------------------------
M3JE22_CANMX/36-392--------------------------------------------------------------------------------
J7S1V6_KAZNA/74-466--------------------------------------------------------------------------------
H2Z276_CIOSA/25-431--------------------------------------------------------------------------------
J9LAG9_ACYPI/57-491--------------------------------------------------------------------------------
M1AHM2_SOLTU/25-464--------------------------------------------------------------------------------
G8YR70_PICSO/63-445--------------------------------------------------------------------------------
G7E9B0_MIXOS/25-410--------------------------------------------------------------------------------
U3KM68_RABIT/35-431--------------------------------------------------------------------------------
N1PN61_DOTSN/24-512--------------------------------------------------------------------------------
M7WKK8_RHOT1/28-438--------------------------------------------------------------------------------
B4GZN2_DROPE/27-402--------------------------------------------------------------------------------
E2C163_HARSA/25-409--------------------------------------------------------------------------------
D5GMM3_TUBMM/58-479--------------------------------------------------------------------------------
B4J2W4_DROGR/27-402--------------------------------------------------------------------------------
H2MXS0_ORYLA/31-430--------------------------------------------------------------------------------
G3Q5J3_GASAC/31-430--------------------------------------------------------------------------------
A0A068XAK8_HYMMI/1-361--------------------------------------------------------------------------------
I1G516_AMPQE/28-420--------------------------------------------------------------------------------
B4LC57_DROVI/27-402--------------------------------------------------------------------------------
G4TLE7_SERID/31-425--------------------------------------------------------------------------------
C5MA37_CANTT/36-393--------------------------------------------------------------------------------
H6BMA7_EXODN/33-480--------------------------------------------------------------------------------
G3AQ79_SPAPN/26-394--------------------------------------------------------------------------------
K0KGY8_WICCF/63-454--------------------------------------------------------------------------------
M2PXH0_CERS8/29-421--------------------------------------------------------------------------------
M3ZWU8_XIPMA/31-428--------------------------------------------------------------------------------
C5FIZ5_ARTOC/29-525--------------------------------------------------------------------------------
G0W9V3_NAUDC/65-461--------------------------------------------------------------------------------
I2GZK7_TETBL/25-415--------------------------------------------------------------------------------
Q54Z56_DICDI/36-464--------------------------------------------------------------------------------
D7THP5_VITVI/25-464--------------------------------------------------------------------------------
B2AS64_PODAN/95-577--------------------------------------------------------------------------------
L8G022_PSED2/46-496--------------------------------------------------------------------------------
S6DZ28_ZYGB2/63-454--------------------------------------------------------------------------------
G7YEG4_CLOSI/35-428--------------------------------------------------------------------------------
E4UQE0_ARTGP/54-531--------------------------------------------------------------------------------
S9XAR5_SCHCR/40-407--------------------------------------------------------------------------------
B0WRU3_CULQU/28-412--------------------------------------------------------------------------------
ALG10_YARLI/35-468--------------------------------------------------------------------------------
B3M3X6_DROAN/27-402--------------------------------------------------------------------------------
E3M395_CAERE/43-392--------------------------------------------------------------------------------
M2QYS3_COCSN/32-490--------------------------------------------------------------------------------
V2X8L4_MONRO/23-410--------------------------------------------------------------------------------
B7PY71_IXOSC/28-414--------------------------------------------------------------------------------
K1WSG6_MARBU/64-554--------------------------------------------------------------------------------
ALG10_CANAL/39-418--------------------------------------------------------------------------------
T1IQU4_STRMM/35-428--------------------------------------------------------------------------------
G8JPI5_ERECY/57-447--------------------------------------------------------------------------------
W5KCZ3_ASTMX/32-428--------------------------------------------------------------------------------
D8PKT8_SCHCM/23-405--------------------------------------------------------------------------------
M7ZBL2_TRIUA/25-435--------------------------------------------------------------------------------
J3LZC5_ORYBR/25-460--------------------------------------------------------------------------------
D8RLA5_SELML/25-447--------------------------------------------------------------------------------
ALG10_YEAST/66-458--------------------------------------------------------------------------------
G8BNV4_TETPH/64-455--------------------------------------------------------------------------------
A5DGH1_PICGU/27-396--------------------------------------------------------------------------------
G0VGC7_NAUCC/66-459--------------------------------------------------------------------------------
W5JWB9_ANODA/28-387--------------------------------------------------------------------------------
Q170T5_AEDAE/28-413--------------------------------------------------------------------------------
C4XWR1_CLAL4/27-397--------------------------------------------------------------------------------

PF10131

Q0AV03_SYNWW/415-1038---------------------------------------------------------------------------CALLG
Q5JIL5_THEKO/62-622---------------------------------------------------------------------------TSFVG
Q97FZ3_CLOAB/258-879---------------------------------------------------------------------------IFFIG
Q0AV07_SYNWW/2-631---------------------------------------------------------------------------YLLVG
Q8TXR3_METKA/68-665---------------------------------------------------------------------------ASALI
A0LQQ1_SYNFM/80-828---------------------------------------------------------------------------PVFGL
Q97FY2_CLOAB/253-873---------------------------------------------------------------------------MFFVG
Q97G45_CLOAB/90-699---------------------------------------------------------------------------VFMVG
R5JZI7_9CLOT/75-690---------------------------------------------------------------------------IFVVG

PF09586

A4VYG6_STRSY/15-836---------------------------------------------------------------------------RNTLH
Q1WT54_LACS1/18-862---------------------------------------------------------------------------RETLL
Q8DRZ1_STRMU/67-904---------------------------------------------------------------------------GHAFR
Q74LA0_LACJO/18-861---------------------------------------------------------------------------RRLIL
Q74LA1_LACJO/22-868---------------------------------------------------------------------------RHLML
Q03YY3_LEUMM/16-848---------------------------------------------------------------------------KYTIL
Q8DRQ9_STRMU/18-837---------------------------------------------------------------------------RNILH
Q03G85_PEDPA/13-851---------------------------------------------------------------------------RSTLI
A5VKU5_LACRD/18-849---------------------------------------------------------------------------RNTIL
Q8DRY9_STRMU/26-950---------------------------------------------------------------------------KATVL
Q38WC5_LACSS/15-827---------------------------------------------------------------------------KRQMA
Q8DWP3_STRA5/16-839---------------------------------------------------------------------------RNILH
Q03NT2_LACBA/19-858---------------------------------------------------------------------------RRAIL
Q38VZ4_LACSS/17-848---------------------------------------------------------------------------RTTLL
Q03RN6_LACBA/20-858---------------------------------------------------------------------------RRAIL
Q5FIZ5_LACAC/21-848---------------------------------------------------------------------------RHNLF
Q839W8_ENTFA/19-846---------------------------------------------------------------------------NNVLH
Q5M231_STRT2/16-841---------------------------------------------------------------------------RNILH
Q82ZW8_ENTFA/12-828---------------------------------------------------------------------------KRSFH
Q5HPU9_STAEQ/10-840---------------------------------------------------------------------------YHQW.
Q5WFJ9_BACSK/12-844---------------------------------------------------------------------------YQQL.
Q74IE5_LACJO/19-843---------------------------------------------------------------------------KNNLL
Q03HY9_PEDPA/14-831---------------------------------------------------------------------------REVLH
Q038D6_LACC3/14-842---------------------------------------------------------------------------RQTLL
Q3XYV7_ENTFC/19-847---------------------------------------------------------------------------RNVLL
Q814J9_BACCR/15-862---------------------------------------------------------------------------QHAF.
Q03TF4_LACBA/23-880---------------------------------------------------------------------------RATIL
Q5WJL1_BACSK/14-845---------------------------------------------------------------------------YSLY.
Q65M97_BACLD/11-842---------------------------------------------------------------------------FEQY.
Q04EK1_OENOB/16-850---------------------------------------------------------------------------RETIL
Q03QV8_LACBA/14-985---------------------------------------------------------------------------YTWLH
Q03A73_LACC3/16-850---------------------------------------------------------------------------KHALM
A8FB68_BACP2/11-842---------------------------------------------------------------------------YDEY.
Q03TW7_LACBA/17-837---------------------------------------------------------------------------VRLVR
Q2FZ40_STAA8/20-851---------------------------------------------------------------------------YEHL.
Q8DMX0_STRR6/15-831---------------------------------------------------------------------------RNILH
Q99XH1_STRP1/14-837---------------------------------------------------------------------------RNIMH
Q9CHA3_LACLA/14-855---------------------------------------------------------------------------RNILH
R6NFF7_9CLOT/15-832---------------------------------------------------------------------------IDVFH
R7DCE3_9FIRM/22-900---------------------------------------------------------------------------RKILH

PF05007

GPI14_YEAST/127-386--------------------------------------------------------------------------------
GPI14_SCHPO/112-368--------------------------------------------------------------------------------
PIGM_TRYB2/134-410--------------------------------------------------------------------------------
PIGM_RAT/140-408--------------------------------------------------------------------------------
Q17515_CAEEL/146-405--------------------------------------------------------------------------------
Q9W2E4_DROME/177-450--------------------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379--------------------------------------------------------------------------------
Q5CYY5_CRYPI/10-436--------------------------------------------------------------------------------
B6AHL5_CRYMR/12-437--------------------------------------------------------------------------------
B9RC32_RICCO/30-452--------------------------------------------------------------------------------
B9GKM7_POPTR/14-432--------------------------------------------------------------------------------
A9TIH7_PHYPA/73-514--------------------------------------------------------------------------------
B4N1B7_DROWI/10-386--------------------------------------------------------------------------------
B4KI55_DROMO/10-386--------------------------------------------------------------------------------
Q16H22_AEDAE/9-388--------------------------------------------------------------------------------
B0W4N5_CULQU/8-388--------------------------------------------------------------------------------
Q7Q3W6_ANOGA/8-396--------------------------------------------------------------------------------
B7QL74_IXOSC/11-391--------------------------------------------------------------------------------
Q4RLI5_TETNG/10-394--------------------------------------------------------------------------------
Q28CK0_XENTR/10-394--------------------------------------------------------------------------------
A7S3Y0_NEMVE/14-406--------------------------------------------------------------------------------
Q54T45_DICDI/55-469--------------------------------------------------------------------------------
Q758M8_ASHGO/10-356--------------------------------------------------------------------------------
C5DB98_LACTC/10-356--------------------------------------------------------------------------------
Q6CPH2_KLULA/10-358--------------------------------------------------------------------------------
C5DUS6_ZYGRC/10-359--------------------------------------------------------------------------------
A7TF02_VANPO/11-360--------------------------------------------------------------------------------
Q6FSI7_CANGA/9-374--------------------------------------------------------------------------------
C5MHK2_CANTT/9-395--------------------------------------------------------------------------------
Q5AGH5_CANAL/13-440--------------------------------------------------------------------------------
A5E2K6_LODEL/111-490--------------------------------------------------------------------------------
Q6BPY5_DEBHA/9-390--------------------------------------------------------------------------------
A3LVF4_PICST/9-390--------------------------------------------------------------------------------
C4Y9V1_CLAL4/8-389--------------------------------------------------------------------------------
C5FSQ4_ARTOC/12-388--------------------------------------------------------------------------------
B6H480_PENRW/12-387--------------------------------------------------------------------------------
A2QI87_ASPNC/12-388--------------------------------------------------------------------------------
B6QEM6_TALMQ/12-390--------------------------------------------------------------------------------
B2WBA6_PYRTR/13-388--------------------------------------------------------------------------------
B2A9S5_PODAN/16-388--------------------------------------------------------------------------------
Q6C5L4_YARLI/7-382--------------------------------------------------------------------------------
B0D118_LACBS/9-373--------------------------------------------------------------------------------
PIGU_SCHPO/10-372--------------------------------------------------------------------------------
B6K154_SCHJY/14-372--------------------------------------------------------------------------------
Q22672_CAEEL/31-382--------------------------------------------------------------------------------
A8X654_CAEBR/27-380--------------------------------------------------------------------------------
Q01AL0_OSTTA/12-375--------------------------------------------------------------------------------
C1EBB5_MICCC/13-406--------------------------------------------------------------------------------
C1MV77_MICPC/13-431--------------------------------------------------------------------------------
C5L3N8_PERM5/23-419--------------------------------------------------------------------------------
Q4YTZ9_PLABA/82-516--------------------------------------------------------------------------------
Q8IE19_PLAF7/127-560--------------------------------------------------------------------------------
B3L8S4_PLAKH/95-534--------------------------------------------------------------------------------
A0DGJ7_PARTE/1-357--------------------------------------------------------------------------------
B8C4L2_THAPS/71-579--------------------------------------------------------------------------------
B4Q6V7_DROSI/10-386--------------------------------------------------------------------------------
G3HAP2_CRIGR/11-394--------------------------------------------------------------------------------
J4TTL1_SACK1/11-359--------------------------------------------------------------------------------
Q5KP79_CRYNJ/19-375--------------------------------------------------------------------------------
Q7SFC3_NEUCR/18-392--------------------------------------------------------------------------------
Q94K70_ARATH/25-442--------------------------------------------------------------------------------
A0A125YKP3_TOXGV/76-514--------------------------------------------------------------------------------

PF09594

PIME_MYCS2/91-321--------------------------------------------------------------------------------
A0JZG9_ARTS2/73-321--------------------------------------------------------------------------------
Q73YN6_MYCPA/82-326--------------------------------------------------------------------------------
E0TET4_PARBH/112-335--------------------------------------------------------------------------------
Q1QK36_NITHX/92-360--------------------------------------------------------------------------------
Q1DFL5_MYXXD/100-338--------------------------------------------------------------------------------
Q1LAW9_CUPMC/87-313--------------------------------------------------------------------------------
Q2J8W8_FRASC/88-337--------------------------------------------------------------------------------
Q9HN16_HALSA/81-322--------------------------------------------------------------------------------
Q6N414_RHOPA/73-354--------------------------------------------------------------------------------
Q8KF88_CHLTE/91-313--------------------------------------------------------------------------------
Q82C69_STRAW/73-314--------------------------------------------------------------------------------
A6W4J4_KINRD/75-318--------------------------------------------------------------------------------
Q8NNL7_CORGL/75-325--------------------------------------------------------------------------------
A6LI36_PARD8/70-300--------------------------------------------------------------------------------
Q0S7Q3_RHOJR/72-303--------------------------------------------------------------------------------
Q0S430_RHOJR/96-330--------------------------------------------------------------------------------
AFTC_MYCS2/90-325--------------------------------------------------------------------------------
Q8KF86_CHLTE/520-743--------------------------------------------------------------------------------
A4X3Z6_SALTO/69-305--------------------------------------------------------------------------------
A5FWG6_ACICJ/133-359--------------------------------------------------------------------------------
Q8EXK5_LEPIN/120-368--------------------------------------------------------------------------------
Q6NG43_CORDI/98-348--------------------------------------------------------------------------------
A4F662_SACEN/84-314--------------------------------------------------------------------------------
A4YMG5_BRASO/52-323--------------------------------------------------------------------------------
Q8FNR9_COREF/132-368--------------------------------------------------------------------------------
Q8FNS1_COREF/85-333--------------------------------------------------------------------------------
Q2IKA8_ANADE/104-327--------------------------------------------------------------------------------
Q8NNL6_CORGL/93-341--------------------------------------------------------------------------------
A7I755_METB6/60-298--------------------------------------------------------------------------------
Q1AS45_RUBXD/75-307--------------------------------------------------------------------------------
Q0SHP5_RHOJR/98-332--------------------------------------------------------------------------------
A1TAY8_MYCVP/79-323--------------------------------------------------------------------------------
Q0KDP9_CUPNH/92-320--------------------------------------------------------------------------------
Q7MTZ4_PORGI/65-295--------------------------------------------------------------------------------
A4XDG1_SALTO/368-608--------------------------------------------------------------------------------
Q73W67_MYCPA/92-327--------------------------------------------------------------------------------
A0JZG6_ARTS2/141-392--------------------------------------------------------------------------------
Q2G5A3_NOVAD/106-326--------------------------------------------------------------------------------
Q8A2B6_BACTN/67-296--------------------------------------------------------------------------------
Q0C0G8_HYPNA/93-341--------------------------------------------------------------------------------
Q1ITA1_KORVE/92-336--------------------------------------------------------------------------------
Q4JVC2_CORJK/78-310--------------------------------------------------------------------------------
Q5Z2C4_NOCFA/88-323--------------------------------------------------------------------------------
Q0S1F1_RHOJR/88-319--------------------------------------------------------------------------------
Q5YR74_NOCFA/76-310--------------------------------------------------------------------------------
Q82B65_STRAW/52-287--------------------------------------------------------------------------------
A6WEV4_KINRD/63-293--------------------------------------------------------------------------------
Q6A9X9_PROAC/81-311--------------------------------------------------------------------------------
B2U6Q0_RALPJ/105-334--------------------------------------------------------------------------------
Q8A2B7_BACTN/70-300--------------------------------------------------------------------------------
A1K2E7_AZOSB/76-322--------------------------------------------------------------------------------
Q1LQN5_CUPMC/107-328--------------------------------------------------------------------------------
Q82AJ1_STRAW/66-309--------------------------------------------------------------------------------
A4F642_SACEN/68-304--------------------------------------------------------------------------------
Q6NEL0_CORDI/90-330--------------------------------------------------------------------------------
Q89QR1_BRADU/100-368--------------------------------------------------------------------------------
Q4JVV2_CORJK/84-315--------------------------------------------------------------------------------
Q5YTA9_NOCFA/80-311--------------------------------------------------------------------------------
Q73WN6_MYCPA/105-337--------------------------------------------------------------------------------
Q8FNS2_COREF/71-313--------------------------------------------------------------------------------
A4Z0F4_BRASO/98-322--------------------------------------------------------------------------------
Q1AX69_RUBXD/44-303--------------------------------------------------------------------------------
Q5YQC7_NOCFA/78-313--------------------------------------------------------------------------------
Q8FPI8_COREF/95-327--------------------------------------------------------------------------------
B2U6P6_RALPJ/116-345--------------------------------------------------------------------------------
Q4JU29_CORJK/82-316--------------------------------------------------------------------------------
A6LBC6_PARD8/70-301--------------------------------------------------------------------------------
Q20YY7_RHOPB/103-326--------------------------------------------------------------------------------
Q1LQN6_CUPMC/104-332--------------------------------------------------------------------------------
A1R1N0_ARTAT/81-341--------------------------------------------------------------------------------
Q2K4Q8_RHIEC/84-305--------------------------------------------------------------------------------
A4YMG3_BRASO/104-327--------------------------------------------------------------------------------
Q82GI4_STRAW/88-314--------------------------------------------------------------------------------
A7I7Y5_METB6/97-335--------------------------------------------------------------------------------
Q3L9S4_RHOE4/54-285--------------------------------------------------------------------------------
A4FR42_SACEN/78-325--------------------------------------------------------------------------------
Q9CBX0_MYCLE/105-336--------------------------------------------------------------------------------
A4FGU5_SACEN/82-312--------------------------------------------------------------------------------
Q82NJ1_STRAW/66-299--------------------------------------------------------------------------------
Q6NF60_CORDI/70-290--------------------------------------------------------------------------------
A4X4Q2_SALTO/67-302--------------------------------------------------------------------------------
A4XDF7_SALTO/84-339--------------------------------------------------------------------------------
B1W388_STRGG/68-304--------------------------------------------------------------------------------
B2HGU8_MYCMM/80-324--------------------------------------------------------------------------------
B4EGA7_BURCJ/104-332--------------------------------------------------------------------------------
B4EQ62_BURCJ/118-340--------------------------------------------------------------------------------
C5B043_METEA/93-315--------------------------------------------------------------------------------
AFTC_MYCTU/94-327--------------------------------------------------------------------------------
PIME_MYCTU/103-334--------------------------------------------------------------------------------
Q63I86_BURPS/104-334--------------------------------------------------------------------------------
Q63I87_BURPS/118-340--------------------------------------------------------------------------------
Q7AQD6_MYCLE/80-324--------------------------------------------------------------------------------
Q8NNL3_CORGL/89-325--------------------------------------------------------------------------------
R6X3N6_9PORP/49-278--------------------------------------------------------------------------------

PF13231

Q65D63_BACLD/64-222--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRADU/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
Q89IJ6_BRADU/52-213--------------------------------------------------------------------------------
Q5ZVN3_LEGPH/45-205--------------------------------------------------------------------------------
A5ULR9_METS3/66-231--------------------------------------------------------------------------------
Q2IKZ1_ANADE/72-232--------------------------------------------------------------------------------
Q2KCI5_RHIEC/48-207--------------------------------------------------------------------------------
Q6NCW5_RHOPA/88-248--------------------------------------------------------------------------------
Q82U54_NITEU/408-568--------------------------------------------------------------------------------

PF02366

PMT3_YEAST/62-306---------------------------------------------------------------------------EF---
POMT1_HUMAN/20-289---------------------------------------------------------------------------IF---
P73015_SYNY3/18-249---------------------------------------------------------------------------ND---
Y1220_AQUAE/1-229---------------------------------------------------------------------------AK---
ARNT_SALTY/3-237---------------------------------------------------------------------------SR---
P73065_SYNY3/8-275---------------------------------------------------------------------------LS---
PMT1_YEAST/54-297---------------------------------------------------------------------------TY---
PMT1_CANAL/70-313---------------------------------------------------------------------------TF---
PMT1_SCHPO/38-284---------------------------------------------------------------------------KL---
PMT2_YEAST/69-313---------------------------------------------------------------------------EF---
POMT2_HUMAN/62-306---------------------------------------------------------------------------TF---
PMT5_YEAST/50-293---------------------------------------------------------------------------IF---
P73712_SYNY3/7-243---------------------------------------------------------------------------GR---
POMT1_DROME/178-421---------------------------------------------------------------------------IF---
PMT4_YEAST/57-305---------------------------------------------------------------------------SY---
PMT4_SCHPO/63-310---------------------------------------------------------------------------KY---
ARNT_ECOLI/3-237---------------------------------------------------------------------------SR---
PMT6_YEAST/70-314---------------------------------------------------------------------------EY---
PMT6_CANAL/97-357---------------------------------------------------------------------------QF---

PF11028

A3U548_CROAH/37-215---------------------------------------------------------------------------SK---
R6XIR1_9BACT/37-217---------------------------------------------------------------------------YK---
F6GE14_LACS5/37-214---------------------------------------------------------------------------AK---
I6ZS60_MELRP/34-208---------------------------------------------------------------------------YA---
H8KSF5_SOLCM/35-209---------------------------------------------------------------------------YK---
A0LXN9_GRAFK/37-215---------------------------------------------------------------------------AN---
U5Q8D9_9BACT/37-212---------------------------------------------------------------------------YK---
R5I514_9BACT/37-217---------------------------------------------------------------------------YK---
Q2S0T5_SALRD/34-225---------------------------------------------------------------------------YT---
I0K9H0_9BACT/35-227---------------------------------------------------------------------------YK---
X5D9M2_9BACT/35-209---------------------------------------------------------------------------FK---
X5DZV9_9BACT/35-212---------------------------------------------------------------------------FK---
H1XP16_9BACT/34-208---------------------------------------------------------------------------YI---
B3ENQ9_CHLPB/34-209---------------------------------------------------------------------------YT---
H1YCC6_9SPHI/34-214---------------------------------------------------------------------------FR---
H8KSF6_SOLCM/35-213---------------------------------------------------------------------------FK---
F4KRQ6_HALH1/35-218---------------------------------------------------------------------------YK---
F4C302_SPHS2/34-214---------------------------------------------------------------------------YK---
E4T8Q1_PALPW/35-213---------------------------------------------------------------------------FK---
H1Y2D3_9SPHI/34-214---------------------------------------------------------------------------FR---
A4CGC2_ROBBH/37-215---------------------------------------------------------------------------AK---
I3YTY0_AEQSU/37-215---------------------------------------------------------------------------SN---
F3ZQH0_9BACE/35-214---------------------------------------------------------------------------YK---
G8TAS2_NIAKG/34-222---------------------------------------------------------------------------YK---
D3IE17_9BACT/35-214---------------------------------------------------------------------------YK---
F4C4U7_SPHS2/36-216---------------------------------------------------------------------------YK---
G8R038_OWEHD/36-216---------------------------------------------------------------------------VK---
A6GWD8_FLAPJ/36-224---------------------------------------------------------------------------AK---
T2KIW2_9FLAO/37-215---------------------------------------------------------------------------AK---
I3KW99_ORENI/21-184---------------------------------------------------------------------------CE---
F4KMK4_PORAD/39-231---------------------------------------------------------------------------FK---
I0AH06_IGNAJ/35-227---------------------------------------------------------------------------AT---
C3L447_AMOA5/43-223---------------------------------------------------------------------------YK---
H8XP42_FLAIG/37-215---------------------------------------------------------------------------AK---
Q74D30_GEOSL/39-214---------------------------------------------------------------------------HS---
R5BN47_9BACE/50-226---------------------------------------------------------------------------YK---
F0S690_PSESL/34-213---------------------------------------------------------------------------YK---
A9AXK7_HERA2/53-215---------------------------------------------------------------------------WF---
R6SBD9_9BACE/36-215---------------------------------------------------------------------------YK---
B3EAC9_GEOLS/36-209---------------------------------------------------------------------------HF---
L7W9H4_NONDD/36-210---------------------------------------------------------------------------SK---
B5EH69_GEOBB/37-210---------------------------------------------------------------------------AS---
A1ARZ9_PELPD/68-243---------------------------------------------------------------------------AS---
G1PIZ8_MYOLU/52-215---------------------------------------------------------------------------HE---
A5G4Z0_GEOUR/37-209---------------------------------------------------------------------------SS---
C9RN70_FIBSS/36-216---------------------------------------------------------------------------NT---
I0AM95_IGNAJ/32-228---------------------------------------------------------------------------AT---
D3BML5_POLPA/98-270---------------------------------------------------------------------------HQ---
W8FBF7_9BACT/35-222---------------------------------------------------------------------------YK---
W0EVP7_9BACT/34-220---------------------------------------------------------------------------YK---
L7W937_NONDD/38-203---------------------------------------------------------------------------AN---
E4RU44_LEAB4/34-214---------------------------------------------------------------------------YK---
I0AN08_IGNAJ/34-208---------------------------------------------------------------------------YY---
A6LGG9_PARD8/35-214---------------------------------------------------------------------------YK---
A4AMM0_MARSH/37-215---------------------------------------------------------------------------AK---
C1A3K8_GEMAT/56-227---------------------------------------------------------------------------KV---
R6SBV2_9BACE/35-216---------------------------------------------------------------------------AK---
I0I530_CALAS/46-211---------------------------------------------------------------------------WN---
G8X584_FLACA/36-214---------------------------------------------------------------------------AK---
W0RJK7_9BACT/57-227---------------------------------------------------------------------------YV---
D0LFQ9_HALO1/25-195---------------------------------------------------------------------------VA---
R5W9J1_9BACT/35-214---------------------------------------------------------------------------YK---
K4IB40_PSYTT/37-215---------------------------------------------------------------------------AK---
E6X4M4_CELAD/37-216---------------------------------------------------------------------------AK---
D0MDF1_RHOM4/34-225---------------------------------------------------------------------------FG---
I3ZYA9_ORNRL/34-223---------------------------------------------------------------------------SK---
R7F5J7_9BACT/37-217---------------------------------------------------------------------------DK---
G8TQ81_NIAKG/34-212---------------------------------------------------------------------------YT---
A2TXJ8_9FLAO/37-215---------------------------------------------------------------------------VK---
I0AH07_IGNAJ/47-229---------------------------------------------------------------------------AT---
Q8KAY9_CHLTE/41-217---------------------------------------------------------------------------YT---
C6W6V6_DYAFD/35-215---------------------------------------------------------------------------FK---
F0NYC1_WEEVC/36-224---------------------------------------------------------------------------AK---
B4S581_PROA2/34-210---------------------------------------------------------------------------RT---
B3QWD0_CHLT3/33-211---------------------------------------------------------------------------YT---
Q39VU9_GEOMG/36-207---------------------------------------------------------------------------HS---
C6Y1Y3_PEDHD/35-207---------------------------------------------------------------------------SK---
C7M410_CAPOD/37-223---------------------------------------------------------------------------AK---
R5P289_9BACT/43-218---------------------------------------------------------------------------VG---
G2Z4K2_FLABF/39-217---------------------------------------------------------------------------AK---
R6AGR2_9BACT/35-214---------------------------------------------------------------------------YK---
B4SC86_PELPB/34-212---------------------------------------------------------------------------YT---
F4AVR9_DOKS4/37-216---------------------------------------------------------------------------SK---
Q7MT47_PORGI/37-226---------------------------------------------------------------------------NK---
I4AKN9_FLELS/34-232---------------------------------------------------------------------------YK---
I2EW61_EMTOG/35-215---------------------------------------------------------------------------YK---
D6D6N6_9BACE/37-216---------------------------------------------------------------------------EK---
R7DIG7_9PORP/35-214---------------------------------------------------------------------------YK---
C1A7V9_GEMAT/57-227---------------------------------------------------------------------------YV---
R5B2K5_9BACE/47-228---------------------------------------------------------------------------FK---
C0R1J1_BRAHW/121-297---------------------------------------------------------------------------YF---
H1Z8K4_MYROD/37-215---------------------------------------------------------------------------AK---
R5RQ99_9BACE/43-220---------------------------------------------------------------------------YK---
W5MZF0_LEPOC/41-204---------------------------------------------------------------------------CE---
F9YU79_CAPCC/36-215---------------------------------------------------------------------------AK---
C7PKN8_CHIPD/34-212---------------------------------------------------------------------------YK---
H6LAI5_SAPGL/35-215---------------------------------------------------------------------------YK---
J9R805_RIEAN/38-218---------------------------------------------------------------------------VK---
B6YRJ5_AZOPC/37-217---------------------------------------------------------------------------YK---
C6Y0P2_PEDHD/34-214---------------------------------------------------------------------------FK---
R5GFJ4_9BACT/35-214---------------------------------------------------------------------------YK---
TM260_DICDI/139-313---------------------------------------------------------------------------HQ---
R5G4M3_9PORP/37-222---------------------------------------------------------------------------AK---
C6X5R1_FLAB3/37-217---------------------------------------------------------------------------AK---
D2QNX1_SPILD/35-215---------------------------------------------------------------------------FK---
E4TV18_MARTH/50-230---------------------------------------------------------------------------YK---
R7HQZ6_9BACT/35-215---------------------------------------------------------------------------YK---
F2I9U5_FLUTR/34-221---------------------------------------------------------------------------NK---
I3Z145_BELBD/35-215---------------------------------------------------------------------------YK---
Q11YB8_CYTH3/35-214---------------------------------------------------------------------------YK---
R6CJ33_9BACT/35-214---------------------------------------------------------------------------YK---

PF02516

STT3A_HUMAN/17-484---------------------------------------------------------------------------TT---
STT3_CAEEL/19-506---------------------------------------------------------------------------AT---
STT3_YEAST/15-475---------------------------------------------------------------------------AT---
STT3_SCHPO/23-509---------------------------------------------------------------------------AS---
O29867_ARCFU/18-493---------------------------------------------------------------------------LI---
O27660_METTH/24-582---------------------------------------------------------------------------LT---
O27928_METTH/21-478---------------------------------------------------------------------------LT---
O27920_METTH/13-461---------------------------------------------------------------------------LT---
Y1525_METJA/33-650---------------------------------------------------------------------------LS---
PGLB_CAMJE/11-477---------------------------------------------------------------------------QL---

PF03901

SMP3_YEAST/6-401---------------------------------------------------------------------------EI---
GPI10_SCHPO/4-414---------------------------------------------------------------------------EV---
ALG9_SCHPO/16-438---------------------------------------------------------------------------EP---
ALG9_ARATH/48-451---------------------------------------------------------------------------EP---
ALG9_YEAST/10-414---------------------------------------------------------------------------EP---
ALG12_CAEEL/6-405---------------------------------------------------------------------------AT---
GPI10_YEAST/16-484---------------------------------------------------------------------------EP---
SMP3_SCHPO/9-412---------------------------------------------------------------------------QI---
Q9VBV8_DROME/75-498---------------------------------------------------------------------------EP---
PIGB_HUMAN/62-449---------------------------------------------------------------------------EV---
PIGB_DROME/5-396---------------------------------------------------------------------------EV---
ALG9_MOUSE/60-482---------------------------------------------------------------------------EP---
PIGZ_DROME/18-541---------------------------------------------------------------------------EV---
YTH3_CAEEL/55-472---------------------------------------------------------------------------EP---
F4K887_ARATH/41-451---------------------------------------------------------------------------EV---
GPI10_TRYB2/4-432---------------------------------------------------------------------------EV---

PF09852

Q119E7_TRIEI/30-487---------------------------------------------------------------------------YL---
Q1CZA2_MYXXD/39-471---------------------------------------------------------------------------AR---
Q7U446_SYNPX/31-511---------------------------------------------------------------------------WN---
A5GS07_SYNR3/40-521---------------------------------------------------------------------------WN---
Q119E6_TRIEI/27-490---------------------------------------------------------------------------YL---
Q82RR9_STRAW/82-508---------------------------------------------------------------------------RS---
Q4J6X7_SULAC/32-488---------------------------------------------------------------------------YS---
A5URL3_ROSS1/78-571---------------------------------------------------------------------------WN---
Q4J7K9_SULAC/43-493---------------------------------------------------------------------------YS---
Q9HK92_THEAC/39-557---------------------------------------------------------------------------EN---
A5GNZ8_SYNPW/38-520---------------------------------------------------------------------------WN---
Q4J7K8_SULAC/16-462---------------------------------------------------------------------------YS---
A5GR01_SYNR3/37-521---------------------------------------------------------------------------WS---
Q8F2H0_LEPIN/76-512---------------------------------------------------------------------------LP---
P73520_SYNY3/35-464---------------------------------------------------------------------------YL---
Q7U443_SYNPX/37-518---------------------------------------------------------------------------WN---
Q7VDJ5_PROMA/39-469---------------------------------------------------------------------------WL---
A5V1J1_ROSS1/34-511---------------------------------------------------------------------------AS---
Q7U444_SYNPX/29-448---------------------------------------------------------------------------WL---
Q10XG3_TRIEI/32-516---------------------------------------------------------------------------WN---
Q7V4G7_PROMM/40-520---------------------------------------------------------------------------WS---
Q7V4G8_PROMM/29-457---------------------------------------------------------------------------WL---

PF09913

Q1MP06_LAWIP/21-414------------------------------------------------------------------........TSI---
A4VVV9_STRSY/36-414------------------------------------------------------------------.........AA---
A0LS06_ACIC1/16-395------------------------------------------------------------------........AQG---
Q5Z3D8_NOCFA/116-537------------------------------------------------------------------...MGYAFHDY---
Q5M3E5_STRT2/28-432------------------------------------------------------------------.........QS---
A5UMR8_METS3/71-461------------------------------------------------------------------.........KT---
A1W3H2_ACISJ/39-436------------------------------------------------------------------........FAR---
Q6AGK9_LEIXX/24-391------------------------------------------------------------------......PPLVA---
A5UN71_METS3/84-467------------------------------------------------------------------.........YI---
Q01XM3_SOLUE/38-442------------------------------------------------------------------R.FGRFKPREL---
Q83H24_TROWT/46-427------------------------------------------------------------------ILDTWHGKGSR---
Q9CIZ8_LACLA/68-463------------------------------------------------------------------.........DT---
Q2JAW9_FRASC/81-503------------------------------------------------------------------......NPGAA---
Q0RGM1_FRAAA/18-412------------------------------------------------------------------......DPGRA---
A5G180_ACICJ/39-445------------------------------------------------------------------.........VL---
Q97N14_CLOAB/17-411------------------------------------------------------------------.......SENL---
A5UKJ8_METS3/70-455------------------------------------------------------------------.........IN---
Q9A0F5_STRP1/71-454------------------------------------------------------------------.........RI---

PF02364

FKS1_YEAST/808-1631......................................................EGNENEAEKEDALKSQIDDLPFY---
G0WGB2_NAUDC/693-1553...........NIASREIRRLVNLNNSQELLNPTILTESGKIDESDTTGNSKVDPIFLDTNGESFWVNEKIKDLPLY---
BGS4_SCHPO/872-1706.......................................................ENDSVSEKEGTYKSKVDDLPFY---
A5DFP6_PICGU/617-1414......................................................................YDNLPYE---
D8R536_SELML/856-1616.............................................................................---
G3BF86_CANTC/689-1496..............................................................PTPERKENHADLPYY---
S2JMJ1_MUCC1/751-1581.........................................LDDASLSGKSKTSTIAATATDEKTERQHKIDDLPFY---
Q6C549_YARLI/838-1663...................................................GEGSNDDLAEKDSDEVKAKIDDLPFY---
BGS2_SCHPO/844-1666...................................................NQDLNSQDESMKAEQLHKKFDDLPFY---
C5DDB6_LACTC/685-1519.....................................NNDQGESESEVLKEGLLGVSKEYDDRSKFFQAKIEDLPYH---
C5DVI4_ZYGRC/728-1590....................NKISKELGKKQIKVEDMEEENEIGIGTDSPTAEAAKKDEDEGEDDLVQKKINDLPFY---
G8BP05_TETPH/703-1537.....................................KSNEKNKTIDTDKEFEVDDENYEFYFDKLIEKKISDLPYE---
F4RFS0_MELLP/756-1575...............................................PSYAFANGQGNTSSSDEKVEKKKTDDIPFY---
A7TG32_VANPO/694-1542.........................KESQDINGDFSTFNYGSAEDYDEKQGSAKSEQENIPIVEELIQTKINDLPYF---
B9RVZ7_RICCO/412-1177.............................................................................---
E6ZX94_SPORE/765-1584.................................................GGASPFGGDSDEKSGTKNSAKADDLPFY---
F0XEB1_GROCL/867-1692...................................................NGDGDKEDGKDNKEAVKNKIDDLPFY---
A3GFC1_PICST/627-1453........................................PEDYDPLNLNINSSTITTKTDKETEYMKNKINDLPFY---
H2B091_KAZAF/695-1551.................SRVFKANMLSLDDEKFDAEEKIIDERYNESSKVYSKSIFEEEGEEADHLIREKISDLPYN---
K0KXK3_WICCF/839-1738DEDEEDEDPKTKTDTNEEIVEIDGVEDDESDEIDDEMDGIQDPRVKRKGIRFRRSKAVPTTPEDDILQGRINDLPFY---
G0VE27_NAUCC/691-1546................KLNSSQEMEGTMDKHLFNPDYSEDAVDSYDSQSGSVMSIPSMLYKDQEYLIREKINDLPYN---
M0Z2P0_HORVD/795-1572.............................................................................---
Q5K6T7_CRYNJ/779-1594......................................................NGGNPFASDEKEEAKKADDIPFY---
I1MEJ0_SOYBN/899-1668.............................................................................---
Q75EM6_ASHGO/644-1429....................................................ASNRANALSDHESCATRALFSLPYS---
A3GH41_PICST/602-1410............................................................TSSPTFDNETKDDLPYY---
C5M4K6_CANTT/600-1409............................................................SSSAEFRKEKLDDLPYY---
G3AGW3_SPAPN/626-1428...............................................DDIIPMLNTEMKDVSKQVNLTINSAELPLY---
G8B602_CANPC/590-1379.......................................................DDNDEGLNEYEKFKQNEDLPYY---
L8WXK6_THACA/691-1484...........................................................TPDEKSGKPGKADDLPFY---
W1QEZ3_OGAPD/758-1567..............................................................TGNASAEANNDLAFY---
S2JUI0_MUCC1/639-1467............................................SLDPSAKSDSELSVAGALEKDLVKSNVDDLPFY---
A9RK32_PHYPA/857-1633.............................................................................---
I1IFT6_BRADI/1065-1817.............................................................................---
Q6BYS5_DEBHA/725-1546............................................LDLGEADFPSEQSLNHKHESDLVNNQISDLPYY---
K4B948_SOLLC/878-1645.............................................................................---
CALSB_ARATH/870-1637.............................................................................---
K5X5R3_AGABU/768-1585.......................................................NGNNPFANEKEGGSKVDDLPFY---
Q6CDD3_YARLI/840-1684..................................GGEEVQGSYQEKKDGGEDGLLNVPEVIHKRDQKSGKYDNLPYY---
W1PHJ3_AMBTC/904-1670.............................................................................---
A5DBZ8_PICGU/697-1497.............................................................SSENSVDKMERDLPYD---
J7RLI4_KAZNA/694-1544....................KDFLPKTDSEVRIEAAKQFSEVDSANHLETKEEEQSHNEYKDTDGFVKEKLSDLPYK---
B9I122_POPTR/880-1647.............................................................................---
Q4WLT4_ASPFU/845-1663.......................................................NGEPEKSEKDVAKSKIDDLPFY---
K2RW51_MACPH/795-1619............................................................TSEKDEQKSKIDDLPFY---
FKS3_YEAST/694-1542.........................KEAESSHDEDRLEIPDALYDPRSSPLSDHTESRKLPTEDDLIKEKINDLPFS---
B6K1V9_SCHJY/528-1348.....................................................PMDPKSPADEKDLLKSKVDDLPFY---
C4R051_KOMPG/700-1508..........................................................EDSFSKSSIKDRLIDLPYY---
F8QGW8_SERL3/687-1503.......................................................DGTTTINEKGHGNSKADDLPFY---
Q5A9Y9_CANAL/588-1367..............................................................EDKFVRENMDDLPYY---
CALSC_ARATH/876-1645.............................................................................---
A9TZ19_PHYPA/865-1623.............................................................................---
W1QB78_OGAPD/694-1512......................................................MPGATVKSEKDFIENKISDLPLY---
G8Y1P4_PICSO/734-1542...........................................................SSSFDFSTKEKHDDLPYY---
M7P3D9_PNEMU/884-1710.....................................................NGGVPFDKDEKDTVKSKIDDLPFY---
Q751P2_ASHGO/697-1537...................................YKHEKEEGSDESLSPSMSDSAPVPAGINNDVLEARIKDLPFY---
C4QVL3_KOMPG/679-1490..................................................EFPELDMTSKELESRLLESKTYDLPFY---
G8ZYC9_TORDC/696-1542...........................KSICDEMKGRDDEVSNKGTLSKYIDHGSVFSDDKVGEDVVQKKISDLPYH---
K7M2P2_SOYBN/849-1612.............................................................................---
Q6FIJ9_CANGA/752-1597............................QYHTVDESSNTILNKKEQQNQMFSSFESVGSISTERDLLNEQMKDMPYR---
S9X5V3_SCHCR/777-1593..................................................DNSKADAKSEKPKKNHFLKE..DLPFY---
B6K096_SCHJY/781-1599....................................................EATTLKTEKGKKGGVTEKVTDLPFY---
C7ZN13_NECH7/785-1607......................................................HDSDSEATGQNQMDRKVQDLPFY---
G8JPJ3_ERECY/666-1455.......................................................IDGSILNSENLEERAMFSLPYS---
Q6CTB0_KLULA/691-1518................................................SKELEESENNSNKKDDSYIQEKISDLPFY---
G3BBN7_CANTC/598-1405.............................................................DSSATRIDEKTDNHYY---
G8YKZ4_PICSO/698-1523..........................................MQLLDPDDEDEKNLMERKENSDAFIRNEINNLPYY---
I1HRP2_BRADI/889-1659.............................................................................---

PF04602

V9XJW7_9NOCA/21-675---------------------------------------------------------------------------EQ...
H6MU20_GORPV/33-681---------------------------------------------------------------------------AE...
Q5Z3F6_NOCFA/13-659---------------------------------------------------------------------------GS...
W5T763_9NOCA/25-694---------------------------------------------------------------------------AE...
D0LC62_GORB4/25-672---------------------------------------------------------------------------AR...
F5YU82_MYCSD/4-645---------------------------------------------------------------------------RE...
A4FLJ6_SACEN/6-630---------------------------------------------------------------------------ER...
EMBB_MYCLE/22-673---------------------------------------------------------------------------AA...
E9T230_RHOHA/21-668---------------------------------------------------------------------------GQ...
A4F676_SACEN/36-675---------------------------------------------------------------------------RG...
D6ZA32_SEGRD/18-683---------------------------------------------------------------------------AA...
EMBC_MYCTU/27-682---------------------------------------------------------------------------AG...
W5T6N4_9NOCA/11-663---------------------------------------------------------------------------RD...
B1VE75_CORU7/37-709---------------------------------------------------------------------------DK...
W5WNE4_9CORY/27-693---------------------------------------------------------------------------TK...
V9XEG0_9NOCA/30-675---------------------------------------------------------------------------RD...
B1MEM1_MYCA9/17-667---------------------------------------------------------------------------NS...
F8DYG1_CORRG/20-684---------------------------------------------------------------------------QN...
U3GXX2_9CORY/12-670---------------------------------------------------------------------------NK...
A1TGU6_MYCVP/6-653---------------------------------------------------------------------------AT...
F6EEB9_HOYSD/14-665---------------------------------------------------------------------------ND...
Q5YYW4_NOCFA/29-683---------------------------------------------------------------------------TQ...
D5UMC1_TSUPD/6-651---------------------------------------------------------------------------AA...
Q745M3_MYCPA/11-658---------------------------------------------------------------------------RD...
V9XIW6_9NOCA/28-673---------------------------------------------------------------------------AE...
J9S8T7_9ACTN/54-705---------------------------------------------------------------------------AS...
C4LG43_CORK4/44-710---------------------------------------------------------------------------DN...
A0R614_MYCS2/24-675---------------------------------------------------------------------------RD...
C0ZLV7_RHOE4/28-666---------------------------------------------------------------------------GQ...
V5X6X3_MYCNE/4-651---------------------------------------------------------------------------AT...
H6MU24_GORPV/10-674---------------------------------------------------------------------------GE...
W5XXY2_9CORY/8-674---------------------------------------------------------------------------SD...
H6RD31_NOCCG/25-671---------------------------------------------------------------------------SQ...
H5X1D6_9PSEU/4-623---------------------------------------------------------------------------MA...
D5UNZ8_TSUPD/31-682---------------------------------------------------------------------------TD...
D5UNZ7_TSUPD/12-675---------------------------------------------------------------------------DR...
W5TDC8_9NOCA/23-685---------------------------------------------------------------------------AQ...
Q745M2_MYCPA/11-679---------------------------------------------------------------------------AT...
F6EEB8_HOYSD/16-671---------------------------------------------------------------------------ND...
D0LC64_GORB4/31-681---------------------------------------------------------------------------DR...
D5UNZ9_TSUPD/37-686---------------------------------------------------------------------------GA...
E9T231_RHOHA/29-674---------------------------------------------------------------------------AE...
L0J7Q5_9MYCO/5-653---------------------------------------------------------------------------RA...
K0ELF6_9NOCA/24-672---------------------------------------------------------------------------DA...
H6MU21_GORPV/21-696---------------------------------------------------------------------------AD...
L0J471_9MYCO/5-652---------------------------------------------------------------------------AS...
D7WBK3_9CORY/39-680---------------------------------------------------------------------------EE...
C1A0M7_RHOE4/26-667---------------------------------------------------------------------------SE...
Q6NK78_CORDI/12-664---------------------------------------------------------------------------DK...
D6ZD22_SEGRD/22-677---------------------------------------------------------------------------KS...
H6R7H1_NOCCG/16-659---------------------------------------------------------------------------AQ...
G8RNM8_MYCRN/11-660---------------------------------------------------------------------------AT...
A0R613_MYCS2/6-652---------------------------------------------------------------------------AE...
EMBA_MYCLE/11-678---------------------------------------------------------------------------AT...
B1MEM2_MYCA9/16-665---------------------------------------------------------------------------AT...
Q0S9C1_RHOJR/40-687---------------------------------------------------------------------------AG...
E9SYL2_RHOHA/31-680---------------------------------------------------------------------------AG...
D0LC65_GORB4/7-654---------------------------------------------------------------------------AD...
J9S5V1_9ACTN/37-692---------------------------------------------------------------------------AT...
W5TPG9_9NOCA/25-684---------------------------------------------------------------------------TQ...
Q0SFU9_RHOJR/35-682---------------------------------------------------------------------------GE...
D0LC63_GORB4/10-666---------------------------------------------------------------------------TSTIL
C3PJ41_CORA7/15-655---------------------------------------------------------------------------DK...
A0R612_MYCS2/13-668---------------------------------------------------------------------------AG...
Q0S9C0_RHOJR/14-655---------------------------------------------------------------------------TQ...
B1MEM5_MYCA9/31-682---------------------------------------------------------------------------KG...
D0LC66_GORB4/32-701---------------------------------------------------------------------------DR...

PF04188

GPI18_YEAST/2-433--------------------------------------------------------------------------------
PIGV_HUMAN/8-493--------------------------------------------------------------------------------
Q6NKT6_ARATH/13-489--------------------------------------------------------------------------------

PF05208

M4B3B6_HYAAE/47-400---------------------------------------------------------------------------GE.RD
ALG3_SCHPO/28-384---------------------------------------------------------------------------GE.RD
C1N7Z4_MICPC/3-383---------------------------------------------------------------------------GE.RD
G3B1L9_CANTC/44-430---------------------------------------------------------------------------GE.LD
H2B2E5_KAZAF/49-418---------------------------------------------------------------------------KN.LN
K7J227_NASVI/23-385---------------------------------------------------------------------------GT.FD
S8AK53_DACHA/26-392---------------------------------------------------------------------------GE.RD
D2A6B4_TRICA/38-438---------------------------------------------------------------------------GT.WD
E9IW57_SOLIN/49-411---------------------------------------------------------------------------GT.TD
N1PIB4_DOTSN/28-383---------------------------------------------------------------------------GE.RD
E3LRP4_CAERE/25-392---------------------------------------------------------------------------GI.MN
M0RYH3_MUSAM/65-429---------------------------------------------------------------------------GE.RD
C8VQM2_EMENI/22-377---------------------------------------------------------------------------GE.RD
E3QV49_COLGM/32-397---------------------------------------------------------------------------GE.RD
B2AMZ6_PODAN/32-391---------------------------------------------------------------------------GE.RD
Q5TWR0_ANOGA/52-490---------------------------------------------------------------------------GT.TD
M3JDA4_CANMX/610-996---------------------------------------------------------------------------GE.IM
K0KP51_WICCF/61-446---------------------------------------------------------------------------GE.LN
X6LVN7_RETFI/23-432---------------------------------------------------------------------------GD.MD
N1JDU5_BLUG1/30-393---------------------------------------------------------------------------GE.RD
K5XHY8_AGABU/29-387---------------------------------------------------------------------------GQ.YN
C5M8N0_CANTT/50-438---------------------------------------------------------------------------GE.LM
H3ATY3_LATCH/48-407---------------------------------------------------------------------------GT.YD
C5DQX2_ZYGRC/29-403---------------------------------------------------------------------------GE.TD
T1KW27_TETUR/32-391---------------------------------------------------------------------------GE.LN
E5QCI3_CAEEL/25-392---------------------------------------------------------------------------GI.LN
A4S939_OSTLU/24-393---------------------------------------------------------------------------GE.RD
A4HP72_LEIBR/7-391---------------------------------------------------------------------------GE.LD
K1XMH6_MARBU/34-397---------------------------------------------------------------------------GE.RD
B4NMK9_DROWI/51-467---------------------------------------------------------------------------GT.TN
U7Q833_SPOS1/49-412---------------------------------------------------------------------------GE.RD
E3JZB5_PUCGT/28-389---------------------------------------------------------------------------GE.RN
B6Q4R6_TALMQ/22-377---------------------------------------------------------------------------GE.RD
ALG3_ASPCL/84-439---------------------------------------------------------------------------GE.RD
S3EFY4_GLAL2/34-397---------------------------------------------------------------------------GE.RD
F1P0T5_CHICK/46-406---------------------------------------------------------------------------GT.RD
G8JVY1_ERECY/53-420---------------------------------------------------------------------------GE.RN
J7RGJ6_KAZNA/49-415---------------------------------------------------------------------------KN.LN
F9XK44_ZYMTI/23-383---------------------------------------------------------------------------GQ.RD
R4X949_TAPDE/11-374---------------------------------------------------------------------------GE.RD
I2FPC0_USTH4/26-382---------------------------------------------------------------------------GE.RH
ALG3_KLULA/54-427---------------------------------------------------------------------------GE.RD
G3PQJ8_GASAC/14-373---------------------------------------------------------------------------GT.YD
K4CV67_SOLLC/31-394---------------------------------------------------------------------------GE.RD
M1VU16_CLAP2/32-396---------------------------------------------------------------------------GE.RD
U5HGX6_USTV1/69-433---------------------------------------------------------------------------GE.RQ
K9G3P7_PEND2/24-384---------------------------------------------------------------------------GE.RD
T1IB96_RHOPR/32-396---------------------------------------------------------------------------GT.FD
B6K873_SCHJY/24-379---------------------------------------------------------------------------GV.RN
ALG3_DEBHA/45-438---------------------------------------------------------------------------GE.LD
B4KQ14_DROMO/49-491---------------------------------------------------------------------------GT.TN
E9FQN9_DAPPU/50-398---------------------------------------------------------------------------GT.WD
ALG3_PICST/52-442---------------------------------------------------------------------------GE.ID
S2JIL9_MUCC1/51-411---------------------------------------------------------------------------GE.RD
T1FMM7_HELRO/35-390---------------------------------------------------------------------------GT.YD
B7QF54_IXOSC/55-405---------------------------------------------------------------------------GT.FN
V5GAA3_BYSSN/22-377---------------------------------------------------------------------------GE.RD
D7FLD1_ECTSI/36-398---------------------------------------------------------------------------GE.RN
E7K994_YEASA/48-417---------------------------------------------------------------------------GM.LD
G8BZ82_TETPH/53-422---------------------------------------------------------------------------GE.YD
C5GLF5_AJEDR/22-377---------------------------------------------------------------------------GE.RD
J3K1V3_COCIM/22-377---------------------------------------------------------------------------GE.RD
Q4E4B0_TRYCC/8-370---------------------------------------------------------------------------GE.LD
Q4Q1L8_LEIMA/8-391---------------------------------------------------------------------------GE.LD
G4VF09_SCHMA/25-373---------------------------------------------------------------------------GT.LD
G0VFQ4_NAUCC/49-421---------------------------------------------------------------------------GQ.LN
ALG3_PICGU/60-451---------------------------------------------------------------------------GE.LD
D6RKR7_COPC7/33-391---------------------------------------------------------------------------GQ.HN
C7Z6Q8_NECH7/32-396---------------------------------------------------------------------------GE.RD
F2U0U1_SALR5/24-375---------------------------------------------------------------------------GT.HD
Q59QZ3_CANAL/67-487---------------------------------------------------------------------------GI.IK
K3XI42_SETIT/33-396---------------------------------------------------------------------------GE.RD
C1E6U6_MICCC/1-365---------------------------------------------------------------------------GE.RD
M7UJ49_BOTF1/42-405---------------------------------------------------------------------------GE.RD
H9GEH2_ANOCA/2-363---------------------------------------------------------------------------GT.LD
F4PBM6_BATDJ/69-446---------------------------------------------------------------------------GE.LD
ALG3_ASHGO/46-411---------------------------------------------------------------------------GE.RD
ALG3_NEUCR/38-404---------------------------------------------------------------------------GE.RD
W5JA52_ANODA/54-487---------------------------------------------------------------------------GT.TD
G2QLH4_MYCTT/46-410---------------------------------------------------------------------------GE.RD
E0VE58_PEDHC/46-408---------------------------------------------------------------------------GT.FD
L8G9R9_PSED2/26-389---------------------------------------------------------------------------GE.HD
I3N142_ICTTR/47-406---------------------------------------------------------------------------GT.YD
B0D3E3_LACBS/29-387---------------------------------------------------------------------------GQ.RN
G6D7P8_DANPL/38-461---------------------------------------------------------------------------GT.LD
A0A0D2U908_CAPO3/41-396---------------------------------------------------------------------------GE.RD
B4MDV8_DROVI/49-475---------------------------------------------------------------------------GT.TN
S9XFL7_SCHCR/33-388---------------------------------------------------------------------------GE.RD
G3AUB5_SPAPN/46-435---------------------------------------------------------------------------GE.IV
R9P1A8_PSEHS/26-382---------------------------------------------------------------------------GQ.RD
T5AE24_OPHSC/31-395---------------------------------------------------------------------------GQ.RD
V5ENX1_KALBG/26-382---------------------------------------------------------------------------GE.RD
G0RBH9_HYPJQ/25-389---------------------------------------------------------------------------GE.RD
A7TI38_VANPO/47-414---------------------------------------------------------------------------GE.LD
S7ZPA3_PENO1/24-378---------------------------------------------------------------------------GE.RD
I4Y5F8_WALMC/28-386---------------------------------------------------------------------------GSITH
M9LSR1_PSEA3/61-417---------------------------------------------------------------------------GE.RT
G3J6N9_CORMM/40-406---------------------------------------------------------------------------GE.RD
G0SZN6_RHOT2/81-458---------------------------------------------------------------------------GE.RD
E3RP57_PYRTT/27-387---------------------------------------------------------------------------GE.RD
H2YCK3_CIOSA/39-392---------------------------------------------------------------------------GT.HD
ALG3_KOMPG/40-432---------------------------------------------------------------------------GE.LD
I1NB48_SOYBN/44-418---------------------------------------------------------------------------GE.RD
V2XSY5_MONRO/23-381---------------------------------------------------------------------------GE.RD
S3D164_OPHP1/66-445---------------------------------------------------------------------------GE.RD
D8PWW0_SCHCM/28-385---------------------------------------------------------------------------GE.RD
G4MX55_MAGO7/32-396---------------------------------------------------------------------------GE.RD
ALG3_CANGA/46-411---------------------------------------------------------------------------GN.YN
U9SRB0_RHIID/43-401---------------------------------------------------------------------------GE.RD
A9S9E9_PHYPA/15-380---------------------------------------------------------------------------GE.RN
A0A0D1DTA4_USTMA/26-382---------------------------------------------------------------------------GE.RD
R9A916_WALI9/668-1026---------------------------------------------------------------------------GKITQ
A8WH14_XENTR/49-408---------------------------------------------------------------------------GT.YD
F0X8A8_GROCL/32-398---------------------------------------------------------------------------GE.RD
G0WBV5_NAUDC/62-452---------------------------------------------------------------------------NE.LD
E4ZQ47_LEPMJ/110-470---------------------------------------------------------------------------GE.RD
W1QI94_OGAPD/44-429---------------------------------------------------------------------------GE.LD
Q17I48_AEDAE/60-492---------------------------------------------------------------------------GT.TN
J9JKC3_ACYPI/34-397---------------------------------------------------------------------------GT.FD
ALG3_ARATH/37-401---------------------------------------------------------------------------GE.RD
F4QBL4_DICFS/50-404---------------------------------------------------------------------------GE.RN
E2BFG0_HARSA/50-411---------------------------------------------------------------------------GT.HD
K2RJR1_MACPH/22-381---------------------------------------------------------------------------GE.RD
A0A0C4DNJ3_MAGP6/32-396---------------------------------------------------------------------------GE.RD
K5UZ89_PHACS/35-392---------------------------------------------------------------------------GE.RD
B7FU52_PHATC/1-358---------------------------------------------------------------------------GE.LD
E1FRZ8_LOALO/22-398---------------------------------------------------------------------------GI.RN
G8YQ30_PICSO/46-439---------------------------------------------------------------------------GE.LD
I2H2F8_TETBL/47-416---------------------------------------------------------------------------HN.LN
Q38AV3_TRYB2/9-364---------------------------------------------------------------------------GE.LD
R0IS40_SETT2/23-383---------------------------------------------------------------------------GQ.RD
B8C606_THAPS/2-402---------------------------------------------------------------------------GE.RD
NT56_DROME/50-470---------------------------------------------------------------------------GT.TN
F1QAD8_DANRE/41-400---------------------------------------------------------------------------GT.YD
E2AE79_CAMFO/50-412---------------------------------------------------------------------------GT.MD
M2RJ12_CERS8/31-389---------------------------------------------------------------------------GE.RD
M7NVY2_PNEMU/31-392---------------------------------------------------------------------------GE.RN
K1PJL2_CRAGI/29-393---------------------------------------------------------------------------GT.YD
K3WI15_PYTUL/49-402---------------------------------------------------------------------------GE.RD
G3YDP3_ASPNA/22-377---------------------------------------------------------------------------GE.RD
G8ZRL4_TORDC/46-409---------------------------------------------------------------------------GE.LD
B4J870_DROGR/49-472---------------------------------------------------------------------------GT.TN
F9FME8_FUSOF/32-396---------------------------------------------------------------------------GE.RD
A7RPJ4_NEMVE/13-362---------------------------------------------------------------------------GT.YD
G4TDK5_SERID/21-386---------------------------------------------------------------------------GQ.RD
S8FYD7_FOMPI/36-394---------------------------------------------------------------------------GE.RD
M2MJW6_BAUCO/22-383---------------------------------------------------------------------------GE.RD
F2PUQ0_TRIEC/23-378---------------------------------------------------------------------------GE.RD
ALG3_CRYNJ/40-416---------------------------------------------------------------------------GE.RD
B9I9T5_POPTR/29-388---------------------------------------------------------------------------GE.RD
E6ZW66_SPORE/26-382---------------------------------------------------------------------------GE.RD
C4YB28_CLAL4/53-446---------------------------------------------------------------------------GA.LD
U4KZB6_PYROM/25-385---------------------------------------------------------------------------GE.RN
G7DY72_MIXOS/36-395---------------------------------------------------------------------------GE.KD
C5DE51_LACTC/56-423---------------------------------------------------------------------------GE.TD

PF14897

D0MGT8_RHOM4/10-327---------------------------------------------------------------------------..-..
A6L8S3_PARD8/36-371---------------------------------------------------------------------------RD-I.
F0R6C6_BACSH/27-352---------------------------------------------------------------------------..-..
C6W3U8_DYAFD/27-360---------------------------------------------------------------------------..-..
C6WZX9_FLAB3/31-373---------------------------------------------------------------------------TT-YG
F0NZQ8_WEEVC/30-359---------------------------------------------------------------------------LY-..
Q5L9T0_BACFN/34-354---------------------------------------------------------------------------YS-Y.
Q6AIA7_DESPS/40-375---------------------------------------------------------------------------NN-F.
D2QJN3_SPILD/45-378---------------------------------------------------------------------------GI-V.
D6D462_9BACE/28-360---------------------------------------------------------------------------..-..
E3HB27_ILYPC/34-350---------------------------------------------------------------------------..-..
C7PMN8_CHIPD/32-372---------------------------------------------------------------------------ID-KF
Q5L965_BACFN/30-358---------------------------------------------------------------------------SD-LW
Q1WTE3_LACS1/26-359---------------------------------------------------------------------------LS-HF
A0KM85_AERHH/26-353---------------------------------------------------------------------------GR-Y.
A9NH20_ACHLI/15-352---------------------------------------------------------------------------..-..
A6GZ52_FLAPJ/21-343---------------------------------------------------------------------------MI-F.
D8IGG5_LACFC/21-364---------------------------------------------------------------------------T.-..
Q03WA2_LEUMM/21-358---------------------------------------------------------------------------..-..
A6TBF0_KLEP7/23-340---------------------------------------------------------------------------GY-D.
A5G608_GEOUR/41-362---------------------------------------------------------------------------KL-..
C6X1R8_FLAB3/21-351---------------------------------------------------------------------------AV-DF
E0SFU5_DICD3/23-330---------------------------------------------------------------------------..-..
Q6FFU5_ACIAD/13-316---------------------------------------------------------------------------SF-NE
E4TIN4_CALNY/56-394---------------------------------------------------------------------------..-..
Q8A831_BACTN/29-353---------------------------------------------------------------------------..-..
C7M7Z9_CAPOD/10-347---------------------------------------------------------------------------..-..
Q8A715_BACTN/26-366---------------------------------------------------------------------------..-..
C7RFF5_ANAPD/29-361---------------------------------------------------------------------------..-..
Q5LH99_BACFN/15-335---------------------------------------------------------------------------..-..
D3SAJ3_THISK/38-360---------------------------------------------------------------------------..-..
C6X0C5_FLAB3/28-350---------------------------------------------------------------------------..-..
C4ZJE6_THASP/44-373---------------------------------------------------------------------------..-..
D6E918_9ACTN/24-356---------------------------------------------------------------------------TF-SQ
F0SY68_SYNGF/34-364---------------------------------------------------------------------------..-..
A6L9H3_PARD8/32-354---------------------------------------------------------------------------S.-..
A1A378_BIFAA/27-350---------------------------------------------------------------------------TP-..
E0RX92_BUTPB/42-359---------------------------------------------------------------------------AY-..
Q8XN60_CLOPE/30-345---------------------------------------------------------------------------YD-P.
C4L730_EXISA/28-346---------------------------------------------------------------------------PL-GA
C7M4A6_CAPOD/29-353---------------------------------------------------------------------------LH-KA
Q39W09_GEOMG/33-369---------------------------------------------------------------------------SG-S.
E4RNL6_HALHG/27-346---------------------------------------------------------------------------GI-SW
C4Z668_EUBE2/44-362---------------------------------------------------------------------------S.-..
E0S0Y2_BUTPB/32-367---------------------------------------------------------------------------KV-YF
D2RIR8_ACIFV/29-352---------------------------------------------------------------------------DD-PW
D5EVG6_PRER2/7-324---------------------------------------------------------------------------..-..
A6QAG6_SULNB/27-344---------------------------------------------------------------------------NY-MD
Q0A657_ALKEH/27-342---------------------------------------------------------------------------SL-QE
Q8DJL9_THEEB/21-349---------------------------------------------------------------------------SW-FA
A7HKI9_FERNB/29-353---------------------------------------------------------------------------GI-DF
E3I7S4_RHOVT/25-342---------------------------------------------------------------------------TV-EE
Q5QWV6_IDILO/29-338---------------------------------------------------------------------------AL-T.
Q1QWW7_CHRSD/27-347---------------------------------------------------------------------------..-..
A6LBP7_PARD8/27-381---------------------------------------------------------------------------FH-LE
E6UEJ4_RUMA7/36-384---------------------------------------------------------------------------ST-SY
E4RXS3_LEAB4/31-353---------------------------------------------------------------------------SN-SF
C4K321_HAMD5/34-350---------------------------------------------------------------------------..-..
C8WKZ6_EGGLE/32-357---------------------------------------------------------------------------FS-LD
A6L4H4_BACV8/26-363---------------------------------------------------------------------------IH-N.
D9S910_FIBSS/29-351---------------------------------------------------------------------------..-..
F5WT29_ERYRF/24-344---------------------------------------------------------------------------TF-GK
G8PTM7_PSEUV/31-346---------------------------------------------------------------------------PF-VE
Q1G8I7_LACDA/49-398---------------------------------------------------------------------------SY-T.
R5KIX9_9CLOT/31-383---------------------------------------------------------------------------SW-SQ
R7EM48_9BACE/29-344---------------------------------------------------------------------------..-..

PF03155

L8G8K2_PSED2/15-492---------------------------------------------------------------------------PVQEW
Q5TNL1_ANOGA/16-506---------------------------------------------------------------------------PVSDW
D8UDK3_VOLCA/12-511---------------------------------------------------------------------------PISKW
Q29NI9_DROPS/12-462---------------------------------------------------------------------------EPGQW
T1K7S4_TETUR/16-504---------------------------------------------------------------------------PISQW
G2RBR7_THITE/15-492---------------------------------------------------------------------------PLWEW
M7PD45_PNEMU/13-491---------------------------------------------------------------------------PLSKW
D3BMH9_POLPA/36-529---------------------------------------------------------------------------PVSKW
A5DZN5_LODEL/28-537---------------------------------------------------------------------------PLSQW
F6ZU35_CIOIN/22-490---------------------------------------------------------------------------PIQDW
S9W0G5_SCHCR/14-492---------------------------------------------------------------------------PISQW
K1XC57_MARBU/15-492---------------------------------------------------------------------------PVREW
G0W812_NAUDC/80-564---------------------------------------------------------------------------PISQW
C1E537_MICCC/36-567---------------------------------------------------------------------------PPARW
D7TT36_VITVI/40-494---------------------------------------------------------------------------PAKEW
E9GMP9_DAPPU/11-491---------------------------------------------------------------------------PLNKW
F2UCB2_SALR5/15-489---------------------------------------------------------------------------PVKEW
H2Z9N9_CIOSA/19-515---------------------------------------------------------------------------PYKDW
G3NV34_GASAC/14-486---------------------------------------------------------------------------PLQEW
G8BYL8_TETPH/49-563---------------------------------------------------------------------------PISKW
I7LWJ3_TETTS/163-672---------------------------------------------------------------------------PPSQW
A3LPA6_PICST/60-509---------------------------------------------------------------------------PISQW
J7SB75_KAZNA/38-553---------------------------------------------------------------------------PLREW
M4BE27_HYAAE/29-565---------------------------------------------------------------------------PRRLW
A0A087ZQU5_APIME/41-513---------------------------------------------------------------------------PLKEW
G7YSM9_CLOSI/17-476---------------------------------------------------------------------------PVREW
F4X5Y5_ACREC/45-518---------------------------------------------------------------------------PVAEW
J9K2E7_ACYPI/9-490---------------------------------------------------------------------------PISQW
R7YRL9_CONA1/15-485---------------------------------------------------------------------------PVKQW
ALG8_YEAST/51-565---------------------------------------------------------------------------PISEW
E2BLU2_HARSA/14-512---------------------------------------------------------------------------PVNQW
C0NWB8_AJECG/15-495---------------------------------------------------------------------------PVDKW
I3IT66_DANRE/14-487---------------------------------------------------------------------------PVHEW
G3BFJ8_CANTC/32-544---------------------------------------------------------------------------PINKW
ALG8_CAEEL/14-494---------------------------------------------------------------------------PLCEW
W5GB91_WHEAT/20-508---------------------------------------------------------------------------PARQW
H2SHL1_TAKRU/16-505---------------------------------------------------------------------------PMSRW
F1A4M3_DICPU/24-508---------------------------------------------------------------------------DVHEW
M3BZ39_SPHMS/15-495---------------------------------------------------------------------------PLREW
B5RU50_DEBHA/74-567---------------------------------------------------------------------------PINKW
R1GPQ5_BOTPV/17-493---------------------------------------------------------------------------PVPEW
ALG6_SCHPO/35-484---------------------------------------------------------------------------PVSQW
B3S4W0_TRIAD/22-470---------------------------------------------------------------------------PVKQW
B0CY11_LACBS/39-528---------------------------------------------------------------------------PISKW
M3K587_CANMX/31-541---------------------------------------------------------------------------PISKW
N4VMS5_COLOR/17-495---------------------------------------------------------------------------PLSQW
I1LX18_SOYBN/37-486---------------------------------------------------------------------------PIKEW
M9PB91_DROME/12-464---------------------------------------------------------------------------AVGEW
ALG8_SCHPO/14-492---------------------------------------------------------------------------PISEW
ALG8_ASHGO/44-558---------------------------------------------------------------------------PLREW
H2M3G8_ORYLA/14-482---------------------------------------------------------------------------PIREW
A0A068XBV5_HYMMI/13-510---------------------------------------------------------------------------EFSQW
D7MJY5_ARALL/49-511---------------------------------------------------------------------------PVIDW
M7UBV6_BOTF1/15-495---------------------------------------------------------------------------PLNEW
B8C862_THAPS/6-526---------------------------------------------------------------------------PLNQW
D5G5Y1_TUBMM/57-510---------------------------------------------------------------------------PAKEW
B6JZC1_SCHJY/14-495---------------------------------------------------------------------------PLKEW
B4JPP0_DROGR/12-469---------------------------------------------------------------------------PAKQW
A0A0K0IZP2_BRUMA/20-473---------------------------------------------------------------------------PINQW
G8ZP39_TORDC/40-554---------------------------------------------------------------------------PLKEW
G8BGI3_CANPC/69-539---------------------------------------------------------------------------PTSDW
ALG6_HUMAN/14-488---------------------------------------------------------------------------PVKQW
B6Q2U6_TALMQ/15-493---------------------------------------------------------------------------PVQEW
ALG6_CHICK/14-488---------------------------------------------------------------------------PIRQW
C3XSJ3_BRAFL/15-487---------------------------------------------------------------------------PLKQW
I1KRW2_SOYBN/28-527---------------------------------------------------------------------------PLSQW
A0A068XHI1_HYMMI/18-474---------------------------------------------------------------------------DFSDW
C5DTD9_ZYGRC/51-531---------------------------------------------------------------------------PISQW
I2GX66_TETBL/28-529---------------------------------------------------------------------------PLREW
A7S144_NEMVE/15-467---------------------------------------------------------------------------PINQW
A0A0J9XRE5_BRUMA/37-513---------------------------------------------------------------------------PICSW
Q6C8U0_YARLI/72-529---------------------------------------------------------------------------PISKW
A7RNB8_NEMVE/17-518---------------------------------------------------------------------------PLNKW
U7Q3L8_SPOS1/16-494---------------------------------------------------------------------------PLWDW
A8WP54_CAEBR/14-530---------------------------------------------------------------------------PLKAW
F6PL55_ORNAN/15-493---------------------------------------------------------------------------PIKQW
F1NPY2_CHICK/24-512---------------------------------------------------------------------------PLSQW
C5M3Q6_CANTT/80-532---------------------------------------------------------------------------PISQW
G9NL14_HYPAI/15-495---------------------------------------------------------------------------PLSQW
C5DJM6_LACTC/29-543---------------------------------------------------------------------------PLHKW
M2TGW6_COCH5/15-493---------------------------------------------------------------------------PIKEW
A0A068XUS9_ECHMU/14-510---------------------------------------------------------------------------NISEW
N1PRH1_DOTSN/15-493---------------------------------------------------------------------------PLEKW
W5KCM7_ASTMX/22-513---------------------------------------------------------------------------PVSQW
A8XHZ8_CAEBR/37-475---------------------------------------------------------------------------PIEHW
W5KTC4_ASTMX/14-487---------------------------------------------------------------------------PVQEW
F0ZUK5_DICPU/35-551---------------------------------------------------------------------------PISKW
A0A068Y0H1_ECHMU/19-476---------------------------------------------------------------------------PISEW
ALG8_HUMAN/21-510---------------------------------------------------------------------------PISQW
G3AHF0_SPAPN/67-518---------------------------------------------------------------------------PISKW
G7DT66_MIXOS/306-809---------------------------------------------------------------------------PPSEW
E4XPJ7_OIKDI/15-474---------------------------------------------------------------------------PLSKW
K0KJ73_WICCF/57-557---------------------------------------------------------------------------PIREW
Q6CSG6_KLULA/71-550---------------------------------------------------------------------------PVREW
S8A5I1_DACHA/15-491---------------------------------------------------------------------------HPSKW
J7S8J5_KAZNA/67-547---------------------------------------------------------------------------PVSQW
G8YLJ6_PICSO/71-564---------------------------------------------------------------------------PIDKW
ALG8_CANGA/21-535---------------------------------------------------------------------------PLRQW
U5GCU1_POPTR/44-501---------------------------------------------------------------------------PIKDW
B4L518_DROMO/13-481---------------------------------------------------------------------------PINRW
C4XYN7_CLAL4/28-542---------------------------------------------------------------------------PVAKW
S9VWR7_SCHCR/35-484---------------------------------------------------------------------------PISNW
C4Y8Y1_CLAL4/65-544---------------------------------------------------------------------------PVDQW
U4LQP8_PYROM/53-504---------------------------------------------------------------------------PVREW
ALG6_DICDI/25-502---------------------------------------------------------------------------DIHQW
W1PIJ5_AMBTC/36-490---------------------------------------------------------------------------PPREW
H0V4T9_CAVPO/14-492---------------------------------------------------------------------------PVRQW
F6UCU7_XENTR/38-526---------------------------------------------------------------------------PVSKW
F9FE00_FUSOF/15-493---------------------------------------------------------------------------PLEKW
B4MG56_DROVI/12-467---------------------------------------------------------------------------DVKNW
M5ECX9_MALS4/12-500---------------------------------------------------------------------------PLRDW
R4G404_RHOPR/9-494---------------------------------------------------------------------------PWKFW
A8J4X2_CHLRE/2-518---------------------------------------------------------------------------PLSKW
I7LUU2_TETTS/10-489---------------------------------------------------------------------------PLREW
Q7Q2B4_ANOGA/11-482---------------------------------------------------------------------------PLSRW
T1G1F7_HELRO/12-479---------------------------------------------------------------------------PVHDW
D8Q0E0_SCHCM/162-611---------------------------------------------------------------------------PTREW
Q176C2_AEDAE/15-501---------------------------------------------------------------------------PVRDW
V2XYC4_MONRO/48-546---------------------------------------------------------------------------PMSKW
K5WXZ7_AGABU/56-542---------------------------------------------------------------------------PISKW
F6GVE0_VITVI/26-508---------------------------------------------------------------------------PLSQW
G8YVD8_PICSO/37-547---------------------------------------------------------------------------PLKQW
F9X7N4_ZYMTI/15-491---------------------------------------------------------------------------PLKEW
B4I046_DROSE/12-481---------------------------------------------------------------------------PLNQW
H6CAF2_EXODN/46-523---------------------------------------------------------------------------PVKRW
E4V433_ARTGP/15-494---------------------------------------------------------------------------PVKEW
ALG6_YEAST/46-528---------------------------------------------------------------------------PLSKW
C5DEQ3_LACTC/41-520---------------------------------------------------------------------------PLSQW
Q17GG0_AEDAE/11-473---------------------------------------------------------------------------PLAKW
M0ZN96_SOLTU/61-545---------------------------------------------------------------------------PLSQW
A5E0J5_LODEL/108-572---------------------------------------------------------------------------PLSQW
C4R675_KOMPG/51-560---------------------------------------------------------------------------PLKEW
T5AJ86_OPHSC/15-492---------------------------------------------------------------------------PVSEW
D2UZR6_NAEGR/31-501---------------------------------------------------------------------------PISEW
D8PR27_SCHCM/33-514---------------------------------------------------------------------------PISQW
E6ZL14_SPORE/61-583---------------------------------------------------------------------------PIREW
F4NSW2_BATDJ/10-461---------------------------------------------------------------------------PRSEW
G3J5X8_CORMM/17-489---------------------------------------------------------------------------PLSEW
T1JIW9_STRMM/20-486---------------------------------------------------------------------------PFDKW
H2VDX9_TAKRU/14-486---------------------------------------------------------------------------PVQEW
G8JSX9_ERECY/78-592---------------------------------------------------------------------------PLLDW
U4KWQ6_PYROM/15-499---------------------------------------------------------------------------PVQKW
E3KWU5_PUCGT/17-510---------------------------------------------------------------------------PLSKW
I3JQF2_ORENI/14-486---------------------------------------------------------------------------PIQEW
K4A8J1_SETIT/40-498---------------------------------------------------------------------------PPSDW
B3MJG1_DROAN/12-464---------------------------------------------------------------------------DVGEW
X1WNC6_ACYPI/31-488---------------------------------------------------------------------------PTTQW
Q75CA8_ASHGO/68-547---------------------------------------------------------------------------PVSKW
D0N326_PHYIT/34-510---------------------------------------------------------------------------PVSDW
Q6FVE1_CANGA/52-532---------------------------------------------------------------------------PISKW
H3CLG0_TETNG/1-489---------------------------------------------------------------------------PLSRW
U5FSQ0_POPTR/25-525---------------------------------------------------------------------------PLDQW
A7TDS1_VANPO/94-608---------------------------------------------------------------------------PISKW
X6MDM2_RETFI/80-636---------------------------------------------------------------------------.....
D2A4Q9_TRICA/20-523---------------------------------------------------------------------------RPLEW
F6PKN9_XENTR/14-490---------------------------------------------------------------------------PVKQW
G8ZY47_TORDC/46-526---------------------------------------------------------------------------APSQW
H2AU41_KAZAF/49-563---------------------------------------------------------------------------HLKDW
F8QIP1_SERL3/1-475---------------------------------------------------------------------------PISQW
A5DBI4_PICGU/24-536---------------------------------------------------------------------------PVSKW
S8A6B8_DACHA/57-532---------------------------------------------------------------------------PISKW
G0VHP8_NAUCC/41-555---------------------------------------------------------------------------PLKQW
ALG8_KLULA/37-549---------------------------------------------------------------------------PLNKW
A3GH90_PICST/41-554---------------------------------------------------------------------------PVSEW
D8SCH8_SELML/18-458---------------------------------------------------------------------------PVSDW
M0SWI1_MUSAM/15-472---------------------------------------------------------------------------PAAEW
E9HIJ0_DAPPU/14-464---------------------------------------------------------------------------PIQDW
G8JQX3_ERECY/54-533---------------------------------------------------------------------------PISRW
E3LGX2_CAERE/56-494---------------------------------------------------------------------------PIEQW
G1KHE7_ANOCA/14-488---------------------------------------------------------------------------PVKDW
M3ZXK5_XIPMA/20-507---------------------------------------------------------------------------PLSRW
M1AYF5_SOLTU/40-493---------------------------------------------------------------------------PVREW
G0WC59_NAUDC/39-554---------------------------------------------------------------------------PLKEW
Q566T2_DANRE/20-507---------------------------------------------------------------------------PVSQW
S7ZR44_PENO1/15-489---------------------------------------------------------------------------PVKEW
B5Y5E2_PHATC/28-512---------------------------------------------------------------------------PVGEW
I2H6P2_TETBL/49-543---------------------------------------------------------------------------PISKW
A9RXF0_PHYPA/16-505---------------------------------------------------------------------------PLKEW
S8ECT2_FOMPI/45-533---------------------------------------------------------------------------PISQW
K5X935_PHACS/65-548---------------------------------------------------------------------------PMSRW
ALG6_CAEEL/56-491---------------------------------------------------------------------------PIEQW
C4R109_KOMPG/50-531---------------------------------------------------------------------------SIEKW
G3BBW3_CANTC/58-534---------------------------------------------------------------------------PINQW
H2ANJ3_KAZAF/67-548---------------------------------------------------------------------------PISKW
M4C591_HYAAE/34-510---------------------------------------------------------------------------PISEW
M2MQ53_BAUCO/15-492---------------------------------------------------------------------------PLKQW
W1NV46_AMBTC/11-495---------------------------------------------------------------------------PLSNW
S2JJH6_MUCC1/40-480---------------------------------------------------------------------------PTSKW
I3JKF5_ORENI/18-505---------------------------------------------------------------------------PVSRW
G8BYB6_TETPH/62-543---------------------------------------------------------------------------PISQW
H2Y782_CIOSA/7-450---------------------------------------------------------------------------PPTEW
G4VBL6_SCHMA/19-502---------------------------------------------------------------------------PFTEW
F4P9K6_BATDJ/14-479---------------------------------------------------------------------------PTSQW
A2QEY3_ASPNC/67-535---------------------------------------------------------------------------PISKW
E2BUL4_HARSA/38-509---------------------------------------------------------------------------PLKEW
ALG8_DEBHA/34-545---------------------------------------------------------------------------PISKW
A0A0D2X4J7_CAPO3/36-488---------------------------------------------------------------------------PPAEW
K3WJX2_PYTUL/33-498---------------------------------------------------------------------------PVSQW
C5DNU1_ZYGRC/30-544---------------------------------------------------------------------------PLRQW
F0YK69_AURAN/94-544---------------------------------------------------------------------------PLADW
B0WBY1_CULQU/17-503---------------------------------------------------------------------------PIADW
B3RIR0_TRIAD/15-519---------------------------------------------------------------------------PVSQW
G8BJG1_CANPC/35-543---------------------------------------------------------------------------PISQW
B6K4U3_SCHJY/35-468---------------------------------------------------------------------------PISQW
K3X7Z1_PYTUL/28-566---------------------------------------------------------------------------PRHDW
G7XVM6_ASPKW/15-493---------------------------------------------------------------------------PVKEW
D7LLP2_ARALL/19-500---------------------------------------------------------------------------PLTKW
G3AQ92_SPAPN/42-557---------------------------------------------------------------------------PISKW
G4TH15_SERID/87-576---------------------------------------------------------------------------PLSQW
B4KK01_DROMO/12-467---------------------------------------------------------------------------EVKLW
A8PTB3_MALGO/18-506---------------------------------------------------------------------------PLREW
B0CVP2_LACBS/18-494---------------------------------------------------------------------------PIRQW
F4WJE6_ACREC/14-512---------------------------------------------------------------------------PLDEW
R4XHB2_TAPDE/18-493---------------------------------------------------------------------------PVNQW
W1Q7Q7_OGAPD/16-525---------------------------------------------------------------------------PLNRW
B4MJ94_DROWI/18-488---------------------------------------------------------------------------PMNRW
F4RT20_MELLP/38-527---------------------------------------------------------------------------PLSRW
ALG8_CANAL/51-572---------------------------------------------------------------------------PISQW
K0KKM0_WICCF/47-534---------------------------------------------------------------------------PISQW
K7H4J1_CAEJA/18-503---------------------------------------------------------------------------PLAEW
B4JLV7_DROGR/13-480---------------------------------------------------------------------------PLDHW
A7TJW9_VANPO/47-530---------------------------------------------------------------------------PISKW
A0DD77_PARTE/10-454---------------------------------------------------------------------------NITQW
N1JGC6_BLUG1/16-499---------------------------------------------------------------------------PTDKW

PF04922

D6W779_TRICA/29-405--------------------------------------------------------------------------------
K5XCQ6_PHACS/29-416--------------------------------------------------------------------------------
T1G2P1_HELRO/32-429--------------------------------------------------------------------------------
H2T3E9_TAKRU/31-424--------------------------------------------------------------------------------
ALG10_CANGA/63-455--------------------------------------------------------------------------------
I1N2G0_SOYBN/25-459--------------------------------------------------------------------------------
E0V9V1_PEDHC/31-428--------------------------------------------------------------------------------
M0THQ1_MUSAM/25-461--------------------------------------------------------------------------------
F4R3Q7_MELLP/33-444--------------------------------------------------------------------------------
R4GKH2_CHICK/31-425--------------------------------------------------------------------------------
G8ZYL6_TORDC/61-452--------------------------------------------------------------------------------
C6H8G6_AJECH/46-531--------------------------------------------------------------------------------
ALG10_DEBHA/27-407--------------------------------------------------------------------------------
E3RDG0_PYRTT/32-497--------------------------------------------------------------------------------
F6RK69_MONDO/31-424--------------------------------------------------------------------------------
F6YIJ5_CIOIN/30-422--------------------------------------------------------------------------------
Q7QC28_ANOGA/28-387--------------------------------------------------------------------------------
R0ILV6_SETT2/32-500--------------------------------------------------------------------------------
U9SYH3_RHIID/26-420--------------------------------------------------------------------------------
B3S3F0_TRIAD/21-412--------------------------------------------------------------------------------
C5GWH0_AJEDR/43-528--------------------------------------------------------------------------------
W4XA33_STRPU/31-418--------------------------------------------------------------------------------
E7FEB7_DANRE/31-427--------------------------------------------------------------------------------
E3KTL2_PUCGT/33-453--------------------------------------------------------------------------------
C4QYK4_KOMPG/29-433--------------------------------------------------------------------------------
M4CND4_BRARP/25-460--------------------------------------------------------------------------------
C3ZVK1_BRAFL/29-413--------------------------------------------------------------------------------
G8BJE7_CANPC/39-409--------------------------------------------------------------------------------
A9TQ25_PHYPA/25-459--------------------------------------------------------------------------------
A7TEV5_VANPO/69-460--------------------------------------------------------------------------------
E5R4I1_LEPMJ/32-494--------------------------------------------------------------------------------
S2JIR9_MUCC1/22-407--------------------------------------------------------------------------------
F6W8Z6_XENTR/31-423--------------------------------------------------------------------------------
M7P9N4_PNEMU/25-418--------------------------------------------------------------------------------
K7J4C0_NASVI/51-442--------------------------------------------------------------------------------
B4L183_DROMO/27-402--------------------------------------------------------------------------------
ALG10_SCHPO/27-398--------------------------------------------------------------------------------
M2MM25_BAUCO/23-505--------------------------------------------------------------------------------
U4KUC8_PYROM/26-429--------------------------------------------------------------------------------
G1KUP0_ANOCA/31-425--------------------------------------------------------------------------------
C5DSA6_ZYGRC/68-459--------------------------------------------------------------------------------
H2AQR8_KAZAF/62-454--------------------------------------------------------------------------------
U5H039_USTV1/30-435--------------------------------------------------------------------------------
W5NGQ4_LEPOC/1-392--------------------------------------------------------------------------------
G2QLA0_MYCTT/27-468--------------------------------------------------------------------------------
AG10B_RAT/31-428--------------------------------------------------------------------------------
S8EM30_FOMPI/28-420--------------------------------------------------------------------------------
H9JJA8_BOMMO/32-432--------------------------------------------------------------------------------
ALG10_DROME/27-402--------------------------------------------------------------------------------
ALG10_ASHGO/57-447--------------------------------------------------------------------------------
G0S7Z5_CHATD/97-541--------------------------------------------------------------------------------
A0DAU3_PARTE/15-377--------------------------------------------------------------------------------
K3Y6Q6_SETIT/25-460--------------------------------------------------------------------------------
C5DDK7_LACTC/53-443--------------------------------------------------------------------------------
A0A0E1RWP6_COCIM/38-522--------------------------------------------------------------------------------
F8PP28_SERL3/26-407--------------------------------------------------------------------------------
D2VB91_NAEGR/36-412--------------------------------------------------------------------------------
B0CP31_LACBS/23-410--------------------------------------------------------------------------------
H3AZ27_LATCH/33-427--------------------------------------------------------------------------------
W1QI63_OGAPD/28-389--------------------------------------------------------------------------------
ALG10_ARATH/25-461--------------------------------------------------------------------------------
U5G642_POPTR/25-462--------------------------------------------------------------------------------
E1ZJK4_CHLVA/29-455--------------------------------------------------------------------------------
A3LRZ3_PICST/40-418--------------------------------------------------------------------------------
G3B8T7_CANTC/34-406--------------------------------------------------------------------------------
E9G0X2_DAPPU/10-399--------------------------------------------------------------------------------
T1KW23_TETUR/49-426--------------------------------------------------------------------------------
B4N5D4_DROWI/27-400--------------------------------------------------------------------------------
A5DZP8_LODEL/41-412--------------------------------------------------------------------------------
K5XJ27_AGABU/23-409--------------------------------------------------------------------------------
ALG10_KLULA/84-474--------------------------------------------------------------------------------
K1R9X9_CRAGI/8-410--------------------------------------------------------------------------------
M3JE22_CANMX/36-392--------------------------------------------------------------------------------
J7S1V6_KAZNA/74-466--------------------------------------------------------------------------------
H2Z276_CIOSA/25-431--------------------------------------------------------------------------------
J9LAG9_ACYPI/57-491--------------------------------------------------------------------------------
M1AHM2_SOLTU/25-464--------------------------------------------------------------------------------
G8YR70_PICSO/63-445--------------------------------------------------------------------------------
G7E9B0_MIXOS/25-410--------------------------------------------------------------------------------
U3KM68_RABIT/35-431--------------------------------------------------------------------------------
N1PN61_DOTSN/24-512--------------------------------------------------------------------------------
M7WKK8_RHOT1/28-438--------------------------------------------------------------------------------
B4GZN2_DROPE/27-402--------------------------------------------------------------------------------
E2C163_HARSA/25-409--------------------------------------------------------------------------------
D5GMM3_TUBMM/58-479--------------------------------------------------------------------------------
B4J2W4_DROGR/27-402--------------------------------------------------------------------------------
H2MXS0_ORYLA/31-430--------------------------------------------------------------------------------
G3Q5J3_GASAC/31-430--------------------------------------------------------------------------------
A0A068XAK8_HYMMI/1-361--------------------------------------------------------------------------------
I1G516_AMPQE/28-420--------------------------------------------------------------------------------
B4LC57_DROVI/27-402--------------------------------------------------------------------------------
G4TLE7_SERID/31-425--------------------------------------------------------------------------------
C5MA37_CANTT/36-393--------------------------------------------------------------------------------
H6BMA7_EXODN/33-480--------------------------------------------------------------------------------
G3AQ79_SPAPN/26-394--------------------------------------------------------------------------------
K0KGY8_WICCF/63-454--------------------------------------------------------------------------------
M2PXH0_CERS8/29-421--------------------------------------------------------------------------------
M3ZWU8_XIPMA/31-428--------------------------------------------------------------------------------
C5FIZ5_ARTOC/29-525--------------------------------------------------------------------------------
G0W9V3_NAUDC/65-461--------------------------------------------------------------------------------
I2GZK7_TETBL/25-415--------------------------------------------------------------------------------
Q54Z56_DICDI/36-464--------------------------------------------------------------------------------
D7THP5_VITVI/25-464--------------------------------------------------------------------------------
B2AS64_PODAN/95-577--------------------------------------------------------------------------------
L8G022_PSED2/46-496--------------------------------------------------------------------------------
S6DZ28_ZYGB2/63-454--------------------------------------------------------------------------------
G7YEG4_CLOSI/35-428--------------------------------------------------------------------------------
E4UQE0_ARTGP/54-531--------------------------------------------------------------------------------
S9XAR5_SCHCR/40-407--------------------------------------------------------------------------------
B0WRU3_CULQU/28-412--------------------------------------------------------------------------------
ALG10_YARLI/35-468--------------------------------------------------------------------------------
B3M3X6_DROAN/27-402--------------------------------------------------------------------------------
E3M395_CAERE/43-392--------------------------------------------------------------------------------
M2QYS3_COCSN/32-490--------------------------------------------------------------------------------
V2X8L4_MONRO/23-410--------------------------------------------------------------------------------
B7PY71_IXOSC/28-414--------------------------------------------------------------------------------
K1WSG6_MARBU/64-554--------------------------------------------------------------------------------
ALG10_CANAL/39-418--------------------------------------------------------------------------------
T1IQU4_STRMM/35-428--------------------------------------------------------------------------------
G8JPI5_ERECY/57-447--------------------------------------------------------------------------------
W5KCZ3_ASTMX/32-428--------------------------------------------------------------------------------
D8PKT8_SCHCM/23-405--------------------------------------------------------------------------------
M7ZBL2_TRIUA/25-435--------------------------------------------------------------------------------
J3LZC5_ORYBR/25-460--------------------------------------------------------------------------------
D8RLA5_SELML/25-447--------------------------------------------------------------------------------
ALG10_YEAST/66-458--------------------------------------------------------------------------------
G8BNV4_TETPH/64-455--------------------------------------------------------------------------------
A5DGH1_PICGU/27-396--------------------------------------------------------------------------------
G0VGC7_NAUCC/66-459--------------------------------------------------------------------------------
W5JWB9_ANODA/28-387--------------------------------------------------------------------------------
Q170T5_AEDAE/28-413--------------------------------------------------------------------------------
C4XWR1_CLAL4/27-397--------------------------------------------------------------------------------

PF10131

Q0AV03_SYNWW/415-1038------ALS.WLLLSRRMGL..WPAVMAAVVWLLWQDNVRVAFSE-----------------------------------
Q5JIL5_THEKO/62-622------AVA.LHFYLRRTGR...EPYVAPVVFLLFPWHLGVAYIE-----------------------------------
Q97FZ3_CLOAB/258-879------ALG.WLIWGIRERS.IFISLVLGILWFFLPENLKVLFYE-----------------------------------
Q0AV07_SYNWW/2-631------AMGVWYICYRYWGS..LIGIAAGILYVLQPFILRSMASE-----------------------------------
Q8TXR3_METKA/68-665------GVG.VYALVRARGYARKVAVICALLGLTSGGFMKALNWE-----------------------------------
A0LQQ1_SYNFM/80-828------PAA.IYFCLRRFGYADLVAALGSALALPFLVMKENAMWG-----------------------------------
Q97FY2_CLOAB/253-873------AFG.WLLWGNREKR.VFICFIFGVLWFLLPENIRIFFFE-----------------------------------
Q97G45_CLOAB/90-699------GMG.WLFWGYYTRR.QNIAIVLAILWFFIPDNLRVLFSE-----------------------------------
R5JZI7_9CLOT/75-690------GLP.WILWGIHENR.RVLGTFFGVLWFFMPEHIRIYFTA-----------------------------------

PF09586

A4VYG6_STRSY/15-836......GDG-SLFYTFSSGLGLNFYALSSYYL.GSFLSPIVFFFD..............LQSMPDAIYLVTIVKFGLTGL
Q1WT54_LACS1/18-862.....HHPG-SFFYSFSKAIGGEMIGEWAYYL.LSPFNLLFIFFP..............GKSIAAGVLVVTLLKYGFCGL
Q8DRZ1_STRMU/67-904H....MDIG-ALFWSWHKGVGGVMPSVWGFNS.LSPFSLAIGLAP..............AKYLNLSVFLVTLLRQGFSGL
Q74LA0_LACJO/18-861.....GNWS-SLQFSFANGLGADMAGNIGYYL.ASPFNLLILLFP..............ASQINLALYVIIIIKLGLASA
Q74LA1_LACJO/22-868.....GNWS-SAGFSFLNGLGGDMAGNIGYYL.LSPLNFIVFLFP..............ASKMNIAVYIIILIKLGLMSG
Q03YY3_LEUMM/16-848.....QHPS-SFFYSFSNALGGDMLGEWAYYL.MSPFNFIFLFVS..............NANLPAAILLVICLKISAAGL
Q8DRQ9_STRMU/18-837......GTD-SLFYSFKAGLGFNIFALTSYYL.GSFLTPFTYFFN..............VKNMADAFYLFTLIKFGLIGL
Q03G85_PEDPA/13-851.....SHPG-QFFYSFSNGLGGDMFGTWAYYL.FSPTNLLLLFFK..............KESITSGILVITVLKYALAGL
A5VKU5_LACRD/18-849.....HHPS-SFFYSFSKGLGGEMFGTNAYYL.LSPLNLILLFFP..............AQHLATGITIVTLVRYGLAGL
Q8DRY9_STRMU/26-950T....GDWS-GLFYSFSKSIGGAMIGIWGFNL.ISPFNLFYILFP..............LTQFKWAVFLTIWLRYGAMGL
Q38WC5_LACSS/15-827......HFN-FSAYSFSLSLGGNLVPLAAYYL.ISPFNLLLLLGS..............NSQLPVMISYVIALKICTMGV
Q8DWP3_STRA5/16-839......GSN-SLFYTFTSGLGLNFYALSSYYL.GSFLSPIVYFFN..............LKNMPDAIYLLTICKIGLIGL
Q03NT2_LACBA/19-858.....HDPS-SIVYSFSNGLGGGMIGIWSYYL.LSPLNWLLLFFP..............GTHITSGIMLLTLLKYGLASL
Q38VZ4_LACSS/17-848.....QHPD-TFFYSFAKGLGGDMLGVWAYYL.MSPFNLLVLLTP..............GKWLSFGVWLMVLLKYGFSGL
Q03RN6_LACBA/20-858.....HDPS-SIFYSFSNGIGGEMLGTWSYYL.LSPLNWLLLLCP..............GTSLTTGVFLLTVFKYGLAGL
Q5FIZ5_LACAC/21-848.....THPF-NLIYTFSNGLGNSMLATDAYYL.LSPFNLLLFVFP..............QHFLPKVILLIITLKIATAGL
Q839W8_ENTFA/19-846......GKQ-SLFYTWNASLGLNYLSLISYYL.GGLFTPLVFFFN..............NQNMPDALYFLTLLKIGSAGL
Q5M231_STRT2/16-841......GDG-SLFYTFTSGLGLNFYALTSYYL.GSFLSPLYYFFT..............VSQMADAFYYITLLKFGLTGL
Q82ZW8_ENTFA/12-828......EGI-TTFYSFSNEIGESIVPLAAYYL.LSPFNVLAFFFP..............YEQLPIAILWIITLKLALMGT
Q5HPU9_STAEQ/10-840......TQG-NLFYSTHLGLGGDFFTDLSYYFSTNLIFILNVPIIKLCEIF.FSLNTNQILLWMYNALIVSIIKSTIALF
Q5WFJ9_BACSK/12-844......KNG-HWSYSIQFGLGAGTFSQLAYYFSTSMVYSFSCLLVYVGEMS.GLIANVDLLFWGKAAVYINAARLALILF
Q74IE5_LACJO/19-843.....SNPL-NFIFTFSNGLGSSFIGTSAYYL.NSPFNFLLLLFS..............NSSLPIAILLIISLKVGAIGL
Q03HY9_PEDPA/14-831......GKN-SLWFNWQAGFGLNYLALYSYYL.GGIVTPLVGLFS..............KNQIPNAFYAITIFKIGLAGL
Q038D6_LACC3/14-842.....GHPG-QLFYAFNKALGGDMYGVFAYYL.LSPFNWLVVLFP..............ADMLDVAAFLITVLKISTIGF
Q3XYV7_ENTFC/19-847......GKQ-SIFYTWNASLGLNYLSLISYYL.GGIFTPLVFFFP..............NQMMPDALYVLTLLKVGCAGL
Q814J9_BACCR/15-862......KDG-NLFWSWDYGLGGDLFGEFSYYYSTAPFFWLTLLLPK...........LNFDQIFEMKLYMSILKSTLAML
Q03TF4_LACBA/23-880......HGQ-FHLFSFSLGSGSAVVPLLTYYA.ISPFNLLIFAFS..............AANLPIAVSWIIMLKISAMGL
Q5WJL1_BACSK/14-845......SEG-SFFYSLQFGLGGGIFSQLAYYFATSTVFFLTFLVVYSGEILGLFADPDTVLFWGQAAVFVNAFRLAAVVF
Q65M97_BACLD/11-842......KQG-NFFYSYSFGLGGGIYSQLGYYFTTSFVFIASFAAVFLMQLL.HLAGDADPLFWAQAAVFISVIKLSLIIL
Q04EK1_OENOB/16-850.....HQPN-QLFYSFAKNFGGEMFSEWSYYL.FSPLNLLLLFFN..............QANLPSGILFLTVVRFGLAGL
Q03QV8_LACBA/14-985......QGS-LTGWSWDLGLGADKLTTFSYYVLGDPFSYLIAFFP..............KGRLELGYNLLILLRLYASGL
Q03A73_LACC3/16-850.....GTAG-KA.YSFSNSLGGGMYANWTYYL.LSPFNLIFVLVS..............RQAIPVAMLFVTALKYSTAAL
A8FB68_BACP2/11-842......VKG-NFFYSYQFGLGGGTYTQLGYYFTTSTVFMVTVAVVWLMNTL.HLIQSTDIHFWANAVIWLSVIKLTLILF
Q03TW7_LACBA/17-837......QHT-WSFMNLHQALGGNWMPVISYYI.LSPFNLLLFVGR..............ASQIPVMIAVIIMLKVATIAG
Q2FZ40_STAA8/20-851......RSF-SSLYDASFGLGGDYMKGLSYYYSLSPLMWLNFLFIKIGETV.GIFNPTTIHFWPTNQLIMAMIRAIITFV
Q8DMX0_STRR6/15-831......GNS-SLFYTFTSGLGLNFYALSSYYL.GSFLAPLVYFFD..............LTNMPDAVYLTTLLKFGLIGL
Q99XH1_STRP1/14-837......GSD-SFFYTFTSGLGINFYALMCYYL.GSFFSPLLFFFN..............LTSMPDAIYLFTLIKFGLIGL
Q9CHA3_LACLA/14-855S....GGSS-GFLYTFTSGLGLNLYAFSAYYM.GSFLMPLTFFFD..............VKSMPDALYLLTILKFGLIGL
R6NFF7_9CLOT/15-832......GQK-ALFFSWEGGLGMNMTGVVSFYL.ASPFSFLIAFFD..............KQSVTEGILLITILKTAACGL
R7DCE3_9FIRM/22-900TLFIEHKLS-IPMWDLNIGYGSDILTTLHYYVIGDPLTLLSVFFK..............SSQTEFLYEFLIFLRIYLAGI

PF05007

GPI14_YEAST/127-386---------------------ISTRG------------------------------------------------------
GPI14_SCHPO/112-368---------------------ISTRG------------------------------------------------------
PIGM_TRYB2/134-410---------------------VSTRG------------------------------------------------------
PIGM_RAT/140-408---------------------VSSRG------------------------------------------------------
Q17515_CAEEL/146-405---------------------ISARG------------------------------------------------------
Q9W2E4_DROME/177-450---------------------ISTRG------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379-------------QLQE.GLWLFNHG.IDPYAGGT.FR-HSPLLL-----------------------------------
Q5CYY5_CRYPI/10-436-------------EVLE.FCALKEYG.ISTYYESKRVN-FPAVFM-----------------------------------
B6AHL5_CRYMR/12-437-------------DIKD.SCTLIKSG.ISPYVSYN.IR-FPVLFL-----------------------------------
B9RC32_RICCO/30-452-------------RLAE.GYWLKQLS.ISPYAGSM.YH-GSPLLL-----------------------------------
B9GKM7_POPTR/14-432-------------RLAE.GYWLKQSS.ISPYAGSM.YH-GSPLLL-----------------------------------
A9TIH7_PHYPA/73-514-------------RLAE.GYWLKEYG.KSPYAGSA.YH-GSPLLL-----------------------------------
B4N1B7_DROWI/10-386-------------RMQE.GVFLLEHD.IDPYSGDL.VH-ESPLVL-----------------------------------
B4KI55_DROMO/10-386-------------RLQE.GVFLLQQG.VDPYRGDL.VH-ESPLLL-----------------------------------
Q16H22_AEDAE/9-388-------------RAIE.GAYLYANG.TNPYEGDL.YH-QNPFVL-----------------------------------
B0W4N5_CULQU/8-388<