Sequence alignment for CL0111

PF13231

Q65D63_BACLD/64-222--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRADU/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
Q89IJ6_BRADU/52-213--------------------------------------------------------------------------------
Q5ZVN3_LEGPH/45-205--------------------------------------------------------------------------------
A5ULR9_METS3/66-231--------------------------------------------------------------------------------
Q2IKZ1_ANADE/72-232--------------------------------------------------------------------------------
Q2KCI5_RHIEC/48-207--------------------------------------------------------------------------------
Q6NCW5_RHOPA/88-248--------------------------------------------------------------------------------
Q82U54_NITEU/408-568--------------------------------------------------------------------------------
R6LJZ9_9BACE/61-222--------------------------------------------------------------------------------

PF02366

PMT3_YEAST/62-306-------------------IIFTVLGMFTRMY-KIGRNNHVV------WDE-------AHF-------------------
POMT1_HUMAN/20-289-------------------VALTGMGLLSRLW-RLTYPRAVV------FDE-------VYY-------------------
P73015_SYNY3/18-249-------------------VAIFLFSLVIRFW-NLGQFNQLV------FDE-------VYY-------------------
Y1220_AQUAE/1-229-------------------MMKKFLLVLIPVL-ILYFYNLGY------NAV-------WMP-------------------
ARNT_SALTY/3-237-------------------SIRYYLAFAAFIA-LYYVIPVNS------RLL-------WQP-------------------
P73065_SYNY3/8-275-------------------KSWGVPLLLAMVW-LGSNGLDRL------WLG-------MDQ-------------------
PMT1_YEAST/54-297-------------------ACLAVFTAVIRLH-GLAWPDSVV------FDE-------VHF-------------------
PMT1_CANAL/70-313-------------------SSLLLIAFYVRMY-NLSNPNSVV------FDE-------VHF-------------------
PMT1_SCHPO/38-284-------------------IFLTVVAFCVRAQ-RLMNPAKVV------FEE-------LRY-------------------
PMT2_YEAST/69-313-------------------VIFTALALFTRMY-KIGINNHVV------WDE-------AHF-------------------
POMT2_HUMAN/62-306-------------------ALVTLLSFATRFH-RLDEPPHIC------WDE-------THF-------------------
PMT5_YEAST/50-293-------------------GCLLIFTAIVRLH-NISLPNSVV------FGE-------NEV-------------------
P73712_SYNY3/7-243-------------------NSSRRLISVIIYL-TIFIRVLTL------GLY-------AVA-------------------
POMT1_DROME/178-421-------------------WTLFLLAFGTRFY-KLATPPHIV------FDE-------LHY-------------------
PMT4_YEAST/57-305-------------------TIVTLLAFAARFY-KIWYPKEVV------FDE-------VHF-------------------
PMT4_SCHPO/63-310-------------------VLITVLSFITRFW-NLNLPGEVV------FDE-------VHF-------------------
ARNT_ECOLI/3-237-------------------SVRYLIGLFAFIA-CYYLLPIST------RLL-------WQP-------------------
PMT6_YEAST/70-314-------------------LLLTITSFYLRFQ-HIDQNNYVV------WDE-------AHF-------------------
PMT6_CANAL/97-357-------------------.ILTAISSFVRLY-RIDVANSVV------WDE-------AHF-------------------

PF11028

A3U548_CROAH/37-215--------------------------------------------------------------------------------
R6XIR1_9BACT/37-217--------------------------------------------------------------------------------
F6GE14_LACS5/37-214--------------------------------------------------------------------------------
I6ZS60_MELRP/34-208--------------------------------------------------------------------------------
H8KSF5_SOLCM/35-209--------------------------------------------------------------------------------
A0LXN9_GRAFK/37-215--------------------------------------------------------------------------------
U5Q8D9_9BACT/37-212--------------------------------------------------------------------------------
R5I514_9BACT/37-217--------------------------------------------------------------------------------
Q2S0T5_SALRD/34-225--------------------------------------------------------------------------------
I0K9H0_9BACT/35-227--------------------------------------------------------------------------------
X5D9M2_9BACT/35-209--------------------------------------------------------------------------------
X5DZV9_9BACT/35-212--------------------------------------------------------------------------------
H1XP16_9BACT/34-208--------------------------------------------------------------------------------
B3ENQ9_CHLPB/34-209--------------------------------------------------------------------------------
H1YCC6_9SPHI/34-214--------------------------------------------------------------------------------
H8KSF6_SOLCM/35-213--------------------------------------------------------------------------------
F4KRQ6_HALH1/35-218--------------------------------------------------------------------------------
F4C302_SPHS2/34-214--------------------------------------------------------------------------------
E4T8Q1_PALPW/35-213--------------------------------------------------------------------------------
H1Y2D3_9SPHI/34-214--------------------------------------------------------------------------------
A4CGC2_ROBBH/37-215--------------------------------------------------------------------------------
I3YTY0_AEQSU/37-215--------------------------------------------------------------------------------
F3ZQH0_9BACE/35-214--------------------------------------------------------------------------------
G8TAS2_NIAKG/34-222--------------------------------------------------------------------------------
D3IE17_9BACT/35-214--------------------------------------------------------------------------------
F4C4U7_SPHS2/36-216--------------------------------------------------------------------------------
G8R038_OWEHD/36-216--------------------------------------------------------------------------------
A6GWD8_FLAPJ/36-224--------------------------------------------------------------------------------
T2KIW2_9FLAO/37-215--------------------------------------------------------------------------------
I3KW99_ORENI/21-184--------------------------------------------------------------------------------
F4KMK4_PORAD/39-231--------------------------------------------------------------------------------
I0AH06_IGNAJ/35-227--------------------------------------------------------------------------------
C3L447_AMOA5/43-223--------------------------------------------------------------------------------
H8XP42_FLAIG/37-215--------------------------------------------------------------------------------
Q74D30_GEOSL/39-214--------------------------------------------------------------------------------
R5BN47_9BACE/50-226--------------------------------------------------------------------------------
F0S690_PSESL/34-213--------------------------------------------------------------------------------
A9AXK7_HERA2/53-215--------------------------------------------------------------------------------
R6SBD9_9BACE/36-215--------------------------------------------------------------------------------
B3EAC9_GEOLS/36-209--------------------------------------------------------------------------------
L7W9H4_NONDD/36-210--------------------------------------------------------------------------------
B5EH69_GEOBB/37-210--------------------------------------------------------------------------------
A1ARZ9_PELPD/68-243--------------------------------------------------------------------------------
G1PIZ8_MYOLU/52-215--------------------------------------------------------------------------------
A5G4Z0_GEOUR/37-209--------------------------------------------------------------------------------
C9RN70_FIBSS/36-216--------------------------------------------------------------------------------
I0AM95_IGNAJ/32-228--------------------------------------------------------------------------------
D3BML5_POLPA/98-270--------------------------------------------------------------------------------
W8FBF7_9BACT/35-222--------------------------------------------------------------------------------
W0EVP7_9SPHI/34-220--------------------------------------------------------------------------------
L7W937_NONDD/38-203--------------------------------------------------------------------------------
E4RU44_LEAB4/34-214--------------------------------------------------------------------------------
I0AN08_IGNAJ/34-208--------------------------------------------------------------------------------
A6LGG9_PARD8/35-214--------------------------------------------------------------------------------
A4AMM0_MARSH/37-215--------------------------------------------------------------------------------
C1A3K8_GEMAT/56-227--------------------------------------------------------------------------------
R6SBV2_9BACE/35-216--------------------------------------------------------------------------------
I0I530_CALAS/46-211--------------------------------------------------------------------------------
G8X584_FLACA/36-214--------------------------------------------------------------------------------
W0RJK7_9BACT/57-227--------------------------------------------------------------------------------
D0LFQ9_HALO1/25-195--------------------------------------------------------------------------------
R5W9J1_9BACT/35-214--------------------------------------------------------------------------------
K4IB40_PSYTT/37-215--------------------------------------------------------------------------------
E6X4M4_CELAD/37-216--------------------------------------------------------------------------------
D0MDF1_RHOM4/34-225--------------------------------------------------------------------------------
I3ZYA9_ORNRL/34-223--------------------------------------------------------------------------------
I3YIE7_ALIFI/35-215--------------------------------------------------------------------------------
R7F5J7_9BACT/37-217--------------------------------------------------------------------------------
G8TQ81_NIAKG/34-212--------------------------------------------------------------------------------
A2TXJ8_9FLAO/37-215--------------------------------------------------------------------------------
I0AH07_IGNAJ/47-229--------------------------------------------------------------------------------
Q8KAY9_CHLTE/41-217--------------------------------------------------------------------------------
C6W6V6_DYAFD/35-215--------------------------------------------------------------------------------
F0NYC1_WEEVC/36-224--------------------------------------------------------------------------------
B4S581_PROA2/34-210--------------------------------------------------------------------------------
B3QWD0_CHLT3/33-211--------------------------------------------------------------------------------
Q39VU9_GEOMG/36-207--------------------------------------------------------------------------------
C6Y1Y3_PEDHD/35-207--------------------------------------------------------------------------------
C7M410_CAPOD/37-223--------------------------------------------------------------------------------
R5P289_9PORP/43-218--------------------------------------------------------------------------------
G2Z4K2_FLABF/39-217--------------------------------------------------------------------------------
R6AGR2_9BACT/35-214--------------------------------------------------------------------------------
B4SC86_PELPB/34-212--------------------------------------------------------------------------------
F4AVR9_DOKS4/37-216--------------------------------------------------------------------------------
Q7MT47_PORGI/37-226--------------------------------------------------------------------------------
I4AKN9_FLELS/34-232--------------------------------------------------------------------------------
I2EW61_EMTOG/35-215--------------------------------------------------------------------------------
D6D6N6_9BACE/37-216--------------------------------------------------------------------------------
R7DIG7_9PORP/35-214--------------------------------------------------------------------------------
C1A7V9_GEMAT/57-227--------------------------------------------------------------------------------
R5B2K5_9BACE/47-228--------------------------------------------------------------------------------
C0R1J1_BRAHW/121-297--------------------------------------------------------------------------------
H1Z8K4_MYROD/37-215--------------------------------------------------------------------------------
R5RQ99_9BACE/43-220--------------------------------------------------------------------------------
W5MZF0_LEPOC/41-204--------------------------------------------------------------------------------
F9YU79_CAPCC/36-215--------------------------------------------------------------------------------
C7PKN8_CHIPD/34-212--------------------------------------------------------------------------------
H6LAI5_SAPGL/35-215--------------------------------------------------------------------------------
J9R805_RIEAN/38-218--------------------------------------------------------------------------------
B6YRJ5_AZOPC/37-217--------------------------------------------------------------------------------
C6Y0P2_PEDHD/34-214--------------------------------------------------------------------------------
R5GFJ4_9BACT/35-214--------------------------------------------------------------------------------
TM260_DICDI/139-313--------------------------------------------------------------------------------
R5G4M3_9PORP/37-222--------------------------------------------------------------------------------
C6X5R1_FLAB3/37-217--------------------------------------------------------------------------------
D2QNX1_SPILD/35-215--------------------------------------------------------------------------------
E4TV18_MARTH/50-230--------------------------------------------------------------------------------
R7HQZ6_9BACT/35-215--------------------------------------------------------------------------------
F2I9U5_FLUTR/34-221--------------------------------------------------------------------------------
I3Z145_BELBD/35-215--------------------------------------------------------------------------------
Q11YB8_CYTH3/35-214--------------------------------------------------------------------------------
R6CJ33_9BACT/35-214--------------------------------------------------------------------------------

PF10131

Q0AV03_SYNWW/415-1038-FRYWA---------PLPYYALAALRGLC.GD-IFTAGNLYI------YLC-------ALL-------------------
Q5JIL5_THEKO/62-622-LRFYP---------PLSYLIGAFLGILL.GS-DIRGYAATL------MLT-------SFV-------------------
Q97FZ3_CLOAB/258-879-FRYWA---------PFSYYLLAACEFLVRGN-VSGAYLIFI------SLI-------FFI-------------------
Q0AV07_SYNWW/2-631-VQYYP---------PLSYFLLAPVQMLF.GN-IMITFKFAV------FFY-------LLV-------------------
Q8TXR3_METKA/68-665-LTYYG---------SLGYLLGAAVDAIV.KD-PVRTFVVCL------IVA-------SAL-------------------
A0LQQ1_SYNFM/80-828-LNYF.---------PFPFFIMSLLAAAV..P-LQVAFKLVT------LLP-------VFG-------------------
Q97FY2_CLOAB/253-873-FRYWA---------PFPYYIFALLEFLTGGN-VSQAYIMFI------GLM-------FFV-------------------
Q97G45_CLOAB/90-699-YRYWA---------PFPYYILAVINMFT.NN-MITTFDVFV------ELV-------FMV-------------------
R5JZI7_9CLOT/75-690-FRYWG---------PLSYYIMAGLMFLTSGD-LLLAYRLIA------FVI-------FVV-------------------

PF02516

STT3A_HUMAN/17-484LLKLLI---------LSMAAVLSFSTR.....-....LFAVL------RFE-------SVI-------------------
STT3_CAEEL/19-506LLTIVV---------LALAWFVGFASR.....-....LFAIV------RFE-------SII-------------------
STT3_YEAST/15-475ILKLVI---------FVAIFGAAISSR.....-....LFAVI------KFE-------SII-------------------
STT3_SCHPO/23-509PLKVLI---------LICIAVASVSSR.....-....LFSVI------RYE-------SII-------------------
O29867_ARCFU/18-493VIAALI---------SVKLRILNPWNS.....-....VFTWT------VRL-------GG.-------------------
O27660_METTH/24-582FYIRAE---------ASNIGGVPADAK.....-...KFYEDA------DGL-------PYF-------------------
O27928_METTH/21-478FFSRIE---------TAELKGMNTADR.....-...AYFTDE------NGL-------PYM-------------------
O27920_METTH/13-461VIFVFG---------FSIRMLNAGYDD.....-...PLYTDD------DGL-------QYF-------------------
Y1525_METJA/33-650MLMFVS---------FQLRAQTADMKFAQDNE-FLKDMFSDE------HGR-------MYL-------------------
PGLB_CAMJE/11-477..YLVL---------FAMIVLAYVFSV.....-.....FCRF------YWV-------WWA-------------------

PF09586

A4VYG6_STRSY/15-836S.FLIP---------LTIISIVLAFQGIWWGS-DTTILASDG------FHQ-------YVI....FNQTLRNTLH...--
Q1WT54_LACS1/18-862S.FFGP---------IVIMLAYFIARHMYPFG-SSTILTVDL------GQQ-------YVD....FFAFFRETLL...--
Q8DRZ1_STRMU/67-904A.FCLP---------MLVMAVVFAVMKLYPFG-KETLMSGDY------TLQ-------YIP....LYRALGHAFRH..--
Q74LA0_LACJO/18-861S.FGIT---------IAIFLIVSSLANCNPFL-GGVLWGGDL------PDE-------YLS....FFQYLRRLIL...--
Q74LA1_LACJO/22-868S.CLTT---------IVLFFLLSTLTDCNPIF-GGVLYSGDL------PNQ-------YLS....FFQYYRHLML...--
A8AU67_STRGC/17-840A.FLIP---------FLIMVIVYLSQGIYWNS-DTSPLLGDG------FHQ-------YVI....FDTTLRNILH...--
Q03YY3_LEUMM/16-848S.FWIP---------FLVLIGYFAYRKMAPFG-SNSILTVDL------GQQ-------YID....QFAAFKYTIL...--
Q8DRQ9_STRMU/18-837S.FLLP---------SFIMFLVLFSKNIYWGS-STTILASDG------FHQ-------YVI....FDALFRNILH...--
Q03G85_PEDPA/13-851S.GCIP---------ACIMLAYFVYRGFAPFG-TSSLLTVDM------GQQ-------YVA....FYEYFRSTLI...--
A5VKU5_LACRD/18-849S.FLLP---------VILMACYFAYRQMTPFG-KSSLLTVDL------GQQ-------YVD....FFSYLRNTIL...--
Q8DRY9_STRMU/26-950S.TLLP---------MMIMLVVWYFMDTFPFG-RNTLMAVDF------GQQ-------YIG....LYGFLKATVLT..--
Q38WC5_LACSS/15-827S.FGLP---------LVLVLIGFAMMGLVPFG-NHNLLFSDL------GTQ-------YMP....FLAEFKRQMA...--
Q8DWP3_STRA5/16-839S.FLLP---------FIIIVCILFTKNIYWGS-PTTILASDG------FHQ-------YVI....FNQALRNILH...--
Q03NT2_LACBA/19-858S.FLIP---------VILMLIYYIYRKMVPFG-GSSLLTVDL------GQQ-------YID....FFSYFRRAIL...--
Q38VZ4_LACSS/17-848S.FLLP---------FAIIFIYGLSRHVFPFG-GQTIMTVDL------GQQ-------YID....FFAYFRTTLL...--
Q03RN6_LACBA/20-858A.FLVP---------FILMTGYFIYRQMAPFG-TSSLLTVDL------GQQ-------YID....FFAYLRRAIL...--
Q5FIZ5_LACAC/21-848S.FILP---------GLIFFSYFFYTK.....-.NGVLTVDL------GQQ-------YVD....FLAFFRHNLF...--
Q839W8_ENTFA/19-846S.FFIP---------FLIMAIIYLSIGIYPGS-SRSVLASDA------FSQ-------FSN....FHASFNNVLH...--
Q5M231_STRT2/16-841A.FFLP---------VLIMIDVLYSQKIYPGS-ERTILTSDG------FHQ-------YVI....FATELRNILH...--
Q82ZW8_ENTFA/12-828S.FFLP---------FLLLLLVWMTLQLAPFG-DNNLLVSDL------GTQ-------YMP....FLSFLKRSFH...--
Q5HPU9_STAEQ/10-840LLITLS---------LIGHSYIIF..RFHHDG-VLSTGPNDG------MEQ-------MIP....IQMYLYHQW....--
Q5WFJ9_BACSK/12-844ASIVVA---------VLAHALFFY...ETAAG-RFMVGLNDG------LGQ-------ILP....FKHFLYQQL....--
Q74IE5_LACJO/19-843S.FLLP---------TCIFASYFLYRG.....-.QEILTVDL------GQQ-------YID....FLSFYKNNLL...--
Q03HY9_PEDPA/14-831S.FILP---------ITIVIIAYASNGIYWGS-AHSILASDA------FTQ-------GAN....FLASFREVLH...--
Q038D6_LACC3/14-842S.FLLP---------GLLVGLYFAIRGTFPFG-SSSVLTVDL------GQQ-------YID....FFAYLRQTLL...--
Q3XYV7_ENTFC/19-847S.FLIP---------FLILALVYLSIGIYPGS-SRSILASDA------FSQ-------FSN....FHASFRNVLL...--
Q814J9_BACCR/15-862TLIIIP---------LLIICAFAFHYFFLKSD-NVFSSTGDA------LSQ-------FSF....FTFLLQHAF....--
Q03TF4_LACBA/23-880A.FLIP---------LIIMCLAFWHLRITPFG-NRNLLLSDM------GTQ-------YIP....ILENLRATIL...--
Q5WJL1_BACSK/14-845GSVLFA---------AAAHAFFFY...QSANG-QFMVGPNDG------TAQ-------MLP....FKQFLYSLY....--
A3CRC9_STRSV/17-843A.FFLP---------FFIMFFVYLMYGIYWNS-ETSPLLGDG------FHQ-------YVI....FDTNLRNILH...--
Q65M97_BACLD/11-842ASIAVS---------VAAHSFFLY...EWAHD-RYMTGNGDG------LAQ-------MII....FKSFLFEQY....--
Q04EK1_OENOB/16-850S.FALP---------ALIMLFYFYYRKMAPFG-NSSILTVDL------GQQ-------YVD....MFSGMRETIL...--
Q03QV8_LACBA/14-985MFMILV---------VALYGIFLL......TG-KSFIWEGDG------LAQ-------HYP....ILEKFYTWLH...--
Q03A73_LACC3/16-850S.FSMT---------FTISLIVFAALKMAPFG-SSSILANDS------AVQ-------YVD....FFTYLKHALM...--
A8FB68_BACP2/11-842MCLILA---------LLGHSFFLY...EYTQG-RYMTGDGDG------ISQ-------MLP....FKKLLYDEY....--
Q03TW7_LACBA/17-837A.TLLA---------LMMMVTLFALRGITPFG-NHNLLIGDL------GVQ-------YTP....FFTDFVRLVR...--
Q2FZ40_STAA8/20-851S.VILT---------LILFSTHIY..DYIVNG-TVFSGAGDG------FRQ-------MMP....FQMYLYEHL....--
Q8DMX0_STRR6/15-831..LIIP---------VVIMSGVYLSQGIYWNS-DNSPLLGDG------FHQ-------YVI....FDVALRNILH...--
Q99XH1_STRP1/14-837S.FLFP---------LSIIFIILLSMGIYYNS-DKTILASDA------FHQ-------YVI....FAQNFRNIMH...--
Q9CHA3_LACLA/14-855S.FFIP---------LLLMVIVLAMTGIYWGS-SRSILAGDA------YHQ-------YVA....IHSLYRNILHS..--
R6NFF7_9CLOT/15-832...VMP---------GVLLLSVYIALGVYPFG-QRSLLITDM------SQL-------YVD....FYSYLIDVFH...--
R7DCE3_9FIRM/22-900..YTIA---------FAGIALFLY.MRFYLNG-KSLIWSHDG------VPQ-------HLNSLAYYGRYLRKILHTLF--

PF09852

Q119E7_TRIEI/30-487RHLLFQ.....---.STAFEMGIYDQVTYLIS-QGL.PPISS------FLE-------V.................HH--
Q1CZA2_MYXXD/39-471LQAAQV.....---CFPNFDLGIYSQAVARLS-LAEPNPWIS------ARQ-------V.................FI--
Q7U446_SYNPX/31-511RSWVL......---.LASYDQGIFQQVLWNCL-QGH.PFEST------LSS-------QLSTNVIHA.GELPSVDYER--
A5GS07_SYNR3/40-521RLWSL......---.SATYDQGIFNQVLWNSG-HGR.WFASS------LSS-------QLSSAVLHG.GLAPDPSYQR--
Q119E6_TRIEI/27-490RHAFFC.....---.STGFDLGIYDQVVYLIS-QGK.SPISS------FLG-------Y.................HH--
Q82RR9_STRAW/82-508LHQRML.....---.TTGYDLGIFEQAVRSYA-HGH.LPVAE------LKG-------P.G..............FPL--
Q4J6X7_SULAC/32-488RLYDLL.....---.SGAFDLGLFMQEFYSTI-YGGKIFYDA------ANF-------LSFG............ALSG--
A5URL3_ROSS1/78-571LFFGLTFKYVH---WAQGYDQIDYQQSIWNTT-QGRFLEISH------YRH-------TD................HL--
Q4J7K9_SULAC/43-493VLYNLN.....---.YSSYNLSMFIQELYSAS-QGK.PFYDT------INL-------LFRG............IPYG--
Q9HK92_THEAC/39-557KYVSLN.....---.ATAYDLGIYVSILENTM-HGH.VMYAN------PLL-------I.................NS--
A5GNZ8_SYNPW/38-520KSWVL......---.LAGYDQGIFQQVAWNSL-HGR.WFESS------LSS-------QLSTNVVHA.GELPFVGYER--
Q4J7K8_SULAC/16-462RLYDLY.....---.SGAFDLGIFLQELYSTL-HGR.IFYDS------PNF-------TYYG............VISG--
A5GR01_SYNR3/37-521RIYTL......---.TATFDQGLFLQEIWSAL-GGR.PFEST------LAS-------ELSSPVLLDKTALPTLGYLH--
Q8F2H0_LEPIN/76-512ALDSLF.....---.LGDLDYTAQLRMILPTT-DGN.FFQTQ------YYG-------SHE.............NANF--
P73520_SYNY3/35-464RHWLFQ.....---.STALDLGFFDQAIYLIS-QGE.YPRVS------FRG-------F.................HI--
Q7U443_SYNPX/37-518RMQSL......---.TASMDQGILMQVLWNGL-RGH.PFEST------LSS-------QLSTNVIHS.GELPALGYHR--
Q7VDJ5_PROMA/39-469RHFLLQ.....---.SNAFDLGLFDQWVWLQS-VGE.PPYSS------MTG-------L.................HL--
A5V1J1_ROSS1/34-511RYMGFN.....---.AGVLDLGTMYQAIASTL-RGEPLIVTS------PQG-------NV................SR--
Q7U444_SYNPX/29-448RHALLH.....---.SNAYDLGLFDQWVWLIS-QGL.PPISS------MEH-------V.................HV--
Q10XG3_TRIEI/32-516RYYSF......---.YASYDQGIFNQVFWNSM-HGH.FFQSS------LSS-------ALSTNVVHQ.GQVSEVYYHR--
Q7V4G7_PROMM/40-520RLESL......---.TATYDQALFLQELWSTA-RGH.FFESS------LSS-------ELSAAVANQ.DALPSIDYLH--
Q7V4G8_PROMM/29-457RHALLQ.....---.SNAYDLGLFDQWIWLAS-QGL.PPYSS------MEG-------V.................HL--

PF03901

SMP3_YEAST/6-401---------------WWLYLVYAIGLMLCLGP-SYI..HPDE------HFQ-------CIE-------------------
GPI10_SCHPO/4-414---------------WFWLAILVFRWWNALWV-KTFF.QPDE------FYQ-------SLE-------------------
ALG9_SCHPO/16-438---------------WTFSILAVLRLTSASFR-VID..DCDE------VYN-------YWE-------------------
ALG9_ARATH/48-451---------------LPFIALCYLRYMSATSN-IIH..DCDE------VFN-------YWE-------------------
ALG9_YEAST/10-414---------------LLLLLFLTRVYIQPTFS-LIS..DCDE------TFN-------YWE-------------------
ALG12_CAEEL/6-405---------------WIVIIVTIIHIILAPGT-.....KVEE------SFN-------VQA-------------------
GPI10_YEAST/16-484---------------QIFWVFLAFRVLNAVLT-RTFF.QADE------FWQ-------ALE-------------------
SMP3_SCHPO/9-412---------------IIYTFLLILRFWFSQ..-GSSYIHPDE------HLQ-------SFQ-------------------
Q9VBV8_DROME/75-498---------------TAFKTFVSARLCSAIWA-YIA..DCDE------TFN-------YWE-------------------
PIGB_HUMAN/62-449---------------YLLLFTIALRILNCFLV-QTSF.VPDE------YWQ-------SLE-------------------
PIGB_DROME/5-396---------------YVFLLILAVRLASVFVV-QTYY.VPDE------YWQ-------SLE-------------------
ALG9_MOUSE/60-482---------------TAFKCLLSARLCAALLS-NIS..DCDE------TFN-------YWE-------------------
PIGZ_DROME/18-541---------------STYFCFAAVRLLLVFVP-QLGYVHPDE------FFQ-------SVE-------------------
YTH3_CAEEL/55-472---------------SVFKMLLSIRISGAIWG-IIN..DCDE------VYN-------YWE-------------------
F4K887_ARATH/41-451---------------.IFLFCLAFRVVNALLI-QTYF.NPDE------HWQ-------SLE-------------------
GPI10_TRYB2/4-432---------------WLISLTFIYRLFLCATI-RTVE.APDE------WWQ-------STE-------------------

PF09913

Q1MP06_LAWIP/21-414---------------F..FWGVIFLFLIPPFQ-APDEQVHFP------RVF.......EL.SC...GKI......LLS--
A4VVV9_STRSY/36-414---------------I..PFLLISIFVMPVTK-VPDEATHAF------MSW.......NILFD............SPT--
A0LS06_ACIC1/16-395---------------F..GITALWAVTTPKYA-APDEPAHAV------KAA.......ANVRGEFRG........TPQ--
Q5Z3D8_NOCFA/116-537---------------LATLFGAVFAVITPPFW-GHDEITQFG------RAY.......QV.AH...GGF......LPT--
Q5M3E5_STRT2/28-432---------------F..FVGILSIFFRHPMS-WYDEQVHYA------RVITYSNDLGST.SE...GSI......EKG--
A5UMR8_METS3/71-461---------------I..IFGIISLFLTPIYD-VSDETEHFV------RSE.......IV.ST...GELSTNYVPIPN--
A1W3H2_ACISJ/39-436---------------V..CVGMAMCFLSPALN-APDEVYHWQ------RAV.......QV.SH...GQF......LAD--
Q6AGK9_LEIXX/24-391---------------L..LVFGAWALSSPPGS-SPDDDFHQT------SIW........................CAD--
A5UN71_METS3/84-467---------------I..LFGLLMVFFAPPMS-FPDEAIHFA------RAE.......SI.TE...GVL......YPV--
Q01XM3_SOLUE/38-442---------------L...MALAFAVVMPPFQ-VPDEDGHFI------RAY.......LI.SR...GEF......VGR--
Q83H24_TROWT/46-427---------------F..ISLAGWALSSPIGS-SPDDDFHLA------SAW........................CAL--
Q9CIZ8_LACLA/68-463---------------L..FLGIGISFIKPVQF-GVDEETHLR------WTI.......RL.AD...GQL......FTR--
Q2JAW9_FRASC/81-503---------------L..LLVAAWVATNPPGF-GPDEPAHFV------KAVGAGTGQWTGTPGRLAHPSFGNGPGRAE--
Q0RGM1_FRAAA/18-412---------------L...LLAAWVGSNAPGF-GPDEPANFV------KEVGAGTGQWSGTPGRLAHPAFGAQPGAPE--
A5G180_ACICJ/39-445---------------C....GLRLVYATPMGE-VADEPSHIA------RAA.......GLLDFDILGHR......AVI--
Q97N14_CLOAB/17-411---------------L..FFGVLFAVINAPFQ-DPDEPIHFY------RAY.......QI.ST...GQM......FEQ--
A5UKJ8_METS3/70-455---------------I..IFGLLTVFASPLLV-APDEVEHFA------RSD.......LT.SE...GGL......IPN--
A8AWZ6_STRGC/67-446---------------...FSGVLTSLITPVLN-TPDEPVHLA------RTI.......HI.VE...GDL.....NLDN--
Q9A0F5_STRP1/71-454---------------L..VFGTISAIISPIND-IPDEYVHYS------RTV.......YI.SE...GDI.....NLTN--

PF04922

K5XCQ6_PHACS/29-416VIEPYMDEPFH---VPQAQAYCIGNYS..YWD-PKITTPPGL......YILSLILKRIF...................--
T1G2P1_HELRO/32-429QSEPYMDEIFH---VSQARQYCNGNFS..HWD-PMITTLPGL......YLASIGSLKPI................DVL--
H2T3E9_TAKRU/31-424QRNPYMDEILH---VPQAQKYCHGKFN..EWD-PMITTLPGL......YLVSVGVIKPV.............VWLSGL--
ALG10_CANGA/63-455VPYEFIDEQFH---IGQTITYLKGHWF..TWD-PKITTPPGL......YILGWLNYKVL.....K..P..........--
I1N2G0_SOYBN/25-459VPEPYMDEIFH---IPQAQQYCKGNFG..SWD-PMITTPPGL......YYLSLAHVASL.......FPGFYCVEAA..--
E0V9V1_PEDHC/31-428QKYPYIDEIFH---IPQAQTYCSNNWT..EWN-PKITTLPGL......YIVSYVILNLF...............KTLF--
M0THQ1_MUSAM/25-461VPDPYMDEIFH---IPQAQRYCRRDFG..TWD-PMITTPPGL......YYISLVYIASL.......FPSMWFAKFAP.--
F4R3Q7_MELLP/33-444VPEPYMDEIFH---VKQARTYCQGQWL..EWD-DKITTPPGL......YLPIAILHHLL...................--
R4GKH2_CHICK/31-425LREPYMDEIFH---VPQAQAYCQGRFL..QWD-PMITTPPGL......YLLSVGVVKPA.............AWLFGW--
G8ZYL6_TORDC/61-452VPYTFIDEQFH---VGQTLKYVGGHWT..HWD-PKITTPPGL......YVLGWLNYKIT.....S.............--
C6H8G6_AJECH/46-531LPDPYLDEVFH---VRQAQAYWKHRWR..QWD-PKITTPPGV......YLCSYIIGAILFVVRLRPVHP.........--
ALG10_DEBHA/27-407VKDPFIDEIFH---LRQCQTYCALRFD..IWD-HKITTPPGL......YILGMVYAEVV.....KRITFTSE......--
E3RDG0_PYRTT/32-497VPDDYLDEFFH---VPQAKKYCEGDYS...WD-PKITTPPGL......YVVSKILKPLL...................--
F6RK69_MONDO/31-424LREPYMDEIFH---LPQAQRYCWGSF...QWD-PMITTLPGL......YLISVGILKPA.............TLIFGW--
F6YIJ5_CIOIN/30-422QPTAFIDEIFH---VPQAQKFCDGHFN..EWD-PKITTLPGM......YIMSVFVLGPL................TWL--
Q7QC28_ANOGA/28-387TSQQVIDEEFH---LRQGDHYCHGRFQ..VWD-PKITTFPGL......YLASALVLRPL...................--
R0ILV6_SETT2/32-500VPEPYLDEFFH---VPQAQKYCKGDYS...WD-PKITTPPGL......YLISKLFKPLL...................--
U9SYH3_RHIID/26-420VPDPYMDEVFH---VSQAKQYCEGNYY..DWN-PKLTTPPGL......YLISNLILRPL................SLL--
B3S3F0_TRIAD/21-412HSMSYMDEIFH---IPQAQRYCRYNFH..EWD-SMITTLPGM......YLASFLIARVT...........VWINYLAM--
C5GWH0_AJEDR/43-528LPDPYLDEVFH---VRQAQAYWAHRWR..QWD-PKITTPPGI......YLCSYAIGAILFVVRLRPAHP.........--
W4XA33_STRPU/31-418QPLPYMDEVFH---IPQAQKYCNGSFG..EWD-PKITTLPGL......YLASVGLLKPV.............AALLES--
E7FEB7_DANRE/31-427QRDPYMDEIFH---VPQAQKYCEGKFT..EWD-PMITTLPGL......YLASVGLIRPV.............VWLADL--
E3KTL2_PUCGT/33-453VPDPYMDEIFH---VEQAKTYCAGQWT..TWN-NLITTPPGL......YIVPSLLHQAL...................--
C4QYK4_PICPG/29-433VRKPFIDEIFH---IPQARQYCRGRFD..VWD-NKITTPPGL......YWLGYVWVKILAVLNGGEFK..........--
M4CND4_BRARP/25-460VPEPYMDEIFH---VPQAQQYCKGNLR..SWD-PMITTPPGL......YYLSLAHVASL.......FPGMLLVGATSQ--
C3ZVK1_BRAFL/29-413QPEPYMDEIFH---IPQAQKYCQGRFT..EWD-PMITTLPGL......YLASVGLLKPA.............VLVAGV--
G8BJE7_CANPC/39-409VAQPFVDEIFH---LRQCQTYCASRFD..KWD-NKITTPPGL......YLLGLVYAKSL.....EAVT..........--
A9TQ25_PHYPA/25-459VPEVYMDEMFH---IPQAQEYCKGDFH..KWD-PMITTFPGL......YLLSLVYVGMV........LPAAKFLHVTP--
A7TEV5_VANPO/69-460VPYLFIDEFFH---VNQTIKYIKNDWF..TWD-PKITTPPGL......YILGWLNYHIF.....R.............--
E5R4I1_LEPMJ/32-494VPEPYLDEFFH---IPQAQRYCSGDYS...WD-PKITTPPGL......YLVSRILKPLL...................--
S2JIR9_MUCC1/22-407VPEPYMDEIFH---VPQAQQYCHGDYY..TWD-PKLTTPPGL......YLVSNGIAWMG.................NM--
F6W8Z6_XENTR/31-423QRDPYMDESFH---IPQAQLYCQGHFN..QWD-PMITTLPGL......YLASVGMVKPA.............AWLFGW--
M7P9N4_PNEMU/25-418VLVPYMDEIFH---VNQMQEYCKGNYL..KWN-DKITTPPGM......YWIHLIILCAI..................P--
K7J4C0_NASVI/51-442QFHFFIDEKFH---IPQTIKYCEGKFF..EWD-PKITTLPGL......YLLSALLLGPL...................--
B4L183_DROMO/27-402TAEYIIDEEFH---IPQGLAFCRKQFD..VWD-SKITTFPGL......YLIA.LVLQPI...................--
ALG10_SCHPO/27-398VPNPYLDEIFH---IAQAQRFCRKDWD...WD-PAITTPPGL......YLVSVALSPFI...................--
M2MM25_BAUCO/23-505VPEPYLDEVFH---VRQAQSYCNGRFD..IWD-PKITTPPGL......YYLSYGFSKTA.......AFFQTSLGLGDG--
U4KUC8_PYROM/26-429IPEPYLDEVFH---IPQAQAYCRNAFD..VWD-PKLTTPAGL......YILSYPLRFFD...................--
G1KUP0_ANOCA/31-425QRAPYMDEAFH---VAQAQAYCEGRFQ..QWD-PMITTLPGL......YLVSVGIVKPA.............AWLFGW--
C5DSA6_ZYGRC/68-459VPYEFIDEKFH---VGQTIEYITGHWR..SWN-PKITTPPGL......YLLGWLNYKWC.....S.............--
H2AQR8_KAZAF/62-454IPYLFIDEKFH---INQTITYIKGDWA..QWD-PKITTPPGL......YILGWCNYHII.....K..P..........--
U5H039_USTV1/30-435GPTPYMDEMIH---IPQARAYCRGDFG..FWD-PALTTPPGL......YLISAIPAYLI.................AP--
W5NGQ4_LEPOC/1-392.....MDEIFH---VPQAQKYCEGRFN..EWD-PMITTLPGL......YLISVGIIKPS.............VWLAGW--
G2QLA0_THIHA/27-468VPEPYLDEVFH---IPQAQKYCAGHFR..DWD-DKITTPPGL......YLLSVAYHRFR...................--
AG10B_RAT/31-428LREPYMDEIFH---LPQAQRYCEGRFSLSQWD-PMITTLPGL......YLVSVGVVKPA.............SWILGW--
S8EM30_FOMPI/28-420VTEPYMDEPFH---VPQAQAYCRGDYW..AWD-PKITTPPGL......YVLSILLKQVF...................--
H9JJA8_BOMMO/32-432TTRTVIDELFH---IPQGLSYCRRNFM..HWD-PKITTLPGL......YLVSAAFLGTY...................--
ALG10_DROME/27-402TSDYVIDEEFH---IPQGLAFCRKEFD..VWD-PKITTFPGL......YLIA.LLLNPL...................--
ALG10_ASHGO/57-447VPYPFIDEKFH---VGQTVRYLAGRWR..EWD-SKITTPPGL......YVIGWAVQRTV.....G.............--
G0S7Z5_CHATD/97-541VCCLGFDEIFH---IPQAQTYCEGRYG..EWD-DKITTPPGL......YLISVAGHRIL...................--
A0DAU3_PARTE/15-377...PLQDEEFH---LDQMQHYLDSDFA..YWN-PKLTTPPML......YFLNYPFIVLLSKMGLS.............--
K3Y6Q6_SETIT/25-460VPEPYMDEIFH---VPQAQQYCRGDFL..TWD-PMITTPPGL......YYVSLAYVASF.......FPVAWMFRLAE.--
C5DDK7_LACTC/53-443VPYQFIDEVFH---VKQTIQYIGGNWK..TWD-PKITTPPGL......YVLGWLNYKWL.....R.............--
A0A0E1RWP6_COCIM/38-522VPDPYLDEAFH---VRQAQAYWRHQWR..EWD-PKITTPPGL......YLLSYVVAAVGFVISRKPAVL.........--
F8PP28_SERL3/26-407VTEPYMDEPFH---VPQALAYCRGEWT..SWD-PKITTPPGL......YVLSVIFHRIF...................--
D2VB91_NAEGR/36-412VPNPYMDEIFH---IPQAIKFVQNRFT..EWD-DKITTLPGL......YLFSYVYEHLG...............MNIS--
B0CP31_LACBS/23-410VDEPYMDEPFH---IPQAQAYCSGDFM..RWD-PKITTPPGL......YLLSVLLKRLF...................--
D6W779_TRICA/32-408TARLIIDEEFH---FQLGEAYCRYEFD..KWH-PKITTFPGL......YLFSNLLLGPF...................--
H3AZ27_LATCH/33-427QKDPYMDEVFH---VPQAQKYCEGKFN..QWD-PMITTLPGL......YLVSVGMIKPA.............GWVTGW--
W1QI63_OGAPD/28-389VNYTFIDEIFH---VNQVKEYWNGNFD..SWD-SKITTPPGL......YYLALWWLKLTGLEL...............--
Q8L638_ARATH/25-461VPEPYMDEIFH---VPQAQQYCNGNFR..SWD-PMITTPPGL......YYLSLAHVASL.......FPGMLLMENTSQ--
U5G642_POPTR/25-462VPEPYMDEIFH---IPQAQQYCKGNFA..SWD-PMITTPPGL......YYLSLAHVASL.......FPGMFFIRGVS.--
E1ZJK4_CHLVA/29-455APDPYMDEPFH---VPQTQRYCAGHWR..EWE-PKITTFPGL......YLFGTALGHAV..........HAAQRLLGI--
A3LRZ3_PICST/40-418VKNPYIDEYFH---IRQCQKYCQHKFH..EWD-NKITTPPGL......YVLGFLYTNAI.....QKLS........GA--
W4W5T7_ATTCE/51-434QPDYYIDEAFH---VPQTLRYCAWNFT..EWD-PKITTLPGL......YFITSAILSPF...................--
G3B8T7_CANTC/34-406VKGPFIDEIFH---LRQCETYCRYEFG..VWD-SKITTPPGL......YLLGFGFAKLL.....SVFS.........D--
E9G0X2_DAPPU/10-399QPVPYLDEIYH---VPQAQEYCRGNFS..YWD-NRITTLPGL......YLISVGVITPL................SSW--
T1KW23_TETUR/49-426VQEPYMDEIFH---IQQVRSYCVHNFT..YWN-PKITTPPGL......YFTTWVLFKPV..........SELIAFAEE--
B4N5D4_DROWI/27-400TSDYIIDEEFH---IPQGLAFCRKQFD..VWD-SKITTFPGL......YLIA.LVLSPL...................--
A5DZP8_LODEL/41-412LQDPFIDEIFH---LRQCQVYCAYNFS..IWD-NKITTPPGL......YILGLIYTKLL.....EFIT..........--
K5XJ27_AGABU/23-409INEPYMDEPFH---IPQAQAYCRGDFT..TWD-PKITTPPGL......YILSLLLKRTF...................--
ALG10_KLULA/84-474LPYVFIDEKFH---VDQTLRYLRGKWY..SWN-GKITTPPGL......YLLGWLQYHAT.....R.............--
K1R9X9_CRAGI/8-410QQSPYMDEIFH---IRQAKHYCHGNFT..VWD-PMITTLPGL......YLITVGILKPF...............ILLL--
M3JE22_CANMX/36-392IPEPYIDEFFH---LRQCQTYCDYNFT..HWD-DKITTPPGL......YIIGFIYSKII.....ELIT..........--
J7S1V6_KAZNA/74-466VPYQFIDEKFH---IGQTLTYLNGKWS..QWD-KKITTPPGL......YLLGWANHHLL.....K..P..........--
H2Z276_CIOSA/25-431QPTPFIDEIFH---IPQAQKFCNGHFS..EWD-PKITTLPGM......YFISVLILAPL................SWF--
J9LAG9_ACYPI/57-491.DEYYIDEEFH---VPQAQHYCRAAFH..KWD-PKITTLPGL......YLLSSTVLVPFMKIYDTILSLFGVLDHDVL--
M1AHM2_SOLTU/25-464VTEPYMDEIFH---IPQAQQYCKGNFR..SWD-PMITTPPGL......YIVSLAYVASL.......FPGIFSMKADV.--
G8YR70_PICSO/63-445VTSPFIDEIFH---LRQCQKYCQYKFQ..EWD-NKITTPPGL......YAIAFIWANLM.....KCFG......TAGA--
G7E9B0_MIXOS/25-410VPKPYMDEIFH---VPQAQAYCSGNWQ..AWD-PKLTTPPGL......YILSTATHHLT...................--
U3KM68_RABIT/35-431LREPYMDEIFH---LPQAQRYCEGRFSLSQWD-PMITTLPGL......YLVSVGVVKPA.............TWIFGW--
N1PN61_DOTSN/24-512VTEPYLDEVFH---VRQAQHYCQNHWH..VWD-PKITTPPGL......YFISYLLSPIL...................--
M7WKK8_RHOT1/28-438VDEPYMDEIFH---VPQAQAYCRGEWT..YWD-PALTTPPGL......YLFPAALAFIQ.....RYLVPVIALLPTNL--
B4GZN2_DROPE/27-402TSNYIIDEEFH---IPQGLAFCRKQFD..VWD-PKITTFPGL......YLIA.LILNPF...................--
E2C163_HARSA/25-409QPHYFIDEAFH---IPQTLRYCAWNFT..EWD-PKITTLPGL......YLITTAILSPF...................--
D5GMM3_TUBMM/58-479VPEPYLDEVFH---IPQAQAYCRNAFK..TWD-PKLTTPAGL......YLTIYPLSYVS...................--
B4J2W4_DROGR/27-402TADYIIDEEFH---IPQGMAFCRKQFD..VWD-NKITTFPGL......YLLA.LVLHPF...................--
H2MXS0_ORYLA/31-430QREAYMDEIFH---VPQAQKYCQGKFSLEQWD-PMITTLPGL......YLVSVGIIKPV.............AWLSDL--
G3Q5J3_GASAC/31-430QREPYMDEIFH---VPQAQKYCHGKFNLPQWD-PMITTLPGL......YLVSVGVIKPV.............VWLADL--
Q7F8Z1_ORYSJ/25-460VPDPYMDEIFH---VPQVQRYCRGDFL..IWD-PMITTPPGL......YYISLAYVASL.......FPGAWVTRIAE.--
A0A068XAK8_HYMMI/1-361.....MDEEFH---VVQTLTYIKGDWR..SWN-PKITTPPGL......YVLTTLVWRFVPFKA...............--
I1G516_AMPQE/28-420VPSPYMDEIFH---VPQAQQYCRNNFS..HWD-PMITTPPGL......YLISLLTIKPL................SSL--
B4LC57_DROVI/27-402TAEYIIDEEFH---IPQGLAFCRKQFD..VWD-SKITTFPGL......YLLA.LVLHPF...................--
G4TLE7_PIRID/31-425VWEPYMDEPFH---VPQAQAYCEGQWD..VWD-PKITTPPGL......YISAVVLRNVF...................--
C5MA37_CANTT/36-393IPEPYIDEIFH---LRQCQTYCDYKFT..QWD-DKITTPPGL......YIIGFVYSKLI.....ELVS..........--
H6BMA7_EXODN/33-480VPVPYLDEFFH---VPQVQAYWLGKWT..QWD-PKITTPPGL......YIYSYIVNSIRDFFSKEDFKP.........--
G3AQ79_SPAPN/26-394VQQPFIDEIFH---LRQCQVYCNYNFT..HWD-NKITTPPGL......YLLGFVYSKSL.....QFVI..........--
K0KGY8_WICCF/63-454VTEPFIDEIFH---IPQTIQYFNGDFK..TWD-PKITTPPGL......YYLGYIWSKFI.....QLTH..........--
M2PXH0_CERS8/29-421VTEPYMDEPFH---VPQAQAYCNGDYW..AWD-PKITTPPGL......YVLSLVLKRVF...................--
M3ZWU8_XIPMA/31-428QRDPYMDEIFH---VPQAQRYCKGKFK..EWD-PMITTLPGL......YLVSVGIIKPM.............TWLAKL--
C5FIZ5_ARTOC/29-525LPDPYLDEVFH---VRQAQAYWDHRWK..QWD-PKITTPPGL......YLVSYAITSTSSILFAKPVEL.........--
G0W9V3_NAUDC/65-461IPYEFIDEKFH---INQTLTYLNGHWT..QWD-PKITTPPGL......YILGWLNYKIV.....HIIP..........--
I2GZK7_TETBL/25-415VPFDFIDEKFH---VNQTIEYIKGNWF..NWD-PKITTPPGL......YIMGWLNWKFF.....H.............--
Q54Z56_DICDI/36-464QIEPYVDEIFH---IPQTIKYCEFKFK..EWD-NKITTLPGL......YILALIYSNIL...........SMFGIGDG--
D7THP5_VITVI/25-464VPHPYMDEIFH---IPQAQEYCRANFR..SWD-PMITTPPGL......YYLSLAHVASL.......FPGMYCVQAAS.--
B2AS64_PODAN/95-577VPEPYLDEFFH---IPQAQVYCEGRYR..QWD-DKITTPPGLYGVTISYLFSVIYNKIT...................--
L8G022_PSED2/46-496VPSPYMDEVFH---IPQAQQYCASDFY..TWD-PKLTTPPGL......YAFSLLLKAAT...................--
S6DZ28_ZYGB2/63-454TPHEFIDEKFH---VAQTLNYVAGNWT..SWD-PKITTPPGL......YILGWFSYRLG.....R.............--
G7YEG4_CLOSI/35-428QPEAYMDEIFH---VRQSLSYLSGNWS..SWD-NKITTPPGT......YVLFVVFYRIGAWLHILPVSP.........--
E4UQE0_ARTGP/54-531LPDPYLDEVFH---VRQAQAYWDHRWQ..QWD-PKITTPPGL......YLVSYAVASFSATLFGRPVEL.........--
A0A087VZH7_ECHMU/65-433QPTAYMDEVFH---EEQTISYLHGEWQ..KWN-PKITTPPGL......YVLTTFLWKVLPFRA...............--
S9XAR5_SCHCR/40-407VNIPYMDEIFH---VSQTQRYCNQDWE...WD-PAITTPPGL......YLLSYFLKPVL...................--
B0WRU3_CULQU/28-412TSKQVIDEEFH---LRQGEHYCRGRFH..IWD-EKITTFPGL......YLISGSFLSPF...................--
ALG10_YARLI/35-468QPTPYIDEIFH---IPQTQQYCKGHWN..AWD-SKITTPPGL......YIIGYAWARML..............TLTGL--
J4GMT8_FIBRA/28-420VTDPYMDEPFH---VPQAQAYCEGDYW..TWD-PKITTPPGL......YVLSVILKRIF...................--
B3M3X6_DROAN/27-402TSEYVIDEEFH---IPQGLAFCQQKFD..VWD-PKITTFPGL......YLLA.LVLSPF...................--
E3M395_CAERE/43-392VPDPYMDEFFH---ISQTRLYCAGNYT...WN-PLITTPPAL......YILSMPL.......................--
M2QYS3_COCSN/32-490VPKPYLDEFFH---VPQAQKYCEGDYS...WD-PKITTPPGL......YLVSKLFKPLL...................--
V2X8L4_MONRO/23-410VDKPYMDEPFH---IPQAQAYCRGEFD..YWD-PKITTPPGL......YIMSLIFKKVF...................--
B7PY71_IXOSC/28-414QPAPYMDEIFH---VPQAQSYCSYNFT..YWD-PKITTPPGL......YLTSLCFALAA................KLL--
K1WSG6_MARBU/64-554AQDPYLDEVFH---IPQAQAYCNGRYE..VWD-PKLTTPPGL......YIFATIYSKAV...................--
ALG10_CANAL/39-418LTQPYIDEIFH---LRQCQTYCQYNFH..HWD-NKITTPPGL......YILGFIYSEGI.....KILTRSSSTGGGGG--
T1IQU4_STRMM/35-428QPTPYMDETFH---IPQAQKYCDGKFQ..EWN-SKITTLPGL......YLISVGFLRPI................NFL--
G8JPI5_ERECY/57-447VPHPFIDEIFH---LNQTVKYIGGHWG..TWD-PKITTPPGL......YVIGWLEYHVM.....R.............--
W5KCZ3_ASTMX/32-428QREPYMDEIFH---IPQAQKYCQGKFN..QWD-PMITTLPGL......YLLSVGVIKPV.............VWLADF--
D8PKT8_SCHCM/23-405VTEPYMDEPFH---VPQAQAYCAGNFS..HWD-PKITTPPGL......YVVSVILKRFF...................--
M7ZBL2_TRIUA/25-435VPDPYMDEIFH---VPQAQHYCRGDFL..TWD-PMITTPPGL......YYISLAYLASL.......FPGAWAIKVAE.--
J3LZC5_ORYBR/25-460VPDPYMDEIFH---IPQVQRYCRGDFL..TWD-PMITTPPGL......YYISLAYVASL.......FPGAWASRTAG.--
D8RLA5_SELML/25-447VPDPYMDEIFH---VPQAQRYCKRDFY..TWD-PMITTLPGL......YLVSLVFESMV................SWI--
ALG10_YEAST/66-458VPYEFIDEKFH---VGQTLTYLKGKWT..QWD-PKITTPPGI......YILGLINYYCI.....K..P..........--
G8BNV4_TETPH/64-455VPYLFIDEVFH---VTQTIRYIKGDWF..YWD-PKITTPPGL......YILGYLNYQIV.....K.............--
A5DGH1_PICGU/27-396VRAPFIDEIFH---LRQCIKYCNNDFY..NWD-NKITTPPGL......YILGYLYGKAL.....NIVG..........--
G0VGC7_NAUCC/66-459IPYQFIDEKFH---VGQTLTYLQGDWF..NWD-PKITTPPGL......YILGWLNYHIW.....R..P..........--
W5JWB9_ANODA/28-387TSQLVIDEEFH---LRQGDHYCRGRFQ..KWD-PKITTFPGL......YLASTAILSPL...................--
Q170T5_AEDAE/28-413TSKVVVDEEFH---LRQGEHYCHGRFD..VWD-NKITTFPGL......YLVSASFLGPF...................--
C4XWR1_CLAL4/27-397VPLPFIDEYFH---LRQAQAYCASDYA..VWD-PKITTPPGL......YVLGAFWARVL.....AAWG..........--

PF02364

FKS1_YEAST/808-1631---FFPRDSEA---ERRISFFAQSLSTPIPEP.LPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQ--
G0WGB2_NAUDC/693-1553---FFPAKSEA---KRRISFFAQSLSTPITEP.LLVESMPTFSVLIPHYGEKILLNLKEIIKEESFSNRMTVLEYLKL--
BGS4_SCHPO/872-1706---FFPANSEA---ERRLSFFAQSLATPIPEP.VPVDNMPTFTVLIPHYAEKILLSLREIIREEDQLSRVTLLEYLKQ--
A5DFP6_PICGU/617-1414---YFPQLGEA---KRRISYFAQSLSSPLCNADFTTDACPAFTVLIPHYSESILLSIEEVIRRS.KQTQITLLDYLKS--
D8R536_SELML/856-1616---.VPHNLEA---RRRISFFSNSLFMTMPRA.PQVEKMLSFSVLTPYYSESVLYTKNELLDENEEG..VSILFYLQK--
G3BF86_CANTC/689-1496---YITMGKEA---QRRISFFAQSLTSPISEP.IPTTAIPSFTVLIPHYSEKILLSLKEIIKED.KGSKVSILDYLKL--
S2JMJ1_MUCC1/751-1581---YYPQKSEA---GRRMQFFAQSLTTPMPES.LPVPNMPTFTVMTPHYGEKIILSLREIIREEDKNARITLLEYLKQ--
Q6C549_YARLI/838-1663---FFPRNSEA---ERRISFFAQSLSTPIPEP.LPVDNMPTFSVLVPHYSEKILLSLREIIREDDQFSRVTLLEYLKQ--
BGS2_SCHPO/844-1666---YFPAHSEA---ERRLSFFAQSLATPIPEP.IPVDAMPTFTVLVPHYGEKILLSLKEIIREQDKLSRVTLLEYLKQ--
C5DDB6_LACTC/685-1519---FFPENSEA---ERRISFFAQSLSTPISEP.IPVECMPTFTVLIPHYSEKILLSLKEIIKEESTKSRITLLEYLKY--
C5DVI4_ZYGRC/728-1590---FFPSNSEA---KRRISFFAQSLSTPITEP.VPVECMPTFTVLVPHYSEKILLSLKEIIKEESSKSKITVLEYLKQ--
G8BP05_TETPH/703-1537---FFFSDSEA---QRRISFFAQSLSTPISEP.LPVECMPTFTVLVPHYSETILLSLQEIIREESSKTKISTLEYLKH--
F4RFS0_MELLP/756-1575---FFPPGSEA---ERRISFFAQSLTTSIPEP.LPVDAMPTFTVLTPHYSEKILLSLREIIREEDQNARVTLLEYLKQ--
A7TG32_VANPO/694-1542---FFPIDSEA---KRRISFFAQSLSTPITEP.VPVECMPTFTVLIPHYSEKILLTLKEIIKEESSKARITVLEYLKQ--
B9RVZ7_RICCO/412-1177---NIPKNVEA---KRRLAFFSNSLLMNMPRA.PKVEKMMAFSVLTPYNDEEVLYSRHQLWTENEDG..ISMLYYLQT--
E6ZX94_SPORE/765-1584---FFPKGSEA---ERRISFFAQSLTTALPEP.LPIDAMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQ--
F0XEB1_GROCL/867-1692---FFPSYSEA---ERRISFFAQSLSTPIPEP.LPVDNMPTFTVFIPHYGEKILLSLREIIREDEPYSRVTQLEYLKQ--
A3GFC1_PICST/627-1453---FFYPKGEA---ERRISFFAQSLATPLLDP.YPTRALPSFTVLVPHYSEKIILGLKEIIKED.KDSKLSLLEYLKQ--
H2B091_KAZAF/695-1551---FFPSNSEA---KRRISFFAQSLSTPIAEP.IPVECMPTFTVLVPHYSEKILLSLREIIKEESSKSRITILEYLKQ--
K0KXK3_WICCF/839-1738---FFPPKSEA---ARRISFFAQSVSTPIPEP.TLVQSMPIFTVLIPHYGEKIILSLKEIIREDNANSRITLMEYLKQ--
G0VE27_NAUCC/691-1546---FFPPNSEA---ERRISFFAQSLSTPVTEP.LLVESMPTFTVIVPHYNEKIILSLKEVIKEESPSNKLTVLEYLKQ--
M0Z2P0_HORVD/795-1572---.VPKNLEA---RRRIAFFSNSLFMNIPRA.TQVEKMMAFSVLTPYYNEEVLYNKDQLYKENEDG..ISILYYLKQ--
Q5K6T7_CRYNJ/779-1594---FFPKGSEA---ERRICFFAQSLTTSVPAP.IPVDAMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQ--
I1MEJ0_SOYBN/899-1668---NVPLNLEA---RRRIAFFTNSLFMNIPRA.PYVEKMMAFSVLTPYYDEEVLYSKEALRKENEDG..ITTLFYLQK--
Q75EM6_ASHGO/644-1429---VFKKSAEA---RRRLGFFSKSLSCPMPEP.YPTSEMPMFSVLIPHFKEKIILSIKDIVKGENDSTHVILLEYLKL--
A3GH41_PICST/602-1410---.FYEQSEA---QRRITFFAQSLSTPMPEV.NPINSMPTFSVLIPHYSEKITLSLREIIREEEQYSHVTMLEYLKS--
C5M4K6_CANTT/600-1409---MFQDQSEA---QRRITFFAQSLSTPMPEV.SPVHLMPSFTVLIPHYSEKITLSLREIIREEEQYSHVTMLEYLKS--
G3AGW3_SPAPN/626-1428---FFTIGKEC---ERRITFFAQSLSSPLPEP.FEVVAIPTFTVLIPHYNEKILINLEELISHS.ALSKLTLLDYLKQ--
G8B602_CANPC/590-1379---YIKIEEEW---ERRITFFAQSLSSPLPDP.FPVVSMPAFTVLIPHYSEKILLGLKDLIKEQ.SFSKLTLLEYLKQ--
L8WXK6_THACA/691-1484---FLPPGSEA---ERRISFFAQSLTASFPEP.ISVECMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQ--
W1QEZ3_OGAPD/758-1567---VLDPNSEA---SRRLTFFAHSLSTPIPKP.LPIDQMPTFSVLIPHHSEKITLSLQEIIKKEDEYSNVTLLEYLKQ--
S2JUI0_MUCC1/639-1467---YFPQSGEA---ERRIHFFAQSLTTPMPPP.HPVECMPTFTVLTPHYGEKILLSLREIIREEDTSTRVTLLEYLKQ--
A9RK32_PHYPA/857-1633---YVPKGLEA---RRRISFFSNSLFMTMPRA.PQVERMLAFSVLTPYYNEEVIFSKHQLKEENEDG..VTILFYLQR--
I1IFT6_BRADI/1065-1817---.VPTNLDA---RRRISFFANSLFMEMPRA.PKVRHMLPFSVLTPYYKEGVLFSSQALEDQNEDG..VSVLFYLQK--
Q6BYS5_DEBHA/725-1546---FFTASKEA---ERRISFFAQSLSSPLPEP.FPILAIPAFTVLIPHYSEKIILSLREIIKED.KHSKVSLLEYLKS--
K4B948_SOLLC/878-1645---.VPKNKEA---RRRIAFFSNSLFMNMPRA.PQVEKMMAFSVLTPYYDEEVLFGKESLRSPNEDG..VSTIFYLQK--
CALSB_ARATH/870-1637---NVPKNIEA---RERLAFFSNSLFMTMPQA.PSVEKMMAFSVLTPYYDEEVMYRQEMLRAENEDG..ISTLFYLQR--
K5X5R3_AGABU/768-1585---FFPPGSEA---ERRISFFAQSLTIAIPEP.LPVHAMPTFTVLTPHYSEKTLLSLREIIREEDQNTRVTLLEYLKQ--
Q6CDD3_YARLI/840-1684---VFDSQTEG---ERRLSFFAQSLATPIPDN.YVIDEMPTFTVLVPHYNEKILLSLKEIIKEDGENSRVTLLEYLKQ--
W1PHJ3_AMBTC/904-1670---.IPRNLEA---RRRIAFFSNSLFMNMPRA.PQVERMLAFSVLTPYYDEDVIYNKEQLHIENEDG..ISILFYLQR--
A5DBZ8_PICGU/697-1497---.FDGHSEA---ERRITFFAQSLSTPMRPA.NNVESTPSFCCLVPHFEEKTILSLKEIIKESDMYSHVTMLEYLKS--
J7RLI4_KAZNA/694-1544---FFSANSEA---QRRISFFAQSLSTPIAEP.TPVECMPTFTVLVPHYAEKIMLELREIIKEESLKSKMPVLEYLKQ--
B9I122_POPTR/880-1647---.VPKNIEA---RRRIAFFSNSVFMNMPHA.PNVEKMMAFSVLTPYYEEDVCFGKQDIRTPNEDG..ISIIFYLQK--
Q4WLT4_ASPFU/845-1663---FFPPGSEA---ERRISFFAQSLSTPMPEP.LPVDNMPTFTVLIPHYSEKILLSLREIIREDEPYSRVTLLEYLKQ--
K2RW51_MACPH/795-1619---YFPPNGEA---QRRISFFGQSLSTPIPEP.VPVDNMPTFTVMVPHYGEKVLLSLREIIREDDPYSRVTLLEYLKQ--
FKS3_YEAST/694-1542---FFPSNSEA---KRRISFFAQSLATPISEP.VPVDCMPTFTVLVPHYSEKILLGLKEIIREESPKSKITVLEYLKH--
B6K1V9_SCHJY/528-1348---LFPPNSEA---ARRISFFAQSLAQVVPKP.CTVDAMPTFTVLVPHYGEKVLLSLREIIREEDQLSRVTLLEYLKQ--
C4R051_PICPG/700-1508---LFKGHKEA---ERRITFFAQTLSTPIPES.IGIEKMPSFSVLIPHYAEKISLSLREIIKEEDENSQLTLLEYLKQ--
F8QGW8_SERL3/687-1503---FFPAGGEA---ERRISFFASSLTTALPEP.LPVDAMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQ--
Q5A9Y9_CANAL/588-1367---FIKIEKEW---ERRITFFAQSLSSPLPEP.FPVVSTPTFTVLIPHYSEKILLSLQDLIKEQ.SFSKLTLLDYLKQ--
CALSC_ARATH/876-1645---SVPVNLEA---RRRIAFFSNSLFMNMPHA.PQVEKMMAFSVLTPYYSEEVVYSKEQLRNETEDG..ISTLYYLQT--
A9TZ19_PHYPA/865-1623---.VPKGLEA---RRRISFFSNSLFMTMPRA.PQVDRMLAFSVLTPYYTEEVIFSSKQLKEENEDG..ITILFYLQR--
W1QB78_OGAPD/694-1512---FFVPNSEA---ERRISFFAQSLSTPIPEP.IPVEAMPTFTVLIPHYSEKILLGLKEIIKED.PSSKISLLEYLKH--
G8Y1P4_PICSO/734-1542---LFYEQSEA---QRRITFFAQSLSTPMPEI.GSTNSMPSFTVLIPHYSEKITLSLREIIREEDQYSHVTMLEYLKQ--
M7P3D9_PNEMU/884-1710---FFPSHSEA---ERRISFFAQSLSTPIPEP.LPVDNMPTFTVLVPHYGEKILYSLREIIREDDQLSRVTLLEYLKQ--
Q751P2_ASHGO/697-1537---FFPRNSEA---QRRLSFFAQSLSTPIIDP.IPVECMPTFTVLIPHYAEKLMLKLKEIIKEESPKSRITLLEYLKH--
C4QVL3_PICPG/679-1490---.....SEA---ERRVSFFAQSLSTPLPEP.VSTQAMPIFTVLVPHYGEKILFSLKEIIKED.QNSRLTLLEYLKQ--
G8ZYC9_TORDC/696-1542---FFPKNSEA---KRRISFFAQSLSTPINEP.VPVECMPTFTVLIPHYSEKILLTLKEVIKEESNKSKITVLEYLKQ--
K7M2P2_SOYBN/849-1612---.IPVNLEA---RRRISFFTNSLFMNMPHA.PQVEKMMAFSVLTPYYSEEVVYSKEQLRVGNEDG..ISTLYYLQT--
Q6FIJ9_CANGA/752-1597---FFPSNSEA---KRRISFFAQSLSTPLLDP.VPVECMPTFTVLIPHYTEKILLGLREIIREESQSSKITVLEYLKY--
S9X5V3_SCHCR/777-1593---YFLATSEA---ERRISFFSQSLAANLPEA.MPVPKMPSFTVLVPHYSEKILLSLREIIREQDPMSRITLLEYLKQ--
B6K096_SCHJY/781-1599---YFPKNSEA---ERRISFFAQSLSCRMPAT.TSVAEMPTFTVLIPHYGEKILLSLREIIREQDPMSRITLLEYLKQ--
C7ZN13_NECH7/785-1607---YFPKNGEA---ERRISFFAQSLSTPIPEP.MPVDSMPTFTVMIPHYSEKILFSLREIIREEDQYSRLTMLEYLKQ--
G8JPJ3_ERECY/666-1455---.FGKSAEA---KRRLGFFAKSLSCPIPDL.VPISEMPMFTVLIPHFKEKIILSIKDIVKGESDSTHVILLEYLKL--
Q6CTB0_KLULA/691-1518---FFPRNSEA---RRRISFFAQSLSTPITEP.IPVECMPTFTVLIPHYAEKILLSLREIIKEESPNSKITLLEYLKQ--
G3BBN7_CANTC/598-1405---.FYGQSEA---QRRITFFAQSLSTPMREI.GPTGSMPSFTVLVPHYKEKITLSLREIIREEQQYSNITMLEYLKK--
G8YKZ4_PICSO/698-1523---FFTTSKEA---ERRISFFAQSLSCPLPEP.IPIMALPSFTVLVPHYSEKIILNLKEIIKED.KKSKVSQLEYLKK--
I1HRP2_BRADI/889-1659---.VPKNPEA---RRRITFFSNSLFMNMPRA.PPVEKMVAFSVLTPYYNEDVLYSKDQLRRENEDG..ISILFYLQK--

PF04602

V9XJW7_9NOCA/21-675RTARIVAIVSG...LLGFVLALTLPFLPVRQETGELEWPQNGS.....IDSVEAPLVTYAPLTLRVSVPCAAAEQ...--
H6MU20_GORPV/33-681RTWSIVAVVAG...LVAVVAAVLTPFLPVTAHTATITWPQPQ......SLSVTAPLVAQTPSNLDVTVDCRVLAE...--
Q5Z3F6_NOCFA/13-659..YRLIALVSG...LLGFVLALLSPLLPVRQDRATLDWPQPDT......ASVTAPLVSYVPLRLDASLPCSVLGS...--
W5T763_9NOCA/25-694RTARLIAVITG...VLGALFAIATPFLPVQQTTAEVNWPQSGT.....VGNVEAPLMSQVPVDLRASIPCSAIAE...--
D0LC62_GORB4/25-672RWVKIAAVVTG...LLGFLAAVLTPLLPVNQTTAELRWPQGDT.....VSDVAAPLVSYVPIDMDMTVPCVLAAR...--
F5YU82_MYCSD/4-645RTTRLVAIIAG...LVGFLLSVATPLLPVVQTTATLNWPQHGE.....LHSVTAPLISQTPISMSVKAPCALVRE...--
A4FLJ6_SACEN/6-630RRARLRAVLAGGSAAVALLCAVAFPFAPVHQPVISYHWPGE.......PGASAVPLMPYQPVSLRASWSCAAIER...--
EMBB_MYCLE/22-673RVARWVAAIAG...LIGFVSSVVTPLLPVVQTTATLNWPQNGQ.....LNSVTAPLISLTPVDITATVPCAVVAA...--
E9T230_RHOHA/21-668RTARLVAIVTG...LLGAILALATPFLPVQQDAASISWPQNGS.....LTNVEAPLVSYTPQQLHVSIPCTAVGQ...--
A4F676_SACEN/36-675..LKLFAAITG...LLGTVLALALPFLPVNHEVTTLKWPTAQG.....TKPVSAPLVSFSPVWLNANVSCETARG...--
D6ZA32_SEGRD/18-683..ARAVALIAG...VLAVLGAIAVPFLPVKERTAELQWPSRV......VGNTNAPLVSYFPESFDLSVPCRAVAA...--
EMBC_MYCTU/27-682RIARYVAVVAG...LLGAVLAIATPLLPVNQTTAQLNWPQNGT.....FASVEAPLIGYVATDLNITVPCQAAAG...--
W5T6N4_9NOCA/11-663..IRLAALLSG...LIAVVLAVLTPLLPVREDRTSLDWPQPQS......VPVTAPLVSYVPLQLDASVPCAAFRD...--
B1VE75_CORU7/37-709SRITTLAIVSG...LLGFLLFIATPFLPVNQQQSSFSWPQNGD.....LSSVTAPLISYSPESLDLSIPLSEVDK...--
W5WNE4_9CORY/27-693RRIKLISIISG...FLGFFLFLSIPFLPVKQEQASFSWPQGGD.....LTSVTAPLMSYVPQDLDISLPIEETTK...--
V9XEG0_9NOCA/30-675..TRLWAVLAA...VVGIVASIAMPFLPVTQTTATIDWPQSES.....NAGISAPLVSYAPVDLDATIECRSVRD...--
B1MEM1_MYCA9/17-667NIARWTATVFG...LLGFVLSVSIPLLPVKVSTATLDWPQQGR.....LNNVTAPLISQTPMDMTVIVPCAVVNS...--
F8DYG1_CORRG/20-684..LKLVSIVSG...LVGLLLFLSLPFLPVKQESAEFNWPQGGD.....LRSVTAPLISYVPQDLDITLPLQEAQN...--
U3GXX2_9CORY/12-670.GIQLAAIISG...IAGFILFVLTPFMPVNQVQSEVSWPQEE......VGSLTSPLISYAPVTWSADIPLRDVNK...--
A1TGU6_MYCVP/6-653..ARLVAVIAG...LLGMLLCGLAPLLPVKQSTATITWPQSVNAEGF.VSDITAPLVSGAPHALDVTIPCPAVAT...--
F6EEB9_AMYSD/14-665RVARIVALLTG...LAGFLLAVATPLLPVHQTTTTISWPQDDQ.....ATSIEAPLISYLPVEVSATIPCAVFND...--
Q5YYW4_NOCFA/29-683.WARPVALLAA...LIGALCAVAVPLLPVRVDAATLTWPQNGA.....PDSVEAPLIGYAPLTFDATVPCAAITQ...--
D5UMC1_TSUPD/6-651RTARIVAVVTG...LVGLLLALATPLLPIKQTAVTIDWPQAGS.....PASVTAPLTMYKPLDMQATVPCALIAA...--
Q745M3_MYCPA/11-658RVTRWVATIAG...LIGFVLSVATPLLPVVQTTATLNWPQGGQ.....LNSVTAPLISLTPVDLTATVPCSSVRD...--
V9XIW6_9NOCA/28-673RTARLVAVVAG...LLGMILALATPFLPVRVTEATMSWPQDAA.....ATDVELPLMSQVPLQLRATVPCSAVAE...--
J9S8T7_9ACTN/54-705GTARVVAMAAG...VVGILLALLSPFLPVDYTKAELTWPQQGS.....VGNVAAPNVSFVPVSMDVAVPCALGAS...--
C4LG43_CORK4/44-710RRTKIVAAVTG...IAAFLLFILTPLLPVKQTQSSIDWPQNDN.....INSVVAPLISYSPESLDFTVPLSLADN...--
A0R614_MYCS2/24-675RIARWVATIAG...LLGFVLSVSIPLLPVTQTTATLNWPQQGR.....LDNVTAPLISQAPLELTATVPCSVVRD...--
C0ZLV7_RHOE4/28-666RTARLIAIVTG...LLGLLLALATPFLPVKQEAASIDWPQGGT.....VNSVSSPLISYSPTSLDISIPCSTLGQ...--
V5X6X3_MYCNE/4-651RTIRLVAIIAG...LVGMVLCALAPLLPVRQSTATIQWPQTAGAEGF.ISDVTAPLVSGAPRELDVTIPCQAIAT...--
H6MU24_GORPV/10-674..AKLVAIITG...LLGLFLALATPFMPVNQTTAQITWPQDGQ.....INSVTAPLISYVPIDLDVSVPCSAVGE...--
W5XXY2_9CORY/8-674TTLVRVALISG...LIGMFLFILTPFMPVNQVQSSLSWPQNGS.....LQSVNAPLESYTPVSMDVAIPLAALSD...--
H6RD31_NOCCG/25-671..ARPVAIVAA...LIGALCALAVPFLPVRMDAATITWPQDDA.....ARSVAAPLVSYAPIGLTAEVPCAAISQ...--
H5X1D6_9PSEU/4-623..HRWVIAGLG...TLSALTAVLFVLAPVEQDVTTYEWPSGPD.....TSSTALPLFPYEPDRMDVTVRCADVMA...--
D5UNZ8_TSUPD/31-682TVARLIAVAAG...VLGLLLCLLTPLLPVKQSTAGLDWPQAGPGAT..SVDITASLVTQSPATLTVTVPCRVLTD...--
D5UNZ7_TSUPD/12-675RRTAWTAAVTG...VLGVLFAVLTPFMPVNQSTAALDWPQRGS.....LESVTAPLVSYVPDRIDIAVPCTAVDR...--
W5TDC8_9NOCA/23-685RWAQPIALIAG...LLGALCAIAVPLLPVQVDRTTLSWPQQGS.....VRGIDAPLVSYAPLTFDATVPCAAVAQ...--
Q745M2_MYCPA/11-679RIPRSVAAVAG...IAGLLLCLAVPLLPVRQTTATVLWPQGTV.DGH.VSQITAPLVSGAPRALDISIPCPAVAT...--
F6EEB8_AMYSD/16-671RAARIVALLTG...LAGFLLAVATPLLPVHQTTTTISWPQDDQ.....ATSIEAPLISYLPVEVSATIPCAVFND...--
D0LC64_GORB4/31-681RRWALAAVFGG...IVAVIAAILTPLLPVTEHTARIDWPQAT......GTAVTASLAAQTPAGLDIAVPCSTLDR...--
D5UNZ9_TSUPD/37-686..WRIVAAVAG...LLGFVLAILTPFLPVKETTASVNWPQNGK.....VANVDAPLVSYVPIRLDVTLPCSLVGA...--
E9T231_RHOHA/29-674RNARLIAVVTG...LVGLLLALATPFLPVTQTAASVSWPENGV.....AANVEAPLMSQVPTSLSATIPCRAVAE...--
L0J7Q5_MYCSM/5-653KVARWTATIAG...LIGFILSVATPLLPVVQTTATLNWPQGAQ.....LNNVTAPLISQVPVTMTVTVPCDVIRA...--
K0ELF6_9NOCA/24-672RRLRLFAIVSG...LIAVLAAVSLPFLPVQQDQASVSWPQAAA.....VTSVTAPLITYAPMDLSAEIPCAAFDA...--
H6MU21_GORPV/21-696RIARIVAVVAG...LIGIVLALAMAVLPVTYTKVQIKWPQPTSQNASGVENILAPNVSYTPTNLDLSVPCRLAAD...--
L0J471_MYCSM/5-652RIARLIAVIAG...VAGVVLCGLVPLLPVTQTTATIAWPQAPGPDGL.VTDITAPLVSGAPQALDVSIPCRTIAS...--
D7WBK3_9CORY/39-680RNLALTAMMSG...LLAFIFFALLPFLPVKQVQSSFDWPQNGS.....LNSVNAPLISLAPESLELTIPISVLEE...--
C1A0M7_RHOE4/26-667..ARIVAIVAS...ILGIVLCGSVPFLPIEQDTAVVNWPQAGS.....TKSVEAPLVSYTPLRMEASIPCASISE...--
Q6NK78_CORDI/12-664..IKWAAILSG...VIGFVLFIITPLMPVNQVQSSVSWPQNGS.....LNSVSAPLMSYTPISFDAKIPVASVDK...--
D6ZD22_SEGRD/22-677..WRLVAVVAG...LIAFVCAVLSPILPLNQKTVTIDWPQNGT.....LGSVTAPLDSFVAESMRAEVPCSLAKS...--
H6R7H1_NOCCG/16-659RTARLIALVAG...VLGALFALATPFLPVTQTTATLSWPQHGS.....LDNVQAPLMSQVPIELRATIPCAAVAQ...--
G8RNM8_MYCRN/11-660GSARLIAVVAG...IAGLLLCGLVPLLPVQQTTATILWPQASGPDGL.ITDITAPLVSGAPLALDLSIPCQAIAT...--
A0R613_MYCS2/6-652RIARLIAVVAG...IAGVLLCGLVPLLPVEETTATVLWPQGVGADGN.VTELTAPLVAGAPRALDVTIPCRAVAE...--
EMBA_MYCLE/11-678RIIRLIAVGAG...ITGLLLCAVVPLLPVKQTTATIRWPQSATRDGW.VTQITAPLVSGTPRALDISIPCSAMAT...--
B1MEM2_MYCA9/16-665R.ARLISLAAA...TIGVLLCVLVPLLPVRQSTVDINWPQGAGADGN.ITGITAPLVSGAPLSFEAHIPCTAVAT...--
Q0S9C1_RHOJR/40-687RTARLIAIVTG...LIGFVLAVATPFMPVQQTTAAVNWPENGV.....VGDLEAPLMSQVPVDLSAAIPCSAVAG...--
E9SYL2_RHOHA/31-680RRARLIAIVAG...VLGVLSAVAVPLLPVNQEQSTLSWPQGGS.....TGSVEAPLVSYAPFTFDARIPCATAAG...--
D0LC65_GORB4/7-654RIAKLVAVIAG...AIGVLLALAAPFLPVTYTKAELNWPQQGS.....VQNVAAPNVSYVPVSVDIAVPCTLAAD...--
J9S5V1_9ACTN/37-692RTVALVAAVAG...VVAVVAGVLTPFLPVSTSTASITWPQQTGE....SASVTAPLVAQTARDLAISIPCRVLAT...--
W5TPG9_9NOCA/25-684..VRPLALIAG...LIGALCAIAVPLLPVKVDHTTLSWPQQDS.....ARSVNAPLVTYSPLTFDATIPGRAMTQ...--
Q0SFU9_RHOJR/35-682RSTRLLAIIAS...VFGVLLTLSLPFLPVEQDNATLSWPQNGS.....TGSVEAPLVTYAPLSLDVRIPCSAVGE...--
D0LC63_GORB4/10-666..ARLVAIVAG...VLGVVLCALTPLLPVKATDATFDWPQDQPLSAQ.TSSVTAPLIAQTPRSLDIRIPCATLTSTIL--
C3PJ41_CORA7/15-655..LRLTAIIAG...FIGFLCFVATPLLPVNQTQSSFDWPQQGS.....LQSINAPLISVAPEEIDAEIPLEAVDK...--
A0R612_MYCS2/13-668RTARLVAIIAG...LLGTLMAIATPLLPVEQTTAELNWPQNGV.....WQSVDAPLIGYVATDLTVTVPCQAAAG...--
Q0S9C0_RHOJR/14-655RTSRLIAIVTG...LIGFVLALATPFLPVKQDAASIDWPQDGT.....LNSVEAPLVSYTPLDMQVTVPCSVFTQ...--
B1MEM5_MYCA9/31-682RKARLLAIVTG...FLGALLAIATPLLPVRQDTAQLNWPQNNT.....LASVDAPLIGYVPTDLTITVPCAAAKG...--
D0LC66_GORB4/32-701RRAKLVAIIAG...LAGLFLALATPLMPVKQTTAEITWPQQNA.....ISSVAAPLISYVPIDLDISIPCTAVDR...--

PF04188

GPI18_YEAST/2-433IVG..LTLYFVLFRSIQYLLVFLTPIRQFDTSTSLLLNELCS......SPSEINSYWNKY--------------------
PIGV_HUMAN/8-493RKE..VLRFAVSCRILTLMLQALFN.AIIPDHHAEAFSPPR.....LAPSGFVDQLVEGL--------------------
Q6NKT6_ARATH/13-489.KETILIKYAIFSRLLVLFLTILWRSLLQPYDTSAALNPPCLYHKEDSFPFLVANAASRS--------------------

PF05007

GPI14_YEAST/127-386-----------------------------------------------------------------ISTRG----------
GPI14_SCHPO/112-368-----------------------------------------------------------------ISTRG----------
PIGM_TRYB2/134-410-----------------------------------------------------------------VSTRG----------
PIGM_RAT/140-408-----------------------------------------------------------------VSSRG----------
Q17515_CAEEL/146-405-----------------------------------------------------------------ISARG----------
Q9W2E4_DROME/177-450-----------------------------------------------------------------ISTRG----------

PF06728

A8N7A6_COPC7/15-379-PALLATKLAF...GFSKLP.DAVRYDHQL...................SSPLTSFSQLQE.GLWLFNHG.IDPYAGG--
Q5CYY5_CRYPI/10-436-IISILIKLSF...FILVEHDLEDYTNGFF...................GILGQNFGEVLE.FCALKEYG.ISTYYES--
B6AHL5_CRYMR/12-437-ILLVIIRILTLQYYASD...PNIYTDPLN...................VIPGYTFRDIKD.SCTLIKSG.ISPYVSY--
B9RC32_RICCO/30-452-ASALILRLIL...IYFSQN.LNLSSRPEV...................STPLTSLRRLAE.GYWLKQLS.ISPYAGS--
B9GKM7_POPTR/14-432-IASVMLRLIL...IYLPKT.FNLASRPEV...................STPLVSLRRLAE.GYWLKQSS.ISPYAGS--
A9TIH7_PHYPA/73-514-TLGICVRFLL...VVMGSL.SLLDRRVEV...................VSPVTSLSRLAE.GYWLKEYG.KSPYAGS--
B4N1B7_DROWI/10-386-LLGGAVRLYF...SRTPLA.SLIGDRVEF...................ATPLNSYKRMQE.GVFLLEHD.IDPYSGD--
B4KI55_DROMO/10-386-LLGGAVRLYF...SQTSLA.PLIGNRVEF...................ATPLNSFKRLQE.GVFLLQQG.VDPYRGD--
Q16H22_AEDAE/9-388-LLGAALRYLL...MHSHYG.VTIQNRVEV...................ATPLNSWKRAIE.GAYLYANG.TNPYEGD--
B0W4N5_CULQU/8-388-FVGALVRYLL...MSSEYS.GLIRGRVEV...................ATPLNSWKRAVE.GAYLYANG.TNPYDGD--
Q7Q3W6_ANOGA/8-396-GVAAAVRFLL...MNSRYS.HGIQNRVEV...................STPINSWKRVEE.GAYLYANG.VNPYDGD--
B7QL74_IXOSC/11-391-TSGFLLRLAL...IYTSIG.KRISDRVEV...................STPLNSWRRVTE.GLYLQRMQ.MSPYDGD--
Q4RLI5_TETNG/10-394-ILAVTIRAAL...YRSNLA.DLIAERVEV...................VSPLTAWKRVVE.GLALLDLG.VSPYSGD--
Q28CK0_XENTR/10-394-LVAVTVRAIL...FRSSLA.EFISERVEV...................VSPLNSWKRVVE.GMALLDLG.VSPYSGD--
A7S3Y0_NEMVE/14-406-LASTAVRLIF...MYSPAR.EWFRDRIEL...................STPLTDWKRVEE.GLSLLSHG.VSPYSGD--
Q54T45_DICDI/55-469-FSAILIRIIL...FYQGFD.QLFSNRNEI...................TTPLTSFKRLVE.GLHLRELG.LSPYAGS--
Q758M8_ASHGO/10-356-IACVGSRLLISL.AFPSLQ.QQLDNAVEF...................STPVTSFRSLQE.GVFLLQNN.LPVYDGG--
C5DB98_LACTC/10-356-FACLASRFGAAA.VFPLLQ.QQLDRSVEF...................STPVTSFRSLQE.GVFLLQND.FPLYSGG--
Q6CPH2_KLULA/10-358-WACFASRLAVSY.LFPSLQ.QQLDRTVEF...................STPVTSYRSLQE.GAYLLLHN.LPIYDGG--
C5DUS6_ZYGRC/10-359-VGCVVVRLAVSL.LFPSLQ.TQLDKSVEL...................STPMSSYRLLNE.GIFLLRNG.FPLYDGG--
A7TF02_VANPO/11-360-LAGFTVRLLLSI.GFSGLQ.SSLDNSVEF...................STPFTSFKSLQE.GIFLLNNG.FPLYSGG--
Q6FSI7_CANGA/9-374-VICGALRLLISA.TFPSLR.SQLDNTVEF...................STPFTSFKSLSE.GVFLYDNG.FPLYNGG--
C5MHK2_CANTT/9-395-IIGGLIRFILPT.LFPQII.TKLDSSVEF...................STPISSFKSLQE.SFYYFNHN.INLYDGG--
Q5AGH5_CANAL/13-440-IIGGLIRFLLPTIIFPQLT.SILDSSILL...................STPITSFKSIQE.SIFYFLYN.IELYNGG--
A5E2K6_LODEL/111-490-LIGGLVRFLLPL.LVPSIV.PVLGSIVEI...................TTPITSFKALQE.AFFFLNSS.IDLYDGG--
Q6BPY5_DEBHA/9-390-LIGALIRFVLPT.SLPSLP.LDLSSSIEI...................ATPLTSFKSLKE.AFYYLQHN.IDLYDGG--
A3LVF4_PICST/9-390-VLGALVRFVVPS.VLPQVT.DVLSSIVEI...................STPVNSFKSLLE.AFYYLHHN.INLYDGG--
C4Y9V1_CLAL4/8-389-ASGFALRFAVPT.LLPHIS.HSLAATPQI...................STPIDSFRSIRE.AVYFLQNG.MDAYDGG--
C5FSQ4_ARTOC/12-388-GAAFALRLILIL.LFPGLP.DLLTGRVEV...................STPISSFKRLQE.GLFLYLRN.VSPYDGG--
B6H480_PENCW/12-387-GAAFMLRLLLTC.LFPSLP.DLLTGRVEV...................STPVNSFKRLQE.GLFLYTRN.VSPYDGG--
A2QI87_ASPNC/12-388-GGALALRLLLSV.LFPSLP.DLLTGRVEV...................STPVTSFKRLQE.GLFLYMRN.VSPYDGG--
B6QEM6_PENMQ/12-390-AAAVAVRLFLFV.AFPSLP.DLLTSRVEV...................STPVSSFKRLQE.GLFLYTRN.VSPYEGG--
B2WBA6_PYRTR/13-388-GAAAAVRLLLFT.VFPALP.DLLAGRVEV...................STPVTSFKRLQE.GVFLHTHN.VSPYDGG--
B2A9S5_PODAN/16-388-AGAAVLRLAIFT.LLPDLP.DLLTGRVEI...................STPVTSFKR..Q.GLFLYNHN.VSPYDGG--
Q6C5L4_YARLI/7-382-ACGAIARIVVYH.LFPSVP.ATLDGHVEI...................STPVTSFKRLQE.GLYLYKQG.IDPYDGG--
B0D118_LACBS/9-373-PALVVARLFV...ALSSLP.DVLKHNHQL...................SSPLTSFSQLQE.GIYLFNHD.IDIYSGG--
PIGU_SCHPO/10-372-LGLLSISFFLQWYLANTWIAEFLYRRIEV...................STPVSGFLRVRE.GLYLYENG.LDPYSGG--
B6K154_SCHJY/14-372-LLYVSIHIVLHTLDFS....SILEKRIEI...................STPASSFLRVKE.GYYLYKKG.IDPYEGV--
Q22672_CAEEL/31-382-SAAIAVRAVCASYS......DLFEERVEL...................TSVVYSFEKLKD.SIAMVDDG.LNPFEAK--
A8X654_CAEBR/27-380-SAAIAVRAASFAYS......DYFEERVEF...................TSTVYSFERVKD.GIAMLDDG.LDPFETK--
Q01AL0_OSTTA/12-375-LTLTLARVVALAFIVPESAREALERRIEL...................SSATDSVRRAREAAYAVRALGVSSAYDGS--
C1EBB5_MICSR/13-406-AAGVLARVLL...AILGWT.ESASERLEL...................ASPVDALARIRE.GHALWGMG.QSPYGGS--
C1MV77_MICPC/13-431-LASVLLRFVL...AARGWG.EILHARPEL...................SSAVDAATRLRE.GDALRRLG.QSPYAGS--
C5L3N8_PERM5/23-419-LLGFLLRLLLFAALGSPLL...LRSSPEL...................NSPINDYERLQEAVAALSKGA..DPYAAS--
Q4YTZ9_PLABA/82-516-LEQYFQTNKRYNKNIKQCIFKSDSMYYSF...................NSDIYNMKYIYDSYILSKRYK..DIYSFL--
Q8IE19_PLAF7/127-560-LELYFQKNKRYN.NLRSFLLKNDYMHYLF...................NTDIYNLKYLYDSYVLRILKK..DMYSSL--
B3L8S4_PLAKH/95-534-LQEYFQRNKRNG.KIKQFLLKNDSMHYSF...................NSDLYNLKYIYESDILGRLSA..DVYSSL--
A0DGJ7_PARTE/1-357-MYRIILILKCLLWYFGKWD.VDLTWLPYF...................SNPYTQYSNIRE.AKYLIANN.YNPYNTD--
B8C4L2_THAPS/71-579-LTQLLGRGILPSIRAAVLDPIHTWSHLEEACFWKDNAPSLWMDVAVAHSTVGNSADA.SDDVVRKAKGGYSAIYTPG--
B4Q6V7_DROSI/10-386-LLGAAVRFYF...CRTPLA.PMIGNRVEF...................ATPLNSHKRMQE.GIFLLQSG.IDPYLGD--
G3HAP2_CRIGR/11-394-.VAVTVRAAL...FRSSLA.EFISERVEV...................VSPLSSWKRVVE.GLSLLDLG.VSPYSGA--
J4TTL1_SACK1/11-359-.GCIAIRLAVIC.LFPSLQ.QQLDQSVEF...................STPVTSFRSLQE.GLYLLRNN.IQVYNHG--
Q5KP79_CRYNJ/19-375-IVGAVLRMALF..SLPEVV.IALQRRPEL...................STPLTSFRSIQE.GVFIYEHG.TSPYSGG--
Q7SFC3_NEUCR/18-392-..AAVLRLALFT.LFPGLP.DLLTGRVEI...................STPVTSFKRLQE.GLFLYNHN.VSPYDGG--
Q94K70_ARATH/25-442-.ASTIFRLFL...IFSPAN.INLSSRPEV...................STPHTSLRRLAE.GYWLKQSS.LSPYAGS--
V4YHY4_TOXGO/76-514-.VGVALRLFLYS...VGLT.LSESTEPLV...................SPASASFSSFRE.ALTLHALS.FSPYTGG--

PF09594

PIME_MYCS2/91-321--------------------------------------------------------------------------------
A0JZG9_ARTS2/73-321--------------------------------------------------------------------------------
Q73YN6_MYCPA/82-326--------------------------------------------------------------------------------
E0TET4_PARBH/112-335--------------------------------------------------------------------------------
Q1QK36_NITHX/92-360--------------------------------------------------------------------------------
Q1DFL5_MYXXD/100-338--------------------------------------------------------------------------------
Q1LAW9_RALME/87-313--------------------------------------------------------------------------------
Q2J8W8_FRASC/88-337--------------------------------------------------------------------------------
Q9HN16_HALSA/81-322--------------------------------------------------------------------------------
Q6N414_RHOPA/73-354--------------------------------------------------------------------------------
Q8KF88_CHLTE/91-313--------------------------------------------------------------------------------
Q82C69_STRAW/73-314--------------------------------------------------------------------------------
A6W4J4_KINRD/75-318--------------------------------------------------------------------------------
Q8NNL7_CORGL/75-325--------------------------------------------------------------------------------
A6LI36_PARD8/70-300--------------------------------------------------------------------------------
Q0S7Q3_RHOJR/72-303--------------------------------------------------------------------------------
Q0S430_RHOJR/96-330--------------------------------------------------------------------------------
AFTC_MYCS2/90-325--------------------------------------------------------------------------------
Q8KF86_CHLTE/520-743--------------------------------------------------------------------------------
A4X3Z6_SALTO/69-305--------------------------------------------------------------------------------
A5FWG6_ACICJ/133-359--------------------------------------------------------------------------------
Q8EXK5_LEPIN/120-368--------------------------------------------------------------------------------
Q6NG43_CORDI/98-348--------------------------------------------------------------------------------
A4F662_SACEN/84-314--------------------------------------------------------------------------------
A4YMG5_BRASO/52-323--------------------------------------------------------------------------------
Q8FNR9_COREF/132-368--------------------------------------------------------------------------------
Q8FNS1_COREF/85-333--------------------------------------------------------------------------------
Q2IKA8_ANADE/104-327--------------------------------------------------------------------------------
Q8NNL6_CORGL/93-341--------------------------------------------------------------------------------
A7I755_METB6/60-298--------------------------------------------------------------------------------
Q1AS45_RUBXD/75-307--------------------------------------------------------------------------------
Q0SHP5_RHOJR/98-332--------------------------------------------------------------------------------
A1TAY8_MYCVP/79-323--------------------------------------------------------------------------------
Q0KDP9_CUPNH/92-320--------------------------------------------------------------------------------
Q7MTZ4_PORGI/65-295--------------------------------------------------------------------------------
A4XDG1_SALTO/368-608--------------------------------------------------------------------------------
Q73W67_MYCPA/92-327--------------------------------------------------------------------------------
A0JZG6_ARTS2/141-392--------------------------------------------------------------------------------
Q2G5A3_NOVAD/106-326--------------------------------------------------------------------------------
Q8A2B6_BACTN/67-296--------------------------------------------------------------------------------
Q0C0G8_HYPNA/93-341--------------------------------------------------------------------------------
Q1ITA1_KORVE/92-336--------------------------------------------------------------------------------
Q4JVC2_CORJK/78-310--------------------------------------------------------------------------------
Q5Z2C4_NOCFA/88-323--------------------------------------------------------------------------------
Q0S1F1_RHOJR/88-319--------------------------------------------------------------------------------
Q5YR74_NOCFA/76-310--------------------------------------------------------------------------------
Q82B65_STRAW/52-287--------------------------------------------------------------------------------
A6WEV4_KINRD/63-293--------------------------------------------------------------------------------
Q6A9X9_PROAC/81-311--------------------------------------------------------------------------------
B2U6Q0_RALPJ/105-334--------------------------------------------------------------------------------
Q8A2B7_BACTN/70-300--------------------------------------------------------------------------------
A1K2E7_AZOSB/76-322--------------------------------------------------------------------------------
Q1LQN5_RALME/107-328--------------------------------------------------------------------------------
Q82AJ1_STRAW/66-309--------------------------------------------------------------------------------
A4F642_SACEN/68-304--------------------------------------------------------------------------------
Q6NEL0_CORDI/90-330--------------------------------------------------------------------------------
Q89QR1_BRADU/100-368--------------------------------------------------------------------------------
Q4JVV2_CORJK/84-315--------------------------------------------------------------------------------
Q5YTA9_NOCFA/80-311--------------------------------------------------------------------------------
Q73WN6_MYCPA/105-337--------------------------------------------------------------------------------
Q8FNS2_COREF/71-313--------------------------------------------------------------------------------
A4Z0F4_BRASO/98-322--------------------------------------------------------------------------------
Q1AX69_RUBXD/44-303--------------------------------------------------------------------------------
Q5YQC7_NOCFA/78-313--------------------------------------------------------------------------------
Q8FPI8_COREF/95-327--------------------------------------------------------------------------------
B2U6P6_RALPJ/116-345--------------------------------------------------------------------------------
Q4JU29_CORJK/82-316--------------------------------------------------------------------------------
A6LBC6_PARD8/70-301--------------------------------------------------------------------------------
Q20YY7_RHOPB/103-326--------------------------------------------------------------------------------
Q1LQN6_RALME/104-332--------------------------------------------------------------------------------
A1R1N0_ARTAT/81-341--------------------------------------------------------------------------------
Q2K4Q8_RHIEC/84-305--------------------------------------------------------------------------------
A4YMG3_BRASO/104-327--------------------------------------------------------------------------------
Q82GI4_STRAW/88-314--------------------------------------------------------------------------------
A7I7Y5_METB6/97-335--------------------------------------------------------------------------------
Q3L9S4_RHOE4/54-285--------------------------------------------------------------------------------
A4FR42_SACEN/78-325--------------------------------------------------------------------------------
Q9CBX0_MYCLE/105-336--------------------------------------------------------------------------------
A4FGU5_SACEN/82-312--------------------------------------------------------------------------------
Q82NJ1_STRAW/66-299--------------------------------------------------------------------------------
Q6NF60_CORDI/70-290--------------------------------------------------------------------------------
A4X4Q2_SALTO/67-302--------------------------------------------------------------------------------
A4XDF7_SALTO/84-339--------------------------------------------------------------------------------
B1W388_STRGG/68-304--------------------------------------------------------------------------------
B2HGU8_MYCMM/80-324--------------------------------------------------------------------------------
B4EGA7_BURCJ/104-332--------------------------------------------------------------------------------
B4EQ62_BURCJ/118-340--------------------------------------------------------------------------------
C5B043_METEA/93-315--------------------------------------------------------------------------------
AFTC_MYCTU/94-327--------------------------------------------------------------------------------
PIME_MYCTU/103-334--------------------------------------------------------------------------------
Q63I86_BURPS/104-334--------------------------------------------------------------------------------
Q63I87_BURPS/118-340--------------------------------------------------------------------------------
Q7AQD6_MYCLE/80-324--------------------------------------------------------------------------------
Q8NNL3_CORGL/89-325--------------------------------------------------------------------------------
R6X3N6_9PORP/49-278--------------------------------------------------------------------------------

PF05208

M4B3B6_HYAAE/47-400WLLLLLEAGVGYM.IIQKVP......YTE-------I---DWS-TYMQQVEL.FKH.GE.RD------------YLNI..
ALG3_SCHPO/28-384SRLLLLEIPFVFA.IISKVP......YTE-------I---DWI-AYMEQVNS.FLL.GE.RD------------YKSL..
C1N7Z4_MICPC/3-383RVLVVLDALLSVA.IVRRVA......YTN-------I---DWN-AYMGEARG.YAS.GE.RD------------YAKL..
G3B1L9_CANTC/44-430.IIAIVTSIGTKV.IIAKVP......YTE-------I---DFN-TYMQQIEV.VND.GE.LD------------YSLI..
H2B2E5_KAZAF/49-418PTLLFMESAALKI.IIKNVA......YTE-------I---DYK-AYMEQIET.IVYYKN.LN------------YTEI..
K7J227_NASVI/23-385VLFIILEVVINIV.VIEKVP......YTE-------I---DWK-AYMQEVEG.VLN.GT.FD------------YSKL..
S8AK53_DACHA/26-392YALLCFDGILSYA.ILRMIP......YTE-------I---DWE-AYMEQVGQ.YRA.GE.RD------------YRNI..
D2A6B4_TRICA/38-438FLLFLFEIILNIF.IIERVN......YTE-------I---DWK-AYMQEVEG.FMN.GT.WD------------YKEL..
E9IW57_SOLIN/49-411KLFIVLEIVLNVV.VIQTVP......YTE-------I---DWR-AYMQEVEG.FLN.GT.TD------------YSKL..
N1PIB4_DOTSN/28-383......DAVLCVL.IIYTIP......YTE-------I---DWH-TYMQQIHL.YTL.GE.RD------------YAKI..
E3LRP4_CAERE/25-392AILMIIEACLSHI.VILKVK......YTE-------I---DWS-TYMQQVEC.YVNKGI.MN------------YTEI..
M0RYH3_MUSAM/65-429SALLVLDSILVAL.IIAYVP......YTK-------I---DWD-AYMTQVDG.FLG.GE.RD------------YSKL..
C8VQM2_EMENI/22-377PILNIADGLLCAF.IIWKVP......YTE-------I---DWT-TYMQQVKL.YLS.GE.RD------------YTLI..
E3QV49_COLGM/32-397PLLLVLDAVLCGL.IIWKVP......YTE-------I---DWV-AYMEQVSQ.FVS.GE.RD------------YTKI..
B2AMZ6_PODAN/32-391PALFLADAVLCAL.VIRLIP......YTE-------I---DWK-AYMEQVSQ.FVS.GE.RD------------YTKI..
Q5TWR0_ANOGA/52-490ILILAAELVLNVF.VVQNVR......YTE-------I---DWK-AYMQECEG.FLN.GT.TD------------YSQL..
M3JDA4_CANMX/610-996.VIVCLASILTKI.IISKVP......YTE-------I---DFK-TYMQQIEL.INQ.GE.IM------------YEEI..
K0KP51_WICCF/61-446PILLVVESIAVKL.IKGFIS......YTE-------I---DYT-AYMEQVTI.INS.GE.LN------------YANI..
X6LVN7_RETFI/23-432CAVVLFELTVSLA.ITKVVA......YTE-------I---DWI-AYMQEVRG.FLQ.GD.MD------------YKNL..
N1JDU5_BLUG1/30-393PVLILADALLCGL.IISHTA......YTE-------I---DWK-AYMEQVEQ.IVQ.GE.RD------------YTRI..
K5XHY8_AGABU/29-387SFVLIGDVVLTEI.IIKFIS......YTE-------I---DWE-TYMIQTEL.YIK.GQ.YN------------YSLI..
C5M8N0_CANTT/50-438.IIICIASILTKI.VINKIP......YTE-------I---DFK-TYMQQIEL.INK.GE.LM------------YDEI..
H3ATY3_LATCH/48-407AGLWLAEIGINVW.AIHRVA......YTE-------I---DWK-AYMDEVEG.VIN.GT.YD------------YTAL..
C5DQX2_ZYGRC/29-403PMLLAFESALLKL.IIWKVP......YTE-------I---DYK-AYMEQIDI.IKS.GE.TD------------YTKI..
T1KW27_TETUR/32-391ALLIIFEIFLNVY.IVQRIK......YTE-------I---DWS-TYMQQVKC.FLN.GE.LN------------YANI..
E5QCI3_CAEEL/25-392ALLMIAEAVLSHL.VILKVN......YTE-------I---DWS-TYMQQVEC.YVNKGI.LN------------YTQI..
A4S939_OSTLU/24-393VALIAFELALCAV.IIAKVA......YTE-------I---DWI-AYMEEVHG.YAR.GE.RD------------YTKL..
A4HP72_LEIBR/7-391..ALAAETVVIII.VILVVP......YTE-------I---DWR-AYMEEVEG.FLN.GE.LD------------YRNL..
K1XMH6_MARBU/34-397SLLLLTDALLTSL.IIWKVP......YTE-------I---DWS-TYMQQVEL.YIK.GE.RD------------YTKI..
B4NMK9_DROWI/51-467ILIVLAEAVINLV.VINRVP......YTE-------I---DWI-AYMQECEG.FIN.GT.TN------------YALL..
U7Q833_SPOS1/49-412.GLFALDAVLCAL.VIWKVP......YTE-------I---DWI-AYMEQIGQ.FVA.GE.RD------------YTQM..
E3JZB5_PUCGT/28-389.LVLLSELVLNTA.IIKYVR......YTE-------I---DWI-AYMQQIRS.YSL.GE.RN------------YLKL..
B6Q4R6_PENMQ/22-377PLLVLVDAVLSAL.IIKKVS......YTE-------I---DWT-TYMQQIAL.YQA.GE.RD------------YTAI..
ALG3_ASPCL/84-439PLLILGDAVLCAL.IIWRVP......YTE-------I---DWT-TYMQQVSL.YLS.GE.RD------------YTLI..
S3EFY4_GLAL2/34-397PLLLLFDALLTSA.IIYKVS......YTE-------I---DWK-AYMEQIQQ.YVD.GE.RD------------YTVI..
F1P0T5_CHICK/46-406ACLCLAEGGVNLW.VIRRVP......YTE-------I---DWQ-AYMQEVEG.FAN.GT.RD------------YARL..
G8JVY1_ERECY/53-420IVLFLFELVLVHL.IIRFIP......YTE-------I---DYL-AYMEQIWT.IKN.GE.RN------------YSKI..
J7RGJ6_KAZNA/49-415PILLLGESMALKF.ITKQIP......YTE-------I---DYE-AYMEQIDM.IVKDKN.LN------------YAEI..
F9XK44_ZYMTI/23-383.LQLLADAVLCGA.VILKIP......YTE-------I---DWS-TYMQQIEL.YLS.GQ.RD------------YAKI..
R4X949_TAPDE/11-374..LLALDAILCAL.IILRVN......YTE-------I---DWT-AYMQQVAQ.FLG.GE.RD------------YGLI..
I2FPC0_USTH4/26-382.ALAIVSAALSQV.VLRRIS......FTE-------I---DFQ-TYVGQAAL.FLQ.GE.RH------------YANLNP
ALG3_KLULA/54-427PVLILLESIAMKF.IQNKVS......YTE-------I---DYT-AYMEQIWM.IQN.GE.RD------------YSQI..
G3PQJ8_GASAC/14-373SVLWFMEIGINVW.VIQKVA......YTE-------I---DWK-AYMDEVEG.VIN.GT.YD------------YTEL..
K4CV67_SOLLC/31-394IAILIADAILVAL.IIAYVP......YTK-------I---DWD-AYMSQVTG.FLE.GE.RD------------YSNL..
M1VU16_CLAP2/32-396WALWLGDAVLCSL.IIWKIP......YTE-------I---DWT-AYMQQVAQ.FVE.GE.RD------------YTKM..
U5HGX6_USTV1/69-433GLLFVFDVALLTL.IIRFIP......YTE-------I---DFS-TYMQQSSL.FIG.GE.RQ------------YSLI..
K9G3P7_PEND2/24-384PLLILGDALLCAL.VIWKIACKIASRYTE-------I---DWS-TYMQQVSL.FIS.GE.RD------------YPLI..
T1IB96_RHOPR/32-396ILLLIGELVLSVL.IVQNVK......YTE-------I---DWV-AYMQEVEG.FLN.GT.FD------------YSQL..
B6K873_SCHJY/24-379.SVLLAEFPLVMA.IIARVP......YTE-------I---DWT-AYMEQVQL.FLS.GV.RN------------YKEL..
ALG3_DEBHA/45-438PVVIVLTSLLSKA.IIYKVP......YTE-------I---DFR-TYIQQIQI.IND.GE.LD------------YSLV..
B4KQ14_DROMO/49-491LLIVLAEAVINVL.VIQHVP......YTE-------I---DWV-AYMQECEG.FLN.GT.TN------------YALL..
E9FQN9_DAPPU/50-398ILLLVGELFVNVL.VIQRVP......YTE-------I---DWI-AYMQEVEG.VVN.GT.WD------------YSKL..
ALG3_PICST/52-442PVIILLTSIITKV.IITKVP......YTE-------I---DFV-TYMQQIQL.VNQ.GE.ID------------YAEI..
S2JIL9_MUCC1/51-411.LFLFGEFVLSTL.IILKVP......YTE-------I---DWI-AYMQEVEG.FIL.GE.RD------------YTKL..
T1FMM7_HELRO/35-390VLFFFLEIFVNVF.VIHNIK......YTE-------I---DWK-AYMQEVEG.VIN.GT.YD------------YYHL..
B7QF54_IXOSC/55-405PFLLIMEFVLNIV.VIDKVP......YTE-------I---DWK-AYMQEVEG.VLN.GT.FN------------YAEL..
V5GAA3_BYSSN/22-377PLLWVADAFLCAL.IIWKIP......YTE-------I---DWT-TYMQQVSL.FLD.GE.RD------------YALI..
D7FLD1_ECTSI/36-398...VLAEIALCGI.IIARIA......YTE-------I---DWV-AYMQEVKG.FLD.GE.RN------------YLNL..
E7K994_YEASA/48-417PLLILFESMLCKI.IIKKVA......YTE-------I---DYK-AYMEQIEM.IQLDGM.LD------------YSQV..
G8BZ82_TETPH/53-422FLLIMFESMALKI.IVSKIA......YTE-------I---DYK-AYVEQIEM.IND.GE.YD------------YSLI..
C5GLF5_AJEDR/22-377PLLLLAELFLCTV.IVWKVP......YTE-------I---DWS-TYMQQVSL.FLS.GE.RD------------YALI..
J3K1V3_COCIM/22-377PLLLLAESVLCSL.IVWKIP......YTE-------I---DWS-TYMQQVSI.FLS.GE.RD------------YTLI..
Q4E4B0_TRYCC/8-370.ALLAAEVLISLI.VVLFVP......YTE-------I---DWN-AYMQEVKG.FLE.GE.LD------------YRKL..
Q4Q1L8_LEIMA/8-391...LAAEAVVIIT.VILTVP......YTE-------I---DWK-AYMEEVEG.FLA.GE.LD------------YRNL..
J4HRL9_FIBRA/31-389ALVIFGDALLTQL.IIRFVP......YTE-------I---DWE-TYIYQLEL.YLK.GE.RD------------YALI..
G4VF09_SCHMA/25-373PVLIILEILCGFI.IIDKVP......FTE-------I---DWV-AYMQQVSG.FIN.GT.LD------------YDKL..
G0VFQ4_NAUCC/49-421PILLLLESIALKV.IVKRVA......YTE-------I---DYR-AYMEQVEM.ITDEGQ.LN------------YSFI..
ALG3_PICGU/60-451PILVVFTSIACKI.VIANVK......YTE-------I---DFK-TYMQQIDM.IND.GE.LD------------YSLI..
D6RKR7_COPC7/33-391TLVILGDAFLTRL.IVAYVP......YTE-------I---DWE-TYMVQTNV.FLK.GQ.HN------------YSMI..
C7Z6Q8_NECH7/32-396VALWLADAVLCGL.IIWKIP......YTE-------I---DWV-AYMEQVSQ.FVS.GE.RD------------YTKM..
F2U0U1_SALR5/24-375TLVFAAEIALLWA.IIHFVS......YTE-------I---DWK-AYMDEVEG.FLN.GT.HD------------YTQL..
Q59QZ3_CANAL/67-487PIIICLSSILTKI.VINKIS......YTE-------I---DFI-TYMQQIKL.INQ.GI.IK------------YSEI..
K3XI42_SETIT/33-396AFLVLADAALVAL.IIAFVP......YTK-------I---DWD-AYMSQVDT.FLE.GE.RD------------YTKI..
C1E6U6_MICSR/1-365..LLLGECVLCGL.IVWKVP......YTE-------I---DWR-AYMDEVGG.YLG.GE.RD------------YLKL..
M7UJ49_BOTF1/42-405ALILLFESFLCSA.IIYFIP......YTE-------I---DWK-AYMEQISQ.YAS.GE.RD------------YTQI..
H9GEH2_ANOCA/2-363..LCLSQLLLAFSSCIHHIQ......NTE-------I---DWK-AYMDEVEG.VVN.GT.LD------------YTQL..
F4PBM6_BATDJ/69-446.SLLVGEALLTMA.IIARVK......YTE-------I---DWQ-TYMQQVSS.FMD.GE.LD------------YKNL..
ALG3_ASHGO/46-411PVLVAWECVLLKL.IVKHVP......YTE-------I---DYL-AYMEQIWQ.INN.GE.RD------------YSKI..
ALG3_NEUCR/38-404PALFLVDALLCGL.IIWKVP......YTE-------I---DWA-AYMEQVSQ.ILS.GE.RD------------YTKV..
W5JA52_ANODA/54-487VIILAIDFVLNVL.IVQNVP......YTE-------I---DWK-AYMQECEG.FLN.GT.TD------------YSQL..
G2QLH4_THIHA/46-410PLVFLADALLCAL.IIWKVP......YTE-------I---DWN-AYMEQVAQ.ILS.GE.RD------------YTKI..
E0VE58_PEDHC/46-408CFLLLAEIFINFF.IVNYIN......YTE-------I---DWK-AYMQEVEG.FLN.GT.FD------------YSLL..
L8G9R9_PSED2/26-389PILLVVDALLCLV.IIWKVP......YTE-------I---DWE-AYMQQVAQ.FLS.GE.HD------------YVKI..
I3N142_SPETR/47-406SCLCLAEVGITFW.VIHRVA......YTE-------I---DWK-AYMAQVEG.VIN.GT.YD------------YTQL..
B0D3E3_LACBS/29-387SLVIIGDVILTEL.VIRFIP......YTE-------I---DWE-TYMIQTEL.YIN.GQ.RN------------YTLI..
G6D7P8_DANPL/38-461FLILIAELIINIL.VVERVP......YTE-------I---DWK-AYMQECEG.FLN.GT.LD------------YSKL..
A0A0D2U908_CAPO3/41-396GLLLLAEIAINAL.IIWRVP......YTE-------I---DWK-AYMDEVKG.AID.GE.RD------------YTLL..
B4MDV8_DROVI/49-475VLIVLAEAVINVL.VIQRVP......YTE-------I---DWQ-AYMQECEG.FLN.GT.TN------------YSLL..
S9XFL7_SCHCR/33-388.RILWLEIPFVIL.IISNVP......YTE-------I---DWI-AYMEQISG.FLS.GE.RD------------YRML..
G3AUB5_SPAPN/46-435.IIVSLSSVVVKL.IIANVN......YTE-------I---DFS-TYMQQIRL.VNE.GE.IV------------YEEI..
R9P1A8_PSEHS/26-382.TLVISSAVLSET.IIRRIS......FTE-------I---DFQ-TYLGQAAL.FLD.GQ.RD------------YTKLDP
T5AE24_OPHSC/31-395PALWLVDAALCCL.VIWKVQ......YTE-------I---DWV-AYMEQVAQ.FVS.GQ.RD------------YAKM..
V5ENX1_PSEBG/26-382.ALTISTLALSQA.VIRRIS......FTE-------I---DFQ-TYIAQAAL.FLD.GE.RD------------YAKIDP
G0RBH9_HYPJQ/25-389.GLWLADAVLCGL.IIWKVP......YTE-------I---DWV-AYMEQVTQ.FVH.GE.RD------------YPKM..
A7TI38_VANPO/47-414PLLLMLESAALKL.IIAKVQ......YTE-------I---DYT-AYMEQIDM.IKN.GE.LD------------YSEI..
S7ZPA3_PENO1/24-378SLLFLGDAALCAL.VIWKIA......YTE-------I---DWT-TYMQQISI.YLA.GE.RD------------YTAI..
I4Y5F8_WALSC/28-386..VIALESILTPL.IVKYVP......YTE-------I---DWK-AYMQQVKM.FRE.GSITH------------YDQI..
M9LSR1_PSEA3/61-417.ALAIASAVLSQA.VVRRIS......FTE-------I---DFQ-TYIAQASL.FLK.GE.RT------------YTNIDP
G3J6N9_CORMM/40-406VALWLADAVLTCL.IIWKIP......YTE-------I---DWV-AYMEQITQ.FVH.GE.RD------------YTKI..
G0SZN6_RHOG2/81-458TAVLLWESVLSVG.VVNYIK......YTE-------I---DFS-TYMQQAQA.FLD.GE.RD------------YSMM..
E3RP57_PYRTT/27-387PLLLIADAALCGV.VIEKIP......YTE-------I---DWS-TYMQQIAI.FLK.GE.RD------------YAKI..
H2YCK3_CIOSA/39-392.LMWSVEVVLNLY.VINRVK......FTE-------I---DWK-AYMQEVEG.FIN.GT.HD------------YMQL..
ALG3_PICPG/40-432PLLWLADSIVIKV.IIGTVS......YTD-------I---DFS-SYMQQIFK.IRQ.GE.LD------------YSNI..
I1NB48_SOYBN/44-418LALLFADAVLVSL.IIAFVP......YTK-------I---DWD-AYMSQITG.FLG.GE.RD------------YRNL..
V2XSY5_MONRO/23-381LLVVVGDAILTEG.IVKFVP......YTE-------I---DWE-TYIIQVQQ.FLK.GE.RD------------YSKM..
S3D164_OPHP1/66-445PALLILDAVLCVY.ILSQVP......YTE-------I---DWV-AYMEQVAQ.FVG.GE.RD------------YTQI..
D8PWW0_SCHCM/28-385FLALLGDAVLTQL.IIRFVP......YTE-------I---DWD-TYMRQVKI.YIE.GE.RD------------YTKI..
G4MX55_MAGO7/32-396PMLLAFDGLLCGL.IIKKVP......YTE-------I---DWT-TYMQQIKQ.YVT.GE.RD------------YTKI..
ALG3_CANGA/46-411PLMFLLESVLLKY.VIAAIP......YTE-------I---DYK-AYMEQVEM.IYEEGN.YN------------YLEI..
U9SRB0_RHIID/43-401SCILIGEALLNIL.IIKYVS......YTE-------I---DWK-AYMQEVSG.FLN.GE.RD------------YIKL..
A9S9E9_PHYPA/15-380..LLVLDALLTAV.IIARVP......YTK-------I---DWD-AYMSQVTG.FLA.GE.RN------------YAEL..
A0A0D1DTA4_USTMA/26-382.ALTIVSAVLSEA.VIRRVS......FTE-------I---DFQ-TYLGQAAL.YLD.GE.RD------------YSNLDP
R9A916_WALI9/668-1026..VIALEVLLTHF.IIQFVP......YTE-------I---DWK-AYMQQAKM.FKE.GKITQ------------YDQI..
A8WH14_XENTR/49-408VFLCLAEVGVTHW.VIQRVP......YTE-------I---DWK-AYMDEVEG.VLN.GT.YD------------YTQL..
F0X8A8_GROCL/32-398VALLALDAVLCCL.IIWKIP......YTE-------I---DWV-AYMEQVGQ.FVA.GE.RD------------YTQM..
G0WBV5_NAUDC/62-452PILLLIESIVLKY.IIFKIP......YTE-------I---DYK-AYMEQIEM.ITYDNE.LD------------YSKI..
E4ZQ47_LEPMJ/110-470PLLLVADAALCGV.IIDRIP......YTE-------I---DWS-TYMQQIAV.YLK.GE.RD------------YAKI..
W1QI94_OGAPD/44-429VLLTVAESLLLKA.VIHFVP......YTE-------I---DYS-TYMQQIDQ.IEA.GE.LD------------YAKI..
Q17I48_AEDAE/60-492WLILAAELVLNVF.VVRKVP......YTE-------I---DWK-AYMQECEG.FLN.GT.TN------------YAEL..
J9JKC3_ACYPI/34-397.IVIAIEFVLNLY.IIQKVR......YTE-------I---DWK-AYMQEVEGVVVN.GT.FD------------YGKL..
ALG3_ARATH/37-401FALILADAILVAL.IIAYVP......YTK-------I---DWD-AYMSQVSG.FLG.GE.RD------------YGNL..
F4QBL4_DICFS/50-404LILFLGEIALNYL.IVTKRA......YTN-------I---DWE-AYMEQIDL.FVN.GE.RN------------YMKL..
E2BFG0_HARSA/50-411.SFVLLEVVLNIL.IIKNVS......YTE-------I---DWK-AYMQEVEG.FIN.GT.HD------------YSKL..
K2RJR1_MACPH/22-381PLLLVADAALCGL.IIWKVP......YTE-------I---DWK-AYMEQVAQ.YLA.GE.RD------------YTRI..
A0A0C4DNJ3_MAGP6/32-396PALLALDVVLCAL.IILKVP......YTE-------I---DWE-AYMEQISQ.YVS.GE.RD------------YTKI..
K5UZ89_PHACS/35-392VLVVLGDTVLTQL.IIRFVP......YTE-------I---DWE-TYMYQLEL.YLK.GE.RD------------YALI..
B7FU52_PHATC/1-358..LLIMELGLNVV.VIRKVA......YTE-------I---DWE-AYMQEVEF.WLD.GE.LD------------YRKI..
E1FRZ8_LOALO/22-398IFLWTFDAILCTL.VVRTVP......YTE-------I---DWS-TYIQQVNC.YEQ.GI.RN------------YSKI..
G8YQ30_PICSO/46-439PIIIALTSIITKI.IISKVN......YTE-------I---DFK-TYMQQIEL.VND.GE.LD------------YSLI..
I2H2F8_TETBL/47-416PVLLLFESIFLKL.IIKNIP......YTE-------I---DYE-AYMEQIAM.IEIDHN.LN------------YLEI..
Q38AV3_TRYB2/9-364..VLTVELCMSII.AFHLVH......FTG-------I---DWN-AYMQEVKG.FLD.GE.LD------------YMKL..
R0IS40_SETT2/23-383PLLLVADAALSGV.IIEKIP......YTE-------I---DWS-TYMEQISI.YLK.GQ.RD------------YKLI..
B8C606_THAPS/2-402..LIVVEVILTTL.IVIRVP......YTE-------I---DWV-AYMQEVTT.YQN.GE.RD------------YANI..
NT56_DROME/50-470LFVLLAELVINVV.VIQRVP......YTE-------I---DWV-AYMQECEG.FLN.GT.TN------------YSLL..
F1QAD8_DANRE/41-400AVLWFLEIAINIW.VIQKVS......YTE-------I---DWK-AYMDEVEG.VIN.GT.YD------------YTQL..
E2AE79_CAMFO/50-412TLFILAEIVVNIL.IIEKVS......YTE-------I---DWR-AYMQEVAG.FLN.GT.MD------------YSKL..
M2RJ12_CERS8/31-389ALVIIGDVLLTQA.IVHLVP......YTE-------I---DWE-TYMYQTEL.YLE.GE.RD------------YALI..
M7NVY2_PNEMU/31-392LSLLFLDAFFCLV.ILLKIP......YTE-------I---DWN-TYMSQVSI.YLS.GE.RN------------YVNI..
K1PJL2_CRAGI/29-393FVLLIAELVVNIL.VIKKIK......YTE-------I---DWT-AYMQEVEG.VVN.GT.YD------------YTQL..
K3WI15_PYTUL/49-402LALLLADAVLGYL.IIQYIP......YTE-------I---DWK-AYMQQVEM.FKA.GE.RD------------YIKI..
G3YDP3_ASPNA/22-377PLLVLGDAFLCAL.IIWKVP......YTE-------I---DWA-TYMQQISL.YLS.GE.RD------------YTLI..
G8ZRL4_TORDC/46-409PLLLVVESLALKI.ITAKVP......YTE-------I---DYK-AYMEQIEM.ITMDGE.LD------------YSQI..
B4J870_DROGR/49-472VLIVLAEALINVF.VIRRVP......YTE-------I---DWV-AYMQECEG.FLN.GT.TN------------YALL..
F9FME8_FUSOF/32-396IALWLVDALGCGL.IIWKIP......YTE-------I---DWV-AYMQQISQ.FVS.GE.RD------------YTKM..
A7RPJ4_NEMVE/13-362LLLLLAEVVVNIA.VIWKIK......YTE-------I---DWE-AYMSEVEG.FLN.GT.YD------------YTKL..
G4TDK5_PIRID/21-386VLILAGDALLTLL.IIHFVA......YTE-------I---DFE-TYIVQADK.VQQ.GQ.RD------------YSLI..
S8FYD7_FOMPI/36-394ALVLVGDALLTQL.IIRFVP......YTE-------I---DWE-TYIYQLEL.YLK.GE.RD------------YSLI..
M2MJW6_BAUCO/22-383PLLLLADTALCGV.VVWKIP......YTE-------I---DWK-AYMQQVSQ.YVS.GE.RD------------YVKL..
F2PUQ0_TRIEC/23-378PLLLTFDACLCAA.IILKVP......YTE-------I---DWS-TYMQHIHL.FLS.GE.RD------------YTAI..
ALG3_CRYNJ/40-416FLLFLGEVALSLL.VIWKIP......YTK-------I---DWP-AYMQQVDM.FLA.GE.RD------------YSKI..
B9I9T5_POPTR/29-388LALIFMDALLVAL.IIAYVP......YTK-------I---DWD-AYMSQVTG.FLG.GE.RD------------YTNL..
E6ZW66_SPORE/26-382.ALAIASAVLSEA.VIRRIS......FTE-------I---DFQ-TYVAQAAL.FLN.GE.RD------------YTNIDP
C4YB28_CLAL4/53-446PIVVSVASILCKI.VISKVN......YTE-------I---DFS-TYMQQIEL.VNA.GA.LD------------YSLI..
U4KZB6_PYROM/25-385.PLLLADALLSTA.VVLKVP......YTE-------I---DWK-AYMEQVTQ.YLG.GE.RN------------YALI..
G7DY72_MIXOS/36-395TLLLLGELILSIF.IVRYVK......YTE-------I---DWS-TYMQQVAL.YQS.GE.KD------------YALL..
C5DE51_LACTC/56-423PLVVVIEFLALEW.IVAHVE......YTE-------I---DYK-AYMEQIWA.IQA.GE.TD------------YSAI..

PF14897

D0MGT8_RHOM4/10-327-KVIAGGVILLLS-LIAIFR------G.S-------VGT.DTA.TYERLVTR.IDTW..-..------------....--
A6L8S3_PARD8/36-371-VRLICIVFFVLF-YGLRGF------V.G-------W...DWQ.GYYPSFEL.IDTLRD-I.------------..SI--
F0R6C6_BACSH/27-352-LYFIVIVALILF-AGLRYK------V.G-------M...DYN.MYNENFTN.LK....-..------------...G--
C6W3U8_DYAFD/27-360-KAIYITMCIIFV-MISGLR------W.N-------TGN.DWK.PYYSFFTR.......-..------------...F--
C6WZX9_FLAB3/31-373-RVFVWVAAILII-IAVGLR------L.E-------VGA.DYP.VYRMLFSG.FAIYTT-YG------------.DVL--
F0NZQ8_WEEVC/30-359-YYQLTLAVMMLT-AGLGYN------L.S-------P...DWL.AYYNAFYA.SGELLY-..------------...L--
Q5L9T0_BACFN/34-354-YFSVVIVGILLS-ITAGFR------NVG-------GVDTDYA.IYKNHYNG.ELGSYS-Y.------------....--
Q6AIA7_DESPS/40-375-IWYMITLFYTLT-IGTREN------V.G-------I...DYL.SYKYHFLL.VESSNN-F.------------....--
D2QJN3_SPILD/45-378-NLIGLIILYSFV-VGCRYY------V.G-------I...DYK.VYVEIFLE.LKETGI-V.------------..P.--
D6D462_9BACE/28-360-RKIVWLWVCILT-VFWGIR------W.N-------CGT.DWD.NFYDVFQG.SD....-..------------...L--
E3HB27_ILYPC/34-350-LKFFNFLILILL-FGFTHE------M.G-------T...DNT.LYERHYYS.ANYQ..-..------------....--
C7PMN8_CHIPD/32-372-LYSVAFIILTCF-AGLRYH------T.G-------A...DWP.NYELHYDT.ILPRID-KF------------.FEF--
Q5L965_BACFN/30-358-LLFFLSFILILF-VGTRFE------T.G-------D...DWG.EYTKVFDK.IPLVSD-LW------------..ND--
Q1WTE3_LACS1/26-359-NFMLCILFMFIA-LHNPYL------T.G-------T...DGR.SYRAYFKT.HIPTLS-HF------------.SEY--
A0KM85_AERHH/26-353-VLLPPFIIYFLI-SALQYN------V.G-------S...DYF.SYLYIYEN.QWVLGR-Y.------------..F.--
A9NH20_ACHLI/15-352-NLLLVILILILG-VGVTNN------F..-------....DYE.AYSMSY.........-..------------...S--
A6GZ52_FLAPJ/21-343-KTLFVLFFLSMW-GLFGWN------YSN-------A...DFH.MYKGMYSV.PLSEMI-F.------------....--
B2GF40_LACF3/21-364-RIVGFLGMGVLA-YLSGAA------N.P-------LTTLDYP.VYLQHYQL.LGWET.-..------------....--
Q03WA2_LEUMM/21-358-KWIGLISILLSV-LFIAYI------PID-------T.VQDTR.IYYSSYYS.DS....-..------------....--
A6TBF0_KLEP7/23-340-NSLFLITGGFYV-LNFGFG------Y..-------....DWM.NYYDSYLN.INTPGY-D.------------..F.--
A5G608_GEOUR/41-362-IICIVVFGTILI-ATAGLQ------LFG-------PSA.DYY.AYQEMVID.KTNVKL-..------------....--
C6X1R8_FLAB3/21-351-KLLSVVLIVVLA-LFAGSR------Y.Y-------IDS.DYS.LYYNYFIY.TEKSAV-DF------------.MNR--
E0SFU5_DICD3/23-330-IIFYMILIPGFT-FLVGDK------NIN-------RWV.DHQ.TYENYFFL.AT....-..------------...Y--
Q6FFU5_ACIAD/13-316-FSYYFIFIPILI-FLVGLK------DNS-------IWL.DYY.VYVDYFNQ.ASASSF-NE------------.IIF--
E4TIN4_CALNY/56-394-DYIDYILVIFIS-FFAGLK------R.P-------FSC.DLI.GYKWMFEN.......-..------------...Y--
Q8A831_BACTN/29-353-LILYLFVIVLLS-LLAGLR------YDN-------A...DYE.NYLEIFKN.PWE...-..------------....--
C7M7Z9_CAPOD/10-347-TIVFLLVSLLVA-FIVGNR------G..-------.DTRDTI.VYYSVFKY.IDV...-..------------...F--
Q8A715_BACTN/26-366-LVLLRCVILFIA-CMVGFR------Y.N-------IGA.DWE.TYVIIYNR.Q.....-..------------...I--
C7RFF5_ANAPD/29-361-NILAGLMFFIMF-VFAGVR------..G-------SGDADYY.NYLWFVKD.LGVD..-..------------...Y--
Q5LH99_BACFN/15-335-IKIVFIIWLYIF-LCFGYM------T.G-------S...DWR.AYELQYQS.AD....-..------------...Y--
D3SAJ3_THISK/38-360-LFLGMVASAPLV-LLLAFR------T.D-------VGT.DYD.AYVRIYNA.......-..------------...F--
C6X0C5_FLAB3/28-350-NLPALLAVGILI-AFAGLR------NVN-------VGT.DTG.NYVGIYYG.......-..------------...Y--
C4ZJE6_THASP/44-373-SLVWPIQTLVLT-IVIGLR------F.E-------VGT.DWY.GYVSIYES.LY....-..------------...Y--
D6E918_9ACTN/24-356-KVCVTLIGIQLF-LLLALR------AES-------YGP.DAE.IYAAGYRY.ISSLTF-SQ------------..ML--
F0SY68_SYNGF/34-364-KLFVFLAFLVVA-LPSAFR------Y.E-------VGL.DYT.TYTTIYDI.IVG...-..------------...A--
A6L9H3_PARD8/32-354-YFYRTIVFLSIV-IPASIR------K.G-------IGT.DYW.AYVGLYDW.YRTNS.-..------------....--
A1A378_BIFAA/27-350-VLPFAIVFLILF-TISGFR------Y.G-------VGT.DYFFTYVPTYKQ.IYNGTP-..------------....--
E0RX92_BUTPB/42-359-HVTCLIIFVLLF-AVSSLR------L.N-------VGN.DYL.NYVELMHL.AYSRAY-..------------....--
D5DBJ5_BACMD/39-371-NITLFLWSIVLL-VLAVFK------GVT-------VGT.DYP.MYYNFFV........-..------------...Y--
Q8XN60_CLOPE/30-345-LYFSIFAILILA-LIAGLR------W..-------.GIGDTP.AYVHLYSL.IEPGYD-P.------------..K.--
C4L730_EXISA/28-346-AWFVSFATIQWI-VLSGFR------DVT-------VGA.DTA.QYKALFLQ.SQTLPL-GA------------.FTD--
C7M4A6_CAPOD/29-353-KYLLLSTYLLSV-FLVGLR------W.R-------TGT.DWE.PYKEVFEN.ISEYLH-KA------------.MYE--
Q39W09_GEOMG/33-369-FILFSASTFFMS-AIIAFR------W.E-------IGT.DWN.SYYEYFVG.IKNGSG-S.------------..SY--
E4RNL6_HALHG/27-346-KILLFISYLFLW-FFAAFR------Y.D-------VGS.DYF.SYIRMYNK.IGSRGI-SW------------.ALS--
C4Z668_EUBE2/44-362-IIYFVLIFIPMW-VLIAFR------NIS-------VGT.DTGITYYRIFQH.SLNGS.-..------------...Y--
E0S0Y2_BUTPB/32-367-VNSCLLPCAFLC-VIAGFR------ALD-------VGK.DNY.SYTRYFLG.MTINKV-YF------------.FDF--
D2RIR8_ACIFV/29-352-FLLALAFLGSTF-FLSAFR------AET-------VGN.DTI.RYVDFFRS.FFYVDD-PW------------.EIV--
D5EVG6_PRER2/7-324-ERWFNVSYFLMT-VMATFR------YGQ-------M..DDYF.NYYINYEH.PEIY..-..------------....--
A6QAG6_SULNB/27-344-LLVWIPTWIVYT-LYIGLR------H.E-------VGS.DWF.NYLAMFNRDVPSMNY-MD------------.AL.--
Q0A657_ALKEH/27-342-LAAWCLIGLFFA-LAIGLR------H.E-------VGG.DWG.SYLAYLKR.AGEMSL-QE------------.VL.--
Q8DJL9_THEEB/21-349-RWYGFFLFFTYV-LFIGLR------F.E-------VGA.DWE.SYIYILEA.AKSQSW-FA------------.LEG--
A7HKI9_FERNB/29-353-KLIKTVIFVFLL-LFIGLR------H.E-------VGG.DWD.TYLWWYKD.IAVNGI-DF------------..SF--
E3I7S4_RHOVT/25-342-RALFPIVALFLF-AFVAFR------Y.E-------VGC.DWS.GYRTNYDL.AQYLTV-EE------------.AV.--
Q5QWV6_IDILO/29-338-VALIGCVILALL-FIYGFR------F.E-------VGV.DWF.NYIRVYER.DVANAL-T.------------..F.--
Q1QWW7_CHRSD/27-347-SVLFYCAVSFLF-YMASFL------RWD-------VGT.DWD.GYYRFYGK.LDN...-..------------...F--
A6LBP7_PARD8/27-381-WTHYRIAVTLLI-LVAGLR------W.R-------VGS.DTV.SYASDFYF.SHDLFH-LE------------..W.--
E6UEJ4_RUMA7/36-384-VFFSVIALFIPS-LLAGVR------ADT-------VGK.DVL.EYAVRTFD.LANSST-SY------------.SYM--
E4RXS3_LEAB4/31-353-GIFGFILFFSLL-GGLRDT------SIG-------I...DLR.VYGVEYFY.YALFSN-SF------------.SDL--
C4K321_HAMD5/34-350-IFVSLLLIIIYV-TLFGLR------DYS-------IGS.DTR.DYVENFLY.NN....-..------------....--
C8WKZ6_EGGLE/32-357-MVFRTVVVLSPA-VLIGLR------GLN-------V...GYD.TEAMTYLL.FSGPFS-LD------------.YLL--
A6L4H4_BACV8/26-363-...LLLSCLILS-LFAGFR------DKN-------IGS.DTD.FYPHWYIS.EIRYIH-N.------------..LI--
D9S910_FIBSS/29-351-.ITFAILLIFLV-CQEGFR------W.Q-------IGT.DWL.PYYRMFEY.NLS...-..------------....--
F5WT29_ERYRF/24-344-...FYLATVPLF-IIVIFR------V.G-------VGT.DYF.SYEYLYNL.QNVTTF-GK------------..ML--
G8PTM7_PSEUV/31-346-..VLASFAIALS-AFIGFR------F.E-------VGK.DWI.QYNYIFKL.ITELPF-VE------------..AM--
Q1G8I7_LACDA/49-398-...VSLSALPIL-LISCFR------Y.G-------VGT.DYFHTYVPQFLS.IVNGSY-T.------------....--
R5KIX9_9CLOT/31-383-...LIVTFGVLI-LVASLR------DPS-------VGT.DLAGHYAKRFNM.IGDYSW-SQ------------IPTF--
R7EM48_9BACE/29-344-.VTAFVWVLLMT-LFVGSQ------D.G-------IGT.DHS.NYIAQIES.PWV...-..------------....--

PF03155

L8G8K2_PSED2/15-492-ATAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPVQEW......YYE...NTSE--
Q5TNL1_ANOGA/16-506-GLFLRAAISL.H-SYSGQNQ.....PPK.......Y..GDYE-AQRHWQEV-TVNLPVSDW..YRNTTDN...DPLY--
D8UDK3_VOLCA/12-511-ATACKLLL....-............VPT.......YRSTDFE-VHRNWLAI-THNLPISKW......YVE...ATSE--
Q29NI9_DROPS/12-462-AVSLRSIVSL.Y-SFSGFDS.....PPM.......Y..GDYE-AQRHWQEV-TINLEPGQW..YTNSSDN...DLQY--
T1K7S4_TETUR/16-504-VTCLKFLL....-............MPS.......YYSTDFE-VHRNWLAI-TNNKPISQW......YTE...STSQ--
G2RBR7_THITE/15-492-AAALKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPLWEW......YYE...KTSE--
M7PD45_PNEMU/13-491-SIFIKILL....-............FPA.......YRSTDFE-VHRNWMAL-TYSLPLSKW......YYE...NTSQ--
D3BMH9_POLPA/36-529-CTALKLLL....-............IPT.......YTSTDFE-VHRNWLAI-TSSLPVSKW......YIE...ATSI--
A5DZN5_LODEL/28-537-TLALKLLL....-............MVG.......YHSTDFD-VHRNWLAV-THNLPLSQW......YTE...NTSQ--
F6ZU35_CIOIN/22-490-SILLRLCVSL.G-PYSGKGK.....SPM.......Y..GDYE-AQRHWQEI-TFNLPIQDW..YTNSSLN...DLQY--
S9W0G5_SCHCR/14-492-STFMKILL....-............FPC.......YRSTDFE-VHRNWLAI-THSLPISQW......YTS...AISE--
K1XC57_MARBU/15-492-ATAFKLLL....-............LPA.......YKSTDFE-VHRNWLAI-TNSLPVREW......YFE...KTSE--
G0W812_NAUDC/80-564-AIIIRCAVGL.G-PYSGFNT.....PPM.......F..GDFE-AQRHWMEI-TQYLPISQW..YWF.......DLQY--
C1E537_MICSR/36-567-VTALKVLL....-............VPC.......YRSTDFE-VHRNWLAV-THSLPPARW......YTE...NTSQ--
D7TT36_VITVI/40-494-AFLVRVAVSF.H-PYSGAGN.....PPK.......Y..GDYE-AQRHWMEI-TLNLPAKEW..YRNSTTN...DLNY--
E9GMP9_DAPPU/11-491-..FGKLLF....-............IPS.......YRSTDFE-VHRNWLAV-THSLPLNKW......YVD...DTSQ--
F2UCB2_SALR5/15-489-GVCLRALVGL.G-GHSGFGN.....PPM.......H..GDFE-AQRHWMEI-TYHTPVKEW..YFNTTNN...DLQY--
H2Z9N9_CIOSA/19-515-VTVFKLLL....-............VPA.......YTSTDFE-VHRNWLAI-THSLPYKDW......YFE...STSE--
G3NV34_GASAC/14-486-ALVVRWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNLPLQEW..YFNTTEN...DLMY--
G8BYL8_TETPH/49-563-SLFLKLLL....-............IPG.......YYSTDFD-VHRNWLAI-TSNLPISKW......YYE...NTSE--
I7LWJ3_TETTS/163-672-ASFIRILAGI.G-PYSGYKD.....APT.......Y..GDYE-AQRHWMEL-TLHTPPSQW..YVETLNN...DLTY--
A3LPA6_PICST/60-509-AILLRAAIGL.G-GYSGKAT.....PPM.......F..GDFE-AQRHWMEL-TIHLPISQW..YWF.......DLQY--
J7SB75_KAZNA/38-553-SLFLKLLL....-............VPD.......YYSTDFD-VHRNWLAI-TNALPLREW......YYE...KTSQ--
M4BE27_HYAAE/29-565-SVCIKLLL....-............LPS.......YTSTDFE-VHRNWLSL-THTLPRRLW......YVD...HTSP--
A0A087ZQU5_APIME/41-513-VTCFKVLL....-............IPV.......YRSTDFE-VHRNWLAI-THSLPLKEW......YVN...ANSQ--
G7YSM9_CLOSI/17-476-GFALRSSVLL.H-PHSGQAK.....PPM.......Y..GDYE-AQRHWMEV-TTNLPVREW..YFNTTDN...DLNY--
F4X5Y5_ACREC/45-518-ITCIKILL....-............IPT.......YRSTDFE-VHRNWLAI-TYSLPVAEW......YVN...AQSP--
J9K2E7_ACYPI/9-490-ITCVKLLL....-............LPS.......YFSTDFE-VHRNWLAT-TYSLPISQW......YSA...NHSE--
R7YRL9_CONA1/15-485-AAALKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSLPVKQW......YYE...KTSE--
ALG8_YEAST/51-565-TLFLKLLL....-............IPD.......YFSTDFD-VHRNWLAI-TNKLPISEW......YYE...HTSQ--
E2BLU2_HARSA/14-512-AILLRCCVTF.H-PHSGEGK.....PPM.......Y..GDYE-AQRHWQEI-ALNLPVNQW..YINTTDN...DLQY--
C0NWB8_AJECG/15-495-ATAFKVTL....-............FPA.......YKSTDFE-VHRNWLAI-THSLPVDKW......YYE...KTSE--
I3IT66_DANRE/14-487-GLTSRWAVSF.H-SYSGAGK.....PPM.......F..GDYE-AQRHWQEL-TYNLPVHEW..YFNTTNN...DLNY--
G3BFJ8_CANTC/32-544-SVFLKLLL....-............SIG.......YHSTDFE-VHRNWLAI-TYNLPINKW......YIE...KTSQ--
ALG8_CAEEL/14-494-LISFKCLL....-............IPA.......YVSTDFE-VHRNWMAV-TWQRPLCEW......YTE...ATSE--
W5GB91_WHEAT/20-508-ATCVKLLL....-............VPT.......YRSTDFD-VHRYWLAL-THTLPARQW......YTD...ASSQ--
H2SHL1_TAKRU/16-505-.SFLKCLL....-............INA.......YLSTDFE-VHRNWLAV-THSLPMSRW......YHE...NTSE--
F1A4M3_DICPU/24-508-SLLARYLVSL.N-SYSGQGK.....PPM.......F..GDYE-AQRHWMEI-TTKLDVHEW..YFNTTDN...NLLY--
M3BZ39_SPHMS/15-495-ATALKVLL....-............WPA.......YKSTDFE-VHRNWLAI-TNTLPLREW......YFE...HTSE--
B5RU50_DEBHA/74-567-AIILRSAVGL.G-SFSGQGE.....KPI.......N..GDFE-AQRHWMEL-TIHLPINKW..YFY.......EPLY--
R1GPQ5_BOTPV/17-493-ATALKLLL....-............LPA.......YKSTDFE-VHRNWLAL-THSLPVPEW......YYE...KTSE--
ALG6_SCHPO/35-484-LVFMQWLISI.G-PYSGYNT.....PPM.......Y..GDFE-AQRHWMEL-TLHTPVSQW..YFR.......DLQW--
B3S4W0_TRIAD/22-470-ALLIRWCISL.N-PYSGKGK.....PPM.......Y..GDYE-AQRHWMEL-TTNLPVKQW..YFESPNN...NLSY--
B0CY11_LACBS/39-528-STALKLLL....-............FPS.......YRSTDFE-VHRNWLAI-THTLPISKW......YFD...TTSE--
M3K587_CANMX/31-541-SLALKILL....-............FIG.......YHSTDFD-VHRNWLAI-TNKLPISKW......YIE...DTSQ--
N4VMS5_COLOR/17-495-..ALKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPLSQW......YYE...KTSE--
I1LX18_SOYBN/37-486-ALLVRVAVSL.H-PYSGAGN.....PPK.......F..GDYE-AQRHWMEI-TINLPIKEW..YRNSSNN...DLRY--
M9PB91_DROME/12-464-GLAVRSIISL.Y-SYSGFDS.....PPM.......H..GDYE-AQRHWQEI-TVNLAVGEW..YTNSSNN...DLQY--
ALG8_SCHPO/14-492-STFVKVFL....-............FPS.......YRSTDFE-VHRNWLAI-THSLPISEW......YKS...SISE--
ALG8_ASHGO/44-558-STALKLLL....-............MPG.......YYSTDFE-VHRNWLAV-THRLPLREW......YVD...ATSQ--
H2M3G8_ORYLA/14-482-GVVVRWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNLPIREW..YFNSTNN...DLAY--
A0A068XBV5_HYMMI/13-510-AVAFKSLL....-............FSA.......YHSTDFE-VHRNWLSI-TYSTEFSQW......YTE...ATSI--
D7MJY5_ARALL/49-511-ALLIRSAVSM.Y-PYSGAGI.....PPK.......F..GDFE-AQRHWMEI-TTNLPVIDW..YRNGTYN...DLTY--
M7UBV6_BOTF1/15-495-ATAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPLNEW......YIE...KTSE--
B8C862_THAPS/6-526-..SVKYLL....-............IPS.......YFSTDFD-VHRNWLAI-THHLPLNQW......YFDDVDGGTV--
D5G5Y1_TUBMM/57-510-SILFRWAVGL.G-PYSGMAA.....PPM.......H..GDFE-AQRHWMEV-TTNLPAKEW..YWH.......DLEW--
B6JZC1_SCHJY/14-495-SAFVKILL....-............FPC.......YRSTDFE-VHRNWLAI-THSLPLKEW......YTS...HISE--
B4JPP0_DROGR/12-469-ALSLRAIISM.N-SFSGYNK.....APM.......F..GDYE-AQRHWQEV-TVNLPAKQW..YTNGTRN...DLQY--
A8Q5F5_BRUMA/20-473-AFTLQIALSL.G-SYSGHAT.....PPM.......Y..GDYE-AQRHWMEI-TYHLPINQW..YVNGSDN...DLNY--
G8ZP39_TORDC/40-554-SLALKLLL....-............MPD.......YFSTDFD-VHRNWLAI-TNELPLKEW......YYE...KTSQ--
G8BGI3_CANPC/69-539-SIILRTAVGL.G-GHSGYKN.....PPM.......Y..GDFE-AQRHWMEL-TIHLPTSDW..YFF.......DLQY--
ALG6_HUMAN/14-488-GLTVRWTVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEI-TFNLPVKQW..YFNSSDN...NLQY--
B6Q2U6_PENMQ/15-493-AAAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPVQEW......YYE...KTSE--
ALG6_CHICK/14-488-ALTVRWTVSL.G-SYSGAGK.....PPM.......Y..GDYE-AQRHWQEV-TYNLPIRQW..YFNTSDN...NLLY--
C3XSJ3_BRAFL/15-487-AVFVRWAVSL.N-SYSGMGK.....PPM.......Y..GDYE-AQRHWMEI-TTSLPLKQW..YFNSTDN...DLLY--
I1KRW2_SOYBN/28-527-ATCIKVLL....-............FPS.......YRSTDFE-VHRNWLAL-THSLPLSQW......YFD...ETSP--
A0A068XHI1_HYMMI/18-474-GLVLRSATLL.H-PYSGKAS.....PPM.......Y..GDYE-AQRHWMEV-TVNLDFSDW..YVNTSSN...DLLY--
C5DTD9_ZYGRC/51-531-AVIIRCAIGL.G-PYSGQSV.....KPM.......H..GDFE-AQRHWLEI-TQHLPISQW..YYF.......DLEY--
I2GX66_TETBL/28-529-ALMLKLLL....-............IPD.......YFSTDFD-VHRNWLAI-TNKLPLREW......YYE...NTSQ--
A7S144_NEMVE/15-467-AIVQRWSVSL.G-PYSGAGK.....KPM.......F..GDYE-AQRHWQEI-TYNLPINQWYVYFNSLDN...NLLY--
A8NHE2_BRUMA/37-513-.FTIKFLL....-............VPC.......YHSTDFE-VHRNWMAI-THTLPICSW......YYE...SRSQ--
Q6C8U0_YARLI/72-529-ALIIRAAVAL.G-PYSGFQQ.....PPM.......H..GDFE-AQRHWMEI-TTALPISKW..YFY.......DLQW--
A7RNB8_NEMVE/17-518-.SFFKLLF....-............LRT.......YHSTDFE-VHRNWLAI-THSLPLNKW......YYE...STSE--
U7Q3L8_SPOS1/16-494-AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPLWDW......YYE...HTSE--
A8WP54_CAEBR/14-530-LIAFKCLL....-............IPS.......YTSTDFE-VHRNWMAV-TWNRPLKAW......YTE...STSE--
F6PL55_ORNAN/15-493-GLTVRWTVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEI-TFNLPIKQW..YFNTSDN...NLQY--
F1NPY2_CHICK/24-512-.SFLKCLL....-............IPT.......YHSTDFE-VHRNWLAI-THNLPLSQW......YYE...ATSE--
C5M3Q6_CANTT/80-532-AVILRTAVGL.G-GHSGYHV.....PPM.......F..GDFE-AQRHWMEL-TINLPISQW..YFF.......DLQY--
G9NL14_HYPAI/15-495-AAAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPLSQW......YYE...NTSE--
C5DJM6_LACTC/29-543-STALKLLL....-............IPA.......YVSTDFD-VHRNWLAI-TNKLPLHKW......YYE...STSQ--
M2TGW6_COCH5/15-493-ATALKVLL....-............FPA.......YKSTDFE-VHRNWLAL-THSLPIKEW......YYE...KTSE--
A0A068XUS9_ECHMU/14-510-..AFKSLL....-............FGA.......YHSTDFE-VHRNWLAI-TYCTNISEW......YSE...ATSK--
N1PRH1_DOTSN/15-493-AAALKVLL....-............WPA.......YRSTDFE-VHRNWLAI-TNSLPLEKW......YYE...ATSE--
W5KCM7_ASTMX/22-513-.SFIKCLL....-............INA.......YHSTDFE-VHRNWLAV-THSLPVSQW......YYE...STSE--
A8XHZ8_CAEBR/37-475-LICFQIAISL.N-PHSGESQ.....PPM.......Y..GDYE-AQRHWMEI-TFNLPIEHW..YVNGSHN...DLLY--
W5KTC4_ASTMX/14-487-GLTTRWAVSF.S-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNLPVQEW..YFNTTDN...DLGY--
F0ZUK5_DICPU/35-551-ITTIKLLL....-............IPS.......YFSTDFE-VHRNWLAI-TSSLPISKW......YFE...NTSE--
A0A068Y0H1_ECHMU/19-476-GLCLRSLGIL.Y-PYSGMSS.....PPM.......F..GDYE-AQRHWMEI-TVNLPISEW..YVNTSSN...DLQY--
ALG8_HUMAN/21-510-VTLLKCLL....-............IPT.......YHSTDFE-VHRNWLAI-THSLPISQW......YYE...ATSE--
G3AHF0_SPAPN/67-518-AVLLRSAVGL.G-GHSGYHT.....PPT.......F..GDFE-AQRHWMEL-TINLPISKW..YYF.......DLSY--
G7DT66_MIXOS/306-809-SFIIRATVSL.G-PYSGYVV.....APM.......Y..GDLE-AQRHWMAV-TYHLPPSEW..YFH.......RLEY--
E4XPJ7_OIKDI/15-474-.FLLRWVVSL.G-PYSGKNT.....SPL.......F..GDYE-AQRHWMEL-TLHQPLSKW..YFF.......DLEY--
K0KJ73_WICCF/57-557-ATILKVLL....-............FDT.......YHSTDFD-VHRNWLAI-TNKLPIREW......YLE...KTSQ--
Q6CSG6_KLULA/71-550-ALIIRCAVGL.G-GYSGMNT.....PPM.......F..GDFE-AQRHWMEI-TQHLPVREW..YWY.......DLQY--
S8A5I1_DACHA/15-491-ATALKLLL....-............IPA.......YRSTDFE-VHRNWLAI-THSLHPSKW......YLE...DTSE--
J7S8J5_KAZNA/67-547-LLIIKSAIGL.G-SYSGFQT.....PPM.......F..GDFE-AQRHWMEI-TQHLPVSQW..YWF.......DLQY--
G8YLJ6_PICSO/71-564-AIILRAAVGL.A-PYSGMGE.....KPI.......N..GDFE-AQRHWMEL-TIHLPIDKW..YFY.......DLQY--
ALG8_CANGA/21-535-SLLLKLLL....-............IPD.......YYSTDFD-VHRNWLAI-TNKLPLRQW......YYE...HTSQ--
U5GCU1_POPTR/44-501-SLLLRVAVSL.H-SYSGAGT.....PPK.......F..GDFE-AQRHWMEI-TTNLPIKDW..YFNTTNN...DLSY--
B4L518_DROMO/13-481-.SALKVLL....-............FPA.......YYSTDFE-VHRNWLAI-THSLPINRW......YLD...ATSE--
C4XYN7_CLAL4/28-542-SLALKALL....-............AVG.......YHSTDFD-VHRNWLAI-TYNLPVAKW......YLE...NTSQ--
S9VWR7_SCHCR/35-484-IIFMQWLISI.G-SYSGRNS.....PPM.......Y..GDFE-AQRHWMEL-TLHSPISNW..YFE.......DLEW--
C4Y8Y1_CLAL4/65-544-AVMLRSAVGL.G-PYSGQGE.....KPI.......N..GDFE-AQRHWMEI-TSHLPVDQW..YFY.......DLQY--
U4LQP8_PYROM/53-504-AFLFRWAVGL.G-SYSGMAA.....PPM.......H..GDFE-AQRHWMEI-TTKLPVREW..YWH.......DLQW--
ALG6_DICDI/25-502-SLLARYLVSL.N-GYSGQSK.....PPM.......F..GDYE-AQRHWMEI-TTNLDIHQW..YFNSTDN...DLMY--
W1PIJ5_AMBTC/36-490-AFFLRILVSL.H-PYSGARR.....PPM.......F..GDYE-AQRHWMEI-TINIPPREW..YKNTTFN...HLAY--
H0V4T9_CAVPO/14-492-GLTVRWTVSL.H-SYSGAGK.....PPL.......F..GDYE-AQRHWQEV-TLNLPVRQW..YFNSSDN...DLQY--
F6UCU7_XENTR/38-526-VSLLKCLL....-............LPT.......YHSTDFE-VHRNWLAI-THSLPVSKW......YYE....VGP--
F9FE00_FUSOF/15-493-AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-TNSLPLEKW......YFE...KTSE--
B4MG56_DROVI/12-467-GLALRSIISM.N-SYSGFNQ.....APM.......F..GDYE-AQRHWQEV-TTNLDVKNW..YTNGTHN...DLQY--
M5ECX9_MALS4/12-500-GTALKVLL....-............WPA.......YHSTDME-VHRNWLAI-THQLPLRDW......YVE...ATSP--
R4G404_RHOPR/9-494-ATCFKILL....-............IKT.......YYSTDFE-VHRHWLAL-TSSRPWKFW......YTD...TTSQ--
A8J4X2_CHLRE/2-518-.TAVKLLL....-............LPT.......YRSTDFE-VHRNWLAI-THSLPLSKW..QADGYVD...ATSV--
I7LUU2_TETTS/10-489-..LIKLLL....-............VFA.......YHSTDFE-VHRNWLRI-TYNLPLREW......YYD...DVSI--
Q7Q2B4_ANOGA/11-482-..GVKLLF....-............IPA.......YRSTDFE-VHRNWLAI-THSLPLSRW......YYE...KTSE--
T1G1F7_HELRO/12-479-AVVVRWLISL.H-DYSGYGK.....PPL.......F..GDFE-AQRHWMEI-TYNLPVHDW..YRQTPSN...DLLY--
D8Q0E0_SCHCM/162-611-TTLLKLAIGT.G-SYSGQAT.....PPM.......F..GDYE-AQRHWMEL-TVHLPTREW..YRY.......DLQY--
Q176C2_AEDAE/15-501-GILLRAAISL.H-SYSGENR.....PPM.......F..GDFE-AQRHWQEV-TVNLPVRDW..YENTTDN...DLQY--
V2XYC4_MONRO/48-546-STTLKLLL....-............FPA.......YRSTDFE-VHRNWLAI-THSLPMSKW......YFD...TTSE--
K5WXZ7_AGABU/56-542-STMLKLLL....-............YPA.......YRSTDFE-VHRNWLAI-THTLPISKW......YYD...TTSE--
F6GVE0_VITVI/26-508-AACIKLLL....-............IPS.......YHSTDFE-VHRNWLAL-THSLPLSQW......YSD...ETSP--
G8YVD8_PICSO/37-547-TLVLKLLV....-............SIG.......YRSTDFE-VHRNWLAI-TYHLPLKQW......YTD...TTSE--
F9X7N4_ZYMTI/15-491-ATALKVLL....-............WPA.......YKSTDFE-VHRNWLAI-TNSLPLKEW......YFE...DTSE--
B4I046_DROSE/12-481-ATGLKILL....-............IPA.......YHSTDFE-VHRNWLAI-THSLPLNQW......YVD...ATSE--
H6CAF2_EXODN/46-523-ATALKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSLPVKRW......YYE...ATSE--
E4V433_ARTGP/15-494-AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSLPVKEW......YYE...KTSE--
ALG6_YEAST/46-528-AVILRCTIGL.G-PYSGKGS.....PPL.......Y..GDFE-AQRHWMEI-TQHLPLSKW..YWY.......DLQY--
C5DEQ3_LACTC/41-520-ALVIRCAVGL.G-SFSGEAT.....VPM.......H..GDFE-AQRHWMEL-TTNLPLSQW..YWF.......DLQY--
Q17GG0_AEDAE/11-473-..AIKMMF....-............LPS.......YRSTDFE-VHRNWLAI-THSRPLAKW......YYE...ATSE--
M0ZN96_SOLTU/61-545-ATCIKFLL....-............IPA.......YHSTDFE-VHRNWLAI-THSLPLSQW......YSD...ETSP--
A5E0J5_LODEL/108-572-SLLLRTAVGL.G-GHSGFGK.....PPM.......Y..GDFE-AQRHWMEI-TNHLPLSQW..YFF.......DLQY--
C4R675_PICPG/51-560-STLLKVLL....-............YPA.......YHSTDFD-VHRNWLAI-TNKLPLKEW......YLE...NTSQ--
T5AJ86_OPHSC/15-492-AAAFKVLL....-............FPA.......YKSTDFE-VHRNWLAI-TSSLPVSEW......YYE...QTSE--
D2UZR6_NAEGR/31-501-GILFRIVLAFYQ-PHSGKST.....PPM.......F..GDFE-AQRHWIEV-TSNLPISEW..YFY.......DLEY--
D8PR27_SCHCM/33-514-STTFKLLL....-............FPT.......YRSTDFE-VHRNWLAI-THSLPISQW......YYD...TTSE--
E6ZL14_SPORE/61-583-STAVKLLL....-............FPT.......YHSTDFE-VHRNWLAI-TRTLPIREW......YFE...ATSQ--
F4NSW2_BATDJ/10-461-TLLIKWAVSL.H-SHSGLNT.....PPM.......F..GDFE-AQRHWMEL-TTHLPRSEW..YRY.......DLGY--
G3J5X8_CORMM/17-489-.AAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSLPLSEW......YYE...DTSQ--
T1JIW9_STRMM/20-486-...LKILL....-............IPS........KSTDFE-VHRNWLAI-THTFPFDKW......YYEASISTSE--
H2VDX9_TAKRU/14-486-GVVVRWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNLPVQEW..YLNTTDN...DLNY--
G8JSX9_ERECY/78-592-STVLKLLL....-............MPD.......YFSTDLE-VHRNWLAL-TNKLPLLDW......YRE...ATSQ--
U4KWQ6_PYROM/15-499-ATAFKLLL....-............LPA.......YKSTDFE-VHRNWLAL-THSLPVQKW......YYE...NTSE--
E3KWU5_PUCGT/17-510-STAIKLIL....-............LPT.......YRSTDFE-VHRNWLAI-TYSLPLSKW......YYD...ETSP--
I3JQF2_ORENI/14-486-AIIARWGVSL.N-SYSGAGK.....PPM.......F..GDYE-AQRHWQEV-TYNLPIQEW..YFNTTNN...DLNY--
K4A8J1_SETIT/40-498-ALLVRVLVSM.G-PYSGQGA.....APK.......F..GDYE-AQRHWMEL-TLHLPPSDW..YRNTSDN...DLAY--
B3MJG1_DROAN/12-464-GLAVRSIISL.H-SYSGHNS.....PPM.......Y..GDYE-AQRHWQEV-TINLDVGEW..YTNSSNN...DLMY--
X1WNC6_ACYPI/31-488-AVLFRWFVSL.H-DYSGKSK.....TPM.......Y..GDYE-AQRHWMEV-TVSLPTTQW..YFNSSDN...DLLY--
Q75CA8_ASHGO/68-547-ALIIRLAVGL.G-GYSGMGK.....PPM.......F..GDFE-AQRHWMEV-TQHIPVSKW..YFH.......QLQY--
D0N326_PHYIT/34-510-LVLVRWIVGL.H-SYSGEHT.....PPM.......F..GDYE-AQRHWMEI-TINLPVSDW..YFNTTSN...DLLY--
Q6FVE1_CANGA/52-532-AMIIRCAIGL.G-PYSGYKD.....GPM.......H..GDFE-AQRHWMEI-TQHLPISKW..YYY.......DLKY--
H3CLG0_TETNG/1-489-...LKCLF....-............INA.......YHSTDFE-VHRNWLAI-THSLPLSRW......YHE...NTSE--
U5FSQ0_POPTR/25-525-STCVKLLL....-............IPS.......YHSTDFE-VHRNWLAI-THSLPLDQW......YID...KTSP--
A7TDS1_VANPO/94-608-SLCLKLLL....-............FPD.......YYSTDFD-VHRNWMAI-TNALPISKW......YFE...NTSQ--
X6MDM2_RETFI/80-636-AVFVRLCVGV.G-SYSGMHK.....PPM.......Y..GDFE-AQRHWMEI-TSG........NKNSSAN...DLMY--
D2A4Q9_TRICA/20-523-AVLLRACTTL.H-PYSGAGS.....PPM.......Y..GDYE-AQRHWMEI-TTNLRPLEW..YKNTTDN...DLMY--
F6PKN9_XENTR/14-490-ALYVRWTVSL.G-PYSGAHK.....PPM.......F..GDYE-AQRHWQEI-TFSLPVKQW..YFNSTDN...NLQY--
G8ZY47_TORDC/46-526-ALIIGCAVGH.G-SYSGQFS.....PPM.......F..GDFE-AQRHWMEI-TQHLAPSQW..YWF.......DLEY--
H2AU41_KAZAF/49-563-SLFLKLLL....-............VPD.......YFSTDFD-VHRNWLAI-TNGMHLKDW......YYE...HTSQ--
F8QIP1_SERL3/1-475-...MKLLL....-............FPS.......YRSTDFE-VHRNWLAI-THSLPISQW......YYD...TTSE--
A5DBI4_PICGU/24-536-SLAIKALL....-............SIG.......YHSTDFD-VHRNWLAI-TYNLPVSKW......YVE...NTSQ--
S8A6B8_DACHA/57-532-AFIFRWAVTY.G-PYSGEHA.....PPM.......F..GDFE-AQRHWMEI-TIHLPISKW..YWY.......DLQW--
G0VHP8_NAUCC/41-555-SFALKLLL....-............IPD.......YYSTDFD-VHRNWLAV-TNKLPLKQW......YYE...HTSQ--
ALG8_KLULA/37-549-ATVLKVLL....-............FPG.......YYSTDFD-VHRNWLAI-TNKLPLNKW......YVE...STSQ--
A3GH90_PICST/41-554-SLTLKVLL....-............VIG.......YHSTDFD-VHRNWLAI-TNKLPVSEW......YLE...KTSQ--
D8SCH8_SELML/18-458-AVLIRLLTGL.H-SYSGAGN.....PPK.......Y..GDYE-AQRHWMEL-TINLPVSDW..YRNTTDN...DLGY--
M0SWI1_MUSAM/15-472-ALLVRVLVSL.G-SYSGQGT.....PPT.......Y..GDYE-AQRHWMEI-TLHTPAAEW..YRNTTAN...DLAY--
E9HIJ0_DAPPU/14-464-TVIIKLGVSL.F-PYSGKNN.....PPM.......F..GDYE-AQRHWMEI-TVNLPIQDW..YRNTTDN...DLLY--
G8JQX3_ERECY/54-533-ALIVRLAVGL.G-GYSGKGK.....GPL.......F..GDFE-AQRHWMEI-TTCLPISRW..YFY.......DLEY--
E3LGX2_CAERE/56-494-LLCFQIVISL.N-PHSGESQ.....PPM.......F..GDYE-AQRHWMEI-TLNLPIEQW..YVNGTLN...DLLY--
G1KHE7_ANOCA/14-488-GLIIRWTVSL.G-SYSGAGK.....PPM.......Y..GDYE-AQRHWQEI-TYNLPVKDW..YFNTTDN...NLQY--
M3ZXK5_XIPMA/20-507-..LFKCLF....-............INA.......YHSTDFE-VHRNWLAI-TYSLPLSRW......YHE...NSSE--
M1AYF5_SOLTU/40-493-AILVRIAVSI.H-PYSGAGT.....PPK.......Y..GDYE-AQRHWMEI-TLNLPVREW..YRNSTVN...DLKY--
G0WC59_NAUDC/39-554-SLALKILL....-............FPD.......YYSTDFD-VHRNWLAI-TNKLPLKEW......YYE...HTSQ--
Q566T2_DANRE/20-507-.SFLKCLL....-............INA.......YHSTDFE-VHRNWLAL-THSLPVSQW......YYE...ATSE--
S7ZR44_PENO1/15-489-AAAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSLPVKEW......YFE...KTSE--
B5Y5E2_PHATC/28-512-LVLLRVLVGY.H-PHSGQDNYHGLHSAY.......G..GDFE-AQRHWMEL-TLHLPVGEW..YWY.......DLSY--
I2H6P2_TETBL/49-543-AIIIRCAISL.G-SYSGKGT.....PPM.......F..GDFE-AQRHWMEI-TQHLPISKW..YWF.......DLQY--
A9RXF0_PHYPA/16-505-ATCVKVLL....-............VPA.......YHSTDFE-VHRHWLAI-THSLPLKEW......YSD...ESSQ--
S8ECT2_FOMPI/45-533-STCLKLLL....-............FPA.......YRSTDFE-VHRNWLAI-TNTLPISQW......YYD...TTSE--
K5X935_PHACS/65-548-STCLKLLL....-............FPA.......YHSTDFE-VHRNWLAI-THSLPMSRW......YYD...TTSE--
ALG6_CAEEL/56-491-LLCFQLAISL.N-PHSGESQ.....PPM.......Y..GDYE-AQRHWMEI-TVNLPIEQW..YLNGTHN...DLLY--
C4R109_PICPG/50-531-AILIRLAVGL.G-SYSGFNT.....PPM.......Y..GDFE-AQRHWMEI-TQHLSIEKW..YFY.......DLQY--
G3BBW3_CANTC/58-534-AIIIRSAVGL.G-SFSGFQE.....NPI.......N..GDFE-AQRHWMEI-TTHLPINQW..YFF.......DLQY--
H2ANJ3_KAZAF/67-548-ALIIRCAIGL.G-SYSGMGH.....SPM.......F..GDFE-AQRHWMEI-TQHLPISKW..YWF.......DLQY--
M4C591_HYAAE/34-510-LILVRWLVGL.H-LYSGEHV.....PPM.......F..GDYE-AQRHWMEI-TFNVPISEW..YFNTTSN...ELLY--
M2MQ53_BAUCO/15-492-GTAFKVLL....-............WPA.......YRSTDFE-VHRNWLAI-THSLPLKQW......YFD...KTSE--
W1NV46_AMBTC/11-495-ATCIKILL....-............IPS.......YRSTDFE-VHRHWLAL-THSLPLSNW......YSD...RTSP--
S2JJH6_MUCC1/40-480-.SLIRWIVAL.N-PYSGYNA.....PPM.......F..GDYE-AQRHWMEI-TTHLPTSKW..YRY.......DLQW--
I3JKF5_ORENI/18-505-..LLKCFF....-............ISA.......YRSTDFE-VHRNWLAI-THSLPVSRW......YYE...NTSE--
G8BYB6_TETPH/62-543-ALIIRCAIGL.G-PYSGMNE.....APM.......F..GDFE-AQRHWMEI-TQHLPISQW..YFY.......DLQY--
H2Y782_CIOSA/7-450-SILLRLCVSL.A-PYSGKGK.....PPM.......F..GDYE-AQRHWQEV-TYNLPPTEW..YVNSSHN...NLGY--
G4VBL6_SCHMA/19-502-GIALRSSTSL.H-SYSGENK.....PPM.......Y..GDYE-AQRHWMEI-TVNLPFTEW..YMNSTHN...DLNY--
F4P9K6_BATDJ/14-479-ALCIKLLL....-............VPS.......YHSTDFE-VHRNWLAI-TSSLPTSQW......YYE...STSE--
A2QEY3_ASPNC/67-535-..LFRWAVSL.W-GYSGFGV.....PPM.......H..GDFE-AQRHWMEI-TTHLPISKW..YLY.......DLQY--
E2BUL4_HARSA/38-509-VTCIKMLL....-............IPT.......YHSTDFE-VHRNWLAI-TYNLPLKEW......YLN...AQSM--
ALG8_DEBHA/34-545-SLALKLLL....-............SVG.......YHSTDFD-VHRNWLAI-TYNLPISKW......YIE...NTSQ--
A0A0D2X4J7_CAPO3/36-488-ALLVRAAVGL.Y-PHSGQAT.....PPM.......Y..GDYE-AQRHWMEI-TLHLPPAEW..YHNSTSN...DLLY--
K3WJX2_PYTUL/33-498-LLLLRWLVGL.H-SYSGAQT.....PPM.......F..GDYE-AQRHWMEI-TLNLPVSQW..YFNTTEN...DLLY--
C5DNU1_ZYGRC/30-544-SLVLKILL....-............IPD.......YFSTDFD-VHRNWLAI-THNLPLRQW......YYE...ATSQ--
F0YK69_AURAN/94-544-..VARHGCSL.H-PYSGEAT.....PPR.......F..GDYE-AHRHWMEV-TIHKPLADW..YAY.......DVDY--
B0WBY1_CULQU/17-503-GILLRATVSL.Y-SYSGHGK.....RPM.......F..GDFE-AQRHWQEV-TVNLPIADW..YRNTTDN...DLLY--
B3RIR0_TRIAD/15-519-ASLFKSLL....-............IPS.......YRSTDFE-VHRNWLAI-THSLPVSQW......YYE...NTSQ--
G8BJG1_CANPC/35-543-SLALKLLL....-............MVG.......YHSTDFD-VHRNWLAI-TSKLPISQW......YTE...NTSQ--
B6K4U3_SCHJY/35-468-VILIQWLVSI.G-SYSGKGA.....PPM.......F..GDFE-AQRHWMEL-TLHVPISQW..YYE.......NLEW--
K3X7Z1_PYTUL/28-566-SVALKLLL....-............LPS.......YTSTDFE-VHRNWLAL-TNALPRHDW......YHE...RTSE--
G7XVM6_ASPKW/15-493-ATAFKILL....-............FPA.......YKSTDFE-VHRNWLAI-THSLPVKEW......YYE...KTSE--
D7LLP2_ARALL/19-500-ATAVKLLL....-............IPS.......YRSTDFE-VHRNWLAI-TNSLPLTKW......YFD...ETSQ--
G3AQ92_SPAPN/42-557-SFTLKALL....-............VVG.......YHSTDFD-VHRNWLAI-THNLPISKW......YVE...NTSQ--
G4TH15_PIRID/87-576-GTVIKLLL....-............FPA.......YRSTDFE-VHRNWMAI-TNSLPLSQW......YYE...ATSE--
B4KK01_DROMO/12-467-AISLRSIISM.S-SYSGFNK.....PPM.......F..GDYE-AQRHWQEV-TFNLEVKLW..YTNSTRN...DLQY--
A8PTB3_MALGO/18-506-STAMKVLL....-............WPA.......YHSTDME-VHRNWLAV-TYSLPLREW......YID...ATSP--
B0CVP2_LACBS/18-494-SVLVRLVMGL.A-SYSGWNT.....PPM.......F..GDYE-AQRHWMEI-TLHLPIRQW..YTY.......DLQY--
F4WJE6_ACREC/14-512-AILLRCCITY.H-SHSGEGK.....PPM.......Y..GDYE-AQRHWQEI-TLNLPLDEW..YINTTDN...DLQY--
R4XHB2_TAPDE/18-493-STALKLLL....-............IPA.......YRSTDFE-VHRNWLAL-THSLPVNQW......YFE...RTSE--
W1Q7Q7_OGAPD/16-525-STLLKILL....-............FPA.......YYSTDFD-VHRNWLSI-TKLLPLNRW......YLE...NTSE--
B4MJ94_DROWI/18-488-ATAFKTLL....-............FPA.......YYSTDFE-VHRNWLAI-THSLPMNRW......YLD...TTSE--
F4RT20_MELLP/38-527-STCIKLLL....-............FPA.......YHSTDFE-VHRNWLAI-THSLPLSRW......YYD...NTSE--
ALG8_CANAL/51-572-SLALKILL....-............FIG.......YHSTDFD-VHRNWLAI-TNKLPISQW......YIE...NTSQ--
K0KKM0_WICCF/47-534-AIIIRSAIGF.G-SYSGHAI.....PPM.......F..GDFE-AQRHWLEI-TQHLPISQW..YWY.......DLQY--
K7H4J1_CAEJA/18-503-.LSFKIIL....-............IPA.......YVSTDFE-VHRNWMAV-TWNRPLAEW......YTE...NTSE--
B4JLV7_DROGR/13-480-.SALKVLL....-............IPA.......YYSTDFE-VHRNWLAI-THSLPLDHW......YLD...ETSE--
A7TJW9_VANPO/47-530-ALIVRCAIGL.G-SYSGMGN.....PPM.......F..GDFE-AQRHWMEI-TQHLPISKW..YFF.......DLEY--
A0DD77_PARTE/10-454-SISLRIYVAF.G-GYSGMND.....PPQ.......Y..GDFE-AQRHWMEL-TSHLNITQW..YEKSEFN...DPKW--
N1JGC6_BLUG1/16-499-.TAFKILL....-............LPAPEDSEYHSQSTDFE-VHRNWLAI-TNSLPTDKW......YFE...NTSE--

PF13231

Q65D63_BACLD/64-222--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRADU/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
Q89IJ6_BRADU/52-213--------------------------------------------------------------------------------
Q5ZVN3_LEGPH/45-205--------------------------------------------------------------------------------
A5ULR9_METS3/66-231--------------------------------------------------------------------------------
Q2IKZ1_ANADE/72-232--------------------------------------------------------------------------------
Q2KCI5_RHIEC/48-207--------------------------------------------------------------------------------
Q6NCW5_RHOPA/88-248--------------------------------------------------------------------------------
Q82U54_NITEU/408-568--------------------------------------------------------------------------------
R6LJZ9_9BACE/61-222--------------------------------------------------------------------------------

PF02366

PMT3_YEAST/62-306-------------------G--KFGS------YYLRHEF-------------YHD-------------------------
POMT1_HUMAN/20-289-------------------G--QYIS------FYMKQIF-------------FLD-------------------------
P73015_SYNY3/18-249-------------------A--KFAS------DYWLGND-------------FFP-------------------------
Y1220_AQUAE/1-229-------------------N--ES..------FYADSAK-------------NML-------------------------
ARNT_SALTY/3-237-------------------D--ET..------RYAEISR-------------EML-------------------------
P73065_SYNY3/8-275-------------------T--VPAW------DQSNHLS-------------YGL-------------------------
PMT1_YEAST/54-297-------------------G--GFAS------QYIRGTY-------------FMD-------------------------
PMT1_CANAL/70-313-------------------G--GFAR------KYILGTF-------------FMD-------------------------
PMT1_SCHPO/38-284-------------------Y--NYAV------DYVNNKL-------------LMD-------------------------
PMT2_YEAST/69-313-------------------G--KFGS------YYLRHEF-------------YHD-------------------------
POMT2_HUMAN/62-306-------------------G--KMGS------YYINRTF-------------FFD-------------------------
PMT5_YEAST/50-293-------------------G--TFVS------QYVNNIF-------------FTD-------------------------
P73712_SYNY3/7-243-------------------D--RTEA------RYAEIGR-------------KMA-------------------------
POMT1_DROME/178-421-------------------G--KYIS------MYMRNIF-------------FFD-------------------------
PMT4_YEAST/57-305-------------------G--KFAS------YYLERSY-------------FFD-------------------------
PMT4_SCHPO/63-310-------------------G--KFAS------YYLQGKY-------------FFD-------------------------
ARNT_ECOLI/3-237-------------------D--ET..------RYAEISR-------------EML-------------------------
PMT6_YEAST/70-314-------------------G--KFGS------YYIKHEY-------------YHD-------------------------
PMT6_CANAL/97-357-------------------G--KFGS------QYLKRQF-------------YFD-------------------------

PF11028

A3U548_CROAH/37-215----------------------DAGE------YIATASK-------------LEI-------------------------
R6XIR1_9BACT/37-217----------------------DCGE------FIASSYK-------------LEV-------------------------
F6GE14_LACS5/37-214----------------------DAGE------YILTSAK-------------LQV-------------------------
I6ZS60_MELRP/34-208----------------------DCGE------FIASSYA-------------LQV-------------------------
H8KSF5_SOLCM/35-209----------------------DCGE------FVASVYK-------------LQV-------------------------
A0LXN9_GRAFK/37-215----------------------DAGE------YIATSAN-------------LEV-------------------------
U5Q8D9_9BACT/37-212----------------------DCGE------FIASSYK-------------LEI-------------------------
R5I514_9BACT/37-217----------------------DCGE------FIASSYK-------------LEV-------------------------
Q2S0T5_SALRD/34-225----------------------DPGE------RIASAYT-------------LQV-------------------------
I0K9H0_9BACT/35-227----------------------DCGE------FIACAYK-------------LQV-------------------------
X5D9M2_9BACT/35-209----------------------DCGE------FITTAFK-------------FEV-------------------------
X5DZV9_9BACT/35-212----------------------DCGE------FITSAFK-------------LEV-------------------------
H1XP16_9BACT/34-208----------------------DCGE------FIACSYI-------------LGV-------------------------
B3ENQ9_CHLPB/34-209----------------------DCGE------FIATAYT-------------LGV-------------------------
H1YCC6_9SPHI/34-214----------------------DCGE------FISCAFR-------------LQV-------------------------
H8KSF6_SOLCM/35-213----------------------DCGE------FISSAFK-------------LQV-------------------------
F4KRQ6_HALH1/35-218----------------------DCGE------FILGAYK-------------LQV-------------------------
F4C302_SPHS2/34-214----------------------DCGE------FIAAAYK-------------MQI-------------------------
E4T8Q1_PALPW/35-213----------------------DCPE------FIASAFK-------------LEV-------------------------
H1Y2D3_9SPHI/34-214----------------------DCGE------FISCAFR-------------LQV-------------------------
A4CGC2_ROBBH/37-215----------------------DAGE------YISTSAK-------------LQV-------------------------
I3YTY0_AEQSU/37-215----------------------DAGE------YIATSSN-------------LEV-------------------------
F3ZQH0_9BACE/35-214----------------------DCGE------FILSSYK-------------LEV-------------------------
G8TAS2_NIAKG/34-222----------------------DCGE------FVSSAYK-------------LQI-------------------------
D3IE17_9BACT/35-214----------------------DCPE------FITTGYK-------------LEV-------------------------
F4C4U7_SPHS2/36-216----------------------DCGE------FIAAAYK-------------LEI-------------------------
G8R038_OWEHD/36-216----------------------DCGE------YISTAVK-------------LQV-------------------------
A6GWD8_FLAPJ/36-224----------------------DCGE------YIATAAK-------------LEV-------------------------
T2KIW2_9FLAO/37-215----------------------DAGE------YILTSAK-------------LQV-------------------------
I3KW99_ORENI/21-184----------------------DSGE------LITTACE-------------LGV-------------------------
F4KMK4_PORAD/39-231----------------------DCPE------FILSAFK-------------LEV-------------------------
I0AH06_IGNAJ/35-227----------------------DSGE------LALAQAT-------------LSI-------------------------
C3L447_AMOA5/43-223----------------------DCSE------YIAAAYK-------------LQV-------------------------
H8XP42_FLAIG/37-215----------------------DCGE------YIATAAK-------------LEV-------------------------
Q74D30_GEOSL/39-214----------------------DSGE------FITAIHS-------------LGT-------------------------
R5BN47_9BACE/50-226----------------------DCGE------FIASSYK-------------LEV-------------------------
F0S690_PSESL/34-213----------------------DCGE------FISAAYK-------------LQI-------------------------
A9AXK7_HERA2/53-215----------------------DSGE------LATALWF-------------GAV-------------------------
R6SBD9_9BACE/36-215----------------------DCPE------FITTGYK-------------LEV-------------------------
B3EAC9_GEOLS/36-209----------------------DSGE------FVTAVHF-------------LGS-------------------------
L7W9H4_NONDD/36-210----------------------DAGE------YIATSSK-------------LEV-------------------------
B5EH69_GEOBB/37-210----------------------DSGE------FITAIAS-------------LGT-------------------------
A1ARZ9_PELPD/68-243----------------------DSGE------FLTAIAS-------------MGS-------------------------
G1PIZ8_MYOLU/52-215----------------------DAGE------LITAAHE-------------LGV-------------------------
A5G4Z0_GEOUR/37-209----------------------DSGE------FITAISS-------------LGT-------------------------
C9RN70_FIBSS/36-216----------------------DCGE------FVACANT-------------LGI-------------------------
I0AM95_IGNAJ/32-228----------------------DSGE------LAAVQAT-------------LGI-------------------------
D3BML5_POLPA/98-270----------------------DAGE------LIINAHQ-------------LGI-------------------------
W8FBF7_9BACT/35-222----------------------DCGE------FIACSYK-------------LLV-------------------------
W0EVP7_9SPHI/34-220----------------------DCGE------FVSTAYK-------------LQM-------------------------
L7W937_NONDD/38-203----------------------DSPE------FAFAGAN-------------FQL-------------------------
E4RU44_LEAB4/34-214----------------------DCGE------FIACAYK-------------LQV-------------------------
I0AN08_IGNAJ/34-208----------------------DCGE------FIAASYY-------------LQV-------------------------
A6LGG9_PARD8/35-214----------------------DCGE------FISSAYK-------------LEV-------------------------
A4AMM0_MARSH/37-215----------------------DAGE------YIATSAK-------------LQV-------------------------
C1A3K8_GEMAT/56-227----------------------DASE------YIAAAKV-------------LGI-------------------------
R6SBV2_9BACE/35-216----------------------DCPE------FILSAAK-------------LEV-------------------------
I0I530_CALAS/46-211----------------------DAGE------FQFAAWN-------------FGL-------------------------
G8X584_FLACA/36-214----------------------DCGE------YISTSAK-------------LEV-------------------------
W0RJK7_9BACT/57-227----------------------DTSE------YIAAAYV-------------LGI-------------------------
D0LFQ9_HALO1/25-195----------------------DAPE------FVAASVA-------------LGV-------------------------
R5W9J1_9BACT/35-214----------------------DCAE------FIATSYK-------------LEV-------------------------
K4IB40_PSYTT/37-215----------------------DAGE------YIATSAK-------------LQV-------------------------
E6X4M4_CELAD/37-216----------------------DAGE------YITTSAK-------------LQV-------------------------
D0MDF1_RHOM4/34-225----------------------DSGE------FIASVFG-------------LEV-------------------------
I3ZYA9_ORNRL/34-223----------------------DCGE------YIVSSSK-------------LGV-------------------------
I3YIE7_ALIFI/35-215----------------------DCSE------FIATSYK-------------LEV-------------------------
R7F5J7_9BACT/37-217----------------------DCGE------FIIQADK-------------LEV-------------------------
G8TQ81_NIAKG/34-212----------------------DCGE------FISTAYT-------------MGI-------------------------
A2TXJ8_9FLAO/37-215----------------------DVGE------YIATSVK-------------LEV-------------------------
I0AH07_IGNAJ/47-229----------------------DSGE------LAAVQAT-------------WGI-------------------------
Q8KAY9_CHLTE/41-217----------------------DCGE------VIATSYT-------------LGI-------------------------
C6W6V6_DYAFD/35-215----------------------DCGE------FIACAFK-------------LQV-------------------------
F0NYC1_WEEVC/36-224----------------------DCGE------YIVSSAK-------------LGV-------------------------
B4S581_PROA2/34-210----------------------DCGE------FIATART-------------LGV-------------------------
B3QWD0_CHLT3/33-211----------------------DCGE------FIATAYT-------------LGV-------------------------
Q39VU9_GEOMG/36-207----------------------DSGE------FITAIHS-------------LGT-------------------------
C6Y1Y3_PEDHD/35-207----------------------DCGE------FIAASSK-------------LEV-------------------------
C7M410_CAPOD/37-223----------------------DCGE------YIATSAK-------------LEV-------------------------
R5P289_9PORP/43-218----------------------DCGE------FITTSVG-------------LQV-------------------------
G2Z4K2_FLABF/39-217----------------------DCGE------YIATAAK-------------LEV-------------------------
R6AGR2_9BACT/35-214----------------------DCPE------FITTAYK-------------LEV-------------------------
B4SC86_PELPB/34-212----------------------DCGE------FIATAYT-------------LGI-------------------------
F4AVR9_DOKS4/37-216----------------------DAGE------YISTSSK-------------LEI-------------------------
Q7MT47_PORGI/37-226----------------------DCAE------FIVCVNK-------------LEI-------------------------
I4AKN9_FLELS/34-232----------------------DCGE------FIAVSYK-------------LMA-------------------------
I2EW61_EMTOG/35-215----------------------DCGE------FIACSYK-------------LQV-------------------------
D6D6N6_9BACE/37-216----------------------DCPE------FISCAEK-------------LQV-------------------------
R7DIG7_9PORP/35-214----------------------DCGE------FISSAYK-------------LEV-------------------------
C1A7V9_GEMAT/57-227----------------------DTSE------YIAAAYV-------------LGL-------------------------
R5B2K5_9BACE/47-228----------------------DCPE------FILQAFK-------------LEV-------------------------
C0R1J1_BRAHW/121-297----------------------DNGE------LTTAAYF-------------LGV-------------------------
H1Z8K4_MYROD/37-215----------------------DPGE------YIATSAK-------------LQV-------------------------
R5RQ99_9BACE/43-220----------------------DCGE------FIASSYK-------------FEV-------------------------
W5MZF0_LEPOC/41-204----------------------DSGE------LITAACE-------------LGV-------------------------
F9YU79_CAPCC/36-215----------------------DCGE------YIATSAK-------------LQI-------------------------
C7PKN8_CHIPD/34-212----------------------DCGE------FISSAYK-------------VQV-------------------------
H6LAI5_SAPGL/35-215----------------------DCGE------FISAAYK-------------LEV-------------------------
J9R805_RIEAN/38-218----------------------DCGE------YISSAVK-------------LEV-------------------------
B6YRJ5_AZOPC/37-217----------------------DCSE------FITSAYK-------------LEV-------------------------
C6Y0P2_PEDHD/34-214----------------------DCGE------FIASAFK-------------MQV-------------------------
R5GFJ4_9BACT/35-214----------------------DCPE------FITTAYK-------------LEV-------------------------
TM260_DICDI/139-313----------------------DAGE------LIVVAHQ-------------FGV-------------------------
R5G4M3_9PORP/37-222----------------------DCPE------FITTFAK-------------MEV-------------------------
C6X5R1_FLAB3/37-217----------------------DTGE------YIASAAK-------------LEV-------------------------
D2QNX1_SPILD/35-215----------------------DCGE------FIACSFK-------------LQV-------------------------
E4TV18_MARTH/50-230----------------------DCAE------FIASAYK-------------LQV-------------------------
R7HQZ6_9BACT/35-215----------------------DCGE------FISQGYK-------------LEV-------------------------
F2I9U5_FLUTR/34-221----------------------DCGE------YITAANK-------------LEV-------------------------
I3Z145_BELBD/35-215----------------------DPGE------FIAVAYK-------------LQV-------------------------
Q11YB8_CYTH3/35-214----------------------DCGE------FISTSYK-------------LMV-------------------------
R6CJ33_9BACT/35-214----------------------DCPE------FITTAYK-------------QEI-------------------------

PF10131

Q0AV03_SYNWW/415-1038-------------------G--ALS.------WLLLSRR-------------MGL..W---PA-----------------
Q5JIL5_THEKO/62-622-------------------G--AVA.------LHFYLRR-------------TGR...---EP-----------------
Q97FZ3_CLOAB/258-879-------------------G--ALG.------WLIWGIR-------------ERS.IF---IS-----------------
Q0AV07_SYNWW/2-631-------------------G--AMGV------WYICYRY-------------WGS..L---IG-----------------
Q8TXR3_METKA/68-665-------------------I--GVG.------VYALVRA-------------RGYARK---VA-----------------
A0LQQ1_SYNFM/80-828-------------------L--PAA.------IYFCLRR-------------FGYADL---VA-----------------
Q97FY2_CLOAB/253-873-------------------G--AFG.------WLLWGNR-------------EKR.VF---IC-----------------
Q97G45_CLOAB/90-699-------------------G--GMG.------WLFWGYY-------------TRR.QN---IA-----------------
R5JZI7_9CLOT/75-690-------------------G--GLP.------WILWGIH-------------ENR.RV---LG-----------------

PF02516

STT3A_HUMAN/17-484-------------------H--EFDP------YFNYRTT-------------RFLAEE---GF-----------------
STT3_CAEEL/19-506-------------------H--EFDP------WFNYRAT-------------HHMVQH---GF-----------------
STT3_YEAST/15-475-------------------H--EFDP------WFNYRAT-------------KYLVNN---SF-----------------
STT3_SCHPO/23-509-------------------H--EFDP------WFNFRAS-------------KILVEQ---GF-----------------
O29867_ARCFU/18-493-------------------.--.NDP------WYYYRLI-------------ENTIHN---..-----------------
O27660_METTH/24-582-------------------S--EMDS------YYNYRLT-------------MNYLTK---GI-----------------
O27928_METTH/21-478-------------------Y--EPDS------YYNYRLT-------------ANILDH---GH-----------------
O27920_METTH/13-461-------------------Q--ESDS------YYNYRLT-------------ENLAIR---GI-----------------
Y1525_METJA/33-650-------------------L--ALDP------YYYLRLS-------------ENLYNN---GH-----------------
PGLB_CAMJE/11-477-------------------S--EFNE------YFFNNQL-------------MIISND---GY-----------------

PF09586

A4VYG6_STRSY/15-836----------------...G--DGSL------FYTFSSG-------------LGLNFY---AL-----------------
Q1WT54_LACS1/18-862----------------..HH--PGSF------FYSFSKA-------------IGGEMI---GE-----------------
Q8DRZ1_STRMU/67-904----------------..MD--IGAL------FWSWHKG-------------VGGVMP---SV-----------------
Q74LA0_LACJO/18-861----------------..GN--WSSL------QFSFANG-------------LGADMA---GN-----------------
Q74LA1_LACJO/22-868----------------..GN--WSSA------GFSFLNG-------------LGGDMA---GN-----------------
A8AU67_STRGC/17-840----------------...G--SDSL------FYTFTSG-------------LGLNFY---AL-----------------
Q03YY3_LEUMM/16-848----------------..QH--PSSF------FYSFSNA-------------LGGDML---GE-----------------
Q8DRQ9_STRMU/18-837----------------...G--TDSL------FYSFKAG-------------LGFNIF---AL-----------------
Q03G85_PEDPA/13-851----------------..SH--PGQF------FYSFSNG-------------LGGDMF---GT-----------------
A5VKU5_LACRD/18-849----------------..HH--PSSF------FYSFSKG-------------LGGEMF---GT-----------------
Q8DRY9_STRMU/26-950----------------..GD--WSGL------FYSFSKS-------------IGGAMI---GI-----------------
Q38WC5_LACSS/15-827----------------...H--FNFS------AYSFSLS-------------LGGNLV---PL-----------------
Q8DWP3_STRA5/16-839----------------...G--SNSL------FYTFTSG-------------LGLNFY---AL-----------------
Q03NT2_LACBA/19-858----------------..HD--PSSI------VYSFSNG-------------LGGGMI---GI-----------------
Q38VZ4_LACSS/17-848----------------..QH--PDTF------FYSFAKG-------------LGGDML---GV-----------------
Q03RN6_LACBA/20-858----------------..HD--PSSI------FYSFSNG-------------IGGEML---GT-----------------
Q5FIZ5_LACAC/21-848----------------..TH--PFNL------IYTFSNG-------------LGNSML---AT-----------------
Q839W8_ENTFA/19-846----------------...G--KQSL------FYTWNAS-------------LGLNYL---SL-----------------
Q5M231_STRT2/16-841----------------...G--DGSL------FYTFTSG-------------LGLNFY---AL-----------------
Q82ZW8_ENTFA/12-828----------------...E--GITT------FYSFSNE-------------IGESIV---PL-----------------
Q5HPU9_STAEQ/10-840----------------...T--QGNL------FYSTHLG-------------LGGDFF---TD-----------------
Q5WFJ9_BACSK/12-844----------------...K--NGHW------SYSIQFG-------------LGAGTF---SQ-----------------
Q74IE5_LACJO/19-843----------------..SN--PLNF------IFTFSNG-------------LGSSFI---GT-----------------
Q03HY9_PEDPA/14-831----------------...G--KNSL------WFNWQAG-------------FGLNYL---AL-----------------
Q038D6_LACC3/14-842----------------..GH--PGQL------FYAFNKA-------------LGGDMY---GV-----------------
Q3XYV7_ENTFC/19-847----------------...G--KQSI------FYTWNAS-------------LGLNYL---SL-----------------
Q814J9_BACCR/15-862----------------...K--DGNL------FWSWDYG-------------LGGDLF---GE-----------------
Q03TF4_LACBA/23-880----------------...H--GQFH------LFSFSLG-------------SGSAVV---PL-----------------
Q5WJL1_BACSK/14-845----------------...S--EGSF------FYSLQFG-------------LGGGIF---SQ-----------------
A3CRC9_STRSV/17-843----------------...G--TDSI------FYTFSSG-------------LGQNFY---AL-----------------
Q65M97_BACLD/11-842----------------...K--QGNF------FYSYSFG-------------LGGGIY---SQ-----------------
Q04EK1_OENOB/16-850----------------..HQ--PNQL------FYSFAKN-------------FGGEMF---SE-----------------
Q03QV8_LACBA/14-985----------------...Q--GSLT------GWSWDLG-------------LGADKL---TT-----------------
Q03A73_LACC3/16-850----------------..GT--AGKA------.YSFSNS-------------LGGGMY---AN-----------------
A8FB68_BACP2/11-842----------------...V--KGNF------FYSYQFG-------------LGGGTY---TQ-----------------
Q03TW7_LACBA/17-837----------------...Q--HTWS------FMNLHQA-------------LGGNWM---PV-----------------
Q2FZ40_STAA8/20-851----------------...R--SFSS------LYDASFG-------------LGGDYM---KG-----------------
Q8DMX0_STRR6/15-831----------------...G--NSSL------FYTFTSG-------------LGLNFY---AL-----------------
Q99XH1_STRP1/14-837----------------...G--SDSF------FYTFTSG-------------LGINFY---AL-----------------
Q9CHA3_LACLA/14-855----------------..GG--SSGF------LYTFTSG-------------LGLNLY---AF-----------------
R6NFF7_9CLOT/15-832----------------...G--QKAL------FFSWEGG-------------LGMNMT---GV-----------------
R7DCE3_9FIRM/22-900----------------IEHK--LSIP------MWDLNIG-------------YGSDIL---TT-----------------

PF09852

Q119E7_TRIEI/30-487----------------LGNH--AAWA------MYPVALF-------------YKIYPS---VY-----------------
Q1CZA2_MYXXD/39-471----------------FNDH--FDPI------LWVAHPL-------------ARIIPP---MW-----------------
Q7U446_SYNPX/31-511----------------LGQH--FTPT------LLLWAPL-------------LGLIGG---.A-----------------
A5GS07_SYNR3/40-521----------------LGQH--YTPL------LLLWAPL-------------VRWLGF---.A-----------------
Q119E6_TRIEI/27-490----------------LGNH--AAWA------VYPLGLF-------------YMIHPD---IH-----------------
Q82RR9_STRAW/82-508----------------LGDH--FSPV------LALLAPL-------------YRVWPA---PV-----------------
Q4J6X7_SULAC/32-488----------------LAIH--PYLI------LFLVIPI-------------YYLFPS---WL-----------------
A5URL3_ROSS1/78-571----------------WGMD--FIPA------ILLIVPF-------------YALFPS---AL-----------------
Q4J7K9_SULAC/43-493----------------LAIH--PYLI------LYILVPL-------------YKAFPS---WL-----------------
Q9HK92_THEAC/39-557----------------FSEH--FSPF------LFVIYPI-------------YWFFPY---VK-----------------
A5GNZ8_SYNPW/38-520----------------LGQH--FTPT------LLLWAPL-------------LGVFGA---.A-----------------
Q4J7K8_SULAC/16-462----------------LGIH--PYFI------MFFLLPI-------------YYFFPS---WL-----------------
A5GR01_SYNR3/37-521----------------LGQH--FTPL------LLLWVPL-------------VALLGP---.W-----------------
Q8F2H0_LEPIN/76-512----------------LSHH--MAPG------ILLLTPF-------------PILFGS---EL-----------------
P73520_SYNY3/35-464----------------LGDH--AAFL------VYPIAIF-------------YKIYPS---VY-----------------
Q7U443_SYNPX/37-518----------------LGQH--FTPI------LALWIPL-------------VGLLGK---.W-----------------
Q7VDJ5_PROMA/39-469----------------MADH--GAWL------LYIPAFL-------------YKIQPS---IH-----------------
A5V1J1_ROSS1/34-511----------------LAGH--FELI------YYAFAPL-------------IALWPD---PR-----------------
Q7U444_SYNPX/29-448----------------LADH--GAWL------LYGTGLL-------------YELIPS---VQ-----------------
Q10XG3_TRIEI/32-516----------------LGQH--FTPA------LLLWLPI-------------YVLFPY---PI-----------------
Q7V4G7_PROMM/40-520----------------LGQH--ANVL------TVLAAPL-------------VALFGR---.W-----------------
Q7V4G8_PROMM/29-457----------------LADH--GAWA------LYLAAIP-------------YHFHAS---VQ-----------------

PF03901

SMP3_YEAST/6-401----------------------ILAM------QFMKVKG-------------TIPWEF---KS-----------------
GPI10_SCHPO/4-414----------------------VA.H------HFIFRYG-------------FLTWEW---..-----------------
ALG9_SCHPO/16-438----------------------PL.H------YLLYGYG-------------LQTWEY---SP-----------------
ALG9_ARATH/48-451----------------------PL.H------YILYKSG-------------FQTWEY---SS-----------------
ALG9_YEAST/10-414----------------------PL.N------LLVRGFG-------------KQTWEY---SP-----------------
ALG12_CAEEL/6-405----------------------THDL------MFHLPTN-------------LSNYDH---SQ-----------------
GPI10_YEAST/16-484----------------------PA.H------WKAFKYG-------------ELTWEW---..-----------------
SMP3_SCHPO/9-412----------------------IFAN------KLFGWKV-------------ELPWEF---TT-----------------
Q9VBV8_DROME/75-498----------------------PL.H------YIINGHG-------------LQTWEY---SP-----------------
PIGB_HUMAN/62-449----------------------VS.H------HMVFNYG-------------YLTWEW---..-----------------
PIGB_DROME/5-396----------------------VA.H------KLTFGYG-------------YLTWEW---..-----------------
ALG9_MOUSE/60-482----------------------PT.H------YLIYGKG-------------FQTWEY---SP-----------------
PIGZ_DROME/18-541----------------------VMTG------DHFRLEH-------------TRTWEF---NN-----------------
YTH3_CAEEL/55-472----------------------PL.H------LFLYGEG-------------FQTWEY---SP-----------------
F4K887_ARATH/41-451----------------------VA.H------RTIFGYG-------------YMTWEW---..-----------------
GPI10_TRYB2/4-432----------------------VA.Y------NMVFGKG-------------HLPWEW---..-----------------

PF09913

Q1MP06_LAWIP/21-414----------------KGEK--VGGS------NLPTSIQ-------------AF....---..-----------------
A4VVV9_STRSY/36-414----------------SRDT--EAMN------ELR....-------------......---..-----------------
A0LS06_ACIC1/16-395----------------PADH--IPYE------AFTVPAT-------------L.....---..-----------------
Q5Z3D8_NOCFA/116-537----------------EIED--DRGV------AYGGVIP-------------PGIDDL---..-----------------
Q5M3E5_STRT2/28-432----------------EQEL--IN..------.......-------------......---..-----------------
A5UMR8_METS3/71-461----------------TTAN--GY..------.......-------------......---..-----------------
A1W3H2_ACISJ/39-436----------------RREE--QDYG------GEIDVAA-------------LE....---..-----------------
Q6AGK9_LEIXX/24-391----------------GIVK--GTCD------AGSRSGH-------------YTV...---..-----------------
A5UN71_METS3/84-467----------------KTPN--GY..------.......-------------......---..-----------------
Q01XM3_SOLUE/38-442----------------GAPR--VPGT------VVLSMMR-------------YPEMGE---R.-----------------
Q83H24_TROWT/46-427----------------GDRP--GLCE------SSGIKDA-------------KKVPTT---IL-----------------
Q9CIZ8_LACLA/68-463----------------EQEK--QPDW------DTVEKY.-------------......---..-----------------
Q2JAW9_FRASC/81-503----------------RIDW--INRN------SRVFALP-------------AGL...---..-----------------
Q0RGM1_FRAAA/18-412----------------RIDW--INRN------SRVFRLP-------------AGL...---..-----------------
A5G180_ACICJ/39-445----------------GHTQ--VSGL------FVNDG..-------------......---..-----------------
Q97N14_CLOAB/17-411----------------KNNS--GIGG------YLPQNLI-------------KT....---..-----------------
A5UKJ8_METS3/70-455----------------YHEN--QGYF------.......-------------......---..-----------------
A8AWZ6_STRGC/67-446----------------SKPL--....------.......-------------......---..-----------------
Q9A0F5_STRP1/71-454----------------NNKK--L...------.......-------------......---..-----------------

PF04922

K5XCQ6_PHACS/29-416----------------..ML--KC.N------LAMLRLT-------------PLLALL---..-----------------
T1G2P1_HELRO/32-429----------------FDVK--TCGN------LYWLRCI-------------NLIFCL---..-----------------
H2T3E9_TAKRU/31-424----------------TGNV--VC.S------TAMLRFI-------------NLLFNC---..-----------------
ALG10_CANGA/63-455----------------LLKS--W.ST------LTILRLV-------------NAFGGL---..-----------------
I1N2G0_SOYBN/25-459----------------SISD--LC.S------AAILRSI-------------NGVLAV---..-----------------
E0V9V1_PEDHC/31-428----------------QYDN--YC.S------VYGLRAT-------------NIIGTL---..-----------------
M0THQ1_MUSAM/25-461----------------TMSS--IC.S------AATLRST-------------NAFVAV---..-----------------
F4R3Q7_MELLP/33-444----------------PYWF--TC.S------INGLRSM-------------NAVLLC---..-----------------
R4GKH2_CHICK/31-425----------------TGTV--VC.S------TGMLRFI-------------NLLISA---..-----------------
G8ZYL6_TORDC/61-452----------------TFTS--W.TA------LTAFRLV-------------NLIGGI---..-----------------
C6H8G6_AJECH/46-531----------------....--...G------ASFFRLG-------------NSIVLF---..-----------------
ALG10_DEBHA/27-407----------------SLVS--VCEN------MNVLRSA-------------NLFGGL---..-----------------
E3RDG0_PYRTT/32-497----------------....--GC.D------TRALRLL-------------NAQAVC---..-----------------
F6RK69_MONDO/31-424----------------SQHV--VC.S------IGMLRFV-------------NLLFSA---..-----------------
F6YIJ5_CIOIN/30-422----------------TGKG--LC.S------LWVLRFF-------------NVIYNT---..-----------------
Q7QC28_ANOGA/28-387----------------...D--AC.S------VYNLRLT-------------SLIAGI---..-----------------
R0ILV6_SETT2/32-500----------------....--GC.E------TRALRIQ-------------NAVALC---..-----------------
U9SYH3_RHIID/26-420----------------STRY--FC.S------TNFLRAT-------------NVLFGI---..-----------------
B3S3F0_TRIAD/21-412----------------GSID--FC.S------VLWLRFH-------------NLIYAT---..-----------------
C5GWH0_AJEDR/43-528----------------....--...G------ASFFRLG-------------NSIILF---..-----------------
W4XA33_STRPU/31-418----------------SLTE--IC.T------VTVLRSL-------------NVLFAV---..-----------------
E7FEB7_DANRE/31-427----------------KGRV--VC.S------TAMLRFI-------------NLLFNS---..-----------------
E3KTL2_PUCGT/33-453----------------PKWF--LC.S------TNHLRWM-------------NAALLC---..-----------------
C4QYK4_PICPG/29-433----------------....--.C.D------TNTLRDI-------------NFVGFV---..-----------------
M4CND4_BRARP/25-460----------------SFSE--AC.S------TSVLRST-------------NAVFAV---..-----------------
C3ZVK1_BRAFL/29-413----------------EVGV--AC.S------TLLLRAT-------------NVLFAV---..-----------------
G8BJE7_CANPC/39-409----------------GVYD--LCRD------YNVLRSL-------------NLLGGI---..-----------------
A9TQ25_PHYPA/25-459----------------SLLE--LC.N------PAVLRSV-------------NLALLL---..-----------------
A7TEV5_VANPO/69-460----------------VFTS--W.ST------LTILRLV-------------NLIGGI---..-----------------
E5R4I1_LEPMJ/32-494----------------....--GC.D------ISSLRVL-------------NTLSLC---..-----------------
S2JIR9_MUCC1/22-407----------------LGYD--LC.T------VNTLRFT-------------NIMFST---..-----------------
F6W8Z6_XENTR/31-423----------------SDSV--AC.S------SGMLRFI-------------NLLFSL---..-----------------
M7P9N4_PNEMU/25-418----------------DIIN--RC.D------LSIFRML-------------NTITGS---..-----------------
K7J4C0_NASVI/51-442----------------...K--LC.S------ITYLRLV-------------NLGLTY---..-----------------
B4L183_DROMO/27-402----------------...N--CC.T------VTGLRLL-------------SLIGAG---..-----------------
ALG10_SCHPO/27-398----------------....--GC.S------NVSLRLI-------------NWLVGV---..-----------------
M2MM25_BAUCO/23-505----------------LSAL--NC.S------LGTLRAG-------------NVLGLI---..-----------------
U4KUC8_PYROM/26-429----------------....--AC.S------PQFLRGI-------------NAFGIA---..-----------------
G1KUP0_ANOCA/31-425----------------SGSI--IC.S------TGMLRFI-------------NLLFSI---..-----------------
C5DSA6_ZYGRC/68-459----------------FFTS--W.ST------LTILRLV-------------NLFGGV---..-----------------
H2AQR8_KAZAF/62-454----------------IFKS--W.SN------LTILRLT-------------NLMGGL---..-----------------
U5H039_USTV1/30-435----------------LRPY--LC.S------TAGLRAV-------------NFLFLS---..-----------------
W5NGQ4_LEPOC/1-392----------------TGEV--VC.S------TAMLRFI-------------NLLFSS---..-----------------
G2QLA0_THIHA/27-468----------------.LLS--EC.T------PFSLRSN-------------NLLATI---..-----------------
AG10B_RAT/31-428----------------SEHV--VC.S------IGMLRFV-------------NLLFSV---..-----------------
S8EM30_FOMPI/28-420----------------..MF--KC.N------LSMLRLT-------------PMLCLA---..-----------------
H9JJA8_BOMMO/32-432----------------...F--PC.T------TYNLRFI-------------NLLASC---..-----------------
ALG10_DROME/27-402----------------...S--LC.T------VTGLRML-------------SLAGAG---..-----------------
ALG10_ASHGO/57-447----------------LLVG--W.NT------LSLLRLS-------------NVIGGL---..-----------------
G0S7Z5_CHATD/97-541----------------.GIL--KC.T------PFSLRYG-------------NLVATL---..-----------------
A0DAU3_PARTE/15-377----------------....--...T------LMACRII-------------NTFIYP---..-----------------
K3Y6Q6_SETIT/25-460----------------TFDV--IC.S------TAALRST-------------NVVMAM---..-----------------
C5DDK7_LACTC/53-443----------------LLTS--W.SS------LTILRLT-------------NLFGGM---..-----------------
A0A0E1RWP6_COCIM/38-522----------------....--...T------AAYLRCA-------------NGFILL---..-----------------
F8PP28_SERL3/26-407----------------..MF--KC.T------LPLLRLT-------------ATLTLL---..-----------------
D2VB91_NAEGR/36-412----------------SIRS--YMGT------SASFRSL-------------NLIFTL---..-----------------
B0CP31_LACBS/23-410----------------..LF--KC.S------LPMLRLT-------------TLLTLL---..-----------------
D6W779_TRICA/32-408----------------...D--LC.S------SYWLRLT-------------SLVSSF---..-----------------
H3AZ27_LATCH/33-427----------------TENI--LC.S------TGFLRFT-------------NLLFST---..-----------------
W1QI63_OGAPD/28-389----------------....--...S------IANLRLL-------------NFIGGV---..-----------------
Q8L638_ARATH/25-461----------------SFSE--AC.S------TSVLRST-------------NAVSAV---..-----------------
U5G642_POPTR/25-462----------------LFSE--LC.S------TPILRSV-------------NGVLAI---..-----------------
E1ZJK4_CHLVA/29-455----------------RPAA--LC.G------TAVLRAT-------------NLLFAA---..-----------------
A3LRZ3_PICST/40-418----------------ESNY--YCGN------YDILRSV-------------NLL.GF---..-----------------
W4W5T7_ATTCE/51-434----------------...N--LC.D------ITYMRGI-------------NVLGAF---..-----------------
G3B8T7_CANTC/34-406----------------PIET--VCEN------HNILRLV-------------NLIGGE---..-----------------
E9G0X2_DAPPU/10-399----------------LSKN--LC.E------THHLRLT-------------NVVLSL---..-----------------
T1KW23_TETUR/49-426----------------DPNR--KC.P------VPLVRFI-------------NLLFAV---..-----------------
B4N5D4_DROWI/27-400----------------...N--YC.T------VTGLRLL-------------SLTGAG---..-----------------
A5DZP8_LODEL/41-412----------------MTHG--LCQN------DNVLRSL-------------NLSGGL---..-----------------
K5XJ27_AGABU/23-409----------------..LL--KC.N------ASMLRLT-------------TLLSLL---..-----------------
ALG10_KLULA/84-474----------------FITN--W.ST------LTVLRLT-------------NLIGGV---..-----------------
K1R9X9_CRAGI/8-410----------------GVDT--AC.S------VAGLRLI-------------NILFQA---..-----------------
M3JE22_CANMX/36-392----------------.GNA--VCMN------ANVLRSV-------------NLLGGL---..-----------------
J7S1V6_KAZNA/74-466----------------IFKS--W.ST------LTILRLV-------------NLFGGV---..-----------------
H2Z276_CIOSA/25-431----------------GGKS--LC.T------VWSLRFI-------------NIMFNL---..-----------------
J9LAG9_ACYPI/57-491----------------RGND--PC.S------LVALRAV-------------NAVGAP---AC-----------------
M1AHM2_SOLTU/25-464----------------SFSD--AC.S------SSILRSS-------------NGVLAV---..-----------------
G8YR70_PICSO/63-445----------------KLDE--VCQQ------YWVLRSV-------------NLLGGT---..-----------------
G7E9B0_MIXOS/25-410----------------..RL--TC.S------TAFLRSH-------------NVALAC---..-----------------
U3KM68_RABIT/35-431----------------SEHV--VC.S------IGMLRFV-------------NLLFSV---..-----------------
N1PN61_DOTSN/24-512----------------....--GC.S------ITALRAA-------------NVICLV---..-----------------
M7WKK8_RHOT1/28-438----------------ATFD--PC.A------LPFLRAV-------------NLFLSL---..-----------------
B4GZN2_DROPE/27-402----------------...N--YC.T------VTGLRLL-------------SLIGAG---..-----------------
E2C163_HARSA/25-409----------------...N--LC.N------IIYIRCV-------------NLIGTC---..-----------------
D5GMM3_TUBMM/58-479----------------....--KC.T------PALLRSV-------------NAWGIA---..-----------------
B4J2W4_DROGR/27-402----------------...N--GC.S------VTGLRLL-------------SLAGAG---..-----------------
H2MXS0_ORYLA/31-430----------------TGEV--VC.S------TAMLRFI-------------NLLFNC---..-----------------
G3Q5J3_GASAC/31-430----------------TGQV--VC.S------TAMLRFV-------------NLLFNC---..-----------------
Q7F8Z1_ORYSJ/25-460----------------AFDA--LC.T------TALLRST-------------NVIMAM---..-----------------
A0A068XAK8_HYMMI/1-361----------------....--...T------VENFRFL-------------NCIIAG---..-----------------
I1G516_AMPQE/28-420----------------FAKD--LC.I------TSLLRAQ-------------NVLFSL---..-----------------
B4LC57_DROVI/27-402----------------...N--YC.T------VTGLRLL-------------SLIGAG---..-----------------
G4TLE7_PIRID/31-425----------------..MF--KC.R------LPLLRLV-------------PALHLL---..-----------------
C5MA37_CANTT/36-393----------------.GYP--ACMD------SNILRSV-------------NLIGGL---..-----------------
H6BMA7_EXODN/33-480----------------....--...S------VNEWRST-------------NVLLLY---..-----------------
G3AQ79_SPAPN/26-394----------------G..G--DCKD------YNLLRSL-------------NLVGGL---..-----------------
K0KGY8_WICCF/63-454----------------LPIN--P.IG------LGSLRLL-------------NTIGGT---..-----------------
M2PXH0_CERS8/29-421----------------..ML--KC.N------LAMLRLT-------------PLLALL---..-----------------
M3ZWU8_XIPMA/31-428----------------TGSV--VC.S------TAMLRFT-------------NLLFNC---..-----------------
C5FIZ5_ARTOC/29-525----------------....--...S------ASVLRCI-------------NGLVLF---..-----------------
G0W9V3_NAUDC/65-461----------------FIKS--WFSD------LTTLRLT-------------NLFGGL---..-----------------
I2GZK7_TETBL/25-415----------------YIFN--W.ST------RCILRMT-------------NLLGGA---..-----------------
Q54Z56_DICDI/36-464----------------IWIS--HC.S------VVVLRSF-------------NVFCLI---..-----------------
D7THP5_VITVI/25-464----------------SFSH--VC.S------TAILRSV-------------NGVLAV---..-----------------
B2AS64_PODAN/95-577----------------..TL--TC.E------TSTLRFH-------------NLSVVL---..-----------------
L8G022_PSED2/46-496----------------..RA--GC.T------ATELRGI-------------GGVALA---..-----------------
S6DZ28_ZYGB2/63-454----------------LFTS--W.TS------LTLLRMV-------------NLLGGT---..-----------------
G7YEG4_CLOSI/35-428----------------....--...N------MIHFRCF-------------SALVST---..-----------------
E4UQE0_ARTGP/54-531----------------....--...S------ASVLRCI-------------NGLVLF---..-----------------
A0A087VZH7_ECHMU/65-433----------------....--...C------VENFRFL-------------NCFIGG---..-----------------
S9XAR5_SCHCR/40-407----------------....--GC.H------LVALRSL-------------NFVLGV---..-----------------
B0WRU3_CULQU/28-412----------------...K--AC.S------VYFLRLT-------------SAVASI---..-----------------
ALG10_YARLI/35-468----------------SESE--AC.S------TLSLRAV-------------NLMAVV---..-----------------
J4GMT8_FIBRA/28-420----------------..MF--KC.N------LPMLRLT-------------PLLFLL---..-----------------
B3M3X6_DROAN/27-402----------------...N--LC.S------VTGLRLL-------------SLAGAG---..-----------------
E3M395_CAERE/43-392----------------....--...C------GGYERYA-------------NSILLF---FA-----------------
M2QYS3_COCSN/32-490----------------....--GC.E------TRLLRMQ-------------NAVALC---..-----------------
V2X8L4_MONRO/23-410----------------..MF--KC.N------LAMLRLT-------------TTLSLL---..-----------------
B7PY71_IXOSC/28-414----------------VAAD--LC.T------PFYLRCT-------------NILLML---..-----------------
K1WSG6_MARBU/64-554----------------.AYG--NC.S------PAILRSF-------------NIFALI---MV-----------------
ALG10_CANAL/39-418----------------GGHL--TCFN------DNVLRSI-------------NLIGGV---..-----------------
T1IQU4_STRMM/35-428----------------TGIN--FC.D------VFNLRLT-------------NLFFSI---..-----------------
G8JPI5_ERECY/57-447----------------WVTS--W.NI------LSILRFA-------------NLVGGM---..-----------------
W5KCZ3_ASTMX/32-428----------------SGAV--VC.S------TAMLRFI-------------NLLFNC---..-----------------
D8PKT8_SCHCM/23-405----------------..IV--KC.A------LPTLRLT-------------PLLALL---..-----------------
M7ZBL2_TRIUA/25-435----------------AFDP--LC.T------TALLRST-------------NVIMAM---..-----------------
J3LZC5_ORYBR/25-460----------------AFDA--LC.T------TALLRST-------------NVIMAM---..-----------------
D8RLA5_SELML/25-447----------------PGMD--LC.T------LNALRSI-------------NILLSL---..-----------------
ALG10_YEAST/66-458----------------IFKS--W.ST------LTILRLV-------------NLLGGI---..-----------------
G8BNV4_TETPH/64-455----------------MFTS--W.ST------TTLLRLV-------------NLIGGT---..-----------------
A5DGH1_PICGU/27-396----------------.NAD--YCSD------YDVLRSL-------------NLLGGT---..-----------------
G0VGC7_NAUCC/66-459----------------FIKS--W.SD------LTILRLV-------------NFIGGM---..-----------------
W5JWB9_ANODA/28-387----------------...N--AC.S------VYGLRLT-------------SLIAAI---..-----------------
Q170T5_AEDAE/28-413----------------...Q--AC.S------IYHLRMI-------------SLIASI---..-----------------
C4XWR1_CLAL4/27-397----------------.VSA--PCGT------.TMLRAL-------------NLLGGT---..-----------------

PF02364

FKS1_YEAST/808-1631----------------LHPV--EWEC------FVKDTKI.............LAEETA---AY.................
G0WGB2_NAUDC/693-1553----------------LYPS--DWKC------FIRDTKL.............VDKQLE---AD.................
BGS4_SCHPO/872-1706----------------LHPV--EWDC------FVKDTKI.............LVEENA---PY.................
A5DFP6_PICGU/617-1414----------------LSSS--DWTN------FVRDTRVADDEKFGCRFPIPLTSEGT---TD.................
D8R536_SELML/856-1616----------------IFPD--EWIN------FLERMSS.............LGIK.E---SD.................
G3BF86_CANTC/689-1496----------------LNKS--DWNA------FVQDTKI.............LTNIPD---RP.................
S2JMJ1_MUCC1/751-1581----------------LHPF--EWDN------FVKDTKV.............LADEEG---QE.................
Q6C549_YARLI/838-1663----------------LHPV--EWDC------FVKDTKI.............LAEETA---GF.................
BGS2_SCHPO/844-1666----------------LHAN--EWKC------FVRDTKI.............LAEEDA---LS.................
C5DDB6_LACTC/685-1519----------------LYPT--EWEC------FVRDTKL.............IAVENC---SI.................
C5DVI4_ZYGRC/728-1590----------------LHPL--EWDC------FVRDTKL.............LNIEKN---AV.................
G8BP05_TETPH/703-1537----------------LYSE--EWDC------FIKDTKL.............LKMEKD---AL.................
F4RFS0_MELLP/756-1575----------------LHPV--EWDN------FVRDTKI.............LAEEAN---VF.................
A7TG32_VANPO/694-1542----------------LHST--EWNC------FVRDTKL.............LKTEKD---AI.................
B9RVZ7_RICCO/412-1177----------------IYDD--EWKN------FMERMRR.............EGMVND---KE.................
E6ZX94_SPORE/765-1584----------------LHPV--EWDN------FVKDTKI.............LAEESQ---GF.................
F0XEB1_GROCL/867-1692----------------LHPH--EWDC------FVKDTKI.............LADETA---QF.................
A3GFC1_PICST/627-1453----------------LHPN--DWEC------FVQDSKV.............LQQISS---AN.................
H2B091_KAZAF/695-1551----------------LHPT--EWNC------FVRDTKL.............LNQERN---SS.................
K0KXK3_WICCF/839-1738----------------LYPT--EWDC------FVKDTKL.............LATNNG---SLPDTYVKYDLTNRWKNDL
G0VE27_NAUCC/691-1546----------------LYPS--EWLN------FVRDTKS.............LNKPSF---KK.................
M0Z2P0_HORVD/795-1572----------------IYPD--EWEF------FVERMKR.............EGMSDM---KE.................
Q5K6T7_CRYNJ/779-1594----------------LHPV--EWDN------FVRDTKI.............LAEESD---AF.................
I1MEJ0_SOYBN/899-1668----------------IYED--EWKN------FMERMHR.............EGLKDE---EA.................
Q75EM6_ASHGO/644-1429----------------LYAD--DWKT------FIQETGS.............LYNDDD---EK.................
A3GH41_PICST/602-1410----------------LHPL--EWSC------FVRDTKL.............LAEEFD---TE.................
C5M4K6_CANTT/600-1409----------------LHPL--EWSC------FVKDTKM.............LAEEFE---TD.................
G3AGW3_SPAPN/626-1428----------------LYPS--EWEA------FVKDSKM.............LETIDI---DD.................
G8B602_CANPC/590-1379----------------LHSK--EWSS------FVKDSKM.............IQSLDD---DD.................
L8WXK6_THACA/691-1484----------------LHPL--EWDN------FVRDTKI.............LAEEVD---VP.................
W1QEZ3_OGAPD/758-1567----------------LYPL--EWHN------FVRDTKL.............LAKESE---LN.................
S2JUI0_MUCC1/639-1467----------------LHAV--EWEN------FVKDTKM.............LVDDDD---RR.................
A9RK32_PHYPA/857-1633----------------IFPE--DWLN------FLERMKK.............LELN.E---SE.................
I1IFT6_BRADI/1065-1817----------------IYPD--EWKN------FLERVEC.............KTEEEL---RE.................
Q6BYS5_DEBHA/725-1546----------------LHST--DWEL------FVEDTKI.............LSLVSS---QP.................
K4B948_SOLLC/878-1645----------------IYND--EWEN------FMERMRT.............EGMKDE---RE.................
CALSB_ARATH/870-1637----------------IYED--EWVN------FLERMRR.............EGAENE---ND.................
K5X5R3_AGABU/768-1585----------------LHPV--EWEN------FVKDTKI.............LAEESA---MF.................
Q6CDD3_YARLI/840-1684----------------LHAN--EWDN------FVCDSKL.............MHDFMH---NN.................
W1PHJ3_AMBTC/904-1670----------------IFPD--EWLN------FLERMRR.............EGMKDQ---GE.................
A5DBZ8_PICGU/697-1497----------------LHPR--EWES------FVCDTKM.............LAEEYD---SE.................
J7RLI4_KAZNA/694-1544----------------LHPK--EWEC------FIRDTKL.............LMSELN---IS.................
B9I122_POPTR/880-1647----------------IYED--EWNN------FMERMRR.............EGTENE---NE.................
Q4WLT4_ASPFU/845-1663----------------LHPH--EWDC------FVKDTKI.............LADETS---QF.................
K2RW51_MACPH/795-1619----------------LYPH--EWDC------FVKDTKI.............LAEEST---GV.................
FKS3_YEAST/694-1542----------------LHPT--EWEC------FVKDTKL.............LSMEKS---FL.................
B6K1V9_SCHJY/528-1348----------------LYPV--EWKN------FVADTKM.............LAEESK---GS.................
C4R051_PICPG/700-1508----------------LHPA--EWVN------FVEDTKI.............LAEEIN---SS.................
F8QGW8_SERL3/687-1503----------------LHPV--EWDN------FVKDTKI.............LAEESD---VV.................
Q5A9Y9_CANAL/588-1367----------------LHSK--EWDS------FVQDSKM.............IQTIKE---MD.................
CALSC_ARATH/876-1645----------------IYAD--EWKN------FKERMHR.............EGIKTD---SE.................
A9TZ19_PHYPA/865-1623----------------IFPE--DWLN------FLERMKK.............KGLL.E---LN.................
W1QB78_OGAPD/694-1512----------------MLPH--EWDY------FVRDTKI.............ISYSEG---EK.................
G8Y1P4_PICSO/734-1542----------------LHQL--EWAC------FVKDTKM.............LAEEFD---TD.................
M7P3D9_PNEMU/884-1710----------------LHPV--EWDC------FVKDTKI.............LAEETS---LY.................
Q751P2_ASHGO/697-1537----------------LHPT--EWEC------FVHDTKL.............LAIEKS---AR.................
C4QVL3_PICPG/679-1490----------------IYPI--EWGC------FVNDTKL.............MAHATG---DY.................
G8ZYC9_TORDC/696-1542----------------LHSA--EWDS------FVRDTKL.............LSMEKD---AT.................
K7M2P2_SOYBN/849-1612----------------IYDD--EWKN------FMERMKR.............EGMNNE---RD.................
Q6FIJ9_CANGA/752-1597----------------LHPE--EWDC------FVKDTKI.............LSAEKK---AD.................
S9X5V3_SCHCR/777-1593----------------LYPH--DWNC------FVQDTKL.............MAGETG---PL.................
B6K096_SCHJY/781-1599----------------LYPN--EWEY------FVRDTKL.............LAGEMD---AD.................
C7ZN13_NECH7/785-1607----------------LHPH--EWSC------FVRDTKA.............LAGEDE---PP.................
G8JPJ3_ERECY/666-1455----------------LYAD--DWKT------FIQETGS.............LYNEDE---EK.................
Q6CTB0_KLULA/691-1518----------------LHPT--EWEC------FVRDSKL.............LAIENG---HL.................
G3BBN7_CANTC/598-1405----------------LHPL--EWSC------FIKDTRL.............LAEEFD---TD.................
G8YKZ4_PICSO/698-1523----------------LHKT--DWEL------FVEDTKL.............LTLISS---QQ.................
I1HRP2_BRADI/889-1659----------------IYED--DWAN------FLERMRR.............EGMVND---DG.................

PF04602

V9XJW7_9NOCA/21-675----------------..VG..SDGG......TLVSTIP-------------SGSPDA...TA-----------------
H6MU20_GORPV/33-681----------------......AVGKTATGSTVVVSTMP-------------RGAQKA...TD-----------------
Q5Z3F6_NOCFA/13-659----------------.......GAP......TLLSTIP-------------VASGQA...TS-----------------
W5T763_9NOCA/25-694----------------..LP...QGG......MLLNTAP-------------PEGDRA...AL-----------------
D0LC62_GORB4/25-672----------------..LP..ANGG......VLLSTIP-------------EQGQDS...AA-----------------
F5YU82_MYCSD/4-645----------------..LP..AEGG......TLLSTAP-------------AKGKDA...AL-----------------
A4FLJ6_SACEN/6-630----------------..LG..GDG.......TVLATAP-------------PTSD.....AL-----------------
EMBB_MYCLE/22-673----------------..LP..PSGG......VVLGTAP-------------KQGKDA...NL-----------------
E9T230_RHOHA/21-668----------------..LT..EKGG......ALVSTVP-------------TSAGRA...EA-----------------
A4F676_SACEN/36-675----------------..LDARTDGRPG....TLLSTNP-------------PNSDYG...NL-----------------
D6ZA32_SEGRD/18-683----------------..QAGRAEGS......TLFSTIP-------------PSSSLA...TT-----------------
EMBC_MYCTU/27-682----------------..LA..GSQNTGKT..VLLSTVP-------------KQAPKA...VD-----------------
W5T6N4_9NOCA/11-663----------------......LPAG......TVLSTVP-------------ADAPDA...SA-----------------
B1VE75_CORU7/37-709----------------..LN..DGQS......NVLSTVP-------------EGSKEE...TL-----------------
W5WNE4_9CORY/27-693----------------..LN..PGAT......TVLSTVP-------------QDAQEA...TL-----------------
V9XEG0_9NOCA/30-675----------------..AL..PDGG......TVFSTLP-------------AGAPDR...ER-----------------
B1MEM1_MYCA9/17-667----------------..AP..ADGA......VILGTAP-------------PEGKEA...AL-----------------
F8DYG1_CORRG/20-684----------------..LN..KGET......SVLSTVP-------------ENSTEP...TL-----------------
U3GXX2_9CORY/12-670----------------..LN..EGQS......LVLGTLP-------------ADSKDP...TA-----------------
A1TGU6_MYCVP/6-653----------------..LP..GDDG......VVFSTIP-------------ADGIDA...GR-----------------
F6EEB9_AMYSD/14-665----------------..LP..DEGG......LVAATIP-------------AQSPDS...QR-----------------
Q5YYW4_NOCFA/29-683----------------..LG..PDGG......VLTATGP-------------KGAPDL...ER-----------------
D5UMC1_TSUPD/6-651----------------..QPTDRETV......LVATTPP-------------PAGDRA...RT-----------------
Q745M3_MYCPA/11-658----------------..LP..PEGG......VILSTGP-------------KKGKDA...AL-----------------
V9XIW6_9NOCA/28-673----------------..MP..GDGG......MLLATAP-------------TNGQDA...AL-----------------
J9S8T7_9ACTN/54-705----------------..LP..ASGG......VLLSTVP-------------EGGAEA...GK-----------------
C4LG43_CORK4/44-710----------------..LN..DNQT......DLLSTLP-------------HDSRFV...AS-----------------
A0R614_MYCS2/24-675----------------..LP..PEGG......LVFGTAP-------------AEGRDA...AL-----------------
C0ZLV7_RHOE4/28-666----------------..LG..GSGG......TLLSTMP-------------NGAPDR...NA-----------------
V5X6X3_MYCNE/4-651----------------..LP..ADGG......LVFSTIP-------------PGGIDA...GR-----------------
H6MU24_GORPV/10-674----------------..LR..GGQS......VLLSTTP-------------KGAEKS...PE-----------------
W5XXY2_9CORY/8-674----------------..LR..TDQQ......LVFGTLP-------------QDSEKA...TS-----------------
H6RD31_NOCCG/25-671----------------..LA..DSGG......VVFSTIP-------------RQSADM...ER-----------------
H5X1D6_9PSEU/4-623----------------..LG..ADARVSTVS.TVLATTA-------------SDDLDVDQHTS-----------------
D5UNZ8_TSUPD/31-682----------------..LA..QKGG......VALSTLP-------------IGTSQA...RE-----------------
D5UNZ7_TSUPD/12-675----------------..LP..GGVG......TLVATGP-------------SDSPDT...IR-----------------
W5TDC8_9NOCA/23-685----------------..LP..AQGS......TLTATMP-------------AGAPDL...ER-----------------
Q745M2_MYCPA/11-679----------------..LP..ADGG......LVVSTLP-------------PGGMDA...GK-----------------
F6EEB8_AMYSD/16-671----------------..LP..DEGG......LVAATIP-------------AQSPDS...QR-----------------
D0LC64_GORB4/31-681----------------..EV..RSGTPGAARVVVLSTVP-------------AGGLRA...AD-----------------
D5UNZ9_TSUPD/37-686----------------..LP..PEGG......TLLRTLP-------------SDGPRP...GL-----------------
E9T231_RHOHA/29-674----------------..MP..EAGG......ILLATAP-------------AQGEDA...PV-----------------
L0J7Q5_MYCSM/5-653----------------..LP..PAGG......MVLGTAP-------------KDGKQA...AL-----------------
K0ELF6_9NOCA/24-672----------------..LA..DTGG......VVLSTIP-------------RQSPDL...ER-----------------
H6MU21_GORPV/21-696----------------..LP..AGGG......VLVSTVP-------------ENGAEA...GK-----------------
L0J471_MYCSM/5-652----------------..MP..AAGG......VVLSTNP-------------PGGIQA...TR-----------------
D7WBK3_9CORY/39-680----------------..LA..PGQS......NVLSTLP-------------VDSTEA...LD-----------------
C1A0M7_RHOE4/26-667----------------..LA..ATGG......TLVSTAP-------------PGAADA...RR-----------------
Q6NK78_CORDI/12-664----------------..LR..KDQD......LILGTLP-------------ANSEDA...GA-----------------
D6ZD22_SEGRD/22-677----------------..LP..EEGG......NLLSTAP-------------ARGKDN...RV-----------------
H6R7H1_NOCCG/16-659----------------..LP..AQGG......MLLATAP-------------PQGDRA...AL-----------------
G8RNM8_MYCRN/11-660----------------..LP..PAGG......LVVSTVP-------------SNGIDA...SR-----------------
A0R613_MYCS2/6-652----------------..LP..ADGG......VVFSTNP-------------AGGIEA...GR-----------------
EMBA_MYCLE/11-678----------------..LP..DSVG......LVVSTLP-------------SGGVDT...GK-----------------
B1MEM2_MYCA9/16-665----------------..LP..ASGG......VVLSTSP-------------DGGFEA...SR-----------------
Q0S9C1_RHOJR/40-687----------------..LP..PQGG......ILLATAP-------------AQGEGA...AL-----------------
E9SYL2_RHOHA/31-680----------------..L...DSGG......ALVATMP-------------SGAPGA...ER-----------------
D0LC65_GORB4/7-654----------------..LP..AAGG......VLLSTVP-------------ENGAEA...GK-----------------
J9S5V1_9ACTN/37-692----------------..TP..DDAST.....VVLSTMP-------------AAAAAA...RD-----------------
W5TPG9_9NOCA/25-684----------------..LS..AHGG......VLASTLP-------------SGAPQL...EK-----------------
Q0SFU9_RHOJR/35-682----------------..LA..DRGG......ILTSTAP-------------AGAADA...GK-----------------
D0LC63_GORB4/10-666----------------PALP..DGAG......VIVGTMP-------------TAAAKS...KA-----------------
C3PJ41_CORA7/15-655----------------..LR..DGQD......LLYGTVP-------------PESKKA...SN-----------------
A0R612_MYCS2/13-668----------------..LV..GPENRNRS..VLLSTVP-------------KQAPKA...ID-----------------
Q0S9C0_RHOJR/14-655----------------..LG..PDGG......TVVSTLP-------------NRAPDF...EK-----------------
B1MEM5_MYCA9/31-682----------------..LD..AHNN......VLLSTVP-------------KQAPNA...VD-----------------
D0LC66_GORB4/32-701----------------..LG..DNGS......VLLSTLP-------------KQAEKS...GE-----------------

PF04188

GPI18_YEAST/2-433----------------------FWNK------LLSWDSV-------------FFIKNI----------------------
PIGV_HUMAN/8-493----------------------LGG.------LSHWDAE-------------HFLF..----------------------
Q6NKT6_ARATH/13-489----------------------LEN.------SVVWDSV-------------YFLR..----------------------

PF05007

GPI14_YEAST/127-386--------------------------------------------------------------------------------
GPI14_SCHPO/112-368--------------------------------------------------------------------------------
PIGM_TRYB2/134-410--------------------------------------------------------------------------------
PIGM_RAT/140-408--------------------------------------------------------------------------------
Q17515_CAEEL/146-405--------------------------------------------------------------------------------
Q9W2E4_DROME/177-450--------------------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379----------------T.FR-HSPLL------LALFSTI-------------......----------------------
Q5CYY5_CRYPI/10-436----------------KRVN-FPAVF------MELISGL-------------C.....----------------------
B6AHL5_CRYMR/12-437----------------N.IR-FPVLF------LALFNDW-------------......----------------------
B9RC32_RICCO/30-452----------------M.YH-GSPLL------LSVL...-------------GPL...----------------------
B9GKM7_POPTR/14-432----------------M.YH-GSPLL------LSLL...-------------GPL...----------------------
A9TIH7_PHYPA/73-514----------------A.YH-GSPLL------LSLI...-------------GPV...----------------------
B4N1B7_DROWI/10-386----------------L.VH-ESPLV------LKGLSWI-------------FLN...----------------------
B4KI55_DROMO/10-386----------------L.VH-ESPLL------LKALSGI-------------LIN...----------------------
Q16H22_AEDAE/9-388----------------L.YH-QNPFV------LVSVWFL-------------MEK...----------------------
B0W4N5_CULQU/8-388----------------L.YH-QNPFI------LVSLWYL-------------MQK...----------------------
Q7Q3W6_ANOGA/8-396----------------V.YH-KNPLI------LHASRWL-------------LDN...----------------------
B7QL74_IXOSC/11-391----------------V.FH-EPPLS------LALYDGL-------------......----------------------
Q4RLI5_TETNG/10-394----------------V.FH-ETPLI------IYLFHFV-------------V.....----------------------
Q28CK0_XENTR/10-394----------------L.FH-ETPLI------LYLFHFL-------------V.....----------------------
A7S3Y0_NEMVE/14-406----------------V.VH-ESPLV------LLLFHAV-------------R.....----------------------
Q54T45_DICDI/55-469----------------A.YH-QPPLV------LLLFYPF-------------VNSINI----------------------
Q758M8_ASHGO/10-356----------------V.VH-HLPLL------VTLMSVV-------------......----------------------
C5DB98_LACTC/10-356----------------V.MH-HAPLL------VALMSTF-------------......----------------------
Q6CPH2_KLULA/10-358----------------V.VH-HVPLL------VALMAFV-------------......----------------------
C5DUS6_ZYGRC/10-359----------------V.VH-HPPLL------VAFMSLI-------------......----------------------
A7TF02_VANPO/11-360----------------V.VH-QSPLL------VYFIAFF-------------......----------------------
Q6FSI7_CANGA/9-374----------------V.VH-HSPLL------IAFMSVI-------------......----------------------
C5MHK2_CANTT/9-395----------------I.NN-HPPLL------VILLNFI-------------NC....----------------------
Q5AGH5_CANAL/13-440----------------V.NH-TPPIL------IVLLSFL-------------GN....----------------------
A5E2K6_LODEL/111-490----------------V.NH-HPPLL------VTVLSLV-------------......----------------------
Q6BPY5_DEBHA/9-390----------------V.NH-HPPLL------VILLNLI-------------D.....----------------------
A3LVF4_PICST/9-390----------------V.NH-HPPLL------VVLLSLL-------------D.....----------------------
C4Y9V1_CLAL4/8-389----------------L.VH-HPPLL------VAIFRVL-------------S.....----------------------
C5FSQ4_ARTOC/12-388----------------V.FH-QAPIL------LPLFALI-------------......----------------------
B6H480_PENCW/12-387----------------V.FH-QAPLL------LPLFALL-------------......----------------------
A2QI87_ASPNC/12-388----------------V.FH-QAPLL------LPLFSLL-------------......----------------------
B6QEM6_PENMQ/12-390----------------V.FH-QAPLL------LPIFALL-------------......----------------------
B2WBA6_PYRTR/13-388----------------V.FH-QAPLL------LPLFSLL-------------......----------------------
B2A9S5_PODAN/16-388----------------V.YH-QAPLF------LPLFSLL-------------......----------------------
Q6C5L4_YARLI/7-382----------------I.FH-QSPLL------LGAVSAV-------------......----------------------
B0D118_LACBS/9-373----------------T.FR-HSPLL------LATFATI-------------LPT...----------------------
PIGU_SCHPO/10-372----------------V.FY-QSPLL------LILNYCC-------------......----------------------
B6K154_SCHJY/14-372----------------V.FF-QSPFI------LLLHTCL-------------......----------------------
Q22672_CAEEL/31-382----------------N.MH-FPPLT------LHLFRFL-------------......----------------------
A8X654_CAEBR/27-380----------------N.MH-FLPLT------LYVVRYL-------------......----------------------
Q01AL0_OSTTA/12-375----------------A.YH-GHPAF------VYVGGTA-------------......----------------------
C1EBB5_MICSR/13-406----------------A.LH-APPLY------LALVGPL-------------......----------------------
C1MV77_MICPC/13-431----------------A.LH-APPLL------LAALAPR-------------IASAP.----------------------
C5L3N8_PERM5/23-419----------------L.FH-QPPLV------LYLFSTT-------------......----------------------
Q4YTZ9_PLABA/82-516----------------V.LR-INPIF------LSFLHFI-------------IFNEKK----------------------
Q8IE19_PLAF7/127-560----------------V.IR-INPIF------LKILHFL-------------LFKPIK----------------------
B3L8S4_PLAKH/95-534----------------T.VR-INPLL------LKALQFV-------------LFREIP----------------------
A0DGJ7_PARTE/1-357----------------G.IF-QKPLI------VYGLNLI-------------......----------------------
B8C4L2_THAPS/71-579----------------TRIV-SPPLV------VAFLGET-------------LVC...----------------------
B4Q6V7_DROSI/10-386----------------L.VH-ESPLI------LSALSGL-------------F.....----------------------
G3HAP2_CRIGR/11-394----------------V.FH-ETPLI------IYLFHFL-------------I.....----------------------
J4TTL1_SACK1/11-359----------------V.VH-HPPIL------VFFLSLF-------------......----------------------
Q5KP79_CRYNJ/19-375----------------T.FY-HSPIY------LVLFSHV-------------IP....----------------------
Q7SFC3_NEUCR/18-392----------------V.YH-QAPLL------LPIFNLL-------------......----------------------
Q94K70_ARATH/25-442----------------M.YH-GSPLL------LSILGPL-------------TV....----------------------
V4YHY4_TOXGO/76-514----------------V.YR-QQPLV------FLSLKWL-------------TGAGR.----------------------

PF09594

PIME_MYCS2/91-321------------------FT.YPPFA------AIVFYPL-------------.H....----------------------
A0JZG9_ARTS2/73-321------------------FT.YPPFA------ALLFALL-------------.A....----------------------
Q73YN6_MYCPA/82-326------------------FT.YPPLA------AIVFCPF-------------.A....----------------------
E0TET4_PARBH/112-335------------------LL.YPPTF------ALLMSPL-------------.K....----------------------
Q1QK36_NITHX/92-360------------------FL.YPPLS------AILLAIP-------------.S....----------------------
Q1DFL5_MYXXD/100-338------------------FK.YAPIT------APLFLPF-------------.T....----------------------
Q1LAW9_RALME/87-313------------------WP.YPPTF------LLVVLPL-------------.G....----------------------
Q2J8W8_FRASC/88-337------------------FT.YPPIA------AVLFTPF-------------.A....----------------------
Q9HN16_HALSA/81-322------------------YV.YPPVA------VALFVPQ-------------.A....----------------------
Q6N414_RHOPA/73-354------------------YH.YPPTF------ALLMGPF-------------.AHPLD----------------------
Q8KF88_CHLTE/91-313------------------WA.YPPSF------YFVVLPL-------------.A....----------------------
Q82C69_STRAW/73-314------------------AT.YPPFA------ALLFTPL-------------.T....----------------------
A6W4J4_KINRD/75-318------------------FT.YPTFS------AVLSIPL-------------.A....----------------------
Q8NNL7_CORGL/75-325------------------FT.YPPFG------ALVFTPL-------------......----------------------
A6LI36_PARD8/70-300------------------FL.YGIPF------TAIIAPF-------------.S....----------------------
Q0S7Q3_RHOJR/72-303------------------FI.YAPFA------AILFAPM-------------.A....----------------------
Q0S430_RHOJR/96-330------------------FT.YPPFA------ALVFFPL-------------.H....----------------------
AFTC_MYCS2/90-325------------------YL.YPPGG------TLLLAPF-------------.G....----------------------
Q8KF86_CHLTE/520-743------------------WF.YPPSY------YLLILPL-------------.A....----------------------
A4X3Z6_SALTO/69-305------------------FT.YPPFG------ALLLSPF-------------.A....----------------------
A5FWG6_ACICJ/133-359------------------YF.YPPPS------LLTTLPL-------------......----------------------
Q8EXK5_LEPIN/120-368------------------YI.YPPTF------AFLLIPI-------------.S....----------------------
Q6NG43_CORDI/98-348------------------YL.YSPGA------TALLSPI-------------.G....----------------------
A4F662_SACEN/84-314------------------WV.YPPFA------LLPLAPF-------------.A....----------------------
A4YMG5_BRASO/52-323------------------FL.NPLIY------LLPYVVR-------------.H....----------------------
Q8FNR9_COREF/132-368------------------FT.YPPIA------AVVFTPL-------------.L....----------------------
Q8FNS1_COREF/85-333------------------FI.YPPIG------AALFAPF-------------.GY...----------------------
Q2IKA8_ANADE/104-327------------------WL.YPPQA------LLVVYPL-------------.A....----------------------
Q8NNL6_CORGL/93-341------------------FI.YPPIG------AILFAPW-------------.GY...----------------------
A7I755_METB6/60-298------------------FT.YPPHT------LFFFWLL-------------.Q....----------------------
Q1AS45_RUBXD/75-307------------------NL.NPPLW------VLLSAPL-------------.G....----------------------
Q0SHP5_RHOJR/98-332------------------FT.YPPLA------AVVFSPL-------------.S....----------------------
A1TAY8_MYCVP/79-323------------------FT.YPPLA------AVAFAPF-------------.A....----------------------
Q0KDP9_CUPNH/92-320------------------WV.YPPTF------LLFVMPL-------------.S....----------------------
Q7MTZ4_PORGI/65-295------------------FL.YGPVF------SILFAPF-------------.A....----------------------
A4XDG1_SALTO/368-608------------------YTPYQPGM------ALFGLPR-------------.A....----------------------
Q73W67_MYCPA/92-327------------------YL.YPPGG------TLLMAPF-------------.G....----------------------
A0JZG6_ARTS2/141-392------------------FT.YPPFA------AVLFSLL-------------.A....----------------------
Q2G5A3_NOVAD/106-326------------------FV.NPPPY------LFLVAPL-------------.G....----------------------
Q8A2B6_BACTN/67-296------------------FL.YGISF------TALISPF-------------.A....----------------------
Q0C0G8_HYPNA/93-341------------------FV.NLPIV------AYLFAPF-------------.G....----------------------
Q1ITA1_KORVE/92-336------------------FIPHTPFS------VLPMIPF-------------.T....----------------------
Q4JVC2_CORJK/78-310------------------YL.YSPGA------TLLLSPL-------------.S....----------------------
Q5Z2C4_NOCFA/88-323------------------FT.YPPLA------ALFFAPL-------------.A....----------------------
Q0S1F1_RHOJR/88-319------------------YL.YPPSG------TLLMAPI-------------.A....----------------------
Q5YR74_NOCFA/76-310------------------FI.YPPFA------ALVLAPF-------------.A....----------------------
Q82B65_STRAW/52-287------------------FT.GTPFG------GLVLKPL-------------.T....----------------------
A6WEV4_KINRD/63-293------------------FV.YPPFA------AILFVPL-------------.L....----------------------
Q6A9X9_PROAC/81-311------------------FT.YPPFA------AIALTPL-------------.A....----------------------
B2U6Q0_RALPJ/105-334------------------FS.YPPTF------LLLIYPI-------------.G....----------------------
Q8A2B7_BACTN/70-300------------------FL.YGIPF------TLLIAPF-------------.S....----------------------
A1K2E7_AZOSB/76-322------------------YL.YPPPS------IAFFLPL-------------.A....----------------------
Q1LQN5_RALME/107-328------------------WL.YPPMS------LWFVLPF-------------.G....----------------------
Q82AJ1_STRAW/66-309------------------WQ.YPPAA------ALAILSP-------------.A....----------------------
A4F642_SACEN/68-304------------------FI.YPPFA------AILFTPL-------------.T....----------------------
Q6NEL0_CORDI/90-330------------------FT.YPPFA------ALAFVPF-------------.T....----------------------
Q89QR1_BRADU/100-368------------------FI.YPPLP------AILLAIP-------------.S....----------------------
Q4JVV2_CORJK/84-315------------------FT.YPPFS------GVIFRVL-------------.P....----------------------
Q5YTA9_NOCFA/80-311------------------YL.YPPGG------TLLIAPI-------------.A....----------------------
Q73WN6_MYCPA/105-337------------------FT.YPPFA------AIVFYPL-------------.H....----------------------
Q8FNS2_COREF/71-313------------------FT.YPPFG------AVVFTPL-------------......----------------------
A4Z0F4_BRASO/98-322------------------WH.YPPFF------FAIAAIT-------------.A....----------------------
Q1AX69_RUBXD/44-303------------------FIEYPPGS------LPVFVPP-------------.A....----------------------
Q5YQC7_NOCFA/78-313------------------FT.YPPFA------ALVFSPL-------------.H....----------------------
Q8FPI8_COREF/95-327------------------YL.YNPGA------TLLLAPL-------------.G....----------------------
B2U6P6_RALPJ/116-345------------------WF.YPPTF------LPFIAPF-------------.G....----------------------
Q4JU29_CORJK/82-316------------------FT.YPPIS------AVLFTPL-------------.A....----------------------
A6LBC6_PARD8/70-301------------------NH.YGILF------SLIIAPF-------------.A....----------------------
Q20YY7_RHOPB/103-326------------------WH.YPPFF------FAVAMAV-------------.A....----------------------
Q1LQN6_RALME/104-332------------------WL.YPPTF------LLVVLPL-------------.A....----------------------
A1R1N0_ARTAT/81-341------------------WV.YPILA------LIPMGLA-------------.A....----------------------
Q2K4Q8_RHIEC/84-305------------------NL.NPPIS------ALLFQTF-------------.G....----------------------
A4YMG3_BRASO/104-327------------------WH.YPPPF------LFVAAFV-------------.A....----------------------
Q82GI4_STRAW/88-314------------------AT.YPPFA------ALLFVPT-------------.T....----------------------
A7I7Y5_METB6/97-335------------------FT.YPPHT------LYFFVIL-------------DQ....----------------------
Q3L9S4_RHOE4/54-285------------------FI.YSPFA------AIIFAPM-------------.A....----------------------
A4FR42_SACEN/78-325------------------FI.YPPFA------AILFAPL-------------.A....----------------------
Q9CBX0_MYCLE/105-336------------------FT.YPPFA------AVVFYPL-------------.H....----------------------
A4FGU5_SACEN/82-312------------------WV.YPPFA------LLPLAPL-------------.A....----------------------
Q82NJ1_STRAW/66-299------------------FT.YPPFA------ALGMLPM-------------.A....----------------------
Q6NF60_CORDI/70-290------------------FT.YTPFA------GLIFKFL-------------.S....----------------------
A4X4Q2_SALTO/67-302------------------FT.YPPFA------ALVMLPM-------------.A....----------------------
A4XDF7_SALTO/84-339------------------FT.YPPFA------GLAMLPM-------------.A....----------------------
B1W388_STRGG/68-304------------------FT.YPPFA------ALVFTPL-------------.S....----------------------
B2HGU8_MYCMM/80-324------------------FT.YPPLS------AVVFSPF-------------.A....----------------------
B4EGA7_BURCJ/104-332------------------WL.YPPSY------LLAVTPL-------------.A....----------------------
B4EQ62_BURCJ/118-340------------------WL.YPPTM------LLFVLPL-------------.G....----------------------
C5B043_METEA/93-315------------------WA.YPPPF------NLVVAVL-------------.A....----------------------
AFTC_MYCTU/94-327------------------YL.YPPGG------TLLMAPF-------------.G....----------------------
PIME_MYCTU/103-334------------------FT.YPPFA------AVVFYPL-------------.H....----------------------
Q63I86_BURPS/104-334------------------WV.YPPTL------LVLVTPL-------------.A....----------------------
Q63I87_BURPS/118-340------------------WL.YPPQT------LLLVAPL-------------.G....----------------------
Q7AQD6_MYCLE/80-324------------------FT.YPPLA------AIAFCPF-------------.A....----------------------
Q8NNL3_CORGL/89-325------------------FT.YPPIS------AALFVPL-------------.A....----------------------
R6X3N6_9PORP/49-278------------------.H.YGPIF------ALVIAPF-------------.S....----------------------

PF05208

M4B3B6_HYAAE/47-400R---------------GDTG--PLVY------PAGFVYL-------------FSF-------------------------
ALG3_SCHPO/28-384V---------------GCTG--PLVY------PGGHVFL-------------YTL-------------------------
C1N7Z4_MICPC/3-383R---------------GDTG--PLVY------PAGFLYL-------------YDA-------------------------
G3B1L9_CANTC/44-430K---------------GDTG--PAVY------PAGFIQV-------------YQF-------------------------
H2B2E5_KAZAF/49-418E---------------GGTG--PLVY------PAGHVML-------------YKI-------------------------
K7J227_NASVI/23-385K---------------GDTG--PLVY------PAGFVYI-------------FTV-------------------------
S8AK53_DACHA/26-392K---------------GGTG--PLVY------PAGHVYI-------------YDF-------------------------
D2A6B4_TRICA/38-438K---------------GDTG--PLVY------PAGFVYV-------------YSL-------------------------
E9IW57_SOLIN/49-411R---------------GDTG--PLVY------PAGFVYI-------------FSG-------------------------
N1PIB4_DOTSN/28-383S---------------GDTG--PLVY------PAAHVYI-------------YRL-------------------------
E3LRP4_CAERE/25-392G---------------GDTG--PIVY------PAGHLFL-------------YRI-------------------------
M0RYH3_MUSAM/65-429K---------------GDTG--PLVY------PAGFLYV-------------YSA-------------------------
C8VQM2_EMENI/22-377K---------------GSTG--PLVY------PAAHVYS-------------YSL-------------------------
E3QV49_COLGM/32-397K---------------GGTG--PLVY------PAAHVYT-------------YTG-------------------------
B2AMZ6_PODAN/32-391R---------------GGTG--PLVY------PAAHVYT-------------YTG-------------------------
Q5TWR0_ANOGA/52-490R---------------GDTG--PLVY------PAGFVYI-------------YSA-------------------------
M3JDA4_CANMX/610-996Y---------------GDTG--PIVY------PGGYVQI-------------YQV-------------------------
K0KP51_WICCF/61-446F---------------GGTG--PLVY------PAGHVWI-------------YRF-------------------------
X6LVN7_RETFI/23-432R---------------GDTG--PLVY------PAGFVYI-------------YSC-------------------------
N1JDU5_BLUG1/30-393K---------------GGTG--PLVY------PAAHVYL-------------YWI-------------------------
K5XHY8_AGABU/29-387S---------------GPTG--PLVY------PAGHVRI-------------HEY-------------------------
C5M8N0_CANTT/50-438Y---------------GDSG--PIVY------PGGFVQI-------------YQI-------------------------
H3ATY3_LATCH/48-407K---------------GDTG--PLVY------PAGFVYI-------------FAV-------------------------
C5DQX2_ZYGRC/29-403Y---------------GGTG--PLVY------PAGHVLI-------------YRF-------------------------
T1KW27_TETUR/32-391S---------------GDTG--PIVY------PAGHLYI-------------YSI-------------------------
E5QCI3_CAEEL/25-392G---------------GDTG--PCVY------PAGHLFV-------------FRL-------------------------
A4S939_OSTLU/24-393K---------------GGTG--PLVY------PAGFVYA-------------YKA-------------------------
A4HP72_LEIBR/7-391K---------------GGTG--PLVY------PGGFIWV-------------HAV-------------------------
K1XMH6_MARBU/34-397T---------------GSTG--PLVY------PAAHVYI-------------YWL-------------------------
B4NMK9_DROWI/51-467R---------------GDTG--PLVY------PAAFVYI-------------YTV-------------------------
U7Q833_SPOS1/49-412A---------------GGTG--PLVY------PAAHVWA-------------YTG-------------------------
E3JZB5_PUCGT/28-389K---------------GDTG--PLVY------PAGFVHV-------------YSV-------------------------
B6Q4R6_PENMQ/22-377K---------------GDTG--PLVY------PASHVYI-------------YSF-------------------------
ALG3_ASPCL/84-439K---------------GSTG--PLVY------PAAHVYI-------------YSI-------------------------
S3EFY4_GLAL2/34-397K---------------GGTG--PLVY------PAAHVYI-------------YWI-------------------------
F1P0T5_CHICK/46-406R---------------GDTG--PLVY------PAGFVYL-------------FLG-------------------------
G8JVY1_ERECY/53-420E---------------GGTG--PLVY------PAGHVLI-------------YNW-------------------------
J7RGJ6_KAZNA/49-415R---------------GGTG--PLVY------PAGHVWI-------------YRF-------------------------
F9XK44_ZYMTI/23-383T---------------GDTG--PLVY------PAAHVYI-------------YRF-------------------------
R4X949_TAPDE/11-374K---------------GQTG--PLVY------PAGHVYL-------------YSL-------------------------
I2FPC0_USTH4/26-382E---------------GGSG--PCVY------PAAHLYV-------------YSF-------------------------
ALG3_KLULA/54-427K---------------GGTG--PLVY------PAGHVFI-------------YKI-------------------------
G3PQJ8_GASAC/14-373K---------------GDTG--PLVY------PAGFVYI-------------FTA-------------------------
K4CV67_SOLLC/31-394K---------------GDTG--PLVY------PAGFLYI-------------YSA-------------------------
M1VU16_CLAP2/32-396E---------------GGTG--PLVY------PAAHVYT-------------YTA-------------------------
U5HGX6_USTV1/69-433K---------------GDTG--PLVY------PAGFLYV-------------YSG-------------------------
K9G3P7_PEND2/24-384K---------------GSTG--PLVY------PAAHVYI-------------YTL-------------------------
T1IB96_RHOPR/32-396E---------------GDTG--PLVY------PAGFVYI-------------YSS-------------------------
B6K873_SCHJY/24-379V---------------GCTG--PLVY------PGGHVLL-------------YTI-------------------------
ALG3_DEBHA/45-438Q---------------GDTG--QIVY------PAGFVQI-------------YQV-------------------------
B4KQ14_DROMO/49-491R---------------GDTG--PLVY------PAAFVYI-------------YSA-------------------------
E9FQN9_DAPPU/50-398K---------------GDTG--PLVY------PAGFVYI-------------FTI-------------------------
ALG3_PICST/52-442S---------------GDTG--PIVY------PAGFVQI-------------YQW-------------------------
S2JIL9_MUCC1/51-411K---------------GDTG--PLVY------PAGFVYI-------------YSL-------------------------
T1FMM7_HELRO/35-390K---------------GDTG--PLVY------PGGFVYF-------------FMF-------------------------
B7QF54_IXOSC/55-405K---------------GDTG--PLVY------PAGFVYI-------------FAA-------------------------
V5GAA3_BYSSN/22-377K---------------GSTG--PLVY------PAAHVYI-------------YSL-------------------------
D7FLD1_ECTSI/36-398R---------------GDTG--PLVY------PAGFVYA-------------YSL-------------------------
E7K994_YEASA/48-417S---------------GGTG--PLVY------PAGHVLI-------------YKM-------------------------
G8BZ82_TETPH/53-422R---------------GGTG--PLVY------PAGHVLI-------------YRF-------------------------
C5GLF5_AJEDR/22-377K---------------GSTG--PLVY------PAVHVYI-------------YSA-------------------------
J3K1V3_COCIM/22-377K---------------GSTG--PLVY------PAGHVYA-------------FSL-------------------------
Q4E4B0_TRYCC/8-370R---------------GDTG--PLVY------PAGFVWI-------------YSA-------------------------
Q4Q1L8_LEIMA/8-391K---------------GGTG--PLVY------PGGFVWV-------------YSV-------------------------
J4HRL9_FIBRA/31-389S---------------GPTG--PIVY------PAGHIYV-------------HRL-------------------------
G4VF09_SCHMA/25-373V---------------GQTG--PCVY------PAGHLYV-------------YTF-------------------------
G0VFQ4_NAUCC/49-421E---------------GGTG--PLVY------PAGHVLL-------------YKF-------------------------
ALG3_PICGU/60-451A---------------GDTG--PIVY------PAGFVQI-------------YQW-------------------------
D6RKR7_COPC7/33-391T---------------GPTG--PLVY------PAGHVRI-------------HQF-------------------------
C7Z6Q8_NECH7/32-396E---------------GGTG--PLVY------PAAHVYT-------------YTA-------------------------
F2U0U1_SALR5/24-375K---------------GDTG--PLVY------PAGFVYI-------------FAG-------------------------
Q59QZ3_CANAL/67-487E---------------GDSG--PIVY------PGGFVQI-------------YQF-------------------------
K3XI42_SETIT/33-396E---------------GDTG--PLVY------PAGFLYV-------------YSA-------------------------
C1E6U6_MICSR/1-365K---------------GDTG--PLVY------PAGFVYI-------------YAW-------------------------
M7UJ49_BOTF1/42-405K---------------GGTG--PLVY------PAAHVWI-------------YYA-------------------------
H9GEH2_ANOCA/2-363K---------------GDTG--PLVY------PAGFVYI-------------FLV-------------------------
F4PBM6_BATDJ/69-446G---------------GDTG--PLVY------PAGFLYV-------------YSF-------------------------
ALG3_ASHGO/46-411E---------------GGTG--PLVY------PAGHVLI-------------HRL-------------------------
ALG3_NEUCR/38-404R---------------GGTG--PLVY------PAAHVYI-------------YTG-------------------------
W5JA52_ANODA/54-487R---------------GDTG--PLVY------PAGFVYI-------------YST-------------------------
G2QLH4_THIHA/46-410R---------------GNTG--PLVY------PAAHVYI-------------YTG-------------------------
E0VE58_PEDHC/46-408K---------------GDTG--PLVY------PAGFVWI-------------FSG-------------------------
L8G9R9_PSED2/26-389A---------------GGTG--PLVY------PAVHVYI-------------YSG-------------------------
I3N142_SPETR/47-406Q---------------GDTG--PLVY------PAGFVYI-------------FMG-------------------------
B0D3E3_LACBS/29-387T---------------GPTG--PLVY------PAGHLRI-------------HQV-------------------------
G6D7P8_DANPL/38-461R---------------GDTG--PLVY------PAGFVYI-------------YSI-------------------------
A0A0D2U908_CAPO3/41-396K---------------GDTG--PLVY------PAGFVYL-------------FGA-------------------------
B4MDV8_DROVI/49-475R---------------GDTG--PLVY------PAAFVYI-------------YSG-------------------------
S9XFL7_SCHCR/33-388Y---------------GSTG--PLVY------PGGHVLL-------------YTL-------------------------
G3AUB5_SPAPN/46-435Y---------------GDTG--PLVY------PAGHVQI-------------YQW-------------------------
R9P1A8_PSEHS/26-382P---------------GGSG--PCVY------PAAHIYL-------------YSF-------------------------
T5AE24_OPHSC/31-395E---------------GGTG--PLVY------PAAHVYT-------------YTG-------------------------
V5ENX1_PSEBG/26-382K---------------GGSG--PCVY------PAVHLYI-------------YSF-------------------------
G0RBH9_HYPJQ/25-389E---------------GGTG--PLVY------PAAHVYI-------------YTG-------------------------
A7TI38_VANPO/47-414R---------------GGTG--PLVY------PAGHVWI-------------YKI-------------------------
S7ZPA3_PENO1/24-378K---------------GSTG--PLVY------PAAHVYI-------------YTL-------------------------
I4Y5F8_WALSC/28-386E---------------GDTG--PLVY------PAAHVYS-------------YTA-------------------------
M9LSR1_PSEA3/61-417L---------------GGSG--PCVY------PAAHIYI-------------YAF-------------------------
G3J6N9_CORMM/40-406K---------------GGTG--PLVY------PAAHVYT-------------YTG-------------------------
G0SZN6_RHOG2/81-458K---------------GDSG--PAYY------PALHIYL-------------YSA-------------------------
E3RP57_PYRTT/27-387A---------------GDTG--PLVY------PGAHVWI-------------YKY-------------------------
H2YCK3_CIOSA/39-392K---------------GDTG--PLVY------PAGFVYV-------------YTA-------------------------
ALG3_PICPG/40-432F---------------GDTG--PLVY------PAGHVHA-------------YSV-------------------------
I1NB48_SOYBN/44-418K---------------GDTG--PLVY------PAGFLYI-------------YSA-------------------------
V2XSY5_MONRO/23-381T---------------GPTG--PLVY------PAGHLYI-------------HAL-------------------------
S3D164_OPHP1/66-445E---------------GGTG--PLVY------PAAHVYT-------------YTA-------------------------
D8PWW0_SCHCM/28-385S---------------GPTG--PLVY------PAGHVYM-------------HEW-------------------------
G4MX55_MAGO7/32-396T---------------GSTG--PLVY------PAGHVYI-------------YTG-------------------------
ALG3_CANGA/46-411T---------------GGTG--PLVY------PAGHVLI-------------FRV-------------------------
U9SRB0_RHIID/43-401H---------------GDTG--PLVY------PAGFVYI-------------YSV-------------------------
A9S9E9_PHYPA/15-380H---------------GDTG--PLVY------PAGFLYI-------------YAA-------------------------
A0A0D1DTA4_USTMA/26-382P---------------GGSG--PCVY------PAAHIYL-------------YSF-------------------------
R9A916_WALI9/668-1026E---------------GDTG--PLVY------PALHLYA-------------YTA-------------------------
A8WH14_XENTR/49-408K---------------GETG--PLVY------PAGFVYI-------------FSI-------------------------
F0X8A8_GROCL/32-398K---------------GGTG--PLVY------PGAHVYT-------------YSV-------------------------
G0WBV5_NAUDC/62-452R---------------GGTG--PLVY------PAGHVFI-------------YKL-------------------------
E4ZQ47_LEPMJ/110-470T---------------GSTG--PLVY------PGAHVWI-------------YKH-------------------------
W1QI94_OGAPD/44-429S---------------GDTG--PIVY------PGGHVYI-------------YSW-------------------------
Q17I48_AEDAE/60-492R---------------GDTG--PLVY------PAGFVYI-------------YSA-------------------------
J9JKC3_ACYPI/34-397K---------------GDTG--PLVY------PAGFVYV-------------FSV-------------------------
ALG3_ARATH/37-401K---------------GDTG--PLVY------PAGFLYV-------------YSA-------------------------
F4QBL4_DICFS/50-404E---------------GGTG--PVVY------PAGYIYV-------------YTA-------------------------
E2BFG0_HARSA/50-411K---------------GDTG--PLVY------PAGFVYI-------------FSG-------------------------
K2RJR1_MACPH/22-381K---------------GGTG--PLVY------PGAHVYI-------------YRG-------------------------
A0A0C4DNJ3_MAGP6/32-396R---------------GGTG--PLVY------PAGHVYI-------------YTA-------------------------
K5UZ89_PHACS/35-392S---------------GPTG--PLVY------PAGHVYV-------------HKF-------------------------
B7FU52_PHATC/1-358Y---------------GGTG--PLVY------PAGFLYL-------------FAW-------------------------
E1FRZ8_LOALO/22-398E---------------GDTG--PIVY------PAGHIWF-------------YLI-------------------------
G8YQ30_PICSO/46-439K---------------GDTG--PIVY------PAGFIQI-------------YQI-------------------------
I2H2F8_TETBL/47-416R---------------GGTG--PLVY------PAGHVML-------------FKL-------------------------
Q38AV3_TRYB2/9-364K---------------GDTG--PLVY------PGGFVWS-------------HSA-------------------------
R0IS40_SETT2/23-383S---------------GSTG--PLVY------PGAHVWI-------------YKQ-------------------------
B8C606_THAPS/2-402R---------------GDTG--PLVY------PAGFLYL-------------YGW-------------------------
NT56_DROME/50-470R---------------GDTG--PLVY------PAAFVYI-------------YSA-------------------------
F1QAD8_DANRE/41-400K---------------GDTG--PLVY------PAGFVYI-------------FTG-------------------------
E2AE79_CAMFO/50-412R---------------GDTG--PLVY------PAGFVYI-------------FSG-------------------------
M2RJ12_CERS8/31-389S---------------GPTG--PIVY------PAGHLYI-------------HRI-------------------------
M7NVY2_PNEMU/31-392K---------------GDTG--PVVY------PSGFLYL-------------YSV-------------------------
K1PJL2_CRAGI/29-393K---------------GDTG--PLVY------PAGFVYI-------------YLA-------------------------
K3WI15_PYTUL/49-402R---------------GDTG--PLVY------PAGFLYV-------------FSV-------------------------
G3YDP3_ASPNA/22-377R---------------GSTG--PLVY------PAAHVYS-------------YTA-------------------------
G8ZRL4_TORDC/46-409R---------------GGTG--PLVY------PAGHVLL-------------YKL-------------------------
B4J870_DROGR/49-472R---------------GDTG--PLVY------PAAFVYI-------------YSA-------------------------
F9FME8_FUSOF/32-396E---------------GDTG--PLVY------PAAHVYT-------------YTG-------------------------
A7RPJ4_NEMVE/13-362Q---------------GATG--PLVY------PAGFVYI-------------FSG-------------------------
G4TDK5_PIRID/21-386Y---------------GPSG--PLVY------PAGHVMI-------------HRA-------------------------
S8FYD7_FOMPI/36-394T---------------GPTG--PIVY------PAGHVHI-------------HHA-------------------------
M2MJW6_BAUCO/22-383H---------------GDTG--PLVY------PAAHVYI-------------YRL-------------------------
F2PUQ0_TRIEC/23-378K---------------GSTG--PLVY------PAGHVYA-------------YTA-------------------------
ALG3_CRYNJ/40-416E---------------GETG--PLVY------PALHLYI-------------YTA-------------------------
B9I9T5_POPTR/29-388K---------------GDTG--PLVY------PAGFLYI-------------YSA-------------------------
E6ZW66_SPORE/26-382P---------------NGSG--PCVY------PAAHLYV-------------YSF-------------------------
C4YB28_CLAL4/53-446E---------------GDTG--PIVY------PAGFIQV-------------YQL-------------------------
U4KZB6_PYROM/25-385K---------------GGTG--PLVY------PAGHVYI-------------YSW-------------------------
G7DY72_MIXOS/36-395K---------------GDTG--PLVY------PAGFLHV-------------YGI-------------------------
C5DE51_LACTC/56-423E---------------GSTG--PLVY------PAGHVWI-------------YEM-------------------------

PF14897

D0MGT8_RHOM4/10-327................SGLE--P...------..ASWIL-------------MYV-------------------------
A6L8S3_PARD8/36-371DSFFIIT...TTGVEFDAVE--P...------..GYILY-------------QSV-------------------------
F0R6C6_BACSH/27-352ESIN.........EQIFSIE--A...------..LFIIL-------------SNL-------------------------
C6W3U8_DYAFD/27-360TADDP........VFLLRME--P...------..GYVQF-------------VKF-------------------------
C6WZX9_FLAB3/31-373DKALF.......RPNTEEIE--W...------..IFVLI-------------NKL-------------------------
F0NZQ8_WEEVC/30-359SEVHM.......FAKMIGVE--S...------..GYIYM-------------NRL-------------------------
Q5L9T0_BACFN/34-354................ELFE--P...------..GYNTV-------------VWL-------------------------
Q6AIA7_DESPS/40-375................LTKD--L...------..IYYLF-------------LPI-------------------------
D2QJN3_SPILD/45-378................REIE--F...------..GYEFM-------------NVV-------------------------
D6D462_9BACE/28-360SNIFTF.....TRGMAEPIE--P...------..GYVLL-------------NAL-------------------------
E3HB27_ILYPC/34-350................DLFN--LGRS------GLGLKIL-------------NLL-------------------------
C7PMN8_CHIPD/32-372RYEF.........FDPMHFE--I...------..GYVYL-------------SSI-------------------------
Q5L965_BACFN/30-358NGMF..........LLFRME--P...------..GYILF-------------NSV-------------------------
Q1WTE3_LACS1/26-359N...............HTYE--I...------..GYALL-------------NSL-------------------------
A0KM85_AERHH/26-353................ESGE--Y...------..FFYYL-------------NIF-------------------------
A9NH20_ACHLI/15-352NLI............ETNFE--K...------..GYRFI-------------ENF-------------------------
A6GZ52_FLAPJ/21-343................FKFE--G...------..GYNIL-------------MYG-------------------------
B2GF40_LACF3/21-364................SPFE--R...------..GYTWM-------------SKL-------------------------
Q03WA2_LEUMM/21-358................GGFE--L...------..GYSYI-------------SHW-------------------------
A6TBF0_KLEP7/23-340................FFYE--P...------..GYLWC-------------MSL-------------------------
A5G608_GEOUR/41-362................DTVE--F...------..AFRAL-------------LWI-------------------------
C6X1R8_FLAB3/21-351P...............LALE--W...------..CMYFF-------------PNL-------------------------
E0SFU5_DICD3/23-330NNYAE........IFRNGVD--P...------..VFVSL-------------MRP-------------------------
Q6FFU5_ACIAD/13-316................SLKD--P...------..FFLII-------------NKF-------------------------
E4TIN4_CALNY/56-394ENL...........SLINTE--P...------..IFLLI-------------AKI-------------------------
Q8A831_BACTN/29-353................VSPD--K...------..GFSAF-------------VLI-------------------------
C7M7Z9_CAPOD/10-347DLLNPI.....QFYAFTGME--I...------..GFGWY-------------CFL-------------------------
Q8A715_BACTN/26-366PSLLD.......PEYRILME--P...------..LFWIL-------------GSL-------------------------
C7RFF5_ANAPD/29-361TRLF.........DFTYPVE--F...------..AFRFF-------------ALL-------------------------
Q5LH99_BACFN/15-335YYY............NATYE--K...------..GFYTL-------------FYF-------------------------
D3SAJ3_THISK/38-360RDGE..........AGMRYE--P...------..LYALL-------------NLA-------------------------
C6X0C5_FLAB3/28-350QDILAS.....GQVITSNME--K...------..GYIAL-------------MYV-------------------------
C4ZJE6_THASP/44-373LEFSDL.....TFRFFQGFE--P...------..GFVAL-------------NII-------------------------
D6E918_9ACTN/24-356GALNPNILDNANLIYPYDFE--N...------..GWVVL-------------NWL-------------------------
F0SY68_SYNGF/34-364GSITD.......SVRFFNIE--Y...------..SFRVL-------------SFI-------------------------
A6L9H3_PARD8/32-354................DEHE--I...------..GFQLL-------------GKL-------------------------
A1A378_BIFAA/27-350................PPME--P...------..IFKWL-------------NGL-------------------------
E0RX92_BUTPB/42-359................VPTE--V...------..GFNVL-------------ARV-------------------------
D5DBJ5_BACMD/39-371ETY............EGIIE--T...------..GIASI-------------YDL-------------------------
Q8XN60_CLOPE/30-345................GGYE--L...------..GFVLF-------------LAI-------------------------
C4L730_EXISA/28-346RFFEI........VFTESED--P...------..GFYLF-------------QRL-------------------------
C7M4A6_CAPOD/29-353GT..............FIME--I...------..GYLFL-------------NYL-------------------------
Q39W09_GEOMG/33-369D...............NHFD--I...------..GFYLL-------------NFV-------------------------
E4RNL6_HALHG/27-346S...............VRTE--P...------..LYAIF-------------NWI-------------------------
C4Z668_EUBE2/44-362QIY............ADNAE--A...------..GYLLF-------------NNL-------------------------
E0S0Y2_BUTPB/32-367KKY............W....--....------..IYNLW-------------VYL-------------------------
D2RIR8_ACIFV/29-352SN..............TRFE--P...------..GYSLL-------------NYI-------------------------
D5EVG6_PRER2/7-324................GLID--P...------..LFGLL-------------IGV-------------------------
A6QAG6_SULNB/27-344................KHGD--P...------..AYWLL-------------QVW-------------------------
Q0A657_ALKEH/27-342................LASD--P...------..GYYLV-------------NWL-------------------------
Q8DJL9_THEEB/21-349I...............TVND--F...------..GYHLI-------------NKL-------------------------
A7HKI9_FERNB/29-353NS.............IWLSD--F...------..GYNFI-------------NWF-------------------------
E3I7S4_RHOVT/25-342................SGPE--P...------..GYWLL-------------LTQ-------------------------
Q5QWV6_IDILO/29-338................TTPE--L...------..GYKYL-------------NVL-------------------------
Q1QWW7_CHRSD/27-347DFVT..........QQGWWE--P...------..AYAFI-------------AYF-------------------------
A6LBP7_PARD8/27-381................SDFE--SVMK------MPLWVLL-------------QAT-------------------------
E6UEJ4_RUMA7/36-384RE..............YTTE--P...------.LGYATL-------------AYI-------------------------
E4RXS3_LEAB4/31-353IRN............SPTSE--Y...------..GYIIL-------------NYI-------------------------
C4K321_HAMD5/34-350................NNFE--P...------..LFVVI-------------TSL-------------------------
C8WKZ6_EGGLE/32-357E...............NQHD--P...------..LSILF-------------AHV-------------------------
A6L4H4_BACV8/26-363DLITI........ETERNLD--K...------..GYLFL-------------YWI-------------------------
D9S910_FIBSS/29-351................GMVE--F...------..GYVLF-------------STV-------------------------
F5WT29_ERYRF/24-344.DH............QSNIE--L...------..GFRIF-------------IFI-------------------------
G8PTM7_PSEUV/31-346................DFTD--V...------..GYSFV-------------NWL-------------------------
Q1G8I7_LACDA/49-398................HYYE--P...------..GFYLL-------------NLL-------------------------
R5KIX9_9CLOT/31-383ST.............TIGYE--I...------..GYCYF-------------TRF-------------------------
R7EM48_9BACE/29-344................VPSE--P...------..FTILV-------------FAI-------------------------

PF03155

L8G8K2_PSED2/15-492----------------WTLD.YPP.F------FAYFEWL-------------LAQ...----------------------
Q5TNL1_ANOGA/16-506----------------WGLD.YPP.L------SAYHSYL-------------VGL...----------------------
D8UDK3_VOLCA/12-511----------------WTLD.YPP.F------FAWFEWL-------------LSQ...----------------------
Q29NI9_DROPS/12-462----------------WGLD.YPP.L------TAHHSYL-------------IGR...----------------------
T1K7S4_TETUR/16-504----------------WTLD.YPP.L------FAWFEMG-------------LSL...----------------------
G2RBR7_THITE/15-492----------------WTLD.YPP.F------FAYFEWI-------------LSQ...----------------------
M7PD45_PNEMU/13-491----------------WMLD.YPP.F------FPWMEYL-------------FSL...----------------------
D3BMH9_POLPA/36-529----------------WTLD.YPP.F------FAWFEYT-------------LSL...----------------------
A5DZN5_LODEL/28-537----------------WTLD.YPP.F------FAFFEWV-------------LSQ...----------------------
F6ZU35_CIOIN/22-490----------------WGLD.YPP.L------TAYHSYV-------------CGW...----------------------
S9W0G5_SCHCR/14-492----------------WTLD.YPP.F------FAYFEFV-------------LSW...----------------------
K1XC57_MARBU/15-492----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
G0W812_NAUDC/80-564----------------WGLD.YPP.L------TAFHSYL-------------CGK...----------------------
C1E537_MICSR/36-567----------------WTLD.YPP.L------FAWFERA-------------LAS...----------------------
D7TT36_VITVI/40-494----------------WGLD.YPP.L------TAYQSYV-------------HGL...----------------------
E9GMP9_DAPPU/11-491----------------WTLD.YPP.L------FAWFEYL-------------LSW...----------------------
F2UCB2_SALR5/15-489----------------WGLD.YPP.L------TAYHSWV-------------CGW...----------------------
H2Z9N9_CIOSA/19-515----------------MTLD.YPP.F------FAWFEFC-------------LSQ...----------------------
G3NV34_GASAC/14-486----------------WGLD.YPP.L------TAYHSLI-------------CAY...----------------------
G8BYL8_TETPH/49-563----------------WTLD.YPP.F------FAYFEWV-------------LSR...----------------------
I7LWJ3_TETTS/163-672----------------WRID.YPP.L------SAYVSYI-------------FGY...----------------------
A3LPA6_PICST/60-509----------------WGLD.YPP.L------TAYHSYI-------------IGK...----------------------
J7SB75_KAZNA/38-553----------------WTLD.YPP.F------FAYFEWV-------------LSQ...----------------------
M4BE27_HYAAE/29-565----------------WTLD.YPP.F------FAYFEYL-------------LSV...----------------------
A0A087ZQU5_APIME/41-513----------------WTLD.YPP.L------FAWFEYF-------------LSH...----------------------
G7YSM9_CLOSI/17-476----------------WGLD.YPP.L------SAYHSWA-------------MGK...----------------------
F4X5Y5_ACREC/45-518----------------WTLD.YPP.L------FAWFEYC-------------LSQ...----------------------
J9K2E7_ACYPI/9-490----------------WTID.YPP.L------FAWFEYF-------------LAQ...----------------------
R7YRL9_CONA1/15-485----------------WTLD.YPP.F------FAYFEWI-------------LSQ...----------------------
ALG8_YEAST/51-565----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
E2BLU2_HARSA/14-512----------------WGLD.YPP.L------TAYHSLL-------------LGH...----------------------
C0NWB8_AJECG/15-495----------------WTLD.YPP.F------FGVLEWL-------------LSQ...----------------------
I3IT66_DANRE/14-487----------------WGLD.YPP.L------TAYHSLA-------------CAY...----------------------
G3BFJ8_CANTC/32-544----------------WTLD.YPP.C------FAYFEWV-------------LSH...----------------------
ALG8_CAEEL/14-494----------------WTLD.YPP.F------FAYFELG-------------LAS...----------------------
W5GB91_WHEAT/20-508----------------WTLD.YPP.F------FAYFSRL-------------LSL...----------------------
H2SHL1_TAKRU/16-505----------------WTLD.YPP.L------FAWFEFG-------------LSQ...----------------------
F1A4M3_DICPU/24-508----------------WGLD.YPP.L------TAYLSWV-------------YGK...----------------------
M3BZ39_SPHMS/15-495----------------WTLD.YPP.F------FAYFEWT-------------MSQ...----------------------
B5RU50_DEBHA/74-567----------------WGID.YPP.L------TAFHSYL-------------FGK...----------------------
R1GPQ5_BOTPV/17-493----------------WTLD.YPP.F------FAYFEWA-------------LSQ...----------------------
ALG6_SCHPO/35-484----------------WGLD.YPP.L------TAYVSWF-------------FGI...----------------------
B3S4W0_TRIAD/22-470----------------WGID.YPP.L------TAYHMWI-------------CGQ...----------------------
B0CY11_LACBS/39-528----------------WTLD.YPP.F------FAYFEKF-------------LSI...----------------------
M3K587_CANMX/31-541----------------WTLD.YPP.F------FAYFEYI-------------LSL...----------------------
N4VMS5_COLOR/17-495----------------WTLD.YPP.F------FAYFEWA-------------MSQ...----------------------
I1LX18_SOYBN/37-486----------------WGLD.YPP.L------TAYQSFI-------------HGL...----------------------
M9PB91_DROME/12-464----------------WGLD.YPP.L------TAYHSYL-------------VGR...----------------------
ALG8_SCHPO/14-492----------------WTLD.YPP.F------FAYMECV-------------LSW...----------------------
ALG8_ASHGO/44-558----------------WTLD.YPP.L------FAWFEWA-------------LSQ...----------------------
H2M3G8_ORYLA/14-482----------------WGLD.YPP.L------TAYHSWL-------------CAY...----------------------
A0A068XBV5_HYMMI/13-510----------------WTLD.YPP.F------FAYFEFL-------------LAH...----------------------
D7MJY5_ARALL/49-511----------------WGLD.YPP.L------TAYQSYI-------------HGI...----------------------
M7UBV6_BOTF1/15-495----------------WTLD.YPP.F------FAYFELF-------------LSK...----------------------
B8C862_THAPS/6-526----------------HTLD.YPP.L------FAFFEWG-------------LSNNFV----------------------
D5G5Y1_TUBMM/57-510----------------WGLD.YPP.L------TAYHSWL-------------LGV...----------------------
B6JZC1_SCHJY/14-495----------------WTLD.YPP.F------FAWLEFT-------------LSW...----------------------
B4JPP0_DROGR/12-469----------------WGLD.YPP.L------TAYHSYL-------------VGR...----------------------
A8Q5F5_BRUMA/20-473----------------WGLD.YPP.L------TAYHSWL-------------LGT...----------------------
G8ZP39_TORDC/40-554----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
G8BGI3_CANPC/69-539----------------WGLD.YPP.L------TAYHSWI-------------LGK...----------------------
ALG6_HUMAN/14-488----------------WGLD.YPP.L------TAYHSLL-------------CAY...----------------------
B6Q2U6_PENMQ/15-493----------------WTLD.YPP.F------FAAFEWA-------------LSQ...----------------------
ALG6_CHICK/14-488----------------WGLD.YPP.L------TAYHSFL-------------CAY...----------------------
C3XSJ3_BRAFL/15-487----------------WGLD.YPP.L------TAYHMWL-------------CGK...----------------------
I1KRW2_SOYBN/28-527----------------WTLD.YPP.F------FAYFERF-------------LSI...----------------------
A0A068XHI1_HYMMI/18-474----------------WGLD.YPP.L------TAYHSYL-------------LGR...----------------------
C5DTD9_ZYGRC/51-531----------------WGLD.YPP.L------TAYHSYI-------------LGK...----------------------
I2GX66_TETBL/28-529----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
A7S144_NEMVE/15-467----------------WGLD.YPP.L------TAYHSWL-------------CGA...----------------------
A8NHE2_BRUMA/37-513----------------WTLD.YPP.F------FAFFEYF-------------LSQ...----------------------
Q6C8U0_YARLI/72-529----------------WGLD.YPP.L------TAYHSWL-------------CGV...----------------------
A7RNB8_NEMVE/17-518----------------WTLD.YPP.L------FAWFEFL-------------LSH...----------------------
U7Q3L8_SPOS1/16-494----------------WTLD.YPP.F------FAYFEFV-------------LSK...----------------------
A8WP54_CAEBR/14-530----------------WTLD.YPP.F------FAYFEWA-------------LAY...----------------------
F6PL55_ORNAN/15-493----------------WGLD.YPP.L------TAYHSLL-------------CAY...----------------------
F1NPY2_CHICK/24-512----------------WTLD.YPP.F------FAWFEYA-------------LSH...----------------------
C5M3Q6_CANTT/80-532----------------WGLD.YPV.L------TAYHSYI-------------CGI...----------------------
G9NL14_HYPAI/15-495----------------WTLD.YPP.F------FAYFEWL-------------LAH...----------------------
C5DJM6_LACTC/29-543----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
M2TGW6_COCH5/15-493----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
A0A068XUS9_ECHMU/14-510----------------WTLD.YPP.F------FAHFEWV-------------LAQ...----------------------
N1PRH1_DOTSN/15-493----------------WTLD.YPP.F------FAYFEWT-------------MSQ...----------------------
W5KCM7_ASTMX/22-513----------------WTLD.YPP.F------FAWFEYG-------------LSH...----------------------
A8XHZ8_CAEBR/37-475----------------WGLD.YPP.L------TAYHHNL-------------LGV...----------------------
W5KTC4_ASTMX/14-487----------------WGLD.YPP.L------TAYHSLL-------------CGH...----------------------
F0ZUK5_DICPU/35-551----------------WTLD.YPP.F------FAWFEFT-------------LSK...----------------------
A0A068Y0H1_ECHMU/19-476----------------WGLD.YPP.V------TAYHSYI-------------LGQ...----------------------
ALG8_HUMAN/21-510----------------WTLD.YPP.F------FAWFEYI-------------LSH...----------------------
G3AHF0_SPAPN/67-518----------------WGLD.YPP.L------TAYHSYL-------------LGM...----------------------
G7DT66_MIXOS/306-809----------------WGLD.YPP.L------TAYLSWL-------------FGA...----------------------
E4XPJ7_OIKDI/15-474----------------WGLD.YPP.L------TAYHMLL-------------CGK...----------------------
K0KJ73_WICCF/57-557----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
Q6CSG6_KLULA/71-550----------------WGLD.YPP.L------TAYHSYL-------------LGK...----------------------
S8A5I1_DACHA/15-491----------------WTLD.YPP.F------FAVFEWV-------------LSQ...----------------------
J7S8J5_KAZNA/67-547----------------WGLD.YPP.F------TAYHSYL-------------LGK...----------------------
G8YLJ6_PICSO/71-564----------------WGLD.YPP.L------TAFHSYL-------------LGK...----------------------
ALG8_CANGA/21-535----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
U5GCU1_POPTR/44-501----------------WGLD.YPP.L------TAYQSYF-------------HGL...----------------------
B4L518_DROMO/13-481----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
C4XYN7_CLAL4/28-542----------------WTLD.YPP.F------FAYFEWF-------------LSH...----------------------
S9VWR7_SCHCR/35-484----------------WGLD.YPP.L------TAYVSLL-------------FGY...----------------------
C4Y8Y1_CLAL4/65-544----------------WGLD.YPP.L------TAYHSWI-------------FGK...----------------------
U4LQP8_PYROM/53-504----------------WGLD.YPP.L------TAYHSWL-------------VGL...----------------------
ALG6_DICDI/25-502----------------WGLD.YPP.L------TAYLSWV-------------FGK...----------------------
W1PIJ5_AMBTC/36-490----------------WGLD.YPP.L------TAYQSYF-------------HGI...----------------------
H0V4T9_CAVPO/14-492----------------WGLD.YPP.L------TAYHSLL-------------CAY...----------------------
F6UCU7_XENTR/38-526----------------WSRSVIPNHL------FT.FDCG-------------.SR...----------------------
F9FE00_FUSOF/15-493----------------WTLD.YPP.F------FAYFEWI-------------LAH...----------------------
B4MG56_DROVI/12-467----------------WGLD.YPP.L------TAYHSYL-------------TGR...----------------------
M5ECX9_MALS4/12-500----------------WTLD.YPP.F------FAYLSWV-------------LSV...----------------------
R4G404_RHOPR/9-494----------------WTLD.YPP.F------FAWFEWC-------------LSL...----------------------
A8J4X2_CHLRE/2-518----------------WTLD.YPP.L------FAWFEWA-------------LSQ...----------------------
I7LUU2_TETTS/10-489----------------WTLD.YPP.L------FAYFEYI-------------LTF...----------------------
Q7Q2B4_ANOGA/11-482----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
T1G1F7_HELRO/12-479----------------WGLD.YPP.L------TAYHSFI-------------CGY...----------------------
D8Q0E0_SCHCM/162-611----------------WGLD.YPP.L------TAYVSWA-------------CGI...----------------------
Q176C2_AEDAE/15-501----------------WGLD.YPP.L------TAYHSFL-------------VGK...----------------------
V2XYC4_MONRO/48-546----------------WTLD.YPP.F------FAYFEKL-------------LSI...----------------------
K5WXZ7_AGABU/56-542----------------WTLD.YPP.F------FAYFEKL-------------LSI...----------------------
F6GVE0_VITVI/26-508----------------WTLD.YPP.F------FAYFERF-------------LSI...----------------------
G8YVD8_PICSO/37-547----------------WTLD.YPP.F------FAYFEWV-------------LSH...----------------------
F9X7N4_ZYMTI/15-491----------------WTLD.YPP.F------FAYFEWT-------------MSQ...----------------------
B4I046_DROSE/12-481----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
H6CAF2_EXODN/46-523----------------WTLD.YPP.A------FALFEWL-------------LSY...----------------------
E4V433_ARTGP/15-494----------------WTLD.YPP.F------FASLEWC-------------LSQ...----------------------
ALG6_YEAST/46-528----------------WGLD.YPP.L------TAFHSYL-------------LGL...----------------------
C5DEQ3_LACTC/41-520----------------WGLD.YPP.L------TAYHSYA-------------LGK...----------------------
Q17GG0_AEDAE/11-473----------------WTLD.YPP.F------FAYFEWA-------------LSQ...----------------------
M0ZN96_SOLTU/61-545----------------WTLD.YPP.F------FAHFEHF-------------LSF...----------------------
A5E0J5_LODEL/108-572----------------WGLD.YPP.L------TAYHSWL-------------LGK...----------------------
C4R675_PICPG/51-560----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
T5AJ86_OPHSC/15-492----------------WTLD.YPP.F------FAYFEWL-------------LAH...----------------------
D2UZR6_NAEGR/31-501----------------WGLD.YPP.L------TAFHHYL-------------MGK...----------------------
D8PR27_SCHCM/33-514----------------WTLD.YPP.F------FAYFEKV-------------LSI...----------------------
E6ZL14_SPORE/61-583----------------WTLD.YPP.F------FAYFSWI-------------LAQ...----------------------
F4NSW2_BATDJ/10-461----------------WGLD.YPP.L------TALHSWL-------------FGN...----------------------
G3J5X8_CORMM/17-489----------------WTLD.YPP.F------FAYFEWL-------------LSH...----------------------
T1JIW9_STRMM/20-486----------------WTLD.YPP.F------FAWFECA-------------LSY...----------------------
H2VDX9_TAKRU/14-486----------------WGLD.YPP.L------TAYHSLI-------------CAY...----------------------
G8JSX9_ERECY/78-592----------------WTLD.YPP.F------FAYFEWV-------------LSQ...----------------------
U4KWQ6_PYROM/15-499----------------WTLD.YPP.F------FAAFEWC-------------MSH...----------------------
E3KWU5_PUCGT/17-510----------------WTLD.YPP.F------FAFFEYL-------------LSR...----------------------
I3JQF2_ORENI/14-486----------------WGLD.YPP.L------TAYHSWI-------------CAY...----------------------
K4A8J1_SETIT/40-498----------------WGLD.YPP.L------SAYQSLL-------------HGR...----------------------
B3MJG1_DROAN/12-464----------------WGLD.YPP.L------TAFHSYL-------------VGQ...----------------------
X1WNC6_ACYPI/31-488----------------WGLD.YPP.L------TAYHSYL-------------NGL...----------------------
Q75CA8_ASHGO/68-547----------------WGLD.YPP.L------TAYHSYL-------------LGK...----------------------
D0N326_PHYIT/34-510----------------WGLD.YPP.L------TAYVSYL-------------FGR...----------------------
Q6FVE1_CANGA/52-532----------------WGLD.YPP.L------TAFHSYL-------------LGK...----------------------
H3CLG0_TETNG/1-489----------------WTLD.YPP.L------FAWFEFG-------------LSQ...----------------------
U5FSQ0_POPTR/25-525----------------WTLD.YPP.F------FAYFEYI-------------ISF...----------------------
A7TDS1_VANPO/94-608----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
X6MDM2_RETFI/80-636----------------WGLD.YPP.L------SAYHSYI-------------CGK...----------------------
D2A4Q9_TRICA/20-523----------------WGLD.YPP.L------TAYHMYL-------------TGK...----------------------
F6PKN9_XENTR/14-490----------------WGLD.YPP.L------TAYHSFL-------------CGQ...----------------------
G8ZY47_TORDC/46-526----------------WGLD.YPP.L------TAYHSYV-------------LGK...----------------------
H2AU41_KAZAF/49-563----------------WTLD.YPP.F------FAYFEWF-------------ISH...----------------------
F8QIP1_SERL3/1-475----------------WTLD.YPP.F------FAYFEKI-------------LSI...----------------------
A5DBI4_PICGU/24-536----------------WTLD.YPP.F------FAYFEWV-------------LSH...----------------------
S8A6B8_DACHA/57-532----------------WGLD.YPP.L------TAYHSWL-------------CGK...----------------------
G0VHP8_NAUCC/41-555----------------WTLD.YPP.F------FAYFEWI-------------ISQ...----------------------
ALG8_KLULA/37-549----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
A3GH90_PICST/41-554----------------WTLD.YPP.F------FAYFEWI-------------LSQ...----------------------
D8SCH8_SELML/18-458----------------WGLD.YPP.L------TAYQSYI-------------HGV...----------------------
M0SWI1_MUSAM/15-472----------------WGLD.YPP.L------TAYQSLA-------------HAL...----------------------
E9HIJ0_DAPPU/14-464----------------WGLD.YPP.L------TAYHSYL-------------TGL...----------------------
G8JQX3_ERECY/54-533----------------WGLD.YPP.L------TAYHSYI-------------LGR...----------------------
E3LGX2_CAERE/56-494----------------WGLD.YPP.L------TAYHHNL-------------LGL...----------------------
G1KHE7_ANOCA/14-488----------------WGLD.YPP.L------TAYHSLL-------------CAY...----------------------
M3ZXK5_XIPMA/20-507----------------WTLD.YPP.L------FAWLERG-------------LAQ...----------------------
M1AYF5_SOLTU/40-493----------------WGLD.YPP.L------TAYQSYI-------------HGL...----------------------
G0WC59_NAUDC/39-554----------------WTLD.YPP.F------FAYFEWF-------------MSQ...----------------------
Q566T2_DANRE/20-507----------------WTLD.YPP.L------FAWFEYG-------------LSH...----------------------
S7ZR44_PENO1/15-489----------------WTLD.YPP.F------FAAFEWL-------------MSQ...----------------------
B5Y5E2_PHATC/28-512----------------WGLD.YPP.I------SAYVSWI-------------CGW...----------------------
I2H6P2_TETBL/49-543----------------WGLD.YPP.F------TAYHSYF-------------FGK...----------------------
A9RXF0_PHYPA/16-505----------------WTLD.YPP.F------FAFFERF-------------LAI...----------------------
S8ECT2_FOMPI/45-533----------------WTLD.YPP.F------FAYFEKL-------------MSI...----------------------
K5X935_PHACS/65-548----------------WTLD.YPP.F------FAYFEKL-------------LSI...----------------------
ALG6_CAEEL/56-491----------------WGLD.YPP.I------TAYHHYL-------------LGV...----------------------
C4R109_PICPG/50-531----------------WGLD.YPP.L------TAFHSYF-------------FGK...----------------------
G3BBW3_CANTC/58-534----------------WGLD.YPP.L------TAYHSYL-------------FGK...----------------------
H2ANJ3_KAZAF/67-548----------------WGLD.YPP.L------TAYHSYI-------------LGK...----------------------
M4C591_HYAAE/34-510----------------WGLD.YPP.L------TAYVSYL-------------FGY...----------------------
M2MQ53_BAUCO/15-492----------------WTLD.YPP.F------FAYFELF-------------LSQ...----------------------
W1NV46_AMBTC/11-495----------------WTLD.YPP.L------FAFFEYF-------------LSL...----------------------
S2JJH6_MUCC1/40-480----------------WGLD.YPP.L------TAFHSWL-------------CGI...----------------------
I3JKF5_ORENI/18-505----------------WTLD.YPP.L------FAWFELG-------------LSQ...----------------------
G8BYB6_TETPH/62-543----------------WGLD.YPP.L------TAYHSYI-------------CGL...----------------------
H2Y782_CIOSA/7-450----------------WGLD.YPP.L------TAYHSYV-------------CGW...----------------------
G4VBL6_SCHMA/19-502----------------WGLD.YPP.L------TAYHSWL-------------MGK...----------------------
F4P9K6_BATDJ/14-479----------------WTLD.YPP.F------FAWFEWL-------------LSK...----------------------
A2QEY3_ASPNC/67-535----------------WGLD.YPP.L------TAYHSWL-------------LGK...----------------------
E2BUL4_HARSA/38-509----------------WTLD.YPP.L------FAWFEYC-------------LSQ...----------------------
ALG8_DEBHA/34-545----------------WTLD.YPP.F------FAYFEWV-------------LAS...----------------------
A0A0D2X4J7_CAPO3/36-488----------------WGLD.YPP.L------TAYGSWL-------------CGA...----------------------
K3WJX2_PYTUL/33-498----------------WGLD.YPP.L------TAYVSYL-------------FGV...----------------------
C5DNU1_ZYGRC/30-544----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
F0YK69_AURAN/94-544----------------WGLD.YPP.A------MAYLEYA-------------LGK...----------------------
B0WBY1_CULQU/17-503----------------WGLD.YPP.L------TAYHSFL-------------VGK...----------------------
B3RIR0_TRIAD/15-519----------------WTLD.YPP.L------FAWFEYS-------------LSQ...----------------------
G8BJG1_CANPC/35-543----------------WTLD.YPP.F------FAFFEWV-------------LSQ...----------------------
B6K4U3_SCHJY/35-468----------------WGLD.YPP.L------TAFVSWL-------------FGI...----------------------
K3X7Z1_PYTUL/28-566----------------WTLD.YPP.F------FAYFEYA-------------LSL...----------------------
G7XVM6_ASPKW/15-493----------------WTLD.YPP.F------FAAFEWV-------------LSQ...----------------------
D7LLP2_ARALL/19-500----------------WTLD.YPP.F------FAYFERF-------------LSI...----------------------
G3AQ92_SPAPN/42-557----------------WTLD.YPP.F------FAYFEWF-------------LSQ...----------------------
G4TH15_PIRID/87-576----------------WTLD.YPP.F------FAYFEYL-------------LSI...----------------------
B4KK01_DROMO/12-467----------------WGLD.YPP.L------TAYHSYL-------------LGH...----------------------
A8PTB3_MALGO/18-506----------------WTLD.YPP.F------FAYLSWI-------------LAQ...----------------------
B0CVP2_LACBS/18-494----------------WGLD.YPP.L------TAYVSWL-------------CGL...----------------------
F4WJE6_ACREC/14-512----------------WGLD.YPP.L------TAYHSLL-------------LGH...----------------------
R4XHB2_TAPDE/18-493----------------WTLD.YPP.F------FAYFEWA-------------LSQ...----------------------
W1Q7Q7_OGAPD/16-525----------------WTLD.YPP.F------FAYFEWF-------------LSL...----------------------
B4MJ94_DROWI/18-488----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
F4RT20_MELLP/38-527----------------WTLD.YPP.F------FAYFERL-------------LSS...----------------------
ALG8_CANAL/51-572----------------WTLD.YPP.F------FAYFEYL-------------LSL...----------------------
K0KKM0_WICCF/47-534----------------WGLD.YPP.L------TAYHSWI-------------LGK...----------------------
K7H4J1_CAEJA/18-503----------------WTLD.YPP.F------FAFFEFA-------------LAH...----------------------
B4JLV7_DROGR/13-480----------------WTLD.YPP.F------FAYFEWL-------------LSQ...----------------------
A7TJW9_VANPO/47-530----------------WGLD.YPP.L------TAYHSYV-------------LGV...----------------------
A0DD77_PARTE/10-454----------------WPLD.YPP.L------SGYFAYA-------------LGK...----------------------
N1JGC6_BLUG1/16-499----------------WTLD.YPP.F------FAYFEWL-------------LSL...----------------------

PF13231

Q65D63_BACLD/64-222--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRADU/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
Q89IJ6_BRADU/52-213---------------------------------------------------