Sequence alignment for CL0111

PF05208

NT53_DROME/48-470---------------VGLFVLLAELVINVV--------------------------------------------------
ALG3_ARATH/35-401---------------FAFALILADAILVAL--------------------------------------------------
ALG3_HUMAN/45-406---------------VAACLCLAEVGITFW--------------------------------------------------
NT56_DROVI/47-475---------------VSVLIVLAEAVINVL--------------------------------------------------
ALG3_SCHPO/26-384---------------HPSRLLLLEIPFVFA--------------------------------------------------
ALG3_YEAST/46-417---------------VMPLLILFESMLCKI--------------------------------------------------
ALG3_NEUCR/36-404---------------IPPALFLVDALLCGL--------------------------------------------------

PF14897

C6IU65_9BACE/1-365------------------MIAV.LTLLFLG--------------------------------------------------
F0G7H3_9BURK/30-339------------------WLSAGIAPAAAF--------------------------------------------------
B1FZW1_9BURK/26-338------------------TAVIVTCALPMV--------------------------------------------------
D0MGT8_RHOM4/10-327------------------KVIAGGVILLLS--------------------------------------------------
B5S941_RALSL/18-319------------------RVIPLLAIVLIS--------------------------------------------------
E0NV04_9BACT/31-360------------------RRLIAFSIGIFM--------------------------------------------------
D8DUW1_PREBR/31-358------------------KRLYIGSLLVVF--------------------------------------------------
C3WBU3_FUSMR/30-360------------------FFIFSLLLLILF--------------------------------------------------
E5BUG7_9FUSO/30-365------------------LYILSIVMLVVF--------------------------------------------------
C3Q046_9BACE/40-371------------------LDLLVLGSLIVF--------------------------------------------------
A6L8S3_PARD8/36-371------------------VRLICIVFFVLF--------------------------------------------------
D7NC58_9BACT/29-366------------------LFEIVLCFCLLF--------------------------------------------------
C3WFM0_FUSMR/30-347------------------LFILFIVILSVL--------------------------------------------------
D0YWK6_LISDA/28-370------------------SFIISFFILFLF--------------------------------------------------
B9CW40_9PAST/29-365------------------FFFISFVILVFF--------------------------------------------------
E5WYZ4_9BACE/30-356------------------IYSLSVLVLILF--------------------------------------------------
F0R6C6_BACSH/27-352------------------LYFIVIVALILF--------------------------------------------------
E4VT48_BACFG/28-352------------------DILYFLFSCFIF--------------------------------------------------
C6W3U8_DYAFD/27-360------------------KAIYITMCIIFV--------------------------------------------------
A9VRB1_BACWK/31-355------------------HFVVTCIFLIFF--------------------------------------------------
D7VWT5_9FLAO/18-361------------------WFWFLAVYFIII--------------------------------------------------
C6WZX9_FLAB3/31-373------------------RVFVWVAAILII--------------------------------------------------
E4TAL9_RIEAD/31-371------------------YKAVWIVVFGMI--------------------------------------------------
F0NZQ8_WEEVC/30-359------------------YYQLTLAVMMLT--------------------------------------------------
Q5L9T0_BACFN/34-354------------------YFSVVIVGILLS--------------------------------------------------
Q1ID93_PSEE4/39-369------------------IFKALALMLIIF--------------------------------------------------
Q64Q37_BACFR/30-355------------------YLHFCVFCLFLI--------------------------------------------------
E1W1Z9_HAEP3/34-354------------------LVLFSLIPLFLI--------------------------------------------------
B0NP44_BACSE/33-342------------------ARWLFFFTLFVP--------------------------------------------------
Q93NP8_ECOLX/36-347------------------SIGCVFCSLFLL--------------------------------------------------
Q64WD5_BACFR/26-339------------------FLICVFILFSIF--------------------------------------------------
Q6XQ50_ECOLX/22-344------------------TVTLLFFIMIIV--------------------------------------------------
E2NIN8_9BACE/9-341------------------FVFFPIIAISML--------------------------------------------------
D0TB70_9BACE/50-382------------------VYAIPIMVLSLV--------------------------------------------------
D0TIG3_9BACE/46-381------------------ILFCVILIFSLI--------------------------------------------------
Q6AIA7_DESPS/40-375------------------IWYMITLFYTLT--------------------------------------------------
D2QJN3_SPILD/45-378------------------NLIGLIILYSFV--------------------------------------------------
C3J824_9PORP/33-348------------------PIVALGVLLILF--------------------------------------------------
E4KSW1_9PORP/26-344------------------GLYQLFTFTLLV--------------------------------------------------
B2RK66_PORG3/26-344------------------PFVFWISGLALV--------------------------------------------------
D9YZ33_PROMI/30-361------------------NSLYFIYSTPLL--------------------------------------------------
E7FXC0_ERYRH/30-380------------------KKIIFIIPVVLV--------------------------------------------------
Q077R9_ECOLX/28-346------------------WLLFLLFFSAVF--------------------------------------------------
Q077Q9_ECOLX/28-345------------------WLLFLLFISIIF--------------------------------------------------
E7FV64_ERYRH/21-356------------------KQKFYLATVPLF--------------------------------------------------
E6RKK7_PSEU9/21-338------------------FVSALLLLLTTL--------------------------------------------------
A9QSJ8_LACLK/28-353------------------FIISSFLLLGII--------------------------------------------------
B5L3N1_ECOLX/27-351------------------AVIISGVVVFIC--------------------------------------------------
C7H3X4_9FIRM/29-345------------------FVIITFLQLAAI--------------------------------------------------
A7VCQ8_9CLOT/30-383------------------YLIVTFGVLILV--------------------------------------------------
B3JEB8_9BACE/29-364------------------LFILWIIIFILF--------------------------------------------------
D6D462_9BACE/28-360------------------RKIVWLWVCILT--------------------------------------------------
C3HRH2_BACTU/24-343------------------FYWLASTYVLLL--------------------------------------------------
C3WQZ8_9FUSO/25-352------------------KSNFLIFLLIFL--------------------------------------------------
E3HB27_ILYPC/34-350------------------LKFFNFLILILL--------------------------------------------------
E4VYN5_BACFG/26-349------------------FFCFYCCFLCLF--------------------------------------------------
C7PMN8_CHIPD/32-372------------------LYSVAFIILTCF--------------------------------------------------
Q5L965_BACFN/30-358------------------LLFFLSFILILF--------------------------------------------------
Q1WTE3_LACS1/26-359------------------NFMLCILFMFIA--------------------------------------------------
B7AIU7_9BACE/32-363------------------ILPLISIILFYS--------------------------------------------------
B6W1S5_9BACE/36-375------------------LFIPSALFYALI--------------------------------------------------
E2N8R2_9BACE/38-379------------------RALIPILLFAFV--------------------------------------------------
B5CXR1_9BACE/33-352------------------LLFFHFCAIWLI--------------------------------------------------
C3JAP3_9PORP/26-357------------------YVPIVLFVISWI--------------------------------------------------
C6I9C7_9BACE/28-351------------------YLLLTPIILLWV--------------------------------------------------
E7DWN5_SALCE/28-357------------------LFIGGMCIFLIA--------------------------------------------------
A0KM85_AERHH/26-353------------------VLLPPFIIYFLI--------------------------------------------------
A6XVI1_VIBCL/26-352------------------VLFPPFLFYFLV--------------------------------------------------
A7M0P5_BACOV/26-361------------------KFVLPFSFILIT--------------------------------------------------
B7BCK8_9PORP/38-375------------------NIDFILPIICFS--------------------------------------------------
D7IN83_9BACE/23-359------------------MPNGMRWGFVLV--------------------------------------------------
Q4JYP9_STRPN/26-355------------------LAFLSWLILFFI--------------------------------------------------
E7DWN9_SALCE/36-394------------------GNFLFAFILGLL--------------------------------------------------
A9NH20_ACHLI/15-352------------------NLLLVILILILG--------------------------------------------------
Q4KYP9_ECOLX/2-316------------------GGFITRLVLLLP--------------------------------------------------
B2EAJ6_BIFAN/21-365------------------YILYFVCIVFLW--------------------------------------------------
E4SMU8_LACAR/20-350------------------RNIIAYSSIILL--------------------------------------------------
D0DSK0_LACFE/28-347------------------KIIFVIQATWLV--------------------------------------------------
A6GZ52_FLAPJ/21-343------------------KTLFVLFFLSMW--------------------------------------------------
B0KTY9_PSEPG/11-328------------------IILSVPVFLLMW--------------------------------------------------
E1WTD5_BACF6/21-369------------------KGVNILLVLTLY--------------------------------------------------
Q8GP42_STRTR/34-383------------------KFQSNIMLIFLW--------------------------------------------------
C7TKZ8_LACRL/24-354------------------SILALAVDAFLV--------------------------------------------------
B2GF40_LACF3/21-364------------------RIVGFLGMGVLA--------------------------------------------------
Q03WA2_LEUMM/21-358------------------KWIGLISILLSV--------------------------------------------------
C8TTX0_ECO26/24-340------------------KLSNLVIVLIIT--------------------------------------------------
C7XF82_9PORP/42-366------------------DVVCIVCYIIFV--------------------------------------------------
C7XB09_9PORP/32-356------------------KSSYFIIFVFFI--------------------------------------------------
A7AJ45_9PORP/41-378------------------ILDYAVYGVLLI--------------------------------------------------
E4TA21_RIEAD/26-353------------------NIFLIMSGSIFF--------------------------------------------------
C4UE48_YERAL/24-352------------------FKVLISVLSVIW--------------------------------------------------
B3I2Q9_ECOLX/24-358------------------TQVAFRLLFIVF--------------------------------------------------
D7PEY6_SALCE/24-353------------------SKVILRFLIWSG--------------------------------------------------
C1M671_9ENTR/24-355------------------AKNTILTLSVLI--------------------------------------------------
E6ALG7_ECOLX/22-354------------------QALYVVSALVFL--------------------------------------------------
A6TBF0_KLEP7/23-340------------------NSLFLITGGFYV--------------------------------------------------
E2SY53_9RALS/25-362------------------VQFFLVALVLLT--------------------------------------------------
A6MF01_ECOLX/23-335------------------KINILLIFIFLS--------------------------------------------------
B7AUK2_9FIRM/25-372------------------KTNYCIAGIFCI--------------------------------------------------
C9BE41_ENTFC/31-354------------------KMILVFSILIPS--------------------------------------------------
A5G608_GEOUR/41-362------------------IICIVVFGTILI--------------------------------------------------
C6X1R8_FLAB3/21-351------------------KLLSVVLIVVLA--------------------------------------------------
A7ZNK7_ECO24/20-336------------------KIGNSITVLAAI--------------------------------------------------
A3D6K3_SHEB5/9-323------------------TLFIILTGLLLA--------------------------------------------------
B5L3F9_ECOLX/24-340------------------YYITLCIIMVLW--------------------------------------------------
C3WK26_9FUSO/25-344------------------IYIYILSGVVLI--------------------------------------------------
B8EDA7_SHEB2/32-359------------------FFLIVASFFCLF--------------------------------------------------
E0SFU5_DICD3/23-330------------------IIFYMILIPGFT--------------------------------------------------
Q6FFU5_ACIAD/13-316------------------FSYYFIFIPILI--------------------------------------------------
E4TIN4_CALNY/56-394------------------DYIDYILVIFIS--------------------------------------------------
B5L3A6_SHIDY/54-384------------------FYFYALLVFIII--------------------------------------------------
C7X5V3_9PORP/26-352------------------RWEIILMLLSFA--------------------------------------------------
E3DJ50_ERWSE/35-367------------------NYFFLIGVLALI--------------------------------------------------
C0H3N7_ERWST/32-370------------------TWLLCIAAMILI--------------------------------------------------
E7NQN0_TREPH/28-357------------------YFMILAVLCILP--------------------------------------------------
Q8A831_BACTN/29-353------------------LILYLFVIVLLS--------------------------------------------------
C6I3T9_9BACE/28-349------------------SLLLSGVWLLLT--------------------------------------------------
Q1V7L3_VIBAL/26-356------------------INLSPALYILLV--------------------------------------------------
C7M7Z9_CAPOD/10-347------------------TIVFLLVSLLVA--------------------------------------------------
B5L3D3_ECOLX/36-361------------------NFSCLITVLTFV--------------------------------------------------
F1Z115_9STRE/49-372------------------YFSDLILLCLLV--------------------------------------------------
A7V5U7_BACUN/28-354------------------FYIIFIYILALF--------------------------------------------------
Q8A715_BACTN/26-366------------------LVLLRCVILFIA--------------------------------------------------
D7ITP9_9BACE/25-344------------------TPLVVILLLLCF--------------------------------------------------
E2N1D0_CAPSP/33-355------------------VFSYIPIIFALL--------------------------------------------------
D7PDX4_ECOLX/28-352------------------AYLMFFLVVLMV--------------------------------------------------
A8U9G3_9LACT/24-350------------------KKISIITGSILA--------------------------------------------------
C7TKU1_LACRL/24-347------------------SVWAWLGVFMLA--------------------------------------------------
E0NTF2_9BACT/25-352------------------KNLLILVCIILT--------------------------------------------------
F0KIR6_ACICP/24-352------------------KIFFFILSLWML--------------------------------------------------
C2BGA1_9FIRM/29-360------------------NLAAFSMFFLMF--------------------------------------------------
B6W8F8_9FIRM/29-359------------------KYAAGLMFLVFF--------------------------------------------------
C7RFF5_ANAPD/29-361------------------NILAGLMFFIMF--------------------------------------------------
Q5LH99_BACFN/15-335------------------IKIVFIIWLYIF--------------------------------------------------
A7V5D6_BACUN/28-344------------------FVTAFVWVLLMT--------------------------------------------------
D3SAJ3_THISK/38-360------------------LFLGMVASAPLV--------------------------------------------------
E5CFC4_9BACE/25-346------------------KITLYATLAIMV--------------------------------------------------
C6X0C5_FLAB3/28-350------------------NLPALLAVGILI--------------------------------------------------
C4ZJE6_THASP/44-373------------------SLVWPIQTLVLT--------------------------------------------------
E5YGM0_9ENTR/19-338------------------KVFCFYSVIILT--------------------------------------------------
C6ITG0_9BACE/26-335------------------MNLNIIVFWVLV--------------------------------------------------
A5ZI18_9BACE/28-334------------------YYFFELVGLFVI--------------------------------------------------
Q0HKL4_SHESM/27-338------------------RLVFALSSLFLF--------------------------------------------------
D6E918_9ACTN/24-356------------------KVCVTLIGIQLF--------------------------------------------------
F0SY68_SYNGF/34-364------------------KLFVFLAFLVVA--------------------------------------------------
C9KPH1_9FIRM/27-363------------------QIISYIILGLMI--------------------------------------------------
B6A8T0_ECOLX/28-355------------------RYFTVCLFLVLW--------------------------------------------------
E2DNR6_ECOLX/32-354------------------VASSLMLIFVIW--------------------------------------------------
D2TQI7_CITRI/31-353------------------VFLWSVLFLFLW--------------------------------------------------
E5V9C7_9BACE/31-351------------------ILCRFFCFFVMF--------------------------------------------------
A6L9H3_PARD8/32-354------------------YFYRTIVFLSIV--------------------------------------------------
Q4K0T2_STRPN/28-349------------------EAVYFWGFIPLI--------------------------------------------------
E0NHN7_PEDAC/40-361------------------KFLYCGAFLIIF--------------------------------------------------
A1A378_BIFAA/27-350------------------VLPFAIVFLILF--------------------------------------------------
F0K0J0_LACD2/31-347------------------KIVDVLPFLALF--------------------------------------------------
E1WLK7_BACF6/35-350------------------ASGFFVSFLILA--------------------------------------------------
E0RX92_BUTPB/42-359------------------HVTCLIIFVLLF--------------------------------------------------
C3R7I4_9BACE/28-352------------------DLFFQIAAFLLF--------------------------------------------------
D5DBJ5_BACMD/39-371------------------NITLFLWSIVLL--------------------------------------------------
C2EVS6_9LACO/30-364------------------NIILFSIVLLLL--------------------------------------------------
C0C0E8_9CLOT/30-354------------------DVAFWGAVIFPA--------------------------------------------------
E7GJ39_CLOSY/47-379------------------CINGCLSVFPVI--------------------------------------------------
Q8XN60_CLOPE/30-345------------------LYFSIFAILILA--------------------------------------------------
A9VPZ7_BACWK/36-350------------------RLLILMATTSLV--------------------------------------------------
C2UYS5_BACCE/36-350------------------RLLIIMAALSLV--------------------------------------------------
C3ADI9_BACMY/38-352------------------KLLVFLTIVILV--------------------------------------------------
C2WEM9_BACCE/36-357------------------SILVLVPLISLV--------------------------------------------------
E3DVZ3_BACA1/36-363------------------KLVMFIPLASLV--------------------------------------------------
E5W8D3_9BACI/36-363------------------AILTVVPLASLI--------------------------------------------------
B0P2K8_9CLOT/37-362------------------WSQAIIFFAVVI--------------------------------------------------
B0ACE3_9FIRM/38-368------------------LLIAIIAILPII--------------------------------------------------
A6NPS1_9FIRM/35-361------------------DICMVLLVVVMT--------------------------------------------------
F0HVE5_LACDL/23-357------------------IAFCISAGVLLY--------------------------------------------------
C2EGY8_9LACO/41-362------------------LVYCIVIGILLY--------------------------------------------------
Q0TSM6_CLOP1/32-355------------------NIYLFLNFSMFI--------------------------------------------------
F0PU56_BACT0/28-368------------------KLYCYGVCGILF--------------------------------------------------
C6I5R5_9BACE/29-346------------------NIFLFIFFFQLF--------------------------------------------------
Q64Y60_BACFR/31-360------------------ILYLFFTFFPLL--------------------------------------------------
C4L730_EXISA/28-346------------------AWFVSFATIQWI--------------------------------------------------
B0P9K3_9FIRM/54-410------------------LWYLYAMTAVMC--------------------------------------------------
E1YWT9_9BACE/27-350------------------YILFTFIFFLFV--------------------------------------------------
C9RN08_FIBSS/27-350------------------KITFAILLIFLV--------------------------------------------------
C7M4A6_CAPOD/29-353------------------KYLLLSTYLLSV--------------------------------------------------
Q39W09_GEOMG/33-369------------------FILFSASTFFMS--------------------------------------------------
D1JP75_9BACE/28-362------------------SFLLSSFILFLV--------------------------------------------------
C9PY95_9BACT/28-358------------------MLFAFICYAFLI--------------------------------------------------
E4RNL6_HALSL/27-346------------------KILLFISYLFLW--------------------------------------------------
B5Q3Y8_SALVI/23-348------------------IYALMLSFLFLV--------------------------------------------------
B9KB09_THENN/26-382------------------KIIILFFSVTFI--------------------------------------------------
B2V0T8_CLOBA/35-358------------------KIVTVYFIVVFG--------------------------------------------------
Q1WCS9_STRTR/30-358------------------TIFCVLTFGTLG--------------------------------------------------
C4Z668_EUBE2/44-362------------------IIYFVLIFIPMW--------------------------------------------------
E0S0Y2_BUTPB/32-367------------------VNSCLLPCAFLC--------------------------------------------------
Q048A4_LACDB/46-398------------------IGLVSLSALPIL--------------------------------------------------
E2DZE7_ECOLX/24-353------------------NILVFFTILTIG--------------------------------------------------
E1LFZ3_STRMT/29-357------------------GFLVLPTFFFFL--------------------------------------------------
D0BKU5_9LACT/28-356------------------NFFIFPTFMFFL--------------------------------------------------
D7YPG3_ECOLX/25-334------------------LLFFLFPCFILL--------------------------------------------------
E4VU68_BACFG/30-357------------------RLLLGILILMLL--------------------------------------------------
D2RIR8_ACIFV/29-352------------------FLLALAFLGSTF--------------------------------------------------
E4MD95_9BACT/23-351------------------KVVYIGVAFALF--------------------------------------------------
C4GCL9_9FIRM/28-345------------------AQLLYGETALLV--------------------------------------------------
B1C3W9_9FIRM/29-372------------------KKFLIFTGIIIV--------------------------------------------------
F2M2L7_LACAL/34-380------------------AFFVVIIPAILA--------------------------------------------------
D1JXK2_9BACE/23-363------------------IIPLLLSCLILS--------------------------------------------------
D3HZQ1_9BACT/22-355------------------KVAFYFIALLLM--------------------------------------------------
B0NR62_BACSE/28-357------------------TFCIVTATCILT--------------------------------------------------
D5EVG6_PRER2/7-324------------------ERWFNVSYFLMT--------------------------------------------------
D1PQ73_9FIRM/29-362------------------QLAFWFCFLLLA--------------------------------------------------
B1SB73_9BIFI/27-361------------------CFGLVMMLTMMT--------------------------------------------------
A6QAG6_SULNB/27-344------------------LLVWIPTWIVYT--------------------------------------------------
A6DEM7_9PROT/26-341------------------ILLFIVFGVFLS--------------------------------------------------
E4PS23_MARAH/27-342------------------SFAWGLAWLLFS--------------------------------------------------
Q0A657_ALHEH/27-342------------------LAAWCLIGLFFA--------------------------------------------------
B7RW64_9GAMM/32-347------------------RLAWVAVLIIFT--------------------------------------------------
Q8DJL9_THEEB/21-349------------------RWYGFFLFFTYV--------------------------------------------------
B6QYQ8_9RHOB/29-346------------------WTVLASFAIALS--------------------------------------------------
A7HKI9_FERNB/29-353------------------KLIKTVIFVFLL--------------------------------------------------
F2ALR7_RHOBT/67-386------------------RLVYRWLLGGLF--------------------------------------------------
E3I7S4_RHOVT/25-342------------------RALFPIVALFLF--------------------------------------------------
E8KJL4_9PAST/2-248------------------CVLF........--------------------------------------------------
F0QJB5_ACIBD/26-342------------------KIFFLLFFLFLF--------------------------------------------------
Q5QWV6_IDILO/29-338------------------VALIGCVILALL--------------------------------------------------
Q1QWW7_CHRSD/27-347------------------SVLFYCAVSFLF--------------------------------------------------
F2UUT5_ACTVI/30-361------------------RVILVVAFVAFV--------------------------------------------------
B5L3I2_ECOLX/31-358------------------FLLYIILFSLLV--------------------------------------------------
Q8KN52_PSEAI/26-351------------------FLLFLFFVAICV--------------------------------------------------
B0MX13_9BACT/23-361------------------GINILQCVIVCA--------------------------------------------------
E5VCV4_9BACE/29-372------------------VFSYIFILLTCV--------------------------------------------------
D1JV57_9BACE/29-369------------------LFLYILLLCISI--------------------------------------------------
D2ETY6_9BACE/27-359------------------VLSYKLLLILAV--------------------------------------------------
D0TG79_9BACE/26-371------------------KYTSFYSIVFIL--------------------------------------------------
D0TBD4_9BACE/31-353------------------VWIFLYVYLIVL--------------------------------------------------
A6LBP7_PARD8/27-381------------------WTHYRIAVTLLI--------------------------------------------------
C7XEA9_9PORP/27-380------------------RLHFFVSLALMI--------------------------------------------------
D1W6W5_9BACT/26-352------------------STFLFVYLCFLA--------------------------------------------------
D9RS75_PREMB/26-353------------------SSFLFLFLLGLS--------------------------------------------------
D1W1V4_9BACT/26-351------------------STVLFVYFLFLA--------------------------------------------------
D3IIR5_9BACT/26-355------------------TAYLACWLAALA--------------------------------------------------
D3I859_9BACT/26-352------------------DRALFFSLVILA--------------------------------------------------
F0F6A4_9BACT/26-352------------------IQGLFLSFLVLS--------------------------------------------------
D8DZP1_PREBR/31-354------------------MPILIIFMLFLA--------------------------------------------------
E1KTN9_9BACT/26-351------------------YKPFLFFFISLA--------------------------------------------------
D7NAB4_9BACT/26-352------------------RIELISILTVLA--------------------------------------------------
C9PWW7_9BACT/24-345------------------NTYLALWLMLLA--------------------------------------------------
E1GYB6_9BACT/25-352------------------RKKLMFCLLGLA--------------------------------------------------
D1XZD4_9BACT/28-352------------------SVVLSFFFLYVA--------------------------------------------------
D1PWT1_9BACT/24-349------------------DKYLIAYFLYVS--------------------------------------------------
C9LKD9_9BACT/25-350------------------KSFFLTYCLLIG--------------------------------------------------
E6MMW3_9BACT/21-348------------------PVFFFSISTMLA--------------------------------------------------
E5V8M3_9BACE/69-395------------------SRCFLIIHMILL--------------------------------------------------
B7GUM4_BIFLS/44-384------------------FSASGILFLASI--------------------------------------------------
A5ZDF0_9BACE/31-358------------------FSAVAVTPLIII--------------------------------------------------
E9SGC4_RUMAL/37-488------------------FLFSAVAILIPS--------------------------------------------------
E6UEJ4_RUMA7/36-384------------------VFFSVIALFIPS--------------------------------------------------
E4RXS3_LEAB4/31-353------------------GIFGFILFFSLL--------------------------------------------------
E3PBR1_ECOH1/28-364------------------NVYIYTYILLLS--------------------------------------------------
B3IUU1_VIBPA/26-360------------------IIFEYFSFLILF--------------------------------------------------
D8MET7_LEUGT/28-370------------------NIFASIVIILLA--------------------------------------------------
A6ASH6_VIBHA/21-345------------------NYLLVISWVILT--------------------------------------------------
D9YYZ5_PROMI/24-338------------------DFFFYILVIITV--------------------------------------------------
C4K321_HAMD5/34-350------------------IFVSLLLIIIYV--------------------------------------------------
Q4K041_STRPN/27-373------------------LFFVILALALPC--------------------------------------------------
C5S1B5_9PAST/27-372------------------NYIVILALILPA--------------------------------------------------
E6MFB5_9FIRM/30-370------------------GMILLLAAVLSA--------------------------------------------------
C5F8C9_LACPA/30-390------------------IVQSFLISLPLA--------------------------------------------------
D1NRU3_9BIFI/51-371------------------NAFAAISALVLI--------------------------------------------------
C8WKZ6_EGGLE/32-357------------------MVFRTVVVLSPA--------------------------------------------------
D4V5L6_BACVU/25-369------------------RTYFVIAIWVVL--------------------------------------------------
C3WC57_FUSMR/29-349------------------KFLKIFTIILLV--------------------------------------------------

PF10131

Q0AV03_SYNWW/415-1038---------------FRYWAPLPYYALAAL-------------RGLC.GDIFTAGN-----LYIYLCALLG------ALS
Q5JIL5_PYRKO/62-622---------------LRFYPPLSYLIGAFL-------------GILL.GSDIRGYA-----ATLMLTSFVG------AVA
Q9UY38_PYRAB/63-619---------------LRFYPPLSYLTAGVL-------------GKVL.GSDTKGYA-----ATLMLTSFLG------ALA
Q97FZ3_CLOAB/258-879---------------FRYWAPFSYYLLAAC-------------EFLVRGNVSGAYL-----IFISLIFFIG------ALG
Q0AV07_SYNWW/2-631---------------VQYYPPLSYFLLAPV-------------QMLF.GNIMITFK-----FAVFFYLLVG------AMG
Q8TXR3_METKA/68-665---------------LTYYGSLGYLLGAAV-------------DAIV.KDPVRTFV-----VCLIVASALI------GVG
A0LQQ1_SYNFM/80-828---------------LNYF.PFPFFIMSLL-------------AAAV..PLQVAFK-----LVTLLPVFGL------PAA
Q97FY2_CLOAB/253-873---------------FRYWAPFPYYIFALL-------------EFLTGGNVSQAYI-----MFIGLMFFVG------AFG
A7VEP1_9CLOT/75-690---------------FRYWGPLSYYIMAGL-------------MFLTGGDLLLAYR-----LLAFVIFVVG------GLP
Q97G45_CLOAB/90-699---------------YRYWAPFPYYILAVI-------------NMFT.NNMITTFD-----VFVELVFMVG------GMG

PF09586

A4VYG6_STRSY/15-836---------------S.FLIPLTIISIVLA....FQGIWWGSDTTILASDGFHQYVI....FNQTLRNTLH......GDG
Q1WT54_LACS1/18-862---------------S.FFGPIVIMLAYFI....ARHMYPFGSSTILTVDLGQQYVD....FFAFFRETLL.....HHPG
Q8DRZ1_STRMU/67-904---------------A.FCLPMLVMAVVFA....VMKLYPFGKETLMSGDYTLQYIP....LYRALGHAFR....HMDIG
A7GVH5_BACCN/15-865---------------TFIIIPLLLLCAFIF....HYFFLTSDQIFSGSGDALSQFGF....FTFLLQHAF.......KDG
A7VEC6_9CLOT/153-972---------------A.GVIPACFLLGVWI....AEKIGPFGGNSLTMVDSLHQYLP....FFSDYYDKLK......NEG
Q3EWS4_BACTI/59-905---------------TIIIMPILLLCAFAF....HYFFLTSNQAFSGTGDALRQFGF....FTFLLQHAF.......KDG
Q74LA0_LACJO/18-861---------------S.FGITIAIFLIVSS....LANCNPFLGGVLWGGDLPDEYLS....FFQYLRRLIL.....GNWS
Q74LA1_LACJO/22-868---------------S.CLTTIVLFFLLST....LTDCNPIFGGVLYSGDLPNQYLS....FFQYYRHLML.....GNWS
A8AU67_STRGC/17-840---------------A.FLIPFLIMVIVYL....SQGIYWNSDTSPLLGDGFHQYVI....FDTTLRNILH......GSD
Q03YY3_LEUMM/16-848---------------S.FWIPFLVLIGYFA....YRKMAPFGSNSILTVDLGQQYID....QFAAFKYTIL.....QHPS
Q8DRQ9_STRMU/18-837---------------S.FLLPSFIMFLVLF....SKNIYWGSSTTILASDGFHQYVI....FDALFRNILH......GTD
Q4L5U5_STAHJ/10-841---------------IFLTLSFLGHSYIIY......RFIHDGVLFTGPNDGIEQMIP....IQMFLFDKW.......SVG
Q03G85_PEDPA/13-851---------------S.GCIPACIMLAYFV....YRGFAPFGTSSLLTVDMGQQYVA....FYEYFRSTLI.....SHPG
Q030D0_LACLS/14-856---------------S.FFIPLILMVIVLA....MTGIYWGSSRSILAGDAYHQYVA....IHSLYRNILH....SGGSQ
A5VKU5_LACRD/18-849---------------S.FLLPVILMACYFA....YRQMTPFGKSSLLTVDLGQQYVD....FFSYLRNTIL.....HHPS
Q8DRY9_STRMU/26-950---------------S.TLLPMMIMLVVWY....FMDTFPFGRNTLMAVDFGQQYIG....LYGFLKATVL....TGDWS
Q38WC5_LACSS/15-827---------------S.FGLPLVLVLIGFA....MMGLVPFGNHNLLFSDLGTQYMP....FLAEFKRQMA......HFN
Q8DWP3_STRA5/16-839---------------S.FLLPFIIIVCILF....TKNIYWGSPTTILASDGFHQYVI....FNQALRNILH......GSN
Q03NT2_LACBA/19-858---------------S.FLIPVILMLIYYI....YRKMVPFGGSSLLTVDLGQQYID....FFSYFRRAIL.....HDPS
A5M1N1_STRPN/14-831---------------S.FIIPVVIMSGVYL....SQGIYWNSDNSPLLGDGFHQYVI....FDVALRNILH......GNS
Q38VZ4_LACSS/17-848---------------S.FLLPFAIIFIYGL....SRHVFPFGGQTIMTVDLGQQYID....FFAYFRTTLL.....QHPD
Q03RN6_LACBA/20-858---------------A.FLVPFILMTGYFI....YRQMAPFGTSSLLTVDLGQQYID....FFAYLRRAIL.....HDPS
Q5FIZ5_LACAC/21-848---------------S.FILPGLIFFSYFF....YTK......NGVLTVDLGQQYVD....FLAFFRHNLF.....THPF
Q4L5U4_STAHJ/19-851---------------IANIVTLTIYYPFIR......DYIKDGVVFSGSGDGFRQMMP....FQLYLYEHF.......TQL
A7VCC3_9CLOT/56-904---------------M.YLLLFLICIGFYMINMAVEHVYPFGSRSFLYQDACDQYPG....ILKIFLEWLH......SGD
Q839W8_ENTFA/19-846---------------S.FFIPFLIMAIIYL....SIGIYPGSSRSVLASDAFSQFSN....FHASFNNVLH......GKQ
Q5M231_STRT2/16-841---------------A.FFLPVLIMIDVLY....SQKIYPGSERTILTSDGFHQYVI....FATELRNILH......GDG
Q82ZW8_ENTFA/12-828---------------S.FFLPFLLLLLVWM....TLQLAPFGDNNLLVSDLGTQYMP....FLSFLKRSFH......EGI
A7VV10_9CLOT/13-832---------------A.SVMPGVLLLSVYI....ALGVYPFGQRSLLITDMSQLYVD....FYSYLIDVFH......GQK
Q8NYY9_STRP8/14-837---------------S.FLFPLSIIFIILL....SMGIYYNSDKTILASDAFHQYVI....FAQNFRNIMH......GSD
Q5HPU9_STAEQ/10-840---------------LLITLSLIGHSYIIF......RFHHDGVLSTGPNDGMEQMIP....IQMYLYHQW.......TQG
A5Z3G2_9FIRM/23-866---------------A.FVLPILSMLIVYY....FKDIFPFGDQMYLRSDCYHQYTP....YLEILQQKLK......DGG
Q5WFJ9_BACSK/12-844---------------ASIVVAVLAHALFFY.......ETAAGRFMVGLNDGLGQILP....FKHFLYQQL.......KNG
Q74IE5_LACJO/19-843---------------S.FLLPTCIFASYFL....YRG......QEILTVDLGQQYID....FLSFYKNNLL.....SNPL
Q03HY9_PEDPA/14-831---------------S.FILPITIVIIAYA....SNGIYWGSAHSILASDAFTQGAN....FLASFREVLH......GKN
Q038D6_LACC3/14-842---------------S.FLLPGLLVGLYFA....IRGTFPFGSSSVLTVDLGQQYID....FFAYLRQTLL.....GHPG
Q3XYV7_ENTFC/19-847---------------S.FLIPFLILALVYL....SIGIYPGSSRSILASDAFSQFSN....FHASFRNVLL......GKQ
Q931T0_STAAM/19-851---------------ISVILTLILFSTHIY......DYIVNGTVFSGAGDGFRQMMP....FQMYLYEHL.......SSF
Q814J9_BACCR/15-862---------------TLIIIPLLIICAFAF....HYFFLKSDNVFSSTGDALSQFSF....FTFLLQHAF.......KDG
Q041X2_LACGA/19-844---------------S.FLLPACIFASYFI....YRN......HEILTVDLGQQYID....FLAFYKNNLF.....SNPL
A7Z2M8_BACA2/11-842---------------ACVLAAAAAHIFFLK.......EWSADRYMTGSGDGIAQMAV....FKKLLFDQY.......MNG
Q03TF4_LACBA/23-880---------------A.FLIPLIIMCLAFW....HLRITPFGNRNLLLSDMGTQYIP....ILENLRATIL......HGQ
Q8CSU8_STAES/19-850---------------VSCILSFILYGPFLY......QFITKGIVFSGSGDGFRQMMP....FQMHLYEHF.......TSL
Q046D7_LACGA/22-883---------------S.CLTTMVLFFLLST....FTDCNPIFGGVLYGGDLPNQYLS....FFQYYRHLVL.....GNWA
Q5WJL1_BACSK/14-845---------------GSVLFAAAAHAFFFY.......QSANGQFMVGPNDGTAQMLP....FKQFLYSLY.......SEG
A3CRC9_STRSV/17-843---------------A.FFLPFFIMFFVYL....MYGIYWNSETSPLLGDGFHQYVI....FDTNLRNILH......GTD
Q65M97_BACLD/11-842---------------ASIAVSVAAHSFFLY.......EWAHDRYMTGNGDGLAQMII....FKSFLFEQY.......KQG
Q04EK1_OENOB/16-850---------------S.FALPALIMLFYFY....YRKMAPFGNSSILTVDLGQQYVD....MFSGMRETIL.....HQPN
Q03QV8_LACBA/14-985---------------MFMILVVALYGIFLL..........TGKSFIWEGDGLAQHYP....ILEKFYTWLH......QGS
Q49X29_STAS1/10-840---------------LFVTLAVVGHSYIIY......RFIHDGVLFTGPNDGMEQMVP....IQMYLFDNW.......HHG
A5ZUP3_9FIRM/20-900---------------LLYTIAFAGIALFLY.....MRFYLNGKSLIWSHDGVPQHLNSLAYYGRYLRKILHTLFIEHKLS
Q03A73_LACC3/16-850---------------S.FSMTFTISLIVFA....ALKMAPFGSSSILANDSAVQYVD....FFTYLKHALM.....GTAG
A8FB68_BACP2/11-842---------------MCLILALLGHSFFLY.......EYTQGRYMTGDGDGISQMLP....FKKLLYDEY.......VKG
Q049H9_LACDB/23-844---------------A.FALPALIFAGYFL....SKK......GNILTVDLGQQYVD....FLAYYQQNLF.....KDPS
Q03TW7_LACBA/17-837---------------A.TLLALMMMVTLFA....LRGITPFGNHNLLIGDLGVQYTP....FFTDFVRLVR......QHT
Q49X28_STAS1/19-851---------------MGILVALLTFTPYIY......RYITQGNVFSGSGDGFRQMMP....FQMYLYEHF.......SQF

PF05007

GPI14_YEAST/127-386--------------------------------------------------------------------------------
GPI14_SCHPO/112-368--------------------------------------------------------------------------------
PIGM_TRYB2/134-410--------------------------------------------------------------------------------
PIGM_RAT/140-408--------------------------------------------------------------------------------
Q17515_CAEEL/146-405--------------------------------------------------------------------------------
Q9W2E4_DROME/177-450--------------------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379------------------PALLATKLAF..--------------------------------------------------
Q5CYY5_CRYPI/10-436------------------IISILIKLSF..--------------------------------------------------
B6AHL5_CRYMR/12-437------------------ILLVIIRILTLQ--------------------------------------------------
B0E7Z2_ENTDS/6-295------------------VVHFIIGLSLRL--------------------------------------------------
B8A6Z1_ORYSI/11-376------------------AAAVGFRLVL..--------------------------------------------------
Q9LN74_ARATH/14-421------------------LASTIFRLFL..--------------------------------------------------
B9RC32_RICCO/30-452------------------ASALILRLIL..--------------------------------------------------
B9GKM7_POPTR/14-432------------------IASVMLRLIL..--------------------------------------------------
A9TIH7_PHYPA/73-514------------------TLGICVRFLL..--------------------------------------------------
B3N7C2_DROER/10-386------------------LLGGAVRFYF..--------------------------------------------------
B4N1B7_DROWI/10-386------------------LLGGAVRLYF..--------------------------------------------------
B4KI55_DROMO/10-386------------------LLGGAVRLYF..--------------------------------------------------
Q16H22_AEDAE/9-388------------------LLGAALRYLL..--------------------------------------------------
B0W4N5_CULQU/8-388------------------FVGALVRYLL..--------------------------------------------------
Q7Q3W6_ANOGA/8-396------------------GVAAAVRFLL..--------------------------------------------------
B7QL74_IXOSC/11-391------------------TSGFLLRLAL..--------------------------------------------------
PIGU_CRIGR/10-394------------------VVAVTVRAAL..--------------------------------------------------
Q4RLI5_TETNG/10-394------------------ILAVTIRAAL..--------------------------------------------------
Q28CK0_XENTR/10-394------------------LVAVTVRAIL..--------------------------------------------------
A7S3Y0_NEMVE/14-406------------------LASTAVRLIF..--------------------------------------------------
C1BQW5_9MAXI/19-392------------------LYALGFLLRV..--------------------------------------------------
C1BTB5_9MAXI/14-387------------------YYVLGVLLRV..--------------------------------------------------
Q54T45_DICDI/55-469------------------FSAILIRIIL..--------------------------------------------------
Q758M8_ASHGO/10-356------------------IACVGSRLLISL--------------------------------------------------
C5DB98_LACTC/10-356------------------FACLASRFGAAA--------------------------------------------------
Q6CPH2_KLULA/10-358------------------WACFASRLAVSY--------------------------------------------------
Q6KCB8_SACBA/10-360------------------LGCIAARLAVTC--------------------------------------------------
C5DUS6_ZYGRC/10-359------------------VGCVVVRLAVSL--------------------------------------------------
A7TF02_VANPO/11-360------------------LAGFTVRLLLSI--------------------------------------------------
Q6FSI7_CANGA/9-374------------------VICGALRLLISA--------------------------------------------------
C5MHK2_CANTT/9-395------------------IIGGLIRFILPT--------------------------------------------------
Q5AGH5_CANAL/13-440------------------IIGGLIRFLLPT--------------------------------------------------
A5E2K6_LODEL/111-490------------------LIGGLVRFLLPL--------------------------------------------------
Q6BPY5_DEBHA/9-390------------------LIGALIRFVLPT--------------------------------------------------
A3LVF4_PICST/9-390------------------VLGALVRFVVPS--------------------------------------------------
C4Y9V1_CLAL4/8-389------------------ASGFALRFAVPT--------------------------------------------------
C4R1V8_PICPG/4-353------------------LPALFLRLALFL--------------------------------------------------
C0RYW5_PARBP/12-388------------------GGAIALRILLFT--------------------------------------------------
C5FSQ4_ARTOC/12-388------------------GAAFALRLILIL--------------------------------------------------
B6H480_PENCW/12-387------------------GAAFMLRLLLTC--------------------------------------------------
A2QI87_ASPNC/12-388------------------GGALALRLLLSV--------------------------------------------------
B6QEM6_PENMQ/12-390------------------AAAVAVRLFLFV--------------------------------------------------
B2WBA6_PYRTR/13-388------------------GAAAAVRLLLFT--------------------------------------------------
B2A9S5_PODAN/16-388------------------AGAAVLRLAIFT--------------------------------------------------
Q6MUS3_NEUCS/16-392------------------AGAAVLRLALFT--------------------------------------------------
Q6C5L4_YARLI/7-382------------------ACGAIARIVVYH--------------------------------------------------
Q55ZX0_CRYNB/19-375------------------IVGAVLRMALF.--------------------------------------------------
B0D118_LACBS/9-373------------------PALVVARLFV..--------------------------------------------------
Q4PGW0_USTMA/31-470------------------IGAALLRIGIS.--------------------------------------------------
PIGU_SCHPO/10-372------------------LGLLSISFFLQW--------------------------------------------------
B6K154_SCHJY/14-372------------------LLYVSIHIVLHT--------------------------------------------------
Q22672_CAEEL/31-382------------------SAAIAVRAVCAS--------------------------------------------------
A8X654_CAEBR/27-380------------------SAAIAVRAASFA--------------------------------------------------
Q01AL0_OSTTA/12-375------------------LTLTLARVVALA--------------------------------------------------
C1EBB5_MICSR/13-406------------------AAGVLARVLL..--------------------------------------------------
C1MV77_MICPC/13-431------------------LASVLLRFVL..--------------------------------------------------
C5L3N8_PERM5/23-419------------------LLGFLLRLLLFA--------------------------------------------------
Q4UC96_THEAN/14-414------------------IVLIRITFILIL--------------------------------------------------
Q4YTZ9_PLABA/82-516------------------LEQYFQTNKRYN--------------------------------------------------
Q8IE19_PLAF7/127-560------------------LELYFQKNKRYN--------------------------------------------------
B3L8S4_PLAKH/95-534------------------LQEYFQRNKRNG--------------------------------------------------
B6KRJ9_TOXGO/75-514------------------AVGVALRLFLYS--------------------------------------------------
A0DGJ7_PARTE/1-357------------------MYRIILILKCLL--------------------------------------------------
B8C4L2_THAPS/71-579------------------LTQLLGRGILPS--------------------------------------------------

PF09594

PIME_MYCS2/91-321------------------FT.Y----------------------------------------------------------
A0JZG9_ARTS2/73-321------------------FT.Y----------------------------------------------------------
Q73YN6_MYCPA/82-326------------------FT.Y----------------------------------------------------------
Q2MF52_STRLV/80-314------------------FN.Y----------------------------------------------------------
A5ERG5_BRASB/100-323------------------WH.Y----------------------------------------------------------
B1K2K9_BURCC/104-334------------------WL.Y----------------------------------------------------------
Q1BSC4_BURCA/94-319------------------WP.Y----------------------------------------------------------
E0TET4_PARBH/112-335------------------LL.Y----------------------------------------------------------
Q1QK36_NITHX/92-360------------------FL.Y----------------------------------------------------------
A8LXF0_SALAI/84-339------------------FT.Y----------------------------------------------------------
Q1DFL5_MYXXD/100-338------------------FK.Y----------------------------------------------------------
Q1LAW9_RALME/87-313------------------WP.Y----------------------------------------------------------
Q0RAR1_FRAAA/151-401------------------YT.M----------------------------------------------------------
Q2J8W8_FRASC/88-337------------------FT.Y----------------------------------------------------------
Q9HN16_HALSA/81-322------------------YV.Y----------------------------------------------------------
A7NFV7_ROSCS/391-632------------------FK.V----------------------------------------------------------
Q1B9V9_MYCSS/90-325------------------YL.Y----------------------------------------------------------
Q6N414_RHOPA/73-354------------------YH.Y----------------------------------------------------------
Q8KF88_CHLTE/91-313------------------WA.Y----------------------------------------------------------
Q9X7Z2_STRCO/66-306------------------WQ.Y----------------------------------------------------------
Q82C69_STRAW/73-314------------------AT.Y----------------------------------------------------------
A6W4J4_KINRD/75-318------------------FT.Y----------------------------------------------------------
Q8NNL7_CORGL/75-325------------------FT.Y----------------------------------------------------------
A6LI36_PARD8/70-300------------------FL.Y----------------------------------------------------------
Q1BEU7_MYCSS/84-314------------------FI.Y----------------------------------------------------------
Q2T300_BURTA/118-340------------------WL.Y----------------------------------------------------------
Q0S7Q3_RHOSR/72-303------------------FI.Y----------------------------------------------------------
O69571_MYCLE/80-324------------------FT.Y----------------------------------------------------------
Q0S430_RHOSR/96-330------------------FT.Y----------------------------------------------------------
Q1BJ26_BURCA/118-340------------------WL.Y----------------------------------------------------------
A0QW28_MYCS2/90-325------------------YL.Y----------------------------------------------------------
A9W380_METEP/98-320------------------WA.Y----------------------------------------------------------
Q8KF86_CHLTE/520-743------------------WF.Y----------------------------------------------------------
A4X3Z6_SALTO/69-305------------------FT.Y----------------------------------------------------------
P71970_MYCTU/94-329------------------YL.Y----------------------------------------------------------
A7AAB1_9PORP/77-308------------------NH.Y----------------------------------------------------------
A0PTL6_MYCUA/80-324------------------FT.Y----------------------------------------------------------
A5FWG6_ACICJ/133-359------------------YF.Y----------------------------------------------------------
A4QI28_CORGB/146-378------------------FL.Y----------------------------------------------------------
Q8EXK5_LEPIN/120-368------------------YI.Y----------------------------------------------------------
Q6NG43_CORDI/98-348------------------YL.Y----------------------------------------------------------
A4LNL6_BURPE/93-323------------------WV.Y----------------------------------------------------------
A4F662_SACEN/84-314------------------WV.Y----------------------------------------------------------
A4YMG5_BRASO/52-323------------------FL.N----------------------------------------------------------
A6CF56_9PLAN/79-322------------------NT.H----------------------------------------------------------
Q8FNR9_COREF/132-368------------------FT.Y----------------------------------------------------------
Q8FNS1_COREF/85-333------------------FI.Y----------------------------------------------------------
A1UKF4_MYCSK/110-340------------------FT.Y----------------------------------------------------------
Q2IKA8_ANADE/104-327------------------WL.Y----------------------------------------------------------
Q8NNL6_CORGL/93-341------------------FI.Y----------------------------------------------------------
A7I755_METB6/60-298------------------FT.Y----------------------------------------------------------
Q1AS45_RUBXD/75-307------------------NL.N----------------------------------------------------------
A3PTP0_MYCSJ/72-303------------------FV.Y----------------------------------------------------------
Q0SHP5_RHOSR/98-332------------------FT.Y----------------------------------------------------------
A1TAY8_MYCVP/79-323------------------FT.Y----------------------------------------------------------
Q0KDP9_CUPNH/92-320------------------WV.Y----------------------------------------------------------
Q7MTZ4_PORGI/65-295------------------FL.Y----------------------------------------------------------
A4XDG1_SALTO/368-608------------------YTPY----------------------------------------------------------
Q73W67_MYCPA/92-327------------------YL.Y----------------------------------------------------------
A1KHU9_MYCBP/103-334------------------FT.Y----------------------------------------------------------
A0JZG6_ARTS2/141-392------------------FT.Y----------------------------------------------------------
A8M762_SALAI/67-302------------------FT.Y----------------------------------------------------------
Q2G5A3_NOVAD/106-326------------------FV.N----------------------------------------------------------
Q8A2B6_BACTN/67-296------------------FL.Y----------------------------------------------------------
Q0C0G8_HYPNA/93-341------------------FV.N----------------------------------------------------------
Q394F5_BURS3/104-334------------------WL.Y----------------------------------------------------------
Q1ITA1_KORVE/92-336------------------FIPH----------------------------------------------------------
Q4JVC2_CORJK/78-310------------------YL.Y----------------------------------------------------------
Q5Z2C4_NOCFA/88-323------------------FT.Y----------------------------------------------------------
Q0S1F1_RHOSR/88-319------------------YL.Y----------------------------------------------------------
Q7UFG8_RHOBA/89-337------------------F..F----------------------------------------------------------
Q5YR74_NOCFA/76-310------------------FI.Y----------------------------------------------------------
Q82B65_STRAW/52-287------------------FT.G----------------------------------------------------------
A6WEV4_KINRD/63-293------------------FV.Y----------------------------------------------------------
Q6A9X9_PROAC/81-311------------------FT.Y----------------------------------------------------------
A4JSX6_BURVG/118-340------------------WL.Y----------------------------------------------------------
Q46XY5_CUPPJ/144-366------------------WF.Y----------------------------------------------------------
B2U6Q0_RALPJ/105-334------------------FS.Y----------------------------------------------------------
Q8A2B7_BACTN/70-300------------------FL.Y----------------------------------------------------------
A1K2E7_AZOSB/76-322------------------YL.Y----------------------------------------------------------
Q1LQN5_RALME/107-328------------------WL.Y----------------------------------------------------------
Q82AJ1_STRAW/66-309------------------WQ.Y----------------------------------------------------------
A4F642_SACEN/68-304------------------FI.Y----------------------------------------------------------
Q6NEL0_CORDI/90-330------------------FT.Y----------------------------------------------------------
Q89QR1_BRAJA/100-368------------------FI.Y----------------------------------------------------------
Q4JVV2_CORJK/84-315------------------FT.Y----------------------------------------------------------
A5ESS8_BRASB/89-311------------------YP.Y----------------------------------------------------------
A4TCS8_MYCGI/75-310------------------YL.Y----------------------------------------------------------
Q5YTA9_NOCFA/80-311------------------YL.Y----------------------------------------------------------
Q73WN6_MYCPA/105-337------------------FT.Y----------------------------------------------------------
Q8FNS2_COREF/71-313------------------FT.Y----------------------------------------------------------
A4Z0F4_BRASO/98-322------------------WH.Y----------------------------------------------------------
Q1AX69_RUBXD/44-303------------------FIEY----------------------------------------------------------
Q5YQC7_NOCFA/78-313------------------FT.Y----------------------------------------------------------
Q8FPI8_COREF/95-327------------------YL.Y----------------------------------------------------------
Q6M3Q3_CORGL/95-331------------------FT.Y----------------------------------------------------------
B2U6P6_RALPJ/116-345------------------WF.Y----------------------------------------------------------
Q1BEU6_MYCSS/107-340------------------FT.Y----------------------------------------------------------
Q0B1Z4_BURCM/118-340------------------WL.Y----------------------------------------------------------
Q2J4C1_FRASC/151-408------------------YT.M----------------------------------------------------------
Q2IYK2_RHOP2/73-354------------------YH.Y----------------------------------------------------------
A8L2W5_FRASN/98-313------------------FV.Y----------------------------------------------------------
A3TJ63_9MICO/77-315------------------FT.Y----------------------------------------------------------
Q133X5_RHOPS/73-354------------------YH.Y----------------------------------------------------------
Q4JU29_CORJK/82-316------------------FT.Y----------------------------------------------------------
Q2CA47_9RHOB/80-334------------------YV.Y----------------------------------------------------------
A6LBC6_PARD8/70-301------------------NH.Y----------------------------------------------------------
A0K2K9_ARTS2/112-358------------------FE.Y----------------------------------------------------------
Q0BA39_BURCM/102-332------------------WL.Y----------------------------------------------------------
Q20YY7_RHOPB/103-326------------------WH.Y----------------------------------------------------------
A4T4C3_MYCGI/71-305------------------YT.Y----------------------------------------------------------
Q1LQN6_RALME/104-332------------------WL.Y----------------------------------------------------------
A1R1N0_ARTAT/81-341------------------WV.Y----------------------------------------------------------
Q0B8R5_BURCM/84-310------------------WP.Y----------------------------------------------------------
A0NV37_9RHOB/121-344------------------FF.Y----------------------------------------------------------
Q2K4Q8_RHIEC/84-305------------------NL.N----------------------------------------------------------
Q0FSE7_9RHOB/90-316------------------WS.Y----------------------------------------------------------
Q2J920_FRASC/92-305------------------FV.Y----------------------------------------------------------
A4YMG3_BRASO/104-327------------------WH.Y----------------------------------------------------------
A1RC95_ARTAT/101-341------------------FE.Y----------------------------------------------------------
Q82GI4_STRAW/88-314------------------AT.Y----------------------------------------------------------
Q135L9_RHOPS/90-313------------------YS.Y----------------------------------------------------------
A7I7Y5_METB6/97-335------------------FT.Y----------------------------------------------------------
A3XXU2_9VIBR/89-316------------------FA.Y----------------------------------------------------------
Q53IC1_STRGR/68-304------------------FT.Y----------------------------------------------------------
Q8FLP5_COREF/222-454------------------FL.Y----------------------------------------------------------
Q3L9S4_RHOE4/54-285------------------FI.Y----------------------------------------------------------
A4FR42_SACEN/78-325------------------FI.Y----------------------------------------------------------
A3S009_RALSL/111-339------------------WL.Y----------------------------------------------------------
Q023J8_SOLUE/86-296------------------FT.R----------------------------------------------------------
Q9CBX0_MYCLE/105-336------------------FT.Y----------------------------------------------------------
A4FGU5_SACEN/82-312------------------WV.Y----------------------------------------------------------
A1U9Z3_MYCSK/75-305------------------FI.Y----------------------------------------------------------
Q82NJ1_STRAW/66-299------------------FT.Y----------------------------------------------------------
Q6NF60_CORDI/70-290------------------FT.Y----------------------------------------------------------

PF03155

ALG8_HUMAN/19-514------------------LGVTLLKCL..L--------------------------------------------------
ALG8_SCHPO/12-497------------------IASTFVKVF..L--------------------------------------------------
ALG6_HUMAN/12-491------------------LIGLTVRWTVSL--------------------------------------------------
ALG6_DROME/10-465------------------FLGLAVRSIISL--------------------------------------------------
ALG8_YEAST/49-570------------------ISTLFLKLL..L--------------------------------------------------
ALG6_YEAST/44-531------------------VCAVILRCTIGL--------------------------------------------------
ALG6_CAEEL/54-494------------------CVLLCFQLAISL--------------------------------------------------
ALG6_SCHPO/33-487------------------MSLVFMQWLISI--------------------------------------------------
ALG8_DROME/10-485------------------GIATGLKIL..L--------------------------------------------------

PF01277

OLEO2_ORYSJ/32-149--------------------------------------------------------------------------------
OLEO2_ARATH/50-167--------------------------------------------------------------------------------
O04925_SESIN/24-138--------------------------------------------------------------------------------
OLEO1_SOYBN/52-169--------------------------------------------------------------------------------
OLEO1_ORYSJ/28-138--------------------------------------------------------------------------------
OLEO1_PRUDU/22-132--------------------------------------------------------------------------------
OLEO2_BRANA/41-151--------------------------------------------------------------------------------
O82308_ARATH/49-159--------------------------------------------------------------------------------
OLNB6_BRANA/26-143--------------------------------------------------------------------------------
Q39273_BRARP/16-133--------------------------------------------------------------------------------
Q43123_DAUCA/35-149--------------------------------------------------------------------------------
OLEO6_GOSHI/39-156--------------------------------------------------------------------------------
OLEO_HELAN/32-149--------------------------------------------------------------------------------
Q39952_HELAN/39-155--------------------------------------------------------------------------------
OLEO4_ARATH/48-165--------------------------------------------------------------------------------

PF13231

A7JBB4_FRATL/52-209--------------------------------------------------------------------------------
A4IZH3_FRATW/52-209--------------------------------------------------------------------------------
Q65D63_BACLD/64-222--------------------------------------------------------------------------------
B6BJT1_9PROT/53-210--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B4UIB9_ANASK/72-232--------------------------------------------------------------------------------
A3WX64_9BRAD/52-213--------------------------------------------------------------------------------
A3WSX1_9BRAD/82-243--------------------------------------------------------------------------------
B9QSP7_9RHOB/49-210--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
A7BVV3_9GAMM/62-229--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
Q1MLH5_RHIL3/48-207--------------------------------------------------------------------------------
C6PVM5_9CLOT/66-224--------------------------------------------------------------------------------
B1KTS9_CLOBM/66-224--------------------------------------------------------------------------------
C6PQH7_9CLOT/67-225--------------------------------------------------------------------------------
A3JRQ6_9RHOB/50-209--------------------------------------------------------------------------------
Q0SVE9_CLOPS/70-234--------------------------------------------------------------------------------
D8JQE0_HYPDA/66-226--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
D1PQJ0_9FIRM/71-229--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
C6E5J9_GEOSM/42-185--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
B4CZL5_9BACT/47-209--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
Q1QI25_NITHX/77-238--------------------------------------------------------------------------------
F0Q666_ACIAP/58-215--------------------------------------------------------------------------------
B9XGL1_9BACT/266-427--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
D1RGG4_LEGLO/47-206--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
B7ACT9_9BACE/61-222--------------------------------------------------------------------------------
E6VI19_RHOPX/75-235--------------------------------------------------------------------------------
B6J193_COXB2/61-221--------------------------------------------------------------------------------
D5WL10_BURSC/70-234--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
A4T8Q0_MYCGI/81-241--------------------------------------------------------------------------------
A9KCN2_COXBN/61-221--------------------------------------------------------------------------------
D2ALV5_FRATE/52-209--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
A3IU57_9CHRO/67-225--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
C6B1B7_RHILS/48-207--------------------------------------------------------------------------------
B9AES9_METSM/66-231--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A7GA58_CLOBL/66-224--------------------------------------------------------------------------------
B4AQA7_FRANO/52-209--------------------------------------------------------------------------------
D2ZPT9_METSM/66-231--------------------------------------------------------------------------------
A0Q5B8_FRATN/52-209--------------------------------------------------------------------------------
Q5X5F8_LEGPA/45-205--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRAJA/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
C4V6B9_9FIRM/60-218--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
A5EQY0_BRASB/42-203--------------------------------------------------------------------------------
B9E1D0_CLOK1/82-240--------------------------------------------------------------------------------
C1FRH4_CLOBJ/66-224--------------------------------------------------------------------------------
A7FQV4_CLOB1/66-224--------------------------------------------------------------------------------
A9ZIV6_COXBE/61-221--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
Q14J09_FRAT1/52-209--------------------------------------------------------------------------------
D5U4D2_BRAM5/61-220--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
A0NV08_9RHOB/41-201--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
B5ZQB2_RHILW/48-207--------------------------------------------------------------------------------
B1IEW1_CLOBK/66-224--------------------------------------------------------------------------------
B9DZF8_CLOK1/66-224--------------------------------------------------------------------------------
Q89IJ6_BRAJA/52-213--------------------------------------------------------------------------------
Q5ZVN3_LEGPH/45-205--------------------------------------------------------------------------------
A7JKU9_FRANO/52-209--------------------------------------------------------------------------------
C7HDF1_CLOTM/37-202--------------------------------------------------------------------------------
A4YN48_BRASO/43-204--------------------------------------------------------------------------------
B3E0D1_METI4/59-219--------------------------------------------------------------------------------
Q5WWU1_LEGPL/45-205--------------------------------------------------------------------------------
Q46CM8_METBF/81-238--------------------------------------------------------------------------------
C6YNI6_FRATL/52-209--------------------------------------------------------------------------------
A7G0J8_CLOBH/66-224--------------------------------------------------------------------------------
B6J844_COXB1/61-221--------------------------------------------------------------------------------
B9XAA6_9BACT/62-222--------------------------------------------------------------------------------
A7JGP5_FRANO/52-209--------------------------------------------------------------------------------
C9LD10_9BACT/72-232--------------------------------------------------------------------------------
Q13A52_RHOPS/52-213--------------------------------------------------------------------------------
A9NC67_COXBR/61-221--------------------------------------------------------------------------------
A5ULR9_METS3/66-231--------------------------------------------------------------------------------
A5IBP9_LEGPC/45-205--------------------------------------------------------------------------------
Q643D0_STRHY/35-195--------------------------------------------------------------------------------
Q0AIT0_NITEC/408-568--------------------------------------------------------------------------------
B1Q920_CLOBO/66-224--------------------------------------------------------------------------------
D6SQ65_9DELT/50-203--------------------------------------------------------------------------------
D1NNY9_CLOTM/61-226--------------------------------------------------------------------------------
A9DP59_9FLAO/58-220--------------------------------------------------------------------------------

PF02366

PMT3_YEAST/62-306------------------IIFTVLGMFTRM--------------------------------------------------
POMT1_HUMAN/20-289------------------VALTGMGLLSRL--------------------------------------------------
P73015_SYNY3/18-249------------------VAIFLFSLVIRF--------------------------------------------------
Y1220_AQUAE/1-229------------------MMKKFLLVLIPV--------------------------------------------------
ARNT_SALTY/3-237------------------SIRYYLAFAAFI--------------------------------------------------
Y1704_AQUAE/1-215------------------MKKDLFLISLVS--------------------------------------------------
P73065_SYNY3/8-275------------------KSWGVPLLLAMV--------------------------------------------------
PMT1_YEAST/54-297------------------ACLAVFTAVIRL--------------------------------------------------
PMT1_CANAL/70-313------------------SSLLLIAFYVRM--------------------------------------------------
PMT1_SCHPO/38-284------------------IFLTVVAFCVRA--------------------------------------------------
PMT2_YEAST/69-313------------------VIFTALALFTRM--------------------------------------------------
POMT2_HUMAN/62-306------------------ALVTLLSFATRF--------------------------------------------------
PMT5_YEAST/50-293------------------GCLLIFTAIVRL--------------------------------------------------
P73712_SYNY3/7-243------------------NSSRRLISVIIY--------------------------------------------------
POMT1_DROME/178-421------------------WTLFLLAFGTRF--------------------------------------------------
PMT4_YEAST/57-305------------------TIVTLLAFAARF--------------------------------------------------
PMT4_SCHPO/63-310------------------VLITVLSFITRF--------------------------------------------------
ARNT_ECOLI/3-237------------------SVRYLIGLFAFI--------------------------------------------------
Q9UVB5_CANAX/96-357------------------LILTAISSFVRL--------------------------------------------------
Q9V2H8_PYRAB/2-224------------------KAK....IEVLV--------------------------------------------------
O57832_PYRHO/2-228------------------KIKGTEKVPILI--------------------------------------------------
PMT6_YEAST/70-314------------------LLLTITSFYLRF--------------------------------------------------

PF11028

Q0VAA1_HUMAN/52-218------------------DSGELITAAHEL--------------------------------------------------
Q1AWM2_RUBXD/47-207------------------DAAMLQMQACVL--------------------------------------------------
A4AMM0_MARSH/37-218------------------DAGEYIATSAKL--------------------------------------------------
A6EKQ0_9SPHI/34-217------------------DCGEFIASAFKM--------------------------------------------------
B3EAC9_GEOLS/36-215------------------DSGEFVTAVHFL--------------------------------------------------
Q1AXH9_RUBXD/53-213------------------DSATLQAKAAVL--------------------------------------------------
A5UPI3_ROSS1/45-212------------------DSAEFQFAATLS--------------------------------------------------
A0LXN9_GRAFK/37-218------------------DAGEYIATSANL--------------------------------------------------
A1ZG62_9BACT/40-223------------------DCGEFIAGAYKL--------------------------------------------------
A3U548_CROAH/37-218------------------DAGEYIATASKL--------------------------------------------------
B5EH69_GEOBB/37-216------------------DSGEFITAIASL--------------------------------------------------
Q650J9_BACFR/35-217------------------DCPEFITTAYKL--------------------------------------------------
A4BY73_9FLAO/37-218------------------DVGEYIATSVKL--------------------------------------------------
A9AXK7_HERA2/53-217------------------DSGELATALWFG--------------------------------------------------
A1ARZ9_PELPD/68-247------------------DSGEFLTAIASM--------------------------------------------------
Q11YB8_CYTH3/35-217------------------DCGEFISTSYKL--------------------------------------------------
A2TUA8_9FLAO/37-219------------------DAGEYISTSSKL--------------------------------------------------
U679_DICDI/139-316------------------DAGELIVVAHQF--------------------------------------------------
Q74D30_GEOSL/39-218------------------DSGEFITAIHSL--------------------------------------------------
A1BIY5_CHLPD/34-214------------------DCGEFIATAYTL--------------------------------------------------
A3XHT8_LEEBM/37-219------------------DAGEYISTSSKL--------------------------------------------------
A1ZGE8_9BACT/35-219------------------DCGEFIACSYKL--------------------------------------------------
Q3AU50_CHLCH/34-214------------------DCGEFIATAVTL--------------------------------------------------
A6GWD8_FLAPJ/36-227------------------DCGEYIATAAKL--------------------------------------------------
A6LGG9_PARD8/35-217------------------DCGEFISSAYKL--------------------------------------------------
Q39VU9_GEOMG/36-214------------------DSGEFITAIHSL--------------------------------------------------
A7NFU7_ROSCS/53-220------------------DPAEFQLASVLL--------------------------------------------------
Q1AXH6_RUBXD/44-204------------------DSAMLQVHAIVL--------------------------------------------------
Q0YR30_9CHLB/34-214------------------DCGEFIATAYTL--------------------------------------------------
Q8KAY9_CHLTE/41-221------------------DCGEVIATSYTL--------------------------------------------------
Q7MT47_PORGI/37-229------------------DCAEFIVCVNKL--------------------------------------------------
Q2S0T5_SALRD/34-228------------------DPGERIASAYTL--------------------------------------------------
A5G4Z0_GEOUR/37-216------------------DSGEFITAISSL--------------------------------------------------
A6EJD1_9SPHI/35-210------------------DCGEFLSAAYKL--------------------------------------------------
A5ZCC1_9BACE/37-219------------------DCPEFISCAEKL--------------------------------------------------
B3ENQ9_CHLPB/34-214------------------DCGEFIATAYTL--------------------------------------------------
Q1VT32_9FLAO/37-218------------------DAGEYIATSAKL--------------------------------------------------
A9AUQ8_HERA2/39-195------------------DTAEFQRVGPTL--------------------------------------------------
A3J436_9FLAO/37-218------------------DCGEYIATSANL--------------------------------------------------
B4S581_PROA2/34-214------------------DCGEFIATARTL--------------------------------------------------
A4CGC2_ROBBH/37-219------------------DAGEYISTSAKL--------------------------------------------------
A6EQ18_9BACT/37-218------------------DAGEYITTASNL--------------------------------------------------
A3I1E4_9BACT/35-218------------------DPGEFIAVSYKL--------------------------------------------------
Q26HV6_FLABB/36-213------------------DAGEYIATSSGL--------------------------------------------------
Q3B6C0_PELLD/34-214------------------DCGEFIATARTL--------------------------------------------------

PF02516

STT3A_HUMAN/17-484------------------LLKLLILSMAAV--------------------------------------------------
STT3_CAEEL/19-506------------------LLTIVVLALAWF--------------------------------------------------
STT3_YEAST/15-475------------------ILKLVIFVAIFG--------------------------------------------------
STT3_SCHPO/23-509------------------PLKVLILICIAV--------------------------------------------------
O30195_ARCFU/14-430------------------LILIVLLGLCIR--------------------------------------------------
O29918_ARCFU/7-427------------------MLAVILFALAVR--------------------------------------------------
O29867_ARCFU/18-493------------------VIAALISVKLRI--------------------------------------------------
O86154_CAMJU/9-478------------------NPYLVLFAMIIL--------------------------------------------------
O27660_METTH/24-582------------------FYIRAEASNIGG--------------------------------------------------
O27928_METTH/21-478------------------FFSRIETAELKG--------------------------------------------------
O26520_METTH/3-426------------------IIFASGFALRAG--------------------------------------------------
O27920_METTH/13-461------------------VIFVFGFSIRML--------------------------------------------------
Y1525_METJA/33-650------------------MLMFVSFQLRAQ--------------------------------------------------
O74088_PYRHO/25-586------------------LKKVLIPILVFG--------------------------------------------------
O58981_PYRHO/1-510------------------MKRRYSILIILL--------------------------------------------------

PF09852

A6W4W4_KINRD/38-458------------------RWNVGR......--------------------------------------------------
A3YXU8_9SYNE/20-501------------------RLQVL.......--------------------------------------------------
D1N9S5_9BACT/168-612------------------AYDSMF......--------------------------------------------------
Q119E7_TRIEI/30-487------------------RHLLFQ......--------------------------------------------------
Q3B035_SYNS9/33-452------------------RHHLLQ......--------------------------------------------------
A3IP01_9CHRO/25-454------------------RHWLFQ......--------------------------------------------------
A4CQE1_SYNPV/54-483------------------RHWLLQ......--------------------------------------------------
Q1CZA2_MYXXD/39-471------------------LQAAQV.....C--------------------------------------------------
A7NHC7_ROSCS/32-505------------------RYEGFN......--------------------------------------------------
A2CD09_PROM3/29-458------------------RHALLQ......--------------------------------------------------
Q7U446_SYNPX/31-511------------------RSWVL.......--------------------------------------------------
Q05VV8_9SYNE/33-513------------------RLESL.......--------------------------------------------------
Q2JTX8_SYNJA/28-474------------------RHHLFQ......--------------------------------------------------
A5GS07_SYNR3/40-521------------------RLWSL.......--------------------------------------------------
A5Z658_9FIRM/175-610------------------RYKSYL......--------------------------------------------------
Q9V170_PYRAB/28-443------------------LYENFS......--------------------------------------------------
Q684B0_9VIRU/32-510------------------QYVTME.....A--------------------------------------------------
D1N6C4_9BACT/168-601------------------RFFLFF......--------------------------------------------------
O59243_PYRHO/26-442------------------IYNGLR......--------------------------------------------------
Q8U0H2_PYRFU/26-441------------------VYNGLR......--------------------------------------------------
Q119E6_TRIEI/27-490------------------RHAFFC......--------------------------------------------------
Q82RR9_STRAW/82-508------------------LHQRML......--------------------------------------------------
Q4J6X7_SULAC/32-488------------------RLYDLL......--------------------------------------------------
Q3AH29_SYNSC/39-458------------------RHGLLQ......--------------------------------------------------
Q053B8_LEPBL/83-522------------------ALDSFF......--------------------------------------------------
A5URL3_ROSS1/78-571------------------LFFGLTFKYVHW--------------------------------------------------
Q4J7K9_SULAC/43-493------------------VLYNLN......--------------------------------------------------
A3Z9V0_9SYNE/14-434------------------RHALLQ......--------------------------------------------------
A6C4J1_9PLAN/210-689------------------LYNGLL......--------------------------------------------------
Q9HK92_THEAC/39-557------------------KYVSLN......--------------------------------------------------
A0YNX7_LYNSP/16-470------------------RHALFQ......--------------------------------------------------
A5GNZ8_SYNPW/38-520------------------KSWVL.......--------------------------------------------------
Q0I6Z8_SYNS3/30-459------------------RHLWLQ......--------------------------------------------------
A7BAH1_9ACTO/37-495------------------QWRALV......--------------------------------------------------
Q4J7K8_SULAC/16-462------------------RLYDLY......--------------------------------------------------
A5GR01_SYNR3/37-521------------------RIYTL.......--------------------------------------------------
A0YZD5_LYNSP/29-458------------------RHALFQ......--------------------------------------------------
Q97AA6_THEVO/27-454------------------KYRSFH......--------------------------------------------------
A0YTH5_LYNSP/32-516------------------RYFSF.......--------------------------------------------------
A3IHC1_9CHRO/29-461------------------KHILFQ......--------------------------------------------------
Q8F2H0_LEPIN/76-512------------------ALDSLF......--------------------------------------------------
P73520_SYNY3/35-464------------------RHWLFQ......--------------------------------------------------
O58892_PYRHO/28-449------------------KCLTFR......--------------------------------------------------
Q063N9_9SYNE/10-492------------------RSWVL.......--------------------------------------------------
Q7U443_SYNPX/37-518------------------RMQSL.......--------------------------------------------------
Q3AH28_SYNSC/37-517------------------RLFSL.......--------------------------------------------------
A4CQE4_SYNPV/18-500------------------KSWVL.......--------------------------------------------------
Q7VDJ5_PROMA/39-469------------------RHFLLQ......--------------------------------------------------
A5V1J1_ROSS1/34-511------------------RYMGFN......--------------------------------------------------
Q7U444_SYNPX/29-448------------------RHALLH......--------------------------------------------------
A0YNX8_LYNSP/40-494------------------RHLLFQ......--------------------------------------------------
Q10XG3_TRIEI/32-516------------------RYYSF.......--------------------------------------------------
A2CD11_PROM3/38-518------------------RLESL.......--------------------------------------------------

PF03901

GPI10_TRYBB/4-432------------------WLISLTFIYRLF--------------------------------------------------
SMP3_YEAST/6-401------------------WWLYLVYAIGLM--------------------------------------------------
GPI10_SCHPO/4-414------------------WFWLAILVFRWW--------------------------------------------------
ALG9_SCHPO/16-438------------------WTFSILAVLRLT--------------------------------------------------
ALG9_ARATH/48-451------------------LPFIALCYLRYM--------------------------------------------------
Q9LEQ5_ARATH/40-428------------------RIFLFCLAFRVV--------------------------------------------------
ALG9_YEAST/10-414------------------LLLLLFLTRVYI--------------------------------------------------
ALG12_CAEEL/6-405------------------WIVIIVTIIHII--------------------------------------------------
GPI10_YEAST/16-484------------------QIFWVFLAFRVL--------------------------------------------------
SMP3_SCHPO/9-412------------------IIYTFLLILRFW--------------------------------------------------
Q9VBV8_DROME/75-498------------------TAFKTFVSARLC--------------------------------------------------
PIGB_HUMAN/62-449------------------YLLLFTIALRIL--------------------------------------------------
PIGB_DROME/5-396------------------YVFLLILAVRLA--------------------------------------------------
ALG9_MOUSE/60-482------------------TAFKCLLSARLC--------------------------------------------------
PIGZ_DROME/18-541------------------STYFCFAAVRLL--------------------------------------------------
YTH3_CAEEL/55-472------------------SVFKMLLSIRIS--------------------------------------------------

PF09913

Q1JHK3_STRPD/71-454---------------L..VFGTISAIISPI--------------------------------------------------
Q1MP06_LAWIP/21-414---------------F..FWGVIFLFLIPP--------------------------------------------------
A4AI52_9ACTN/32-415---------------L..LALSAWAFASPM--------------------------------------------------
A4VVV9_STRSY/36-414---------------I..PFLLISIFVMPV--------------------------------------------------
A5CTF3_CLAM3/34-413---------------V...LSALWAVTTPL--------------------------------------------------
A2RHT4_LACLM/28-400---------------L..VAGLIFTVAQPL--------------------------------------------------
A0LS06_ACIC1/16-395---------------F..GITALWAVTTPK--------------------------------------------------
Q5Z3D8_NOCFA/116-537---------------LATLFGAVFAVITPP--------------------------------------------------
Q5M3E5_STRT2/28-432---------------F..FVGILSIFFRHP--------------------------------------------------
A7BEG1_9ACTO/22-395---------------I..VASLAWVIASPV--------------------------------------------------
A5UMR8_METS3/71-461---------------I..IFGIISLFLTPI--------------------------------------------------
A1W3H2_ACISJ/39-436---------------V..CVGMAMCFLSPA--------------------------------------------------
A6BHE0_9FIRM/204-596---------------F..FIGCIYIFVLPP--------------------------------------------------
Q032N2_LACLS/44-428---------------L..FFGVVLSILMPF--------------------------------------------------
Q6AGK9_LEIXX/24-391---------------L..LVFGAWALSSPP--------------------------------------------------
Q03JM9_STRTD/69-443---------------I..IFGTIISVVKPV--------------------------------------------------
O05375_AGGAC/17-398---------------I..LTFIIGVIITPP--------------------------------------------------
A5UN71_METS3/84-467---------------I..LFGLLMVFFAPP--------------------------------------------------
A3CP01_STRSV/1-366---------------M.........IAQPI--------------------------------------------------
A7VGI6_9CLOT/233-636---------------L..LLGMIMNVVIAP--------------------------------------------------
Q83YS3_STRGN/66-446---------------V..FSGVLTSLITPV--------------------------------------------------
Q01XM3_SOLUE/38-442---------------L...MALAFAVVMPP--------------------------------------------------
Q83H24_TROWT/46-427---------------F..ISLAGWALSSPI--------------------------------------------------
Q9CIZ8_LACLA/68-463---------------L..FLGIGISFIKPV--------------------------------------------------
Q2JAW9_FRASC/81-503---------------L..LLVAAWVATNPP--------------------------------------------------
A2V6Y4_9NOCA/100-508---------------V...FGVIFSVVTPP--------------------------------------------------
Q0RGM1_FRAAA/18-412---------------L...LLAAWVGSNAP--------------------------------------------------
Q1N997_9SPHN/34-430---------------C..LLTLFFCLVTPP--------------------------------------------------
A7BEE9_9ACTO/34-400---------------L..SVATGWIFASPP--------------------------------------------------
A5G180_ACICJ/39-445---------------C....GLRLVYATPM--------------------------------------------------
Q97N14_CLOAB/17-411---------------L..FFGVLFAVINAP--------------------------------------------------
A4AI53_9ACTN/26-395---------------F..VALAAWALSSPV--------------------------------------------------
A5UKJ8_METS3/70-455---------------I..IFGLLTVFASPL--------------------------------------------------
A3XYG2_9VIBR/1-400---------------M.....IYLAFQVPA--------------------------------------------------

PF04922

ALG10_YEAST/63-458------------------TNIVPYEFIDEK--------------------------------------------------
O02332_CAEEL/40-377------------------YHYVPEPYMDEI--------------------------------------------------
Q9LZ85_ARATH/22-450------------------NHIVPEPYMDEI--------------------------------------------------
AG10B_RAT/28-428------------------SRALREPYMDEI--------------------------------------------------
ALG10_SCHPO/24-398------------------QYYVPNPYLDEI--------------------------------------------------

PF07220

D4HSK9_LEPIR/4-673--MKFGLDANVAYPPLSVLYSIFLIFGCDF--------------------------------------------------
Q8VTZ1_LEPIR/1-667--MKFGLDANITYPPLSVIYSILLILGCDF--------------------------------------------------

PF04188

GPI18_YEAST/2-433-------IVG..LTLYFVLFRSIQYLLVFL--------------------------------------------------
GPI18_SCHPO/63-464-------RSG..YNYFKGICVCTFLLSTIL--------------------------------------------------
PIGV_HUMAN/8-493-------RKE..VLRFAVSCRILTLMLQAL--------------------------------------------------
O65394_ARATH/12-492-------RKETILIKYAIFSRLLVLFLTIL--------------------------------------------------

PF02364

P87204_ASPFM/843-1663------------------EFFPPGSEAERR--------------------------------------------------
FKS1_CRYNV/778-1595------------------EFFPKGSEAERR--------------------------------------------------
BGS2_SCHPO/843-1667------------------EYFPAHSEAERR--------------------------------------------------
O13429_CANAX/305-1090------------------DFIKIEKEWERR--------------------------------------------------
FKS1_YEAST/807-1632------------------EFFPRDSEAERR--------------------------------------------------
FKS3_YEAST/693-1543------------------EFFPSNSEAKRR--------------------------------------------------
O13423_CANAX/599-1410------------------SLFQDQAEAQRR--------------------------------------------------
CALSC_ARATH/875-1655------------------HSVPVNLEARRR--------------------------------------------------
BGS4_SCHPO/871-1707------------------TFFPANSEAERR--------------------------------------------------

PF04602

EMBA_MYCLE/4-679DGHEPPQRIIRLIAVGAGITGLLLCAVVPL--------------------------------------------------
EMBA_MYCSM/13-666DAVTEPSRIARLIAVVAGIAGVLLCGLVPL--------------------------------------------------
EMBC_MYCSM/6-669AAGGSNHRTARLVAIIAGLLGTLMAIATPL--------------------------------------------------
EMBC_MYCTU/20-683RDAGANYRIARYVAVVAGLLGAVLAIATPL--------------------------------------------------
EMBB_MYCLE/15-674RTASRNVRVARWVAAIAGLIGFVSSVVTPL--------------------------------------------------
EMBA_MYCAV/4-680DGKQRSQRIPRSVAAVAGIAGLLLCLAVPL--------------------------------------------------
EMBB_MYCSM/17-676VSAGKDVRIARWVATIAGLLGFVLSVSIPL--------------------------------------------------

PF05208

NT53_DROME/48-470--------------------------------------------------------------------------------
ALG3_ARATH/35-401--------------------------------------------------------------------------------
ALG3_HUMAN/45-406--------------------------------------------------------------------------------
NT56_DROVI/47-475--------------------------------------------------------------------------------
ALG3_SCHPO/26-384--------------------------------------------------------------------------------
ALG3_YEAST/46-417--------------------------------------------------------------------------------
ALG3_NEUCR/36-404--------------------------------------------------------------------------------

PF14897

C6IU65_9BACE/1-365--------------------------------------------------------------------------------
F0G7H3_9BURK/30-339--------------------------------------------------------------------------------
B1FZW1_9BURK/26-338--------------------------------------------------------------------------------
D0MGT8_RHOM4/10-327--------------------------------------------------------------------------------
B5S941_RALSL/18-319--------------------------------------------------------------------------------
E0NV04_9BACT/31-360--------------------------------------------------------------------------------
D8DUW1_PREBR/31-358--------------------------------------------------------------------------------
C3WBU3_FUSMR/30-360--------------------------------------------------------------------------------
E5BUG7_9FUSO/30-365--------------------------------------------------------------------------------
C3Q046_9BACE/40-371--------------------------------------------------------------------------------
A6L8S3_PARD8/36-371--------------------------------------------------------------------------------
D7NC58_9BACT/29-366--------------------------------------------------------------------------------
C3WFM0_FUSMR/30-347--------------------------------------------------------------------------------
D0YWK6_LISDA/28-370--------------------------------------------------------------------------------
B9CW40_9PAST/29-365--------------------------------------------------------------------------------
E5WYZ4_9BACE/30-356--------------------------------------------------------------------------------
F0R6C6_BACSH/27-352--------------------------------------------------------------------------------
E4VT48_BACFG/28-352--------------------------------------------------------------------------------
C6W3U8_DYAFD/27-360--------------------------------------------------------------------------------
A9VRB1_BACWK/31-355--------------------------------------------------------------------------------
D7VWT5_9FLAO/18-361--------------------------------------------------------------------------------
C6WZX9_FLAB3/31-373--------------------------------------------------------------------------------
E4TAL9_RIEAD/31-371--------------------------------------------------------------------------------
F0NZQ8_WEEVC/30-359--------------------------------------------------------------------------------
Q5L9T0_BACFN/34-354--------------------------------------------------------------------------------
Q1ID93_PSEE4/39-369--------------------------------------------------------------------------------
Q64Q37_BACFR/30-355--------------------------------------------------------------------------------
E1W1Z9_HAEP3/34-354--------------------------------------------------------------------------------
B0NP44_BACSE/33-342--------------------------------------------------------------------------------
Q93NP8_ECOLX/36-347--------------------------------------------------------------------------------
Q64WD5_BACFR/26-339--------------------------------------------------------------------------------
Q6XQ50_ECOLX/22-344--------------------------------------------------------------------------------
E2NIN8_9BACE/9-341--------------------------------------------------------------------------------
D0TB70_9BACE/50-382--------------------------------------------------------------------------------
D0TIG3_9BACE/46-381--------------------------------------------------------------------------------
Q6AIA7_DESPS/40-375--------------------------------------------------------------------------------
D2QJN3_SPILD/45-378--------------------------------------------------------------------------------
C3J824_9PORP/33-348--------------------------------------------------------------------------------
E4KSW1_9PORP/26-344--------------------------------------------------------------------------------
B2RK66_PORG3/26-344--------------------------------------------------------------------------------
D9YZ33_PROMI/30-361--------------------------------------------------------------------------------
E7FXC0_ERYRH/30-380--------------------------------------------------------------------------------
Q077R9_ECOLX/28-346--------------------------------------------------------------------------------
Q077Q9_ECOLX/28-345--------------------------------------------------------------------------------
E7FV64_ERYRH/21-356--------------------------------------------------------------------------------
E6RKK7_PSEU9/21-338--------------------------------------------------------------------------------
A9QSJ8_LACLK/28-353--------------------------------------------------------------------------------
B5L3N1_ECOLX/27-351--------------------------------------------------------------------------------
C7H3X4_9FIRM/29-345--------------------------------------------------------------------------------
A7VCQ8_9CLOT/30-383--------------------------------------------------------------------------------
B3JEB8_9BACE/29-364--------------------------------------------------------------------------------
D6D462_9BACE/28-360--------------------------------------------------------------------------------
C3HRH2_BACTU/24-343--------------------------------------------------------------------------------
C3WQZ8_9FUSO/25-352--------------------------------------------------------------------------------
E3HB27_ILYPC/34-350--------------------------------------------------------------------------------
E4VYN5_BACFG/26-349--------------------------------------------------------------------------------
C7PMN8_CHIPD/32-372--------------------------------------------------------------------------------
Q5L965_BACFN/30-358--------------------------------------------------------------------------------
Q1WTE3_LACS1/26-359--------------------------------------------------------------------------------
B7AIU7_9BACE/32-363--------------------------------------------------------------------------------
B6W1S5_9BACE/36-375--------------------------------------------------------------------------------
E2N8R2_9BACE/38-379--------------------------------------------------------------------------------
B5CXR1_9BACE/33-352--------------------------------------------------------------------------------
C3JAP3_9PORP/26-357--------------------------------------------------------------------------------
C6I9C7_9BACE/28-351--------------------------------------------------------------------------------
E7DWN5_SALCE/28-357--------------------------------------------------------------------------------
A0KM85_AERHH/26-353--------------------------------------------------------------------------------
A6XVI1_VIBCL/26-352--------------------------------------------------------------------------------
A7M0P5_BACOV/26-361--------------------------------------------------------------------------------
B7BCK8_9PORP/38-375--------------------------------------------------------------------------------
D7IN83_9BACE/23-359--------------------------------------------------------------------------------
Q4JYP9_STRPN/26-355--------------------------------------------------------------------------------
E7DWN9_SALCE/36-394--------------------------------------------------------------------------------
A9NH20_ACHLI/15-352--------------------------------------------------------------------------------
Q4KYP9_ECOLX/2-316--------------------------------------------------------------------------------
B2EAJ6_BIFAN/21-365--------------------------------------------------------------------------------
E4SMU8_LACAR/20-350--------------------------------------------------------------------------------
D0DSK0_LACFE/28-347--------------------------------------------------------------------------------
A6GZ52_FLAPJ/21-343--------------------------------------------------------------------------------
B0KTY9_PSEPG/11-328--------------------------------------------------------------------------------
E1WTD5_BACF6/21-369--------------------------------------------------------------------------------
Q8GP42_STRTR/34-383--------------------------------------------------------------------------------
C7TKZ8_LACRL/24-354--------------------------------------------------------------------------------
B2GF40_LACF3/21-364--------------------------------------------------------------------------------
Q03WA2_LEUMM/21-358--------------------------------------------------------------------------------
C8TTX0_ECO26/24-340--------------------------------------------------------------------------------
C7XF82_9PORP/42-366--------------------------------------------------------------------------------
C7XB09_9PORP/32-356--------------------------------------------------------------------------------
A7AJ45_9PORP/41-378--------------------------------------------------------------------------------
E4TA21_RIEAD/26-353--------------------------------------------------------------------------------
C4UE48_YERAL/24-352--------------------------------------------------------------------------------
B3I2Q9_ECOLX/24-358--------------------------------------------------------------------------------
D7PEY6_SALCE/24-353--------------------------------------------------------------------------------
C1M671_9ENTR/24-355--------------------------------------------------------------------------------
E6ALG7_ECOLX/22-354--------------------------------------------------------------------------------
A6TBF0_KLEP7/23-340--------------------------------------------------------------------------------
E2SY53_9RALS/25-362--------------------------------------------------------------------------------
A6MF01_ECOLX/23-335--------------------------------------------------------------------------------
B7AUK2_9FIRM/25-372--------------------------------------------------------------------------------
C9BE41_ENTFC/31-354--------------------------------------------------------------------------------
A5G608_GEOUR/41-362--------------------------------------------------------------------------------
C6X1R8_FLAB3/21-351--------------------------------------------------------------------------------
A7ZNK7_ECO24/20-336--------------------------------------------------------------------------------
A3D6K3_SHEB5/9-323--------------------------------------------------------------------------------
B5L3F9_ECOLX/24-340--------------------------------------------------------------------------------
C3WK26_9FUSO/25-344--------------------------------------------------------------------------------
B8EDA7_SHEB2/32-359--------------------------------------------------------------------------------
E0SFU5_DICD3/23-330--------------------------------------------------------------------------------
Q6FFU5_ACIAD/13-316--------------------------------------------------------------------------------
E4TIN4_CALNY/56-394--------------------------------------------------------------------------------
B5L3A6_SHIDY/54-384--------------------------------------------------------------------------------
C7X5V3_9PORP/26-352--------------------------------------------------------------------------------
E3DJ50_ERWSE/35-367--------------------------------------------------------------------------------
C0H3N7_ERWST/32-370--------------------------------------------------------------------------------
E7NQN0_TREPH/28-357--------------------------------------------------------------------------------
Q8A831_BACTN/29-353--------------------------------------------------------------------------------
C6I3T9_9BACE/28-349--------------------------------------------------------------------------------
Q1V7L3_VIBAL/26-356--------------------------------------------------------------------------------
C7M7Z9_CAPOD/10-347--------------------------------------------------------------------------------
B5L3D3_ECOLX/36-361--------------------------------------------------------------------------------
F1Z115_9STRE/49-372--------------------------------------------------------------------------------
A7V5U7_BACUN/28-354--------------------------------------------------------------------------------
Q8A715_BACTN/26-366--------------------------------------------------------------------------------
D7ITP9_9BACE/25-344--------------------------------------------------------------------------------
E2N1D0_CAPSP/33-355--------------------------------------------------------------------------------
D7PDX4_ECOLX/28-352--------------------------------------------------------------------------------
A8U9G3_9LACT/24-350--------------------------------------------------------------------------------
C7TKU1_LACRL/24-347--------------------------------------------------------------------------------
E0NTF2_9BACT/25-352--------------------------------------------------------------------------------
F0KIR6_ACICP/24-352--------------------------------------------------------------------------------
C2BGA1_9FIRM/29-360--------------------------------------------------------------------------------
B6W8F8_9FIRM/29-359--------------------------------------------------------------------------------
C7RFF5_ANAPD/29-361--------------------------------------------------------------------------------
Q5LH99_BACFN/15-335--------------------------------------------------------------------------------
A7V5D6_BACUN/28-344--------------------------------------------------------------------------------
D3SAJ3_THISK/38-360--------------------------------------------------------------------------------
E5CFC4_9BACE/25-346--------------------------------------------------------------------------------
C6X0C5_FLAB3/28-350--------------------------------------------------------------------------------
C4ZJE6_THASP/44-373--------------------------------------------------------------------------------
E5YGM0_9ENTR/19-338--------------------------------------------------------------------------------
C6ITG0_9BACE/26-335--------------------------------------------------------------------------------
A5ZI18_9BACE/28-334--------------------------------------------------------------------------------
Q0HKL4_SHESM/27-338--------------------------------------------------------------------------------
D6E918_9ACTN/24-356--------------------------------------------------------------------------------
F0SY68_SYNGF/34-364--------------------------------------------------------------------------------
C9KPH1_9FIRM/27-363--------------------------------------------------------------------------------
B6A8T0_ECOLX/28-355--------------------------------------------------------------------------------
E2DNR6_ECOLX/32-354--------------------------------------------------------------------------------
D2TQI7_CITRI/31-353--------------------------------------------------------------------------------
E5V9C7_9BACE/31-351--------------------------------------------------------------------------------
A6L9H3_PARD8/32-354--------------------------------------------------------------------------------
Q4K0T2_STRPN/28-349--------------------------------------------------------------------------------
E0NHN7_PEDAC/40-361--------------------------------------------------------------------------------
A1A378_BIFAA/27-350--------------------------------------------------------------------------------
F0K0J0_LACD2/31-347--------------------------------------------------------------------------------
E1WLK7_BACF6/35-350--------------------------------------------------------------------------------
E0RX92_BUTPB/42-359--------------------------------------------------------------------------------
C3R7I4_9BACE/28-352--------------------------------------------------------------------------------
D5DBJ5_BACMD/39-371--------------------------------------------------------------------------------
C2EVS6_9LACO/30-364--------------------------------------------------------------------------------
C0C0E8_9CLOT/30-354--------------------------------------------------------------------------------
E7GJ39_CLOSY/47-379--------------------------------------------------------------------------------
Q8XN60_CLOPE/30-345--------------------------------------------------------------------------------
A9VPZ7_BACWK/36-350--------------------------------------------------------------------------------
C2UYS5_BACCE/36-350--------------------------------------------------------------------------------
C3ADI9_BACMY/38-352--------------------------------------------------------------------------------
C2WEM9_BACCE/36-357--------------------------------------------------------------------------------
E3DVZ3_BACA1/36-363--------------------------------------------------------------------------------
E5W8D3_9BACI/36-363--------------------------------------------------------------------------------
B0P2K8_9CLOT/37-362--------------------------------------------------------------------------------
B0ACE3_9FIRM/38-368--------------------------------------------------------------------------------
A6NPS1_9FIRM/35-361--------------------------------------------------------------------------------
F0HVE5_LACDL/23-357--------------------------------------------------------------------------------
C2EGY8_9LACO/41-362--------------------------------------------------------------------------------
Q0TSM6_CLOP1/32-355--------------------------------------------------------------------------------
F0PU56_BACT0/28-368--------------------------------------------------------------------------------
C6I5R5_9BACE/29-346--------------------------------------------------------------------------------
Q64Y60_BACFR/31-360--------------------------------------------------------------------------------
C4L730_EXISA/28-346--------------------------------------------------------------------------------
B0P9K3_9FIRM/54-410--------------------------------------------------------------------------------
E1YWT9_9BACE/27-350--------------------------------------------------------------------------------
C9RN08_FIBSS/27-350--------------------------------------------------------------------------------
C7M4A6_CAPOD/29-353--------------------------------------------------------------------------------
Q39W09_GEOMG/33-369--------------------------------------------------------------------------------
D1JP75_9BACE/28-362--------------------------------------------------------------------------------
C9PY95_9BACT/28-358--------------------------------------------------------------------------------
E4RNL6_HALSL/27-346--------------------------------------------------------------------------------
B5Q3Y8_SALVI/23-348--------------------------------------------------------------------------------
B9KB09_THENN/26-382--------------------------------------------------------------------------------
B2V0T8_CLOBA/35-358--------------------------------------------------------------------------------
Q1WCS9_STRTR/30-358--------------------------------------------------------------------------------
C4Z668_EUBE2/44-362--------------------------------------------------------------------------------
E0S0Y2_BUTPB/32-367--------------------------------------------------------------------------------
Q048A4_LACDB/46-398--------------------------------------------------------------------------------
E2DZE7_ECOLX/24-353--------------------------------------------------------------------------------
E1LFZ3_STRMT/29-357--------------------------------------------------------------------------------
D0BKU5_9LACT/28-356--------------------------------------------------------------------------------
D7YPG3_ECOLX/25-334--------------------------------------------------------------------------------
E4VU68_BACFG/30-357--------------------------------------------------------------------------------
D2RIR8_ACIFV/29-352--------------------------------------------------------------------------------
E4MD95_9BACT/23-351--------------------------------------------------------------------------------
C4GCL9_9FIRM/28-345--------------------------------------------------------------------------------
B1C3W9_9FIRM/29-372--------------------------------------------------------------------------------
F2M2L7_LACAL/34-380--------------------------------------------------------------------------------
D1JXK2_9BACE/23-363--------------------------------------------------------------------------------
D3HZQ1_9BACT/22-355--------------------------------------------------------------------------------
B0NR62_BACSE/28-357--------------------------------------------------------------------------------
D5EVG6_PRER2/7-324--------------------------------------------------------------------------------
D1PQ73_9FIRM/29-362--------------------------------------------------------------------------------
B1SB73_9BIFI/27-361--------------------------------------------------------------------------------
A6QAG6_SULNB/27-344--------------------------------------------------------------------------------
A6DEM7_9PROT/26-341--------------------------------------------------------------------------------
E4PS23_MARAH/27-342--------------------------------------------------------------------------------
Q0A657_ALHEH/27-342--------------------------------------------------------------------------------
B7RW64_9GAMM/32-347--------------------------------------------------------------------------------
Q8DJL9_THEEB/21-349--------------------------------------------------------------------------------
B6QYQ8_9RHOB/29-346--------------------------------------------------------------------------------
A7HKI9_FERNB/29-353--------------------------------------------------------------------------------
F2ALR7_RHOBT/67-386--------------------------------------------------------------------------------
E3I7S4_RHOVT/25-342--------------------------------------------------------------------------------
E8KJL4_9PAST/2-248--------------------------------------------------------------------------------
F0QJB5_ACIBD/26-342--------------------------------------------------------------------------------
Q5QWV6_IDILO/29-338--------------------------------------------------------------------------------
Q1QWW7_CHRSD/27-347--------------------------------------------------------------------------------
F2UUT5_ACTVI/30-361--------------------------------------------------------------------------------
B5L3I2_ECOLX/31-358--------------------------------------------------------------------------------
Q8KN52_PSEAI/26-351--------------------------------------------------------------------------------
B0MX13_9BACT/23-361--------------------------------------------------------------------------------
E5VCV4_9BACE/29-372--------------------------------------------------------------------------------
D1JV57_9BACE/29-369--------------------------------------------------------------------------------
D2ETY6_9BACE/27-359--------------------------------------------------------------------------------
D0TG79_9BACE/26-371--------------------------------------------------------------------------------
D0TBD4_9BACE/31-353--------------------------------------------------------------------------------
A6LBP7_PARD8/27-381--------------------------------------------------------------------------------
C7XEA9_9PORP/27-380--------------------------------------------------------------------------------
D1W6W5_9BACT/26-352--------------------------------------------------------------------------------
D9RS75_PREMB/26-353--------------------------------------------------------------------------------
D1W1V4_9BACT/26-351--------------------------------------------------------------------------------
D3IIR5_9BACT/26-355--------------------------------------------------------------------------------
D3I859_9BACT/26-352--------------------------------------------------------------------------------
F0F6A4_9BACT/26-352--------------------------------------------------------------------------------
D8DZP1_PREBR/31-354--------------------------------------------------------------------------------
E1KTN9_9BACT/26-351--------------------------------------------------------------------------------
D7NAB4_9BACT/26-352--------------------------------------------------------------------------------
C9PWW7_9BACT/24-345--------------------------------------------------------------------------------
E1GYB6_9BACT/25-352--------------------------------------------------------------------------------
D1XZD4_9BACT/28-352--------------------------------------------------------------------------------
D1PWT1_9BACT/24-349--------------------------------------------------------------------------------
C9LKD9_9BACT/25-350--------------------------------------------------------------------------------
E6MMW3_9BACT/21-348--------------------------------------------------------------------------------
E5V8M3_9BACE/69-395--------------------------------------------------------------------------------
B7GUM4_BIFLS/44-384--------------------------------------------------------------------------------
A5ZDF0_9BACE/31-358--------------------------------------------------------------------------------
E9SGC4_RUMAL/37-488--------------------------------------------------------------------------------
E6UEJ4_RUMA7/36-384--------------------------------------------------------------------------------
E4RXS3_LEAB4/31-353--------------------------------------------------------------------------------
E3PBR1_ECOH1/28-364--------------------------------------------------------------------------------
B3IUU1_VIBPA/26-360--------------------------------------------------------------------------------
D8MET7_LEUGT/28-370--------------------------------------------------------------------------------
A6ASH6_VIBHA/21-345--------------------------------------------------------------------------------
D9YYZ5_PROMI/24-338--------------------------------------------------------------------------------
C4K321_HAMD5/34-350--------------------------------------------------------------------------------
Q4K041_STRPN/27-373--------------------------------------------------------------------------------
C5S1B5_9PAST/27-372--------------------------------------------------------------------------------
E6MFB5_9FIRM/30-370--------------------------------------------------------------------------------
C5F8C9_LACPA/30-390--------------------------------------------------------------------------------
D1NRU3_9BIFI/51-371--------------------------------------------------------------------------------
C8WKZ6_EGGLE/32-357--------------------------------------------------------------------------------
D4V5L6_BACVU/25-369--------------------------------------------------------------------------------
C3WC57_FUSMR/29-349--------------------------------------------------------------------------------

PF10131

Q0AV03_SYNWW/415-1038.WLLLSRRMGL..WPAVMAAVVWLLWQDNVRVAFSE--------------------------------------------
Q5JIL5_PYRKO/62-622.LHFYLRRTGR...EPYVAPVVFLLFPWHLGVAYIE--------------------------------------------
Q9UY38_PYRAB/63-619.LHHYLKSTGR...EPCISPLIFLLFPWHLTVSYIE--------------------------------------------
Q97FZ3_CLOAB/258-879.WLIWGIRERS.IFISLVLGILWFFLPENLKVLFYE--------------------------------------------
Q0AV07_SYNWW/2-631VWYICYRYWGS..LIGIAAGILYVLQPFILRSMASE--------------------------------------------
Q8TXR3_METKA/68-665.VYALVRARGYARKVAVICALLGLTSGGFMKALNWE--------------------------------------------
A0LQQ1_SYNFM/80-828.IYFCLRRFGYADLVAALGSALALPFLVMKENAMWG--------------------------------------------
Q97FY2_CLOAB/253-873.WLLWGNREKR.VFICFIFGVLWFLLPENIRIFFFE--------------------------------------------
A7VEP1_9CLOT/75-690.WIFWGIHENR.RVIGTFFGLLWFFMPEHIRIYFTA--------------------------------------------
Q97G45_CLOAB/90-699.WLFWGYYTRR.QNIAIVLAILWFFIPDNLRVLFSE--------------------------------------------

PF09586

A4VYG6_STRSY/15-836-SLFYTFSSGLGLNFYALSSYYL.GSFLSPIVFFFD..............LQSMPDAIYLVTIVKFGLTGLSTYFSLKGI
Q1WT54_LACS1/18-862-SFFYSFSKAIGGEMIGEWAYYL.LSPFNLLFIFFP..............GKSIAAGVLVVTLLKYGFCGLSFAYLLSKR
Q8DRZ1_STRMU/67-904-ALFWSWHKGVGGVMPSVWGFNS.LSPFSLAIGLAP..............AKYLNLSVFLVTLLRQGFSGLSFYYFLHKR
A7GVH5_BACCN/15-865-NFFWSWNYGLGGDLFGEFSYYYSTAPFFWITLLLPKLN...........IEQIYDMKLYMSIFKSFLAMLFMYGSLRYH
A7VEC6_9CLOT/153-972-SLFYTWDIGLGSNMLAIIAYYI.ACPINFLVVLFK..............REHIYIAMSLFIGIKIVLSGMSFAYYMREK
Q3EWS4_BACTI/59-905-NLFWSFDYGLGGDLFGEFSYYYSTSPFFWITLLLPKLS...........LEQVYDVKLYMSILKNFLAMLFMYGSLRYH
Q74LA0_LACJO/18-861-SLQFSFANGLGADMAGNIGYYL.ASPFNLLILLFP..............ASQINLALYVIIIIKLGLASAAFTFLILNF
Q74LA1_LACJO/22-868-SAGFSFLNGLGGDMAGNIGYYL.LSPLNFIVFLFP..............ASKMNIAVYIIILIKLGLMSGTFTWLTLKW
A8AU67_STRGC/17-840-SLFYTFTSGLGLNFYALTSYYL.GSFLSPFVYFFN..............LENMPDAVYIFTLIKFGLIGLTAAISLKGI
Q03YY3_LEUMM/16-848-SFFYSFSNALGGDMLGEWAYYL.MSPFNFIFLFVS..............NANLPAAILLVICLKISAAGLSMGYLLKKL
Q8DRQ9_STRMU/18-837-SLFYSFKAGLGFNIFALTSYYL.GSFLTPFTYFFN..............VKNMADAFYLFTLIKFGLIGLSAFYSLGQI
Q4L5U5_STAHJ/10-841-NLFYATDFGLGGDFFTDLSYYFSTNILFIINVLCIILLKTFIHINTQG.LLFWMVNALVISTIKAALAMYCTYLYSKFI
Q03G85_PEDPA/13-851-QFFYSFSNGLGGDMFGTWAYYL.FSPTNLLLLFFK..............KESITSGILVITVLKYALAGLTSAIYLQHL
Q030D0_LACLS/14-856-GFLYTFTSGLGLNLYAFSAYYM.GSFLMPFTFFFD..............VKSMPDALYLFTIIKFGLIGLSSFVSFKNM
A5VKU5_LACRD/18-849-SFFYSFSKGLGGEMFGTNAYYL.LSPLNLILLFFP..............AQHLATGITIVTLVRYGLAGLSFAWLMQKT
Q8DRY9_STRMU/26-950-GLFYSFSKSIGGAMIGIWGFNL.ISPFNLFYILFP..............LTQFKWAVFLTIWLRYGAMGLSFAYLLIKR
Q38WC5_LACSS/15-827-FSAYSFSLSLGGNLVPLAAYYL.ISPFNLLLLLGS..............NSQLPVMISYVIALKICTMGVTMNYFLRTR
Q8DWP3_STRA5/16-839-SLFYTFTSGLGLNFYALSSYYL.GSFLSPIVYFFN..............LKNMPDAIYLLTICKIGLIGLSMFVTLCKR
Q03NT2_LACBA/19-858-SIVYSFSNGLGGGMIGIWSYYL.LSPLNWLLLFFP..............GTHITSGIMLLTLLKYGLASLSFSWLIKKN
A5M1N1_STRPN/14-831-SLFYTFTSGLGLNFYALSSYYL.GSFLAPLVYFFD..............LTNMPDAVYLTTLLKFGLIGLSTFFSLNKL
Q38VZ4_LACSS/17-848-TFFYSFAKGLGGDMLGVWAYYL.MSPFNLLVLLTP..............GKWLSFGVWLMVLLKYGFSGLSFAYYLKKS
Q03RN6_LACBA/20-858-SIFYSFSNGIGGEMLGTWSYYL.LSPLNWLLLLCP..............GTSLTTGVFLLTVFKYGLAGLSFAWLLEKT
Q5FIZ5_LACAC/21-848-NLIYTFSNGLGNSMLATDAYYL.LSPFNLLLFVFP..............QHFLPKVILLIITLKIATAGLTSYYYW..K
Q4L5U4_STAHJ/19-851-KGFYDHSFGLGGDYVKGLAYYYSLSPIMWVNFIIVWIGEHIFHWQPQN.IRFWPTNQLIVAYVRTIITFICAFYYFRYL
A7VCC3_9CLOT/56-904-KGSFIWERGLGIDIVLNMFYYC.MSPFNIIAIVLG..............PDRVELSMTLMIVLKASCLAPAGLFFFRHS
Q839W8_ENTFA/19-846-SLFYTWNASLGLNYLSLISYYL.GGLFTPLVFFFN..............NQNMPDALYFLTLLKIGSAGLSFWFLAKQT
Q5M231_STRT2/16-841-SLFYTFTSGLGLNFYALTSYYL.GSFLSPLYYFFT..............VSQMADAFYYITLLKFGLTGLSGAFSFKHL
Q82ZW8_ENTFA/12-828-TTFYSFSNEIGESIVPLAAYYL.LSPFNVLAFFFP..............YEQLPIAILWIITLKLALMGTTMFSYLKYT
A7VV10_9CLOT/13-832-ALFFSWEGGLGMNMTGVVSFYL.ASPFSFLIAFFD..............KQSVTEGILLITILKTAACGLTFSIYTRKA
Q8NYY9_STRP8/14-837-SFFYTFTSGLGINFYALMCYYL.GSFFSPLLFFFN..............LASMPDAIYLFTLIKFGLIGLAACYSFHRL
Q5HPU9_STAEQ/10-840-NLFYSTHLGLGGDFFTDLSYYFSTNLIFILNVPIIKLCEIFFSLNTNQ.ILLWMYNALIVSIIKSTIALFCTYLFSYYI
A5Z3G2_9FIRM/23-866-SLFYTWEIGAGMNFMAVAAYYL.TSPLNLLAIIWP...............GYMADMVSFFIVLKMGLAGFSVCYYLTKR
Q5WFJ9_BACSK/12-844-HWSYSIQFGLGAGTFSQLAYYFSTSMVYSFSCLLVYVGEMSGLIANVD.LLFWGKAAVYINAARLALILFLATSVFHYM
Q74IE5_LACJO/19-843-NFIFTFSNGLGSSFIGTSAYYL.NSPFNFLLLLFS..............NSSLPIAILLIISLKVGAIGLSSFFYFQKF
Q03HY9_PEDPA/14-831-SLWFNWQAGFGLNYLALYSYYL.GGIVTPLVGLFS..............KNQIPNAFYAITIFKIGLAGLSSFSYLKHQ
Q038D6_LACC3/14-842-QLFYAFNKALGGDMYGVFAYYL.LSPFNWLVVLFP..............ADMLDVAAFLITVLKISTIGFTMGWY.AKR
Q3XYV7_ENTFC/19-847-SIFYTWNASLGLNYLSLISYYL.GGIFTPLVFFFP..............NQMMPDALYVLTLLKVGCAGLAFWFLAR.T
Q931T0_STAAM/19-851-SSLYDASFGLGGDYMKGLSYYYSLSPLMWLNFLFIKIGETVGIFNPTT.IHFWPTNQLIMAMIRAIITFVVTFYLFKIL
Q814J9_BACCR/15-862-NLFWSWDYGLGGDLFGEFSYYYSTAPFFWLTLLLPKLN...........FDQIFEMKLYMSILKSTLAMLFMYGSLRYH
Q041X2_LACGA/19-844-NFIFTFSSGLGNSFIGTWAYYL.TSPFNFLLLIFP..............KSQLPEAILLIISLKIGSIGLSGFYYFQKF
A7Z2M8_BACA2/11-842-RLFYSYSFGLGGGVYSQLGYYFSTSFLFLFISAAVRFLQLIQLTGEAD.ALFWAQASVFISFAKQSFIIFTAACVFRYF
Q03TF4_LACBA/23-880-FHLFSFSLGSGSAVVPLLTYYA.ISPFNLLIFAFS..............AANLPIAVSWIIMLKISAMGLTMAIFLRHA
Q8CSU8_STAES/19-850-KGFYDASFGLGGDYVKSLAYYYSLSPLMWINFSMIWILEQTINVNPHD.ISFWTINQLIMAYVRTVITFIFSFYLFSYL
Q046D7_LACGA/22-883-SAGYTFSNGLGGDMAGNIAYYV.LSPLNFIVFLFP..............ANKINIAVYVIILFKLGLMSGTFTWLILKW
Q5WJL1_BACSK/14-845-SFFYSLQFGLGGGIFSQLAYYFATSTVFFLTFLVVYSGEILGLFADPDTVLFWGQAAVFVNAFRLAAVVFITSLLFCYM
A3CRC9_STRSV/17-843-SIFYTFSSGLGQNFYALSSYYL.GSFLSPLVYFFD..............LKSMPDAVYLFTLIKFGLIGLSAFISIKGI
Q65M97_BACLD/11-842-NFFYSYSFGLGGGIYSQLGYYFTTSFVFIASFAAVFLMQLLHLAGDAD.PLFWAQAAVFISVIKLSLIILAAAYALNGM
Q04EK1_OENOB/16-850-QLFYSFAKNFGGEMFSEWSYYL.FSPLNLLLLFFN..............QANLPSGILFLTVVRFGLAGLSMQYLLVRR
Q03QV8_LACBA/14-985-LTGWSWDLGLGADKLTTFSYYVLGDPFSYLIAFFP..............KGRLELGYNLLILLRLYASGLAFLFFARQR
Q49X29_STAS1/10-840-NFFYASDFGLGGDFFSDLSYYFSTNIIFIINVIVIVLLKTFITLDTTH.IMFWMTNALIVSIFKSAIAMLATYLYVRYI
A5ZUP3_9FIRM/20-900-IPMWDLNIGYGSDILTTLHYYVIGDPLTLLSVFFK..............SSQTEFLYEFLIFLRIYLAGIAFSRYAFYH
Q03A73_LACC3/16-850-KA.YSFSNSLGGGMYANWTYYL.LSPFNLIFVLVS..............RQAIPVAMLFVTALKYSTAALA.AQVLASH
A8FB68_BACP2/11-842-NFFYSYQFGLGGGTYTQLGYYFTTSTVFMVTVAVVWLMNTLHLIQSTD.IHFWANAVIWLSVIKLTLILFIAYRVLLSM
Q049H9_LACDB/23-844-KLIYSFASGLGGSMLGTDSYYL.LSPFNLLLLFFP..............QKFLPQGILLVISCKIGAIGLSAYLVWGKK
Q03TW7_LACBA/17-837-WSFMNLHQALGGNWMPVISYYI.LSPFNLLLFVGR..............ASQIPVMIAVIIMLKVATIAGTMTFYLQAH
Q49X28_STAS1/19-851-KLFYDHSFGLGGDYVKDLSYYYSTSPLTWINFIFVWFSEILFNSHPNQ.ISYWASNQIIVAFVKGVVTFVISFYFFRYL

PF05007

GPI14_YEAST/127-386--------------------------------------------------------------------------------
GPI14_SCHPO/112-368--------------------------------------------------------------------------------
PIGM_TRYB2/134-410--------------------------------------------------------------------------------
PIGM_RAT/140-408--------------------------------------------------------------------------------
Q17515_CAEEL/146-405--------------------------------------------------------------------------------
Q9W2E4_DROME/177-450--------------------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379-.GFSKL-------------------------------------------------------------------------
Q5CYY5_CRYPI/10-436-.FILVE-------------------------------------------------------------------------
B6AHL5_CRYMR/12-437-YYASD.-------------------------------------------------------------------------
B0E7Z2_ENTDS/6-295-ILLNFL-------------------------------------------------------------------------
B8A6Z1_ORYSI/11-376-.VLFGG-------------------------------------------------------------------------
Q9LN74_ARATH/14-421-.IFSPA-------------------------------------------------------------------------
B9RC32_RICCO/30-452-.IYFSQ-------------------------------------------------------------------------
B9GKM7_POPTR/14-432-.IYLPK-------------------------------------------------------------------------
A9TIH7_PHYPA/73-514-.VVMGS-------------------------------------------------------------------------
B3N7C2_DROER/10-386-.CRTPL-------------------------------------------------------------------------
B4N1B7_DROWI/10-386-.SRTPL-------------------------------------------------------------------------
B4KI55_DROMO/10-386-.SQTSL-------------------------------------------------------------------------
Q16H22_AEDAE/9-388-.MHSHY-------------------------------------------------------------------------
B0W4N5_CULQU/8-388-.MSSEY-------------------------------------------------------------------------
Q7Q3W6_ANOGA/8-396-.MNSRY-------------------------------------------------------------------------
B7QL74_IXOSC/11-391-.IYTSI-------------------------------------------------------------------------
PIGU_CRIGR/10-394-.FRSSL-------------------------------------------------------------------------
Q4RLI5_TETNG/10-394-.YRSNL-------------------------------------------------------------------------
Q28CK0_XENTR/10-394-.FRSSL-------------------------------------------------------------------------
A7S3Y0_NEMVE/14-406-.MYSPA-------------------------------------------------------------------------
C1BQW5_9MAXI/19-392-.GLWFL-------------------------------------------------------------------------
C1BTB5_9MAXI/14-387-.GLWCL-------------------------------------------------------------------------
Q54T45_DICDI/55-469-.FYQGF-------------------------------------------------------------------------
Q758M8_ASHGO/10-356-.AFPSL-------------------------------------------------------------------------
C5DB98_LACTC/10-356-.VFPLL-------------------------------------------------------------------------
Q6CPH2_KLULA/10-358-.LFPSL-------------------------------------------------------------------------
Q6KCB8_SACBA/10-360-.LFPAL-------------------------------------------------------------------------
C5DUS6_ZYGRC/10-359-.LFPSL-------------------------------------------------------------------------
A7TF02_VANPO/11-360-.GFSGL-------------------------------------------------------------------------
Q6FSI7_CANGA/9-374-.TFPSL-------------------------------------------------------------------------
C5MHK2_CANTT/9-395-.LFPQI-------------------------------------------------------------------------
Q5AGH5_CANAL/13-440-IIFPQL-------------------------------------------------------------------------
A5E2K6_LODEL/111-490-.LVPSI-------------------------------------------------------------------------
Q6BPY5_DEBHA/9-390-.SLPSL-------------------------------------------------------------------------
A3LVF4_PICST/9-390-.VLPQV-------------------------------------------------------------------------
C4Y9V1_CLAL4/8-389-.LLPHI-------------------------------------------------------------------------
C4R1V8_PICPG/4-353-TIPADI-------------------------------------------------------------------------
C0RYW5_PARBP/12-388-.LFPTL-------------------------------------------------------------------------
C5FSQ4_ARTOC/12-388-.LFPGL-------------------------------------------------------------------------
B6H480_PENCW/12-387-.LFPSL-------------------------------------------------------------------------
A2QI87_ASPNC/12-388-.LFPSL-------------------------------------------------------------------------
B6QEM6_PENMQ/12-390-.AFPSL-------------------------------------------------------------------------
B2WBA6_PYRTR/13-388-.VFPAL-------------------------------------------------------------------------
B2A9S5_PODAN/16-388-.LLPDL-------------------------------------------------------------------------
Q6MUS3_NEUCS/16-392-.LFPGL-------------------------------------------------------------------------
Q6C5L4_YARLI/7-382-.LFPSV-------------------------------------------------------------------------
Q55ZX0_CRYNB/19-375-.SLPEV-------------------------------------------------------------------------
B0D118_LACBS/9-373-.ALSSL-------------------------------------------------------------------------
Q4PGW0_USTMA/31-470-.LYTDT-------------------------------------------------------------------------
PIGU_SCHPO/10-372-YLANTW-------------------------------------------------------------------------
B6K154_SCHJY/14-372-LDFS..-------------------------------------------------------------------------
Q22672_CAEEL/31-382-YS....-------------------------------------------------------------------------
A8X654_CAEBR/27-380-YS....-------------------------------------------------------------------------
Q01AL0_OSTTA/12-375-FIVPES-------------------------------------------------------------------------
C1EBB5_MICSR/13-406-.AILGW-------------------------------------------------------------------------
C1MV77_MICPC/13-431-.AARGW-------------------------------------------------------------------------
C5L3N8_PERM5/23-419-ALGSPL-------------------------------------------------------------------------
Q4UC96_THEAN/14-414-YLLKVF-------------------------------------------------------------------------
Q4YTZ9_PLABA/82-516-KNIKQC-------------------------------------------------------------------------
Q8IE19_PLAF7/127-560-.NLRSF-------------------------------------------------------------------------
B3L8S4_PLAKH/95-534-.KIKQF-------------------------------------------------------------------------
B6KRJ9_TOXGO/75-514-VGLT..-------------------------------------------------------------------------
A0DGJ7_PARTE/1-357-WYFGKW-------------------------------------------------------------------------
B8C4L2_THAPS/71-579-IRAAVL-------------------------------------------------------------------------

PF09594

PIME_MYCS2/91-321--------------------------------------------------------------------------------
A0JZG9_ARTS2/73-321--------------------------------------------------------------------------------
Q73YN6_MYCPA/82-326--------------------------------------------------------------------------------
Q2MF52_STRLV/80-314--------------------------------------------------------------------------------
A5ERG5_BRASB/100-323--------------------------------------------------------------------------------
B1K2K9_BURCC/104-334--------------------------------------------------------------------------------
Q1BSC4_BURCA/94-319--------------------------------------------------------------------------------
E0TET4_PARBH/112-335--------------------------------------------------------------------------------
Q1QK36_NITHX/92-360--------------------------------------------------------------------------------
A8LXF0_SALAI/84-339--------------------------------------------------------------------------------
Q1DFL5_MYXXD/100-338--------------------------------------------------------------------------------
Q1LAW9_RALME/87-313--------------------------------------------------------------------------------
Q0RAR1_FRAAA/151-401--------------------------------------------------------------------------------
Q2J8W8_FRASC/88-337--------------------------------------------------------------------------------
Q9HN16_HALSA/81-322--------------------------------------------------------------------------------
A7NFV7_ROSCS/391-632--------------------------------------------------------------------------------
Q1B9V9_MYCSS/90-325--------------------------------------------------------------------------------
Q6N414_RHOPA/73-354--------------------------------------------------------------------------------
Q8KF88_CHLTE/91-313--------------------------------------------------------------------------------
Q9X7Z2_STRCO/66-306--------------------------------------------------------------------------------
Q82C69_STRAW/73-314--------------------------------------------------------------------------------
A6W4J4_KINRD/75-318--------------------------------------------------------------------------------
Q8NNL7_CORGL/75-325--------------------------------------------------------------------------------
A6LI36_PARD8/70-300--------------------------------------------------------------------------------
Q1BEU7_MYCSS/84-314--------------------------------------------------------------------------------
Q2T300_BURTA/118-340--------------------------------------------------------------------------------
Q0S7Q3_RHOSR/72-303--------------------------------------------------------------------------------
O69571_MYCLE/80-324--------------------------------------------------------------------------------
Q0S430_RHOSR/96-330--------------------------------------------------------------------------------
Q1BJ26_BURCA/118-340--------------------------------------------------------------------------------
A0QW28_MYCS2/90-325--------------------------------------------------------------------------------
A9W380_METEP/98-320--------------------------------------------------------------------------------
Q8KF86_CHLTE/520-743--------------------------------------------------------------------------------
A4X3Z6_SALTO/69-305--------------------------------------------------------------------------------
P71970_MYCTU/94-329--------------------------------------------------------------------------------
A7AAB1_9PORP/77-308--------------------------------------------------------------------------------
A0PTL6_MYCUA/80-324--------------------------------------------------------------------------------
A5FWG6_ACICJ/133-359--------------------------------------------------------------------------------
A4QI28_CORGB/146-378--------------------------------------------------------------------------------
Q8EXK5_LEPIN/120-368--------------------------------------------------------------------------------
Q6NG43_CORDI/98-348--------------------------------------------------------------------------------
A4LNL6_BURPE/93-323--------------------------------------------------------------------------------
A4F662_SACEN/84-314--------------------------------------------------------------------------------
A4YMG5_BRASO/52-323--------------------------------------------------------------------------------
A6CF56_9PLAN/79-322--------------------------------------------------------------------------------
Q8FNR9_COREF/132-368--------------------------------------------------------------------------------
Q8FNS1_COREF/85-333--------------------------------------------------------------------------------
A1UKF4_MYCSK/110-340--------------------------------------------------------------------------------
Q2IKA8_ANADE/104-327--------------------------------------------------------------------------------
Q8NNL6_CORGL/93-341--------------------------------------------------------------------------------
A7I755_METB6/60-298--------------------------------------------------------------------------------
Q1AS45_RUBXD/75-307--------------------------------------------------------------------------------
A3PTP0_MYCSJ/72-303--------------------------------------------------------------------------------
Q0SHP5_RHOSR/98-332--------------------------------------------------------------------------------
A1TAY8_MYCVP/79-323--------------------------------------------------------------------------------
Q0KDP9_CUPNH/92-320--------------------------------------------------------------------------------
Q7MTZ4_PORGI/65-295--------------------------------------------------------------------------------
A4XDG1_SALTO/368-608--------------------------------------------------------------------------------
Q73W67_MYCPA/92-327--------------------------------------------------------------------------------
A1KHU9_MYCBP/103-334--------------------------------------------------------------------------------
A0JZG6_ARTS2/141-392--------------------------------------------------------------------------------
A8M762_SALAI/67-302--------------------------------------------------------------------------------
Q2G5A3_NOVAD/106-326--------------------------------------------------------------------------------
Q8A2B6_BACTN/67-296--------------------------------------------------------------------------------
Q0C0G8_HYPNA/93-341--------------------------------------------------------------------------------
Q394F5_BURS3/104-334--------------------------------------------------------------------------------
Q1ITA1_KORVE/92-336--------------------------------------------------------------------------------
Q4JVC2_CORJK/78-310--------------------------------------------------------------------------------
Q5Z2C4_NOCFA/88-323--------------------------------------------------------------------------------
Q0S1F1_RHOSR/88-319--------------------------------------------------------------------------------
Q7UFG8_RHOBA/89-337--------------------------------------------------------------------------------
Q5YR74_NOCFA/76-310--------------------------------------------------------------------------------
Q82B65_STRAW/52-287--------------------------------------------------------------------------------
A6WEV4_KINRD/63-293--------------------------------------------------------------------------------
Q6A9X9_PROAC/81-311--------------------------------------------------------------------------------
A4JSX6_BURVG/118-340--------------------------------------------------------------------------------
Q46XY5_CUPPJ/144-366--------------------------------------------------------------------------------
B2U6Q0_RALPJ/105-334--------------------------------------------------------------------------------
Q8A2B7_BACTN/70-300--------------------------------------------------------------------------------
A1K2E7_AZOSB/76-322--------------------------------------------------------------------------------
Q1LQN5_RALME/107-328--------------------------------------------------------------------------------
Q82AJ1_STRAW/66-309--------------------------------------------------------------------------------
A4F642_SACEN/68-304--------------------------------------------------------------------------------
Q6NEL0_CORDI/90-330--------------------------------------------------------------------------------
Q89QR1_BRAJA/100-368--------------------------------------------------------------------------------
Q4JVV2_CORJK/84-315--------------------------------------------------------------------------------
A5ESS8_BRASB/89-311--------------------------------------------------------------------------------
A4TCS8_MYCGI/75-310--------------------------------------------------------------------------------
Q5YTA9_NOCFA/80-311--------------------------------------------------------------------------------
Q73WN6_MYCPA/105-337--------------------------------------------------------------------------------
Q8FNS2_COREF/71-313--------------------------------------------------------------------------------
A4Z0F4_BRASO/98-322--------------------------------------------------------------------------------
Q1AX69_RUBXD/44-303--------------------------------------------------------------------------------
Q5YQC7_NOCFA/78-313--------------------------------------------------------------------------------
Q8FPI8_COREF/95-327--------------------------------------------------------------------------------
Q6M3Q3_CORGL/95-331--------------------------------------------------------------------------------
B2U6P6_RALPJ/116-345--------------------------------------------------------------------------------
Q1BEU6_MYCSS/107-340--------------------------------------------------------------------------------
Q0B1Z4_BURCM/118-340--------------------------------------------------------------------------------
Q2J4C1_FRASC/151-408--------------------------------------------------------------------------------
Q2IYK2_RHOP2/73-354--------------------------------------------------------------------------------
A8L2W5_FRASN/98-313--------------------------------------------------------------------------------
A3TJ63_9MICO/77-315--------------------------------------------------------------------------------
Q133X5_RHOPS/73-354--------------------------------------------------------------------------------
Q4JU29_CORJK/82-316--------------------------------------------------------------------------------
Q2CA47_9RHOB/80-334--------------------------------------------------------------------------------
A6LBC6_PARD8/70-301--------------------------------------------------------------------------------
A0K2K9_ARTS2/112-358--------------------------------------------------------------------------------
Q0BA39_BURCM/102-332--------------------------------------------------------------------------------
Q20YY7_RHOPB/103-326--------------------------------------------------------------------------------
A4T4C3_MYCGI/71-305--------------------------------------------------------------------------------
Q1LQN6_RALME/104-332--------------------------------------------------------------------------------
A1R1N0_ARTAT/81-341--------------------------------------------------------------------------------
Q0B8R5_BURCM/84-310--------------------------------------------------------------------------------
A0NV37_9RHOB/121-344--------------------------------------------------------------------------------
Q2K4Q8_RHIEC/84-305--------------------------------------------------------------------------------
Q0FSE7_9RHOB/90-316--------------------------------------------------------------------------------
Q2J920_FRASC/92-305--------------------------------------------------------------------------------
A4YMG3_BRASO/104-327--------------------------------------------------------------------------------
A1RC95_ARTAT/101-341--------------------------------------------------------------------------------
Q82GI4_STRAW/88-314--------------------------------------------------------------------------------
Q135L9_RHOPS/90-313--------------------------------------------------------------------------------
A7I7Y5_METB6/97-335--------------------------------------------------------------------------------
A3XXU2_9VIBR/89-316--------------------------------------------------------------------------------
Q53IC1_STRGR/68-304--------------------------------------------------------------------------------
Q8FLP5_COREF/222-454--------------------------------------------------------------------------------
Q3L9S4_RHOE4/54-285--------------------------------------------------------------------------------
A4FR42_SACEN/78-325--------------------------------------------------------------------------------
A3S009_RALSL/111-339--------------------------------------------------------------------------------
Q023J8_SOLUE/86-296--------------------------------------------------------------------------------
Q9CBX0_MYCLE/105-336--------------------------------------------------------------------------------
A4FGU5_SACEN/82-312--------------------------------------------------------------------------------
A1U9Z3_MYCSK/75-305--------------------------------------------------------------------------------
Q82NJ1_STRAW/66-299--------------------------------------------------------------------------------
Q6NF60_CORDI/70-290--------------------------------------------------------------------------------

PF03155

ALG8_HUMAN/19-514-IPTYHS-------------------------------------------------------------------------
ALG8_SCHPO/12-497-FPSYRS-------------------------------------------------------------------------
ALG6_HUMAN/12-491-NSYSGA-------------------------------------------------------------------------
ALG6_DROME/10-465-YSYSGF-------------------------------------------------------------------------
ALG8_YEAST/49-570-IPDYFS-------------------------------------------------------------------------
ALG6_YEAST/44-531-GPYSGK-------------------------------------------------------------------------
ALG6_CAEEL/54-494-NPHSGE-------------------------------------------------------------------------
ALG6_SCHPO/33-487-GPYSGY-------------------------------------------------------------------------
ALG8_DROME/10-485-IPAYHS-------------------------------------------------------------------------

PF01277

OLEO2_ORYSJ/32-149--------------------------------------------------------------------------------
OLEO2_ARATH/50-167--------------------------------------------------------------------------------
O04925_SESIN/24-138--------------------------------------------------------------------------------
OLEO1_SOYBN/52-169--------------------------------------------------------------------------------
OLEO1_ORYSJ/28-138--------------------------------------------------------------------------------
OLEO1_PRUDU/22-132--------------------------------------------------------------------------------
OLEO2_BRANA/41-151--------------------------------------------------------------------------------
O82308_ARATH/49-159--------------------------------------------------------------------------------
OLNB6_BRANA/26-143--------------------------------------------------------------------------------
Q39273_BRARP/16-133--------------------------------------------------------------------------------
Q43123_DAUCA/35-149--------------------------------------------------------------------------------
OLEO6_GOSHI/39-156--------------------------------------------------------------------------------
OLEO_HELAN/32-149--------------------------------------------------------------------------------
Q39952_HELAN/39-155--------------------------------------------------------------------------------
OLEO4_ARATH/48-165--------------------------------------------------------------------------------

PF13231

A7JBB4_FRATL/52-209--------------------------------------------------------------------------------
A4IZH3_FRATW/52-209--------------------------------------------------------------------------------
Q65D63_BACLD/64-222--------------------------------------------------------------------------------
B6BJT1_9PROT/53-210--------------------------------------------------------------------------------
C6VYQ4_DYAFD/49-207--------------------------------------------------------------------------------
B4UIB9_ANASK/72-232--------------------------------------------------------------------------------
A3WX64_9BRAD/52-213--------------------------------------------------------------------------------
A3WSX1_9BRAD/82-243--------------------------------------------------------------------------------
B9QSP7_9RHOB/49-210--------------------------------------------------------------------------------
B8FAL6_DESAA/67-226--------------------------------------------------------------------------------
D5UN54_TSUPD/63-221--------------------------------------------------------------------------------
A5N5X9_CLOK5/66-224--------------------------------------------------------------------------------
A7BVV3_9GAMM/62-229--------------------------------------------------------------------------------
D1CDY5_THET1/40-195--------------------------------------------------------------------------------
Q1MLH5_RHIL3/48-207--------------------------------------------------------------------------------
C6PVM5_9CLOT/66-224--------------------------------------------------------------------------------
B1KTS9_CLOBM/66-224--------------------------------------------------------------------------------
C6PQH7_9CLOT/67-225--------------------------------------------------------------------------------
A3JRQ6_9RHOB/50-209--------------------------------------------------------------------------------
Q0SVE9_CLOPS/70-234--------------------------------------------------------------------------------
D8JQE0_HYPDA/66-226--------------------------------------------------------------------------------
D7DXP9_NOSA0/73-233--------------------------------------------------------------------------------
D1PQJ0_9FIRM/71-229--------------------------------------------------------------------------------
B9JC29_AGRRK/54-216--------------------------------------------------------------------------------
C6E5J9_GEOSM/42-185--------------------------------------------------------------------------------
D5SV69_PLAL2/52-212--------------------------------------------------------------------------------
Q3SN70_NITWN/82-243--------------------------------------------------------------------------------
Q83DW3_COXBU/61-221--------------------------------------------------------------------------------
B4CZL5_9BACT/47-209--------------------------------------------------------------------------------
D5SQG0_PLAL2/83-244--------------------------------------------------------------------------------
Q2NGP0_METST/64-225--------------------------------------------------------------------------------
Q97GW4_CLOAB/66-224--------------------------------------------------------------------------------
Q1QI25_NITHX/77-238--------------------------------------------------------------------------------
F0Q666_ACIAP/58-215--------------------------------------------------------------------------------
B9XGL1_9BACT/266-427--------------------------------------------------------------------------------
A3DI20_CLOTH/61-226--------------------------------------------------------------------------------
A5FIR4_FLAJ1/49-207--------------------------------------------------------------------------------
D2R091_PIRSD/75-235--------------------------------------------------------------------------------
D1RGG4_LEGLO/47-206--------------------------------------------------------------------------------
A1TJR6_ACIAC/58-215--------------------------------------------------------------------------------
B7ACT9_9BACE/61-222--------------------------------------------------------------------------------
E6VI19_RHOPX/75-235--------------------------------------------------------------------------------
B6J193_COXB2/61-221--------------------------------------------------------------------------------
D5WL10_BURSC/70-234--------------------------------------------------------------------------------
D1Z262_METPS/82-248--------------------------------------------------------------------------------
A4T8Q0_MYCGI/81-241--------------------------------------------------------------------------------
A9KCN2_COXBN/61-221--------------------------------------------------------------------------------
D2ALV5_FRATE/52-209--------------------------------------------------------------------------------
D3HR46_LEGLN/60-219--------------------------------------------------------------------------------
A3IU57_9CHRO/67-225--------------------------------------------------------------------------------
B4U611_HYDS0/73-230--------------------------------------------------------------------------------
C6B1B7_RHILS/48-207--------------------------------------------------------------------------------
B9AES9_METSM/66-231--------------------------------------------------------------------------------
Q97MK3_CLOAB/67-225--------------------------------------------------------------------------------
A7GA58_CLOBL/66-224--------------------------------------------------------------------------------
B4AQA7_FRANO/52-209--------------------------------------------------------------------------------
D2ZPT9_METSM/66-231--------------------------------------------------------------------------------
A0Q5B8_FRATN/52-209--------------------------------------------------------------------------------
Q5X5F8_LEGPA/45-205--------------------------------------------------------------------------------
A5N7W9_CLOK5/72-230--------------------------------------------------------------------------------
Q89E32_BRAJA/157-318--------------------------------------------------------------------------------
Q5NHK7_FRATT/52-209--------------------------------------------------------------------------------
A5HYJ2_CLOBH/66-224--------------------------------------------------------------------------------
Q2YBZ2_NITMU/191-351--------------------------------------------------------------------------------
A6LZW3_CLOB8/77-235--------------------------------------------------------------------------------
C4V6B9_9FIRM/60-218--------------------------------------------------------------------------------
D9SE28_GALCS/50-205--------------------------------------------------------------------------------
A5EQY0_BRASB/42-203--------------------------------------------------------------------------------
B9E1D0_CLOK1/82-240--------------------------------------------------------------------------------
C1FRH4_CLOBJ/66-224--------------------------------------------------------------------------------
A7FQV4_CLOB1/66-224--------------------------------------------------------------------------------
A9ZIV6_COXBE/61-221--------------------------------------------------------------------------------
Q2Y860_NITMU/404-564--------------------------------------------------------------------------------
A6LU67_CLOB8/66-224--------------------------------------------------------------------------------
Q14J09_FRAT1/52-209--------------------------------------------------------------------------------
D5U4D2_BRAM5/61-220--------------------------------------------------------------------------------
B8FN25_DESAA/52-212--------------------------------------------------------------------------------
A0NV08_9RHOB/41-201--------------------------------------------------------------------------------
Q3SQJ3_NITWN/52-213--------------------------------------------------------------------------------
B5ZQB2_RHILW/48-207--------------------------------------------------------------------------------
B1IEW1_CLOBK/66-224--------------------------------------------------------------------------------
B9DZF8_CLOK1/66-224--------------------------------------------------------------------------------
Q89IJ6_BRAJA/52-213--------------------------------------------------------------------------------
Q5ZVN3_LEGPH/45-205--------------------------------------------------------------------------------
A7JKU9_FRANO/52-209--------------------------------------------------------------------------------
C7HDF1_CLOTM/37-202--------------------------------------------------------------------------------
A4YN48_BRASO/43-204--------------------------------------------------------------------------------
B3E0D1_METI4/59-219--------------------------------------------------------------------------------
Q5WWU1_LEGPL/45-205--------------------------------------------------------------------------------
Q46CM8_METBF/81-238--------------------------------------------------------------------------------
C6YNI6_FRATL/52-209--------------------------------------------------------------------------------
A7G0J8_CLOBH/66-224--------------------------------------------------------------------------------
B6J844_COXB1/61-221--------------------------------------------------------------------------------
B9XAA6_9BACT/62-222--------------------------------------------------------------------------------
A7JGP5_FRANO/52-209--------------------------------------------------------------------------------
C9LD10_9BACT/72-232--------------------------------------------------------------------------------
Q13A52_RHOPS/52-213--------------------------------------------------------------------------------
A9NC67_COXBR/61-221--------------------------------------------------------------------------------
A5ULR9_METS3/66-231--------------------------------------------------------------------------------
A5IBP9_LEGPC/45-205--------------------------------------------------------------------------------
Q643D0_STRHY/35-195--------------------------------------------------------------------------------
Q0AIT0_NITEC/408-568--------------------------------------------------------------------------------
B1Q920_CLOBO/66-224--------------------------------------------------------------------------------
D6SQ65_9DELT/50-203--------------------------------------------------------------------------------
D1NNY9_CLOTM/61-226--------------------------------------------------------------------------------
A9DP59_9FLAO/58-220--------------------------------------------------------------------------------

PF02366

PMT3_YEAST/62-306-YKIGRN----------NHVVWDEAHF-----------------------------------------------------
POMT1_HUMAN/20-289-WRLTYP----------RAVVFDEVYY-----------------------------------------------------
P73015_SYNY3/18-249-WNLGQF----------NQLVFDEVYY-----------------------------------------------------
Y1220_AQUAE/1-229-LILYFY----------NLGYNAVWMP-----------------------------------------------------
ARNT_SALTY/3-237-ALYYVI----------PVNSRLLWQP-----------------------------------------------------
Y1704_AQUAE/1-215-FVFFIF----------GNWILSLTSL-----------------------------------------------------
P73065_SYNY3/8-275-WLGSNG----------LDRLWLGMDQ-----------------------------------------------------
PMT1_YEAST/54-297-HGLAWP----------DSVVFDEVHF-----------------------------------------------------
PMT1_CANAL/70-313-YNLSNP----------NSVVFDEVHF-----------------------------------------------------
PMT1_SCHPO/38-284-QRLMNP----------AKVVFEELRY-----------------------------------------------------
PMT2_YEAST/69-313-YKIGIN----------NHVVWDEAHF-----------------------------------------------------
POMT2_HUMAN/62-306-HRLDEP----------PHICWDETHF-----------------------------------------------------
PMT5_YEAST/50-293-HNISLP----------NSVVFGENEV-----------------------------------------------------
P73712_SYNY3/7-243-LTIFIR----------VLTLGLYAVA-----------------------------------------------------
POMT1_DROME/178-421-YKLATP----------PHIVFDELHY-----------------------------------------------------
PMT4_YEAST/57-305-YKIWYP----------KEVVFDEVHF-----------------------------------------------------
PMT4_SCHPO/63-310-WNLNLP----------GEVVFDEVHF-----------------------------------------------------
ARNT_ECOLI/3-237-ACYYLL----------PISTRLLWQP-----------------------------------------------------
Q9UVB5_CANAX/96-357-YRIDVA----------NSVVWDEAHF-----------------------------------------------------
Q9V2H8_PYRAB/2-224-FLGALI----------.LGILSLPPE-----------------------------------------------------
O57832_PYRHO/2-228-FLGALA----------.IGIAFLPPE-----------------------------------------------------
PMT6_YEAST/70-314-QHIDQN----------NYVVWDEAHF-----------------------------------------------------

PF11028

Q0VAA1_HUMAN/52-218-GV-----------------------------------------------------------------------------
Q1AWM2_RUBXD/47-207-GI-----------------------------------------------------------------------------
A4AMM0_MARSH/37-218-QV-----------------------------------------------------------------------------
A6EKQ0_9SPHI/34-217-QV-----------------------------------------------------------------------------
B3EAC9_GEOLS/36-215-GS-----------------------------------------------------------------------------
Q1AXH9_RUBXD/53-213-GI-----------------------------------------------------------------------------
A5UPI3_ROSS1/45-212-GV-----------------------------------------------------------------------------
A0LXN9_GRAFK/37-218-EV-----------------------------------------------------------------------------
A1ZG62_9BACT/40-223-QA-----------------------------------------------------------------------------
A3U548_CROAH/37-218-EI-----------------------------------------------------------------------------
B5EH69_GEOBB/37-216-GT-----------------------------------------------------------------------------
Q650J9_BACFR/35-217-EV-----------------------------------------------------------------------------
A4BY73_9FLAO/37-218-EV-----------------------------------------------------------------------------
A9AXK7_HERA2/53-217-AV-----------------------------------------------------------------------------
A1ARZ9_PELPD/68-247-GS-----------------------------------------------------------------------------
Q11YB8_CYTH3/35-217-MV-----------------------------------------------------------------------------
A2TUA8_9FLAO/37-219-EI-----------------------------------------------------------------------------
U679_DICDI/139-316-GV-----------------------------------------------------------------------------
Q74D30_GEOSL/39-218-GT-----------------------------------------------------------------------------
A1BIY5_CHLPD/34-214-GI-----------------------------------------------------------------------------
A3XHT8_LEEBM/37-219-EI-----------------------------------------------------------------------------
A1ZGE8_9BACT/35-219-QV-----------------------------------------------------------------------------
Q3AU50_CHLCH/34-214-GI-----------------------------------------------------------------------------
A6GWD8_FLAPJ/36-227-EV-----------------------------------------------------------------------------
A6LGG9_PARD8/35-217-EV-----------------------------------------------------------------------------
Q39VU9_GEOMG/36-214-GT-----------------------------------------------------------------------------
A7NFU7_ROSCS/53-220-GV-----------------------------------------------------------------------------
Q1AXH6_RUBXD/44-204-GI-----------------------------------------------------------------------------
Q0YR30_9CHLB/34-214-GI-----------------------------------------------------------------------------
Q8KAY9_CHLTE/41-221-GI-----------------------------------------------------------------------------
Q7MT47_PORGI/37-229-EI-----------------------------------------------------------------------------
Q2S0T5_SALRD/34-228-QV-----------------------------------------------------------------------------
A5G4Z0_GEOUR/37-216-GT-----------------------------------------------------------------------------
A6EJD1_9SPHI/35-210-QV-----------------------------------------------------------------------------
A5ZCC1_9BACE/37-219-QV-----------------------------------------------------------------------------
B3ENQ9_CHLPB/34-214-GV-----------------------------------------------------------------------------
Q1VT32_9FLAO/37-218-QV-----------------------------------------------------------------------------
A9AUQ8_HERA2/39-195-EV-----------------------------------------------------------------------------
A3J436_9FLAO/37-218-EV-----------------------------------------------------------------------------
B4S581_PROA2/34-214-GV-----------------------------------------------------------------------------
A4CGC2_ROBBH/37-219-QV-----------------------------------------------------------------------------
A6EQ18_9BACT/37-218-EV-----------------------------------------------------------------------------
A3I1E4_9BACT/35-218-QV-----------------------------------------------------------------------------
Q26HV6_FLABB/36-213-QV-----------------------------------------------------------------------------
Q3B6C0_PELLD/34-214-GV-----------------------------------------------------------------------------

PF02516

STT3A_HUMAN/17-484-LSFSTR.........LFAVLRFESVI-----------------------------------------------------
STT3_CAEEL/19-506-VGFASR.........LFAIVRFESII-----------------------------------------------------
STT3_YEAST/15-475-AAISSR.........LFAVIKFESII-----------------------------------------------------
STT3_SCHPO/23-509-ASVSSR.........LFSVIRYESII-----------------------------------------------------
O30195_ARCFU/14-430-LQNFGE.........IFDSRIYYYG.-----------------------------------------------------
O29918_ARCFU/7-427-FQNFGE.........IFDSGIYYTG.-----------------------------------------------------
O29867_ARCFU/18-493-LNPWNS.........VFTWTVRLGG.-----------------------------------------------------
O86154_CAMJU/9-478-AYVFSV..........FCRFYWVWWA-----------------------------------------------------
O27660_METTH/24-582-VPADAK........KFYEDADGLPYF-----------------------------------------------------
O27928_METTH/21-478-MNTADR........AYFTDENGLPYM-----------------------------------------------------
O26520_METTH/3-426-TVTVAG.........VYSEAHYQPLM-----------------------------------------------------
O27920_METTH/13-461-NAGYDD........PLYTDDDGLQYF-----------------------------------------------------
Y1525_METJA/33-650-TADMKFAQDNEFLKDMFSDEHGRMYL-----------------------------------------------------
O74088_PYRHO/25-586-FAIYAF.........YLRHLTAGKYF-----------------------------------------------------
O58981_PYRHO/1-510-VAIFYR...........MITFRFKYL-----------------------------------------------------

PF09852

A6W4W4_KINRD/38-458-SGAYDL------------GVFAQSAQ-----------------------------------------------------
A3YXU8_9SYNE/20-501-SASYDQ------------GIFLQTIW-----------------------------------------------------
D1N9S5_9BACT/168-612-LYFSDW------------GEYAENYL-----------------------------------------------------
Q119E7_TRIEI/30-487-STAFEM------------GIYDQVTY-----------------------------------------------------
Q3B035_SYNS9/33-452-SNAYDL------------GLFDQWAW-----------------------------------------------------
A3IP01_9CHRO/25-454-SNALDL------------GWFDQSLY-----------------------------------------------------
A4CQE1_SYNPV/54-483-SNAYDL------------GLFDQWAW-----------------------------------------------------
Q1CZA2_MYXXD/39-471-FPNFDL------------GIYSQAVA-----------------------------------------------------
A7NHC7_ROSCS/32-505-AGMYDL------------GNMAQSIW-----------------------------------------------------
A2CD09_PROM3/29-458-SNAYDL------------GLFDQWIW-----------------------------------------------------
Q7U446_SYNPX/31-511-LASYDQ------------GIFQQVLW-----------------------------------------------------
Q05VV8_9SYNE/33-513-SATYDQ------------ALFLQELW-----------------------------------------------------
Q2JTX8_SYNJA/28-474-SGGYDL------------GIFDQAVY-----------------------------------------------------
A5GS07_SYNR3/40-521-SATYDQ------------GIFNQVLW-----------------------------------------------------
A5Z658_9FIRM/175-610-NSTFDF------------GIFTQMYE-----------------------------------------------------
Q9V170_PYRAB/28-443-YKSLDL------------GIFSQSLY-----------------------------------------------------
Q684B0_9VIRU/32-510-FPIYDV------------GVNLMFLY-----------------------------------------------------
D1N6C4_9BACT/168-601-...SDW------------GEYSENYL-----------------------------------------------------
O59243_PYRHO/26-442-YRSLDL------------GIFAQSLH-----------------------------------------------------
Q8U0H2_PYRFU/26-441-YRSLDL------------GIFTQSLY-----------------------------------------------------
Q119E6_TRIEI/27-490-STGFDL------------GIYDQVVY-----------------------------------------------------
Q82RR9_STRAW/82-508-TTGYDL------------GIFEQAVR-----------------------------------------------------
Q4J6X7_SULAC/32-488-SGAFDL------------GLFMQEFY-----------------------------------------------------
Q3AH29_SYNSC/39-458-SNAYDL------------GLFDQWAW-----------------------------------------------------
Q053B8_LEPBL/83-522-LGDFDY------------TAQTRMIV-----------------------------------------------------
A5URL3_ROSS1/78-571-AQGYDQ------------IDYQQSIW-----------------------------------------------------
Q4J7K9_SULAC/43-493-YSSYNL------------SMFIQELY-----------------------------------------------------
A3Z9V0_9SYNE/14-434-SNAYDL------------GLFDQWAW-----------------------------------------------------
A6C4J1_9PLAN/210-689-IPHGDS------------AMYEEHLW-----------------------------------------------------
Q9HK92_THEAC/39-557-ATAYDL------------GIYVSILE-----------------------------------------------------
A0YNX7_LYNSP/16-470-STAFEL------------GIYDQIVY-----------------------------------------------------
A5GNZ8_SYNPW/38-520-LAGYDQ------------GIFQQVAW-----------------------------------------------------
Q0I6Z8_SYNS3/30-459-SNGFDL------------GIYDQVAW-----------------------------------------------------
A7BAH1_9ACTO/37-495-APSWDL------------GIFAEAVQ-----------------------------------------------------
Q4J7K8_SULAC/16-462-SGAFDL------------GIFLQELY-----------------------------------------------------
A5GR01_SYNR3/37-521-TATFDQ------------GLFLQEIW-----------------------------------------------------
A0YZD5_LYNSP/29-458-SNAFDL------------GIFDNGIY-----------------------------------------------------
Q97AA6_THEVO/27-454-SYVFDL------------GVSSYLIS-----------------------------------------------------
A0YTH5_LYNSP/32-516-YASYDH------------GIFNQVFW-----------------------------------------------------
A3IHC1_9CHRO/29-461-STAWDL------------AIFDQAVY-----------------------------------------------------
Q8F2H0_LEPIN/76-512-LGDLDY------------TAQLRMIL-----------------------------------------------------
P73520_SYNY3/35-464-STALDL------------GFFDQAIY-----------------------------------------------------
O58892_PYRHO/28-449-IQAYDT------------GIYMQSLW-----------------------------------------------------
Q063N9_9SYNE/10-492-LASYDQ------------GIFQQVLW-----------------------------------------------------
Q7U443_SYNPX/37-518-TASMDQ------------GILMQVLW-----------------------------------------------------
Q3AH28_SYNSC/37-517-SATYDQ------------ALFLQELW-----------------------------------------------------
A4CQE4_SYNPV/18-500-LAGYDQ------------GIFQQVAW-----------------------------------------------------
Q7VDJ5_PROMA/39-469-SNAFDL------------GLFDQWVW-----------------------------------------------------
A5V1J1_ROSS1/34-511-AGVLDL------------GTMYQAIA-----------------------------------------------------
Q7U444_SYNPX/29-448-SNAYDL------------GLFDQWVW-----------------------------------------------------
A0YNX8_LYNSP/40-494-STGYDL------------GIYDQVTY-----------------------------------------------------
Q10XG3_TRIEI/32-516-YASYDQ------------GIFNQVFW-----------------------------------------------------
A2CD11_PROM3/38-518-TATYDQ------------ALFLQELW-----------------------------------------------------

PF03901

GPI10_TRYBB/4-432-LCATIR-------------------------------------------------------------------------
SMP3_YEAST/6-401-LCLGPS-------------------------------------------------------------------------
GPI10_SCHPO/4-414-NALWVK-------------------------------------------------------------------------
ALG9_SCHPO/16-438-SASFRV-------------------------------------------------------------------------
ALG9_ARATH/48-451-SATSNI-------------------------------------------------------------------------
Q9LEQ5_ARATH/40-428-NALLIQ-------------------------------------------------------------------------
ALG9_YEAST/10-414-QPTFSL-------------------------------------------------------------------------
ALG12_CAEEL/6-405-LAPGT.-------------------------------------------------------------------------
GPI10_YEAST/16-484-NAVLTR-------------------------------------------------------------------------
SMP3_SCHPO/9-412-FSQ..G-------------------------------------------------------------------------
Q9VBV8_DROME/75-498-SAIWAY-------------------------------------------------------------------------
PIGB_HUMAN/62-449-NCFLVQ-------------------------------------------------------------------------
PIGB_DROME/5-396-SVFVVQ-------------------------------------------------------------------------
ALG9_MOUSE/60-482-AALLSN-------------------------------------------------------------------------
PIGZ_DROME/18-541-LVFVPQ-------------------------------------------------------------------------
YTH3_CAEEL/55-472-GAIWGI-------------------------------------------------------------------------

PF09913

Q1JHK3_STRPD/71-454-NDIPDE------------YVHYSRTV.......YI.SE...GDIN.....LTNNNKKL.....................
Q1MP06_LAWIP/21-414-FQAPDE------------QVHFPRVF.......EL.SC...GKI......LLSKGEKVGGSNLPTSIQAFT........
A4AI52_9ACTN/32-415-GAAPDD------------DYHLVSIW........................CATGDADL.CQSTESPKTRMVPQA.....
A4VVV9_STRSY/36-414-TKVPDE------------ATHAFMSW.......NILFD............SPTSRDTEAMNELR...............
A5CTF3_CLAM3/34-413-GASPDE------------PAHMNKAA.......SVVRGQFLGDV......TDDPQVRMVQVPAGVAY............
A2RHT4_LACLM/28-400-FIEPDS------------SYHFDKSS.......YL.SN............TVVDRSKIGFPAEDYQSAP..........
A0LS06_ACIC1/16-395-YAAPDE------------PAHAVKAA.......ANVRGEFRG........TPQPADHIPYEAFTVPATLA.........
Q5Z3D8_NOCFA/116-537-FWGHDE------------ITQFGRAY.......QV.AH...GGF......LPTEIEDDRGVAYGGVIPPGIDDLMGYAF
Q5M3E5_STRT2/28-432-MSWYDE------------QVHYARVITYSNDLGST.SE...GSI......EKGEQELIN....................
A7BEG1_9ACTO/22-395-GSSPDE------------DFHVGSMW........................CPPPVDETGCQISTKDGEKAVMVPQSLA.
A5UMR8_METS3/71-461-YDVSDE------------TEHFVRSE.......IV.ST...GELSTNYVPIPNTTANGY....................
A1W3H2_ACISJ/39-436-LNAPDE------------VYHWQRAV.......QV.SH...GQF......LADRREEQDYGGEIDVAALEF........
A6BHE0_9FIRM/204-596-FAVPDE------------SAHFVTVY.......SK.SNKLLGKE......VADKEGKVIA...................
Q032N2_LACLS/44-428-FNEPDG------------VYHFVNSS.......NI.VH............LTTDINVYGENSKWFG.............
Q6AGK9_LEIXX/24-391-GSSPDD------------DFHQTSIW........................CADGIVKGTCDAGSRSGHYTVPPL.....
Q03JM9_STRTD/69-443-QYGLDE------------ESHLPNVI.......SV.SD...SPI......FKYSKEKLTDYD.................
O05375_AGGAC/17-398-YQSPDE------------FYHFQRGY.......AI.SN...GQI......IPSSTEKLDKAM.................
A5UN71_METS3/84-467-MSFPDE------------AIHFARAE.......SI.TE...GVL......YPVKTPNGY....................
A3CP01_STRSV/1-366-NRVPDE------------TNHARMTW.......EI.FH............KPTSR........................
A7VGI6_9CLOT/233-636-HGVPDE------------PWHIDTAYKYSNKIMFAGDTGIEGTI......YKRTCDV......................
Q83YS3_STRGN/66-446-LNTPDE------------PVHLARTI.......HI.VE...GDLN.....LDNSKP.......................
Q01XM3_SOLUE/38-442-FQVPDE------------DGHFIRAY.......LI.SR...GEF......VGRGAPRVPGTVVLSMMRYPEMGERFGRF
Q83H24_TROWT/46-427-GSSPDD------------DFHLASAW........................CALGDRPGLCESSGIKDAKKVPTTILDTW
Q9CIZ8_LACLA/68-463-QFGVDE------------ETHLRWTI.......RL.AD...GQL......FTREQEKQPDWDTVEKY............
Q2JAW9_FRASC/81-503-GFGPDE------------PAHFVKAVGAGTGQWTGTPGRLAHPSFGNGPGRAERIDWINRNSRVFALPAGLNPG.....
A2V6Y4_9NOCA/100-508-FWGHDE------------ITQFGRAY.......QV.AQ...GGF......LPERIADDRGVSYGGDIPLSIDGLMGYAF
Q0RGM1_FRAAA/18-412-GFGPDE------------PANFVKEVGAGTGQWSGTPGRLAHPAFGAQPGAPERIDWINRNSRVFRLPAGLDPG.....
Q1N997_9SPHN/34-430-FQAPDE------------NQHYMKAL.......AI.SQ...GDV......LTQQRGPAIGTTLPRAALD..........
A7BEE9_9ACTO/34-400-GSSPDD------------DYHLVSTW........................CPRPIESTGCDTTTIDGELYVMAPVT...
A5G180_ACICJ/39-445-GEVADE------------PSHIARAA.......GLLDFDILGHR......AVIGHTQVSGLFVNDG.............
Q97N14_CLOAB/17-411-FQDPDE------------PIHFYRAY.......QI.ST...GQM......FEQKNNSGIGGYLPQNLIKTSE.......
A4AI53_9ACTN/26-395-GSSPDD------------DFHLTSIW........................CATGDSEY.CAPSGDPGTRLVPPA.....
A5UKJ8_METS3/70-455-LVAPDE------------VEHFARSD.......LT.SE...GGL......IPNYHENQGYF..................
A3XYG2_9VIBR/1-400-FQVADE------------GSHYQRAY.......QV.SQ...GELFPQKKLLPNTVDDYTVGGTTSPEISQ.........

PF04922

ALG10_YEAST/63-458-FHVGQT-------------------------------------------------------------------------
O02332_CAEEL/40-377-FHITQT-------------------------------------------------------------------------
Q9LZ85_ARATH/22-450-FHVPQA-------------------------------------------------------------------------
AG10B_RAT/28-428-FHLPQA-------------------------------------------------------------------------
ALG10_SCHPO/24-398-FHIAQA-------------------------------------------------------------------------

PF07220

D4HSK9_LEPIR/4-673-LGFYILKLFESSLGKVKNTWIRWQAPLIGALLLSVILYPLALSALTPRFLMKSAAIFLSVLGCANICFFVKNGTKNLVS
Q8VTZ1_LEPIR/1-667-LGFYILKLFENHLGEIKNTWRRWQAPLTGALLLSVSLYPLALFGFTSRLFMESVAFLLVILGLINLGGFIKKIKSNKDI

PF04188

GPI18_YEAST/2-433-TPIRQFDTSTSLLLNELCS......S-----------------------------------------------------
GPI18_SCHPO/63-464-YLGIAVIMSHLCVFDDTAMLYLRQNR-----------------------------------------------------
PIGV_HUMAN/8-493-FN.AIIPDHHAEAFSPPR.....LAP-----------------------------------------------------
O65394_ARATH/12-492-WRSLLQPYDTSAALNPPCLYHKEDSF-----------------------------------------------------

PF02364

P87204_ASPFM/843-1663-ISFFAQ-------------------------------------------------------------------------
FKS1_CRYNV/778-1595-ICFFAQ-------------------------------------------------------------------------
BGS2_SCHPO/843-1667-LSFFAQ-------------------------------------------------------------------------
O13429_CANAX/305-1090-ITFFAQ-------------------------------------------------------------------------
FKS1_YEAST/807-1632-ISFFAQ-------------------------------------------------------------------------
FKS3_YEAST/693-1543-ISFFAQ-------------------------------------------------------------------------
O13423_CANAX/599-1410-ITFFAQ-------------------------------------------------------------------------
CALSC_ARATH/875-1655-IAFFSN-------------------------------------------------------------------------
BGS4_SCHPO/871-1707-LSFFAQ-------------------------------------------------------------------------

PF04602

EMBA_MYCLE/4-679-LPVKQTTATIRWPQSATRDGWVT--------------------------------------------------------
EMBA_MYCSM/13-666-LPVEETTATVLWPQGVGADGNVT--------------------------------------------------------
EMBC_MYCSM/6-669-LPVEQTTAELNWPQ....NGVWQ--------------------------------------------------------
EMBC_MYCTU/20-683-LPVNQTTAQLNWPQ....NGTFA--------------------------------------------------------
EMBB_MYCLE/15-674-LPVVQTTATLNWPQ....NGQLN--------------------------------------------------------
EMBA_MYCAV/4-680-LPVRQTTATVLWPQG.TVDGHVS--------------------------------------------------------
EMBB_MYCSM/17-676-LPVTQTTATLNWPQ....QGRLD--------------------------------------------------------

PF05208

NT53_DROME/48-470------------------------------VIQRVPYTEI-----------DWV---AYM-QECEGFLN.GTTNYSLLR-
ALG3_ARATH/35-401------------------------------IIAYVPYTKI-----------DWD---AYM-SQVSGFLG.GERDYGNLK-
ALG3_HUMAN/45-406------------------------------VIHRVAYTEI-----------DWK---AYM-AEVEGVIN.GTYDYTQLQ-
NT56_DROVI/47-475------------------------------VIQRVPYTEI-----------DWK---AYM-QECEGFLN.GTTNYSLLR-
ALG3_SCHPO/26-384------------------------------IISKVPYTEI-----------DWI---AYM-EQVNSFLL.GERDYKSLV-
ALG3_YEAST/46-417------------------------------IIKKVAYTEI-----------DYK---AYM-EQIEMIQLDGMLDYSQVS-
ALG3_NEUCR/36-404------------------------------IIWKVPYTEI-----------DWA---AYM-EQVSQILS.GERDYTKVR-

PF14897

C6IU65_9BACE/1-365------------------------------ILFCFND.GE........SG.DHY...LYK.LGFEN.QNGG.........
F0G7H3_9BURK/30-339------------------------------AVLRGRT.GT...........DTA...VYQ.EIVAG.IWSGNLKVVP...
B1FZW1_9BURK/26-338------------------------------ALAVLRG.HC........GT.DTA...AYY.QAFAD.LGQGNG.......
D0MGT8_RHOM4/10-327------------------------------LIAIFRG.SV........GT.DTA...TYE.RLVTR.IDTW.........
B5S941_RALSL/18-319------------------------------ALVAHRPPGL........DK.DYY...GYL.DYYGR.VLAGET.......
E0NV04_9BACT/31-360------------------------------FFFGFRGFCF..........YDWN...SYY.PVFQH.YTLRDLFSLPVED
D8DUW1_PREBR/31-358------------------------------IFFGFRGYIL..........SDWV...SYY.PYFFD.CSWDNISNYEFGS
C3WBU3_FUSMR/30-360------------------------------FGLRGYI.GY...........DWY...SYK.PNFDK.MVTIGELLKGNTQ
E5BUG7_9FUSO/30-365------------------------------FGTRGYL.GY...........DWY...SYK.PNFDK.ADNIFQVLSGNYQ
C3Q046_9BACE/40-371------------------------------LGLRGFV.YT...........DWT...LYY.QFFLK.LPMLADWDYWTLD
A6L8S3_PARD8/36-371------------------------------YGLRGFV.GW...........DWQ...GYY.PSFEL.IDTLRDI..SIDS
D7NC58_9BACT/29-366------------------------------GFFGFRD.IT........VLNDTP...HYY.GTYYH.LSQ.......YNS
C3WFM0_FUSMR/30-347------------------------------AGTRLNV.GV...........DYI...SYI.NIFEN.VN...........
D0YWK6_LISDA/28-370------------------------------GSLRYDT.GW...........DFA...TYR.YYFER.VDT.......IHV
B9CW40_9PAST/29-365------------------------------AGFRFDT.GW...........DYN...GYR.DYYNN.IPSLLEIPTYYDE
E5WYZ4_9BACE/30-356------------------------------AGLRGHNVGF...........DYE...SYE.NIFED.SDDILQV......
F0R6C6_BACSH/27-352------------------------------AGLRYKV.GM...........DYN...MYN.ENFTN.LK........GES
E4VT48_BACFG/28-352------------------------------IVAAFRGMGN...........DYD...GYE.KIFDA.LKNLSILS.IFDV
C6W3U8_DYAFD/27-360------------------------------MISGLRW.NT........GN.DWK...PYY.SFFTR...........FTA
A9VRB1_BACWK/31-355------------------------------TGLRYNI.GI...........DYV...SHE.RIYES.IQSGLLENFSN..
D7VWT5_9FLAO/18-361------------------------------VGFRKDV.GP...........DYG...SYK.GIYIY.SDTKSYYS.IFMK
C6WZX9_FLAB3/31-373------------------------------IAVGLRL.EV........GA.DYP...VYR.MLFSG.FAIYTTYGDVLDK
E4TAL9_RIEAD/31-371------------------------------VFVGFRD.WI........GA.DYG...AYV.QMYEY.FGQRTAYSTVYNK
F0NZQ8_WEEVC/30-359------------------------------AGLGYNL.SP...........DWL...AYY.NAFYA.SGELLY....LSE
Q5L9T0_BACFN/34-354------------------------------ITAGFRNVGG........VDTDYA...IYK.NHYNG.ELGSYSY......
Q1ID93_PSEE4/39-369------------------------------SATRYET.GY...........DWP...AYK.EFYLLGDQLEGR.......
Q64Q37_BACFR/30-355------------------------------IAGGRNNVGT...........DWW...QYK.ETF.............DNY
E1W1Z9_HAEP3/34-354------------------------------SGLRENT.GA...........DYE...NYV.YIYKN.LDY.......YHS
B0NP44_BACSE/33-342------------------------------AAIRYEV.GY...........DYG...NYS.EIYNN.LVDA.........
Q93NP8_ECOLX/36-347------------------------------SALRFDV.GP...........DYE...TYV.YIYKN.IVA..........
Q64WD5_BACFR/26-339------------------------------SGFRYYV.GV...........DYV...NYV.KIYNL.EEGY.........
Q6XQ50_ECOLX/22-344------------------------------SFFKYNI.GF...........DWG...NYH.EIY.............LQQ
E2NIN8_9BACE/9-341------------------------------AGFRYFV.GT...........DWE...NYY.YIYDL.ALQNNLSIEDVTV
D0TB70_9BACE/50-382------------------------------LGLRYNI.GT...........DYL...AYE.EIYDT.QNADLL....WNI
D0TIG3_9BACE/46-381------------------------------FGTRYEV.GI...........DYL...SYK.KIYEV.IQNGEIP..D...
Q6AIA7_DESPS/40-375------------------------------IGTRENV.GI...........DYL...SYK.YHFLL.VESSNNF......
D2QJN3_SPILD/45-378------------------------------VGCRYYV.GI...........DYK...VYV.EIFLE.LKETGIV..P...
C3J824_9PORP/33-348------------------------------LGLRFEV.GR...........DYP...IYK.DA..............FEN
E4KSW1_9PORP/26-344------------------------------GFAGLRV.GL........GQ.DYE...VYE.NGYNW.ISSESF.......
B2RK66_PORG3/26-344------------------------------IFSGTRI.GM........GR.DYK...IYE.YAYQF.PDSKTA.......
D9YZ33_PROMI/30-361------------------------------IFFSFTA.SR...........DYN...IGT.DTENY.LYF.......FSK
E7FXC0_ERYRH/30-380------------------------------LALKYGQ.GA...........DYV...VYE.YFYEN.PNMI.........
Q077R9_ECOLX/28-346------------------------------VGLRVDV.GA...........DYT...EYA.QIYNQ.SGNI.........
Q077Q9_ECOLX/28-345------------------------------IGLRVNV.GA...........DYT...EYV.RIYNQ.SYD..........
E7FV64_ERYRH/21-356------------------------------IIVIFRV.GV........GT.DYF...SYE.YLYNL.QNVTTFGKMLDHQ
E6RKK7_PSEU9/21-338------------------------------SAFRYYV.GS...........DFT...NYV.ILFDT.AKVGNF.......
A9QSJ8_LACLK/28-353------------------------------SAFRSSVVGS...........DTA...LYE.FLFFN.PKLL.........
B5L3N1_ECOLX/27-351------------------------------LSGNYYN.GY...........DWI...NYL.DNFQC.LKYLGVYC.W...
C7H3X4_9FIRM/29-345------------------------------VSLRKKTVGI...........DTA...MYI.QLLEW.SK...........
A7VCQ8_9CLOT/30-383------------------------------ASLRDPSVGT...........DLA...GHYAKRFNMIGDYSWSQIPTFST
B3JEB8_9BACE/29-364------------------------------KGLRWDT.GT...........DFN...QFY.ACFKY.SD........WSN
D6D462_9BACE/28-360------------------------------VFWGIRW.NC........GT.DWD...NFY.DVFQG.SD........LSN
C3HRH2_BACTU/24-343------------------------------AGFRYGV.GT...........DYY...SYE.RMYTE.GRV..........
C3WQZ8_9FUSO/25-352------------------------------FAFSYKM.GS...........DWL...SYQ.EWYEN.IFPKLEWNNFYKQ
E3HB27_ILYPC/34-350------------------------------FGFTHEM.GT...........DNT...LYE.RHYYS.ANYQ.........
E4VYN5_BACFG/26-349------------------------------LCFGYMC.GS...........DWR...GYE.IMYNR.IDLDNLFS.D...
C7PMN8_CHIPD/32-372------------------------------AGLRYHT.GA...........DWP...NYE.LHYDT.ILPRIDKFFEFRY
Q5L965_BACFN/30-358------------------------------VGTRFET.GD...........DWG...EYT.KVFDK.IPLVSDLW.NDNG
Q1WTE3_LACS1/26-359------------------------------LHNPYLT.GT...........DGR...SYR.AYFKT.HIPTLSHFSEYN.
B7AIU7_9BACE/32-363------------------------------LIESIRY.GR........GV.DYW...GYR.ITYKV.GI...........
B6W1S5_9BACE/36-375------------------------------EALRYDR.GV...........DYL...HYK.DIYEV.GYF..........
E2N8R2_9BACE/38-379------------------------------HGLRFGR.DQ...........DYN...GYY.HIFTS.LSNGRNE......
B5CXR1_9BACE/33-352------------------------------ISGGQYYVGT...........DYP...TYI.GLFDG.WG........LEL
C3JAP3_9PORP/26-357------------------------------LFVGGQY.GV........GT.DYF...SYL.EKFSD.IDSAEVA......
C6I9C7_9BACE/28-351------------------------------IIIGGQY.NV........GT.DYF...SYM.KLFVG.REGLSRY..I...
E7DWN5_SALCE/28-357------------------------------LLPAFQY.GV........GT.DYF...SYQ.NIYNN.ANV.......LDT
A0KM85_AERHH/26-353------------------------------SALQYNV.GS...........DYF...SYL.YIYEN.QWVLGRY..F...
A6XVI1_VIBCL/26-352------------------------------SALQYNV.GS...........DYP...SYI.YIYEN.PWVLDKY..F...
A7M0P5_BACOV/26-361------------------------------LFFALRY.EY........GN.DYW...HYY.LRWDS.G............
B7BCK8_9PORP/38-375------------------------------FIFGIRY.NV........GN.DYM...SYL.DIYEG...........YAH
D7IN83_9BACE/23-359------------------------------TFLGCIHYDY........GN.DYM...AYM.NDYKI.DTKYS.....FDL
Q4JYP9_STRPN/26-355------------------------------YAGNIREGFS...........DLI...HYR.ARYAV.GKSSL........
E7DWN9_SALCE/36-394------------------------------AFSLIPYSDW...........DLT...RHY.ETYLS...........YNN
A9NH20_ACHLI/15-352------------------------------VGVTNNF..............DYE...AYS.MSY.............SNL
Q4KYP9_ECOLX/2-316------------------------------LFLLFYFPAD........HNKDYF...NYQ.TDYDY.AIGQFD.......
B2EAJ6_BIFAN/21-365------------------------------LIASFTTGNA...........DEQ...IYQ.SRYDE.YQLWE........
E4SMU8_LACAR/20-350------------------------------VFLTFNAINI..........NDFS...DYE.YIYNN.NNLIGA.......
D0DSK0_LACFE/28-347------------------------------VLSSFNTLSG...........DWS...GNE.GLYNL.T............
A6GZ52_FLAPJ/21-343------------------------------GLFGWNYSNA...........DFH...MYK.GMYSV.PLSEMIF......
B0KTY9_PSEPG/11-328------------------------------VLYGWNTWNG...........DRE...GYE.LYYNT.RVTLAS.......
E1WTD5_BACF6/21-369------------------------------LLLAFEHSDQ...........DYL...AYV.NSYDA.VGSGNIFE.L...
Q8GP42_STRTR/34-383------------------------------ILFAFSYGNA...........DYN...IHL.RKYTQ.YQVLN........
C7TKZ8_LACRL/24-354------------------------------AYPAVRH.NA...........DYN...LYK.LSYSQ.QL...........
B2GF40_LACF3/21-364------------------------------YLSGAAN.PL........TTLDYP...VYL.QHYQL.LGWET........
Q03WA2_LEUMM/21-358------------------------------LFIAYIPIDT.........VQDTR...IYY.SSYYS.DS...........
C8TTX0_ECO26/24-340------------------------------TLFIINRQNQ...........DYE...AYV.DIFNV.NE...........
C7XF82_9PORP/42-366------------------------------VLSTYSLFAS...........DFL...NYK.IEFIT.YKASPNT...FDT
C7XB09_9PORP/32-356------------------------------IFSVYGYITA...........DYN...SYL.ELMK............MSK
A7AJ45_9PORP/41-378------------------------------LFCTFGYADN...........DFY...HYE.GLFKR.ICSTGLN......
E4TA21_RIEAD/26-353------------------------------IIQAFITWTP...........DLF...NYE.IHFYN.IDLDYVR......
C4UE48_YERAL/24-352------------------------------LSTAFSIFYL........NGNDWS...IYF.LSFVD.GGAPF........
B3I2Q9_ECOLX/24-358------------------------------FSLSFFSYYT........NGEDWS...VYY.LRFIE.DEGLF........
D7PEY6_SALCE/24-353------------------------------LVFSFSSFYI........NGVDWT...VYF.SKFSY.EDNYYLF......
C1M671_9ENTR/24-355------------------------------LSLAYTSFYL........NGEDWV...NYY.VNFYT.HNGS.........
E6ALG7_ECOLX/22-354------------------------------FLALTYPSGG...........DWI...GYF.LHYDC.MVNEQCNNGF...
A6TBF0_KLEP7/23-340------------------------------LNFGFGY..............DWM...NYY.DSYLN.INTPGYD..F...
E2SY53_9RALS/25-362------------------------------VFAGNQLNGA...........DWI...NYT.TVYAR.VAETTLEESLAA.
A6MF01_ECOLX/23-335------------------------------GAYSWGY..............DWI...RYR.EYYEN.VFLISDLV.T...
B7AUK2_9FIRM/25-372------------------------------LFVATAVSRVYRVNELRAYS.DMA...YYL.KCYSE.GNS..........
C9BE41_ENTFC/31-354------------------------------LFATFRMVGT...........DTP...VYY.SKFNS.LNGKSLSD.IFFT
A5G608_GEOUR/41-362------------------------------ATAGLQLFGP........SA.DYY...AYQ.EMVID.KTNVKL.......
C6X1R8_FLAB3/21-351------------------------------LFAGSRY.YI........DS.DYS...LYY.NYFIY.TEKSAVDFMNRP.
A7ZNK7_ECO24/20-336------------------------------ITAGFIAPGV........SQ.DYY...NYL.NGYYL.TTPS.........
A3D6K3_SHEB5/9-323------------------------------IVAAFRG.GN........DP.DYG...NYY.DIY.............ISS
B5L3F9_ECOLX/24-340------------------------------FLASFRGAGV........DG.DYA...NYI.EYIND.AQSIG........
C3WK26_9FUSO/25-344------------------------------LFATFRSNMI........NI.DTN...TYI.NYYKT.VPS.......FKY
B8EDA7_SHEB2/32-359------------------------------ILTTFKG.PI........EP.DYY...SYR.NIFYL.SPD.......FDT
E0SFU5_DICD3/23-330------------------------------FLVGDKNINR........WV.DHQ...TYE.NYFFL.AT........YNN
Q6FFU5_ACIAD/13-316------------------------------FLVGLKDNSI........WL.DYY...VYV.DYFNQ.ASASSFNEIIF..
E4TIN4_CALNY/56-394------------------------------FFAGLKR.PF........SC.DLI...GYK.WMFEN...........YEN
B5L3A6_SHIDY/54-384------------------------------FFSTLKPFG............DIA...EYL.HVYHE.LNYNLIDVFGYSR
C7X5V3_9PORP/26-352------------------------------VLFGMRY.DV........GQ.DHL...AYL.DGYIN.PFLH.........
E3DJ50_ERWSE/35-367------------------------------LFAGMRGPDS........GMDDS....QYV.GFFHD.FSRQTGMT.GYQA
C0H3N7_ERWST/32-370------------------------------VFGGIRGLGT........GMDDF....QYR.SFFED.FVRRIQINGFFNT
E7NQN0_TREPH/28-357------------------------------LLVGINSDRA...........DFN...NYL.LFFQE.SPTSIFSTEFYNY
Q8A831_BACTN/29-353------------------------------LLAGLRYDNA...........DYE...NYL.EIFKN.PWE..........
C6I3T9_9BACE/28-349------------------------------LFAGLRYNNA...........DWN...SYF.DFYKN.IANGSGE......
Q1V7L3_VIBAL/26-356------------------------------LFVGIRYASV...........DYF...NYE.EIYYY.VDNVSEMG.FPNY
C7M7Z9_CAPOD/10-347------------------------------FIVGNRG...........DTRDTI...VYY.SVFKY.IDV.......FDL
B5L3D3_ECOLX/36-361------------------------------ILIFART.GL........GV.DES...TYL.ESY.............HYY
F1Z115_9STRE/49-372------------------------------FIVGIRT.NS........GS.DYY...NYL.LSFRN.VDNW......FHS
A7V5U7_BACUN/28-354------------------------------VMVVFRY.DV........GT.DYL...EYT.DYYYR.IHSL......FEL
Q8A715_BACTN/26-366------------------------------CMVGFRY.NI........GA.DWE...TYV.IIYNR.Q.........IPS
D7ITP9_9BACE/25-344------------------------------VVGALRGEGV........GA.DYY...AYL.RIFLH.GD...........
E2N1D0_CAPSP/33-355------------------------------YIAGLRDITV........GT.DTA...HYR.DIFNN.P............
D7PDX4_ECOLX/28-352------------------------------LISGLRMNDS...........DYI...EYK.KMYNE.VPILCD....FSL
A8U9G3_9LACT/24-350------------------------------IVAGFRF.YT........GY.DFN...SYG.KFYTE.IEK.......FSD
C7TKU1_LACRL/24-347------------------------------VVAGLRY.ET........GN.DFL...PYK.TIYAG.D.........YSA
E0NTF2_9BACT/25-352------------------------------WMIGNRD.LA........WA.DTF...VYV.MAFNQ.APTI......FQI
F0KIR6_ACICP/24-352------------------------------IFSAFRVGGT........GTGDYD...AYL.RLYSA.TDTFEKVIDPE..
C2BGA1_9FIRM/29-360------------------------------IFAAMR..GS........GDADYY...NYL.WFAKD.IGTD......FDK
B6W8F8_9FIRM/29-359------------------------------IFAGLR..GS........GDADYY...NYL.YFAKD.IGTD......LSK
C7RFF5_ANAPD/29-361------------------------------VFAGVR..GS........GDADYY...NYL.WFVKD.LGVD......YTR
Q5LH99_BACFN/15-335------------------------------LCFGYMT.GS...........DWR...AYE.LQYQS.AD........YYY
A7V5D6_BACUN/28-344------------------------------LFVGSQD.GI........GT.DHS...NYI.AQIES.PWV..........
D3SAJ3_THISK/38-360------------------------------LLLAFRT.DV........GT.DYD...AYV.RIYNA...........FRD
E5CFC4_9BACE/25-346------------------------------LFAGLRSAGV........GT.DSG...SYA.RSFTD.IGDMEGDWKEQ..
C6X0C5_FLAB3/28-350------------------------------AFAGLRNVNV........GT.DTG...NYV.GIYYG...........YQD
C4ZJE6_THASP/44-373------------------------------IVIGLRF.EV........GT.DWY...GYV.SIYES.LY........YLE
E5YGM0_9ENTR/19-338------------------------------MFNGLRV.GI........GN.DYE...QYL.NIYNQ.VNAGLY.......
C6ITG0_9BACE/26-335------------------------------IIAGLRY.NV........GV.DYP...VYE.DIYND.P.........YSV
A5ZI18_9BACE/28-334------------------------------IFIGIFRFDV........GW.DYI...NYY.NYIDK.IEVNQI.......
Q0HKL4_SHESM/27-338------------------------------FFSAIRY.DV........GF.DYA...TYW.NMISN.GSFEH........
D6E918_9ACTN/24-356------------------------------LLLALRAESY........GP.DAE...IYA.AGYRY.ISSLTFSQ.MLGA
F0SY68_SYNGF/34-364------------------------------LPSAFRY.EV........GL.DYT...TYT.TIYDI.IVG.......AGS
C9KPH1_9FIRM/27-363------------------------------VVSGFRY.RI........GY.DYD...QYM.NMYSW.ISYDPNM......
B6A8T0_ECOLX/28-355------------------------------VPLALRY.GI........GR.DYF...SYI.EIYKN.VLVAR........
E2DNR6_ECOLX/32-354------------------------------IPSGIRY.GI........GT.DYF...SYL.RIFQS.ALEGR........
D2TQI7_CITRI/31-353------------------------------IPAAIRF.GV........GA.DYF...RYL.SMVES.VRLGY........
E5V9C7_9BACE/31-351------------------------------IPAALRY.DI........GT.DYS...FYV.EAYHS.QYLL.........
A6L9H3_PARD8/32-354------------------------------IPASIRK.GI........GT.DYW...AYV.GLYDW.YRTNS........
Q4K0T2_STRPN/28-349------------------------------LIGALRA.YV........GI.DYT...TYS.LDQIP.AVLAGSQ..T...
E0NHN7_PEDAC/40-361------------------------------VPGAIRY.YV........GV.DYT...TYS.NLQIP.MVLSGNP......
A1A378_BIFAA/27-350------------------------------TISGFRY.GV........GT.DYF..FTYV.PTYKQ.IYNGTP.......
F0K0J0_LACD2/31-347------------------------------VVSAFRY.QV........GK.DYG...IYV.RTYDL.IKTGQQ.......
E1WLK7_BACF6/35-350------------------------------FFSAIRD.DC........GC.DYN...SYI.LHIER.IQMGKL.......
E0RX92_BUTPB/42-359------------------------------AVSSLRL.NV........GN.DYL...NYV.ELMHL.AYSRAY.......
C3R7I4_9BACE/28-352------------------------------LVMAIRDESV........GT.DLP...KYL.DIVNT.IG........YSN
D5DBJ5_BACMD/39-371------------------------------VLAVFKGVTV........GT.DYP...MYY.NFFV............YET
C2EVS6_9LACO/30-364------------------------------FLTVSRGITV........GT.DYP...AYN.GYFYS.TKDELKV......
C0C0E8_9CLOT/30-354------------------------------AIAVLRGITV........GA.DTK...NYY.AYYED.IVQLHTWK.DLSY
E7GJ39_CLOSY/47-379------------------------------AMFGLRY.GI........GT.DYF...NYE.QIYNA.VHGTSICDYWSLH
Q8XN60_CLOPE/30-345------------------------------LIAGLRW...........GIGDTP...AYV.HLYSL.IEPGYDP..K...
A9VPZ7_BACWK/36-350------------------------------LVSGFRN.NI........G..DTY...FYM.HAFKV.TDFNWGYI.R...
C2UYS5_BACCE/36-350------------------------------LVAGLRN.NI........G..DTY...FYM.HAYKI.TEFNWEYV.Q...
C3ADI9_BACMY/38-352------------------------------MVSGLRN.NI........G..DTF...FYM.YSYKK.DTFDWEHI.K...
C2WEM9_BACCE/36-357------------------------------FISGFRY.MV........GT.DYW...TYT.DIYYL.TGLSDNVKDLM..
E3DVZ3_BACA1/36-363------------------------------LVSGLRY.RV........GT.DFQ...TYG.LMYQL.AGDYQNIWEIFGF
E5W8D3_9BACI/36-363------------------------------IVAGLRY.KV........GT.DYH...TYM.LLYEL.AGKYNSIWEIFGF
B0P2K8_9CLOT/37-362------------------------------FFCGLRS...........GIADTG...TYI.QMFKG.YPSSISGMDLKS.
B0ACE3_9FIRM/38-368------------------------------IFAGCRS...........SVADTA...VYI.NGFEN.YPNNLSLVYNMIF
A6NPS1_9FIRM/35-361------------------------------LFSGLRT..............DYNDTWAYI.TSFRN.AEPVFIFLSDPEN
F0HVE5_LACDL/23-357------------------------------ALISLRSITL........GVYDTS..GIYL.QNFNY.VQSTSWNN.IWTY
C2EGY8_9LACO/41-362------------------------------LLVALRSVYL........GVNDTL..NVYY.PAFNV.ANLGSWSNAIDNF
Q0TSM6_CLOP1/32-355------------------------------FISAFRGRNI........GN.DTC...KYL.DLFNK.VRFKSITELK...
F0PU56_BACT0/28-368------------------------------SLMAFKGQNI........GN.DTP...VYI.ALYNQ.LQSS......VDL
C6I5R5_9BACE/29-346------------------------------IIHGLKNPYC........FP.DTP...EYA.QGFRE.ICEMDFSDYLLVG
Q64Y60_BACFR/31-360------------------------------LFSSLRYPKY........GT.DTY...VYS.DMFGV.FAHGNYAFYENP.
C4L730_EXISA/28-346------------------------------VLSGFRDVTV........GA.DTA...QYK.ALFLQ.SQTLPLGAFTDRF
B0P9K3_9FIRM/54-410------------------------------LMVLLRSSMV........GV.DYP...TYQ.AYFET.VSQNP.....FSF
E1YWT9_9BACE/27-350------------------------------LHDGLRW.ET........GT.DWG...NYY.RFFLN.CL........WDE
C9RN08_FIBSS/27-350------------------------------CQEGFRW.QI........GT.DWL...PYY.RMFEY.NLS..........
C7M4A6_CAPOD/29-353------------------------------FLVGLRW.RT........GT.DWE...PYK.EVFEN.ISEYLHKAMYEGT
Q39W09_GEOMG/33-369------------------------------AIIAFRW.EI........GT.DWN...SYY.EYFVG.IKNGSGS..SYD.
D1JP75_9BACE/28-362------------------------------IGCRWET.GT...........DWN...SYL.LLFQE.IKIDLSFLLMA..
C9PY95_9BACT/28-358------------------------------FHDGFRW.ET........GC.DWI...PYT.GYFDK.LLVD......FSI
E4RNL6_HALSL/27-346------------------------------FFAAFRY.DV........GS.DYF...SYI.RMYNK.IGSRGISWALSS.
B5Q3Y8_SALVI/23-348------------------------------SFCSLRW.QT........GT.DW........LPY.............YDD
B9KB09_THENN/26-382------------------------------FISSLRY.RI........GT.DWE...PYY.EFFHL.PS........YKL
B2V0T8_CLOBA/35-358------------------------------LFLALRNKSV........GP.DTL...LYC.NIFKE.IGNGWGIS.EY..
Q1WCS9_STRTR/30-358------------------------------FISASRASSA........GT.DVT...LYE.NIFKS.INYGIS.......
C4Z668_EUBE2/44-362------------------------------VLIAFRNISV........GT.DTG..ITYY.RIFQH.SLNGS.....YQI
E0S0Y2_BUTPB/32-367------------------------------VIAGFRALDV........GK.DNY...SYT.RYFLG.MTINKVYFFDFKK
Q048A4_LACDB/46-398------------------------------LISCFRY.GV........GT.DYF..HTYV.PQFLS.IVNGSYT......
E2DZE7_ECOLX/24-353------------------------------TIVSFRDISV........DR.DSI...VYF.TVFND.LSNINSLYELWIF
E1LFZ3_STRMT/29-357------------------------------IIAGFRTSSV........GG.DLG...TYI.HIFES.NNLQLPDLSHLFS
D0BKU5_9LACT/28-356------------------------------LIDGFRKSSV........GG.DLS...VYV.SIFEQ.NALKLPEFSKIFK
D7YPG3_ECOLX/25-334------------------------------LLTAIR..GN........GGDDFY...VYE.KYFNA..............
E4VU68_BACFG/30-357------------------------------LLSILRKNTV........GG.DLI...NYI.PLYDT.IAKSS.....FGE
D2RIR8_ACIFV/29-352------------------------------FLSAFRAETV........GN.DTI...RYV.DFFRS.FFYVDDPWEIVSN
E4MD95_9BACT/23-351------------------------------FLAAYRSLGV........GT.DSE...AYY.TIYYQ.YANNDAYVAANEN
C4GCL9_9FIRM/28-345------------------------------LFAGLRNNSI........GLDSAD...GYH.RYFNF.LLVGKSL..D...
B1C3W9_9FIRM/29-372------------------------------VVFSIRNAEVD......IGS.DLN...NYY.RLYCR.AIESSSLVDFLNN
F2M2L7_LACAL/34-380------------------------------GIRSYDI.GT...........DVN...GYV.RSS.............FEL
D1JXK2_9BACE/23-363------------------------------LFAGFRDKNI........GS.DTD...FYP.HWYIS.EIRYIHNLIDLIT
D3HZQ1_9BACT/22-355------------------------------VMGVIRARTV........GS.DLN..GGYW.SEYIA.MGENPASWGIVM.
B0NR62_BACSE/28-357------------------------------LFAGFRQIGL...........DFD...SYL.DHFKV.VPSI......FQY
D5EVG6_PRER2/7-324------------------------------VMATFRYGQM..........DDYF...NYY.INYEH.PEIY.........
D1PQ73_9FIRM/29-362------------------------------AMLVLRF.GQ........GT.DYF...SYL.DYYYR.MPDTGIHVPVPD.
B1SB73_9BIFI/27-361------------------------------TVSGLRSSNV........GT.DSP...MYA.RLLRH.SGKCLK.......
A6QAG6_SULNB/27-344------------------------------LYIGLRH.EV........GS.DWF...NYL.AMFNRDVPSMNYMDAL...
A6DEM7_9PROT/26-341------------------------------FIIGFRY.QV........GG.DWY...NYL.AHYEF.TKHETINEIL...
E4PS23_MARAH/27-342------------------------------LAIGLRF.EV........GG.DWF...AYI.NLLEI.HAAKDLTGVI...
Q0A657_ALHEH/27-342------------------------------LAIGLRH.EV........GG.DWG...SYL.AYLKR.AGEMSLQEVL...
B7RW64_9GAMM/32-347------------------------------LMIGFRH.DV........GG.DWA...NYA.RHFNH.ISFMTFDEAL...
Q8DJL9_THEEB/21-349------------------------------LFIGLRF.EV........GA.DWE...SYI.YILEA.AKSQSWFALEGI.
B6QYQ8_9RHOB/29-346------------------------------AFIGFRF.EV........GK.DWI...QYN.YIFKL.ITELPFVEAM...
A7HKI9_FERNB/29-353------------------------------LFIGLRH.EV........GG.DWD...TYL.WWYKD.IAVNGIDF.SFNS
F2ALR7_RHOBT/67-386------------------------------FFSAFRY.EV........GP.DWL...GYL.NIFNI.QRWQSYLDAS...
E3I7S4_RHOVT/25-342------------------------------AFVAFRY.EV........GC.DWS...GYR.TNYDL.AQYLTVEEAV...
E8KJL4_9PAST/2-248------------------------------.....................DNR..........................
F0QJB5_ACIBD/26-342------------------------------IFIGLRF.KV........GG.DWD...NYL.ILYEN.FK........YLN
Q5QWV6_IDILO/29-338------------------------------FIYGFRF.EV........GV.DWF...NYI.RVYER.DVANALT..F...
Q1QWW7_CHRSD/27-347------------------------------YMASFLRWDV........GT.DWD...GYY.RFYGK.LDN.......FDF
F2UUT5_ACTVI/30-361------------------------------AFSSMRAVSV........GN.DTV...EYH.RVFEE.IKATTSLQEAFTV
B5L3I2_ECOLX/31-358------------------------------TFIGLRY.QT........GL.DWL...FYN.NLFNG.EGFS.........
Q8KN52_PSEAI/26-351------------------------------FVFGFSY.KV........GS.DWY...NYF.SYFDS.GCTG.........
B0MX13_9BACT/23-361------------------------------LFGGSQD.PL...........DFY...NYE.DIYNT.VKQG......YD.
E5VCV4_9BACE/29-372------------------------------SVLKYRV.GS...........DIL...VYM.SEYGD...........YLP
D1JV57_9BACE/29-369------------------------------SAFKFRV.GS...........DIL...VYI.EEYKT...........YKS
D2ETY6_9BACE/27-359------------------------------LIMGCRY.VV........GG.DTV...RYI.RYFDF.YPKLGDEMNLFSY
D0TG79_9BACE/26-371------------------------------ILLNVLSYKI........GG.DTE...TYM.YSWKY.DYRSIFDVNLLDE
D0TBD4_9BACE/31-353------------------------------MGYRYEV.GG...........DTL...NYM.GYWNY.QEDLSDWQLTFK.
A6LBP7_PARD8/27-381------------------------------LVAGLRW.RV........GS.DTV...SYA.SDFYF.SHDLFHLE.W...
C7XEA9_9PORP/27-380------------------------------LVSGLRY.RV........GS.DTV...VYM.DDFKY.YPDLFHL..RWND
D1W6W5_9BACT/26-352------------------------------AFVGLSD.MF........GGYDRY...IYG.EVFDT.VADITTAH.ESYL
D9RS75_PREMB/26-353------------------------------LFVGFSD.MF........GGYDRY...IYG.EVFDN.IADITTIK.GDYS
D1W1V4_9BACT/26-351------------------------------LFVGVSD.ML........GGYDRY...IYC.ELFDG.LADDIREGRNPFL
D3IIR5_9BACT/26-355------------------------------LFVGFSD.ML........GGYDRY...IYA.ELFDE.VADVQRTG.GDVK
D3I859_9BACT/26-352------------------------------VFVGLSD.ML........GGYDRY...IYA.SLFDD.IADITRVG.GNYK
F0F6A4_9BACT/26-352------------------------------VFVGVSD.ML........GGYDRY...IYG.ELFDE.VAYITHIG.SSYN
D8DZP1_PREBR/31-354------------------------------CFVGFGD.ML........GGYDRY...IYA.ELFDD.VANTLSRDMNIHM
E1KTN9_9BACT/26-351------------------------------VFVGLGD.ML........GGYDRY...IYG.ELFDN.LADQLKIG.IPIT
D7NAB4_9BACT/26-352------------------------------LIVGLGD.ML........GGYDRY...IYG.ELFDR.NADLIRNGGPFIN
C9PWW7_9BACT/24-345------------------------------LFVGFAD.ML........GGYDRY...IYG.EVFDN.IADQTRAGVPISD
E1GYB6_9BACT/25-352------------------------------LFVGFGD.ML........GGYDRY...IYA.ELFDD.TSDATDAAIPYID
D1XZD4_9BACT/28-352------------------------------LFVGLGD.MI........GGYDRY...IYG.EVFDT.IADEFQHTSSPNI
D1PWT1_9BACT/24-349------------------------------LFVGLGD.MI........GGYDRY...IYG.EVFDT.IAEEMRGGRNLAR
C9LKD9_9BACT/25-350------------------------------IFVGISD.ML........GGYDRY...VYA.EAFEG.QAWSVHLGKGLFN
E6MMW3_9BACT/21-348------------------------------LFVACSD.ML........GGYDRY...IYS.DAFTA.YAEEIQMR.GNIF
E5V8M3_9BACE/69-395------------------------------LFMGLRGSWV........GI.DTI...VYS.QTFEN.ATS.......LSA
B7GUM4_BIFLS/44-384------------------------------AGVRDVTIGT...........DVK...VYVIDTFEK.VSQLRFTDIFISY
A5ZDF0_9BACE/31-358------------------------------GGLRDVGVGY...........DTI...AYP.VSA.............YNY
E9SGC4_RUMAL/37-488------------------------------LLAGVRADTV........GK.DVL...EYA.VRTFE.LAEKSDNFAYMKE
E6UEJ4_RUMA7/36-384------------------------------LLAGVRADTV........GK.DVL...EYA.VRTFD.LANSSTSYSYMRE
E4RXS3_LEAB4/31-353------------------------------GGLRDTSIGI...........DLR...VYG.VEYFY.YALFSNSFSDLIR
E3PBR1_ECOH1/28-364------------------------------LLAGLRF.HT........GW.DWE...AYD.YFFYE.LTSSNLFEISKAN
B3IUU1_VIBPA/26-360------------------------------LFSSNSYFN.........GW.DAY...TYL.RYFNV.IVDKGNYE.GFSV
D8MET7_LEUGT/28-370------------------------------LLSGTRY.HL........GGYDYS...NYE.YMFQL.APTLNHLNLVNYV
A6ASH6_VIBHA/21-345------------------------------LFSALRY.HV........GP.DFI...QYE.YIYST.LTSGGT.......
D9YYZ5_PROMI/24-338------------------------------LFSGLRY.DA........GN.DFF...SYY.SMITN.VVDI.........
C4K321_HAMD5/34-350------------------------------TLFGLRDYSI........GS.DTR...DYV.ENFLY.NN...........
Q4K041_STRPN/27-373------------------------------MLAGFRADHI........GT.DTG...VYL.MPTIN.AATSSHS...FSE
C5S1B5_9PAST/27-372------------------------------VLAAFRANNI........GT.DVE...VYL.NPIIN.AALETSS...FDE
E6MFB5_9FIRM/30-370------------------------------VLAALRDDTI........GT.DIHYYGNPQ.FFWCL.QNHDLKWL.IQSQ
C5F8C9_LACPA/30-390------------------------------CLAGLRTSQI........GT.DI....SVY.GAFNF.RMAHAFSS.LFDY
D1NRU3_9BIFI/51-371------------------------------LLMGLRY.NT........GY.DYV..YSYV.PSLND.NRRGDK.......
C8WKZ6_EGGLE/32-357------------------------------VLIGLRGLNV...........GYD...TEA.MTYLL.FSGPFSLDYLLE.
D4V5L6_BACVU/25-369------------------------------FFIGFRSRVV........GGADSI...NYV.RFFTG.EQNFYNINDT...
C3WC57_FUSMR/29-349------------------------------ILIGFRG.NI.........ARDDQ...MYI.DLLKQ.FQYS......FDF

PF10131

Q0AV03_SYNWW/415-1038--------------------------GNLPRVLA......-----------TALLPL--------LFALFLHIITQRKSY
Q5JIL5_PYRKO/62-622--------------------------ANFPRANS......-----------INLFPL--------FL.LALLWAVDIRE.
Q9UY38_PYRAB/63-619--------------------------GNFPRANA......-----------IHLAPL--------FL.LSLYWLREKRE.
Q97FZ3_CLOAB/258-879--------------------------GNIPRALI......-----------TALLPY--------LF.YFLWDFVNYGRK
Q0AV07_SYNWW/2-631--------------------------GVIAQGPI......-----------FALSPW--------LL.VATLLFIEKRSP
Q8TXR3_METKA/68-665--------------------------GVYPTI........-----------LSLGFG--------FLALSCYERWLRGEK
A0LQQ1_SYNFM/80-828--------------------------GNIASTLAGEFCYG-----------IGLVIA--------VV.LTGKVFHDIRDG
Q97FY2_CLOAB/253-873--------------------------GNIPRVVI......-----------AALIPY--------LF.YFLWGFVEKGKK
A7VEP1_9CLOT/75-690--------------------------GNLPQMVT......-----------TMLVPY--------VI.WFLWLYVRKKNN
Q97G45_CLOAB/90-699--------------------------GNIPFVTV......-----------ISISPM--------VF.FYYYKSMMGKKI

PF09586

A4VYG6_STRSY/15-836H........KNLKE..EWALL.....LATSFSLMSFSTSQ-----------LEINNW...LDVFILLPLVLLGLHRLLKK
Q1WT54_LACS1/18-862K........L.QKG..WMIPT.....FSISYALMAWNVVN-----------QLNLLW...MDAAILLPLIIASFYDLMEK
Q8DRZ1_STRMU/67-904Y.........EAHRHRLLAVC.....IAAIYGLSGFLIVN-----------QVNPNF...LDNIILLPLLLIGVEKILDG
A7GVH5_BACCN/15-865H........KTT....FSSFI.....SAIIYG..GCITFI-----------RHSLLWDFMADAIVFLPLVLWGFDRYIIE
A7VEC6_9CLOT/153-972C........RNYKTYDAAILI.....FSTAYAISNYVIGY-----------SWNLMW...MDCIMILPLIMAGFERMTES
Q3EWS4_BACTI/59-905N........KTA....FSSFV.....AAIIYG..GCITFI-----------RHSLLWDFMADAIVFLPLVIWGLDKYIIE
Q74LA0_LACJO/18-861F........NFKNQ..IYSVF.....LGIIYGLSGYCIGY-----------GANLMW...LDGVILLPLIIYALIKGLVK
Q74LA1_LACJO/22-868F........KFKYQ..AYPVF.....LGIAYGLSGYSIAY-----------AGNVMW...FDGLVLLPLISYALIRGIRK
A8AU67_STRGC/17-840F........KKIPN..FLILM.....LSTCYSLMSFATSQ-----------IEIKTW...LDVFIIAPLILYGLHLLLIK
Q03YY3_LEUMM/16-848H........L.QHG..YYITL.....FAINFALSGWFVAN-----------NLNLLW...LDTAVMLPLVIYQLEQVFYR
Q8DRQ9_STRMU/18-837Y........TKISK..SLVLM.....LSTSYALMSFTSSQ-----------LELNNW...LDVFILLPLIMLGLQRLVEK
Q4L5U5_STAHJ/10-841S........RNT....WISII.....MAFLFVMS..PLYY-----------RFTVYWPFFSDVFIWMPLLLFSIERTLQK
Q03G85_PEDPA/13-851A........Q.KNK..ITTPRASVVGFATAYSLMAFSIAN-----------QLNLFW...LDAPILLPLIILGLDALIDQ
Q030D0_LACLS/14-856Y........QKLSN..LTVLS.....ISTAFALMSFLTSQ-----------LEITMW...LDVFILLPLIIWGLHRLMDE
A5VKU5_LACRD/18-849E........L.QQG..WRILA.....FSTVYSMNGWMIAN-----------QLNMIW...QDALILLPLIIWGLLKLIYQ
Q8DRY9_STRMU/26-950Y........KALSYNPWLVPL.....MATAYALSGMIVSY-----------QMNPIF...YDAMIMLPLVIISLEELIDG
Q38WC5_LACSS/15-827T........TSYH...YSALI.....FSTAYSLCGFVAMN-----------FYNLMW...LDALILVPLIVIGLERLFSV
Q8DWP3_STRA5/16-839H........CKVNR..VLLLV.....ISTCYSLMSFSISQ-----------IEINMW...LDVFILIPLVVLGVDQLLWE
Q03NT2_LACBA/19-858S........Q.ISG..VLIVL.....FSISYALMGWTIAN-----------QLNIMW...LDILFLLPLILNGLIKILNG
A5M1N1_STRPN/14-831F........QSIPQ..TLKLA.....LSTSYALMSFTVSQ-----------LEIKTW...LDVFILIPLIITGLHLLITE
Q38VZ4_LACSS/17-848R........L.LSG..WWLPT.....LSLTYALSGFAIAN-----------QFNVMW...LDAMIWLPLVVLGIEQLFER
Q03RN6_LACBA/20-858T........Q.QRG..FKAIM.....FATAYALMGWSVAN-----------QLNVMW...LDAAYLLPLIFYGLYQLMHT
Q5FIZ5_LACAC/21-848Q........K.IND..FYALA.....ASAAYALSGYVVSN-----------HYNLMW...LDSVLLLPLLIEAIDRVLNG
Q4L5U4_STAHJ/19-851K........LSS....TPLLI.....ATILYGASTVVLYY-----------NFT..WSFYGDLLIILPLSLWGMERFFQR
A7VCC3_9CLOT/56-904KIRRFAEKGLSEKYITVISMM.....FGLLYALNSYVVVY-----------NHNVLW...LDGLILLPFIAIAVEHLAEG
Q839W8_ENTFA/19-846F.........KIPK..WSHVT.....LSVSYALMSFIVAH-----------SELIMW...LDAFIYLPLVILGIHRLMDQ
Q5M231_STRT2/16-841F........TKVSR..SFILC.....LSTGFSLMSFATSQ-----------LEINTW...LDVFILAPLIILGLHLLLRF
Q82ZW8_ENTFA/12-828Y........QKVD...GTTLL.....FSTSYSFCGFVTVY-----------SQNFMW...LDALILFPLILLGLQRLWDQ
A7VV10_9CLOT/13-832L.........HLRA..APNLC.....FSVAYSLMSYVIVY-----------ALNIMW...LDGVIFLPLVLLGLHRLQDK
Q8NYY9_STRP8/14-837Y........PKISA..FLMIS.....ISVFYSLMSFLTSQ-----------MELNSW...LDVFILLPLVVLGLNKLITE
Q5HPU9_STAEQ/10-840S........KNK....IIGLL.....ISFIFVIS..PLYF-----------RFTIYWPFFSDTFIWLPLLLLGIERLLRD
A5Z3G2_9FIRM/23-866F........GQKN...ISSVV.....FGMAYALSAYFAAF-----------SWNIMW...LDCMWLLPFIVLGLEKLVNE
Q5WFJ9_BACSK/12-844N........MSL....PYAFL.....GAVFYGVS..VMYF-----------THGIYWEFFADAFLWLPLLVLGVEKLIRE
Q74IE5_LACJO/19-843F........KGDNK..IFALA.....ASLAFALSGFVVSY-----------NLNLMW...LDSLILLPLLLDAIDKLFEQ
Q03HY9_PEDPA/14-831F.........KIKR..YQQLL.....LAISYATMSFGLVN-----------AEQIMW...LDVLYILPLIVWGVDQWIEQ
Q038D6_LACC3/14-842H........A.IHG..MMIPA.....FGLAYALSGWLLAN-----------SFNLMW...LDAAMLLPLIIDSVDILFKG
Q3XYV7_ENTFC/19-847F.........KIPR..WGHVA.....LSVSYALISFITAH-----------SEIIMW...LDAFFYLPLVILGIHRVMDL
Q931T0_STAAM/19-851H........FKR....STNMI.....ATILYGMSTVVIYF-----------NFT..WSFYGNLLYLLPLSILGLERYFQQ
Q814J9_BACCR/15-862N........KTI....FSSFI.....SAIIYG..GCVTFI-----------RHSLLWDFMADAIVFLPLVIWGLDKYILE
Q041X2_LACGA/19-844F........NGDNK..IFALA.....ASLAFSLSGFVVSY-----------NLNLMW...LDSLILLPLLLDAIDKLEDK
A7Z2M8_BACA2/11-842V........KRT....VPAFA.....GAVLYGVS..IIYF-----------RHEVYWDFFTDSMVWLPLLVLGAEKIIRE
Q03TF4_LACBA/23-880F........LKSG...WSMLL.....FTTAYSLCGFVAMY-----------FYDMMW...LDALIWLPLVALGLHRLVSQ
Q8CSU8_STAES/19-850R........LKP....APMFI.....ATILYGMSTVVTYY-----------NFT..WSFYGNLLIMLPMSLWAIERFFKE
Q046D7_LACGA/22-883F........NFKYQ..AYAIF.....LGIAYSLSGYSVAY-----------AGNVMW...FDGLILLPLITYALVRGIKI
Q5WJL1_BACSK/14-845N........IKA....KYAFI.....GAVLYGGS..VMYF-----------RHAAFWEFFADAYLWLPLLVLGVEKIIRE
A3CRC9_STRSV/17-843F........KKIPA..LLIIT.....LSTSFSLMSFSVSQ-----------LEIKTW...LDVFILTPLIVLGLHRLITG
Q65M97_BACLD/11-842V........KNK....LAAFT.....GAVLYGTS..VIYF-----------RHTVFWEFFSDAMLWLPLLVAGAEKVIRE
Q04EK1_OENOB/16-850N........F.TGK..EMGLL.....ISSSYALSGWFVAN-----------QVNLLW...QDQIILLPLIIYAAIKLINE
Q03QV8_LACBA/14-985S........FKP....ASQLV.....GTLAYTFTGYSLY.-----------.VSIRHPFFLLPMILFPLLAYGIDHVLSG
Q49X29_STAS1/10-840A........LNK....KIAVL.....AAFIFVIS..PIYF-----------RFTVYWPFFSDVFIWLPLLLWSIERFLKS
A5ZUP3_9FIRM/20-900K........NSK....QAVFM.....GSMIYVFAGWTIY.-----------.AAMKHPYFSNPMIYLPFILMGIDKIYKK
Q03A73_LACC3/16-850R........Y.GKN..WYTLV.....FSVSYGLSGFLIAN-----------FLNIMW...MDGVILLPLVILGIDRLFEE
A8FB68_BACP2/11-842V........QNR....LGALT.....GAAIYGLS..IVYF-----------RHQTFWEFFTDSMMWLPLLVLGVERIFKT
Q049H9_LACDB/23-844Y........Q.LAK..EYVLA.....ASFAFALCGFVVAN-----------NLNLMW...LDSLALLPWLQEAIDRLLSG
Q03TW7_LACBA/17-837W........RTTS...RFVLV.....FGLAFAFSGFVALN-----------FFNVMW...LDALIWLPLVTWGVDQLVRT
Q49X28_STAS1/19-851K........FKN....YATLL.....AAMLYASSTTVIYF-----------NFT..WSYYGDLLIFLPLSLLGVERFYKE

PF05007

GPI14_YEAST/127-386--------------------------------------------------------------------------------
GPI14_SCHPO/112-368--------------------------------------------------------------------------------
PIGM_TRYB2/134-410--------------------------------------------------------------------------------
PIGM_RAT/140-408--------------------------------------------------------------------------------
Q17515_CAEEL/146-405--------------------------------------------------------------------------------
Q9W2E4_DROME/177-450--------------------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379-----------------------------P.DAVRYDHQL-----------...................SSPLTSFSQL
Q5CYY5_CRYPI/10-436-----------------------------HDLEDYTNGFF-----------...................GILGQNFGEV
B6AHL5_CRYMR/12-437-----------------------------..PNIYTDPLN-----------...................VIPGYTFRDI
B0E7Z2_ENTDS/6-295-----------------------------PTYLLPSRVEL-----------...................NTSPFALLD.
B8A6Z1_ORYSI/11-376-----------------------------D.LHLASRPEV-----------...................STPLTSIRRL
Q9LN74_ARATH/14-421-----------------------------N.INLSSRPEV-----------...................STPHTSLRRL
B9RC32_RICCO/30-452-----------------------------N.LNLSSRPEV-----------...................STPLTSLRRL
B9GKM7_POPTR/14-432-----------------------------T.FNLASRPEV-----------...................STPLVSLRRL
A9TIH7_PHYPA/73-514-----------------------------L.SLLDRRVEV-----------...................VSPVTSLSRL
B3N7C2_DROER/10-386-----------------------------A.PMIGNRVEF-----------...................ATPLNSHKRM
B4N1B7_DROWI/10-386-----------------------------A.SLIGDRVEF-----------...................ATPLNSYKRM
B4KI55_DROMO/10-386-----------------------------A.PLIGNRVEF-----------...................ATPLNSFKRL
Q16H22_AEDAE/9-388-----------------------------G.VTIQNRVEV-----------...................ATPLNSWKRA
B0W4N5_CULQU/8-388-----------------------------S.GLIRGRVEV-----------...................ATPLNSWKRA
Q7Q3W6_ANOGA/8-396-----------------------------S.HGIQNRVEV-----------...................STPINSWKRV
B7QL74_IXOSC/11-391-----------------------------G.KRISDRVEV-----------...................STPLNSWRRV
PIGU_CRIGR/10-394-----------------------------A.EFISERVEV-----------...................VSPLSSWKRV
Q4RLI5_TETNG/10-394-----------------------------A.DLIAERVEV-----------...................VSPLTAWKRV
Q28CK0_XENTR/10-394-----------------------------A.EFISERVEV-----------...................VSPLNSWKRV
A7S3Y0_NEMVE/14-406-----------------------------R.EWFRDRIEL-----------...................STPLTDWKRV
C1BQW5_9MAXI/19-392-----------------------------G.PDLSERVEL-----------...................STPLNSHKQL
C1BTB5_9MAXI/14-387-----------------------------G.PDLRDRVEL-----------...................STPLNSHKRL
Q54T45_DICDI/55-469-----------------------------D.QLFSNRNEI-----------...................TTPLTSFKRL
Q758M8_ASHGO/10-356-----------------------------Q.QQLDNAVEF-----------...................STPVTSFRSL
C5DB98_LACTC/10-356-----------------------------Q.QQLDRSVEF-----------...................STPVTSFRSL
Q6CPH2_KLULA/10-358-----------------------------Q.QQLDRTVEF-----------...................STPVTSYRSL
Q6KCB8_SACBA/10-360-----------------------------Q.QQLDQSVEF-----------...................STPVTSFRSL
C5DUS6_ZYGRC/10-359-----------------------------Q.TQLDKSVEL-----------...................STPMSSYRLL
A7TF02_VANPO/11-360-----------------------------Q.SSLDNSVEF-----------...................STPFTSFKSL
Q6FSI7_CANGA/9-374-----------------------------R.SQLDNTVEF-----------...................STPFTSFKSL
C5MHK2_CANTT/9-395-----------------------------I.TKLDSSVEF-----------...................STPISSFKSL
Q5AGH5_CANAL/13-440-----------------------------T.SILDSSILL-----------...................STPITSFKSI
A5E2K6_LODEL/111-490-----------------------------V.PVLGSIVEI-----------...................TTPITSFKAL
Q6BPY5_DEBHA/9-390-----------------------------P.LDLSSSIEI-----------...................ATPLTSFKSL
A3LVF4_PICST/9-390-----------------------------T.DVLSSIVEI-----------...................STPVNSFKSL
C4Y9V1_CLAL4/8-389-----------------------------S.HSLAATPQI-----------...................STPIDSFRSI
C4R1V8_PICPG/4-353-----------------------------E.SIIQDSVLF-----------...................STPTNSYKQL
C0RYW5_PARBP/12-388-----------------------------P.DLLTGRVEV-----------...................STPASSFKRL
C5FSQ4_ARTOC/12-388-----------------------------P.DLLTGRVEV-----------...................STPISSFKRL
B6H480_PENCW/12-387-----------------------------P.DLLTGRVEV-----------...................STPVNSFKRL
A2QI87_ASPNC/12-388-----------------------------P.DLLTGRVEV-----------...................STPVTSFKRL
B6QEM6_PENMQ/12-390-----------------------------P.DLLTSRVEV-----------...................STPVSSFKRL
B2WBA6_PYRTR/13-388-----------------------------P.DLLAGRVEV-----------...................STPVTSFKRL
B2A9S5_PODAN/16-388-----------------------------P.DLLTGRVEI-----------...................STPVTSFKR.
Q6MUS3_NEUCS/16-392-----------------------------P.DLLTGRVEI-----------...................STPVTSFKRL
Q6C5L4_YARLI/7-382-----------------------------P.ATLDGHVEI-----------...................STPVTSFKRL
Q55ZX0_CRYNB/19-375-----------------------------V.IALQRRPEL-----------...................LTPLTSFRSI
B0D118_LACBS/9-373-----------------------------P.DVLKHNHQL-----------...................SSPLTSFSQL
Q4PGW0_USTMA/31-470-----------------------------F.ELLQDRPEL-----------...................STPLSSFKAL
PIGU_SCHPO/10-372-----------------------------IAEFLYRRIEV-----------...................STPVSGFLRV
B6K154_SCHJY/14-372-----------------------------..SILEKRIEI-----------...................STPASSFLRV
Q22672_CAEEL/31-382-----------------------------..DLFEERVEL-----------...................TSVVYSFEKL
A8X654_CAEBR/27-380-----------------------------..DYFEERVEF-----------...................TSTVYSFERV
Q01AL0_OSTTA/12-375-----------------------------AREALERRIEL-----------...................SSATDSVRRA
C1EBB5_MICSR/13-406-----------------------------T.ESASERLEL-----------...................ASPVDALARI
C1MV77_MICPC/13-431-----------------------------G.EILHARPEL-----------...................SSAVDAATRL
C5L3N8_PERM5/23-419-----------------------------L...LRSSPEL-----------...................NSPINDYERL
Q4UC96_THEAN/14-414-----------------------------IPFMISKNAFD-----------............................I
Q4YTZ9_PLABA/82-516-----------------------------IFKSDSMYYSF-----------...................NSDIYNMKYI
Q8IE19_PLAF7/127-560-----------------------------LLKNDYMHYLF-----------...................NTDIYNLKYL
B3L8S4_PLAKH/95-534-----------------------------LLKNDSMHYSF-----------...................NSDLYNLKYI
B6KRJ9_TOXGO/75-514-----------------------------..LSESTEPLV-----------...................SPASASFSSF
A0DGJ7_PARTE/1-357-----------------------------D.VDLTWLPYF-----------...................SNPYTQYSNI
B8C4L2_THAPS/71-579-----------------------------DPIHTWSHLEE-----------ACFWKDNAPSLWMDVAVAHSTVGNSADA.

PF09594

PIME_MYCS2/91-321--------------------------------------------------------------------------------
A0JZG9_ARTS2/73-321--------------------------------------------------------------------------------
Q73YN6_MYCPA/82-326--------------------------------------------------------------------------------
Q2MF52_STRLV/80-314--------------------------------------------------------------------------------
A5ERG5_BRASB/100-323--------------------------------------------------------------------------------
B1K2K9_BURCC/104-334--------------------------------------------------------------------------------
Q1BSC4_BURCA/94-319--------------------------------------------------------------------------------
E0TET4_PARBH/112-335--------------------------------------------------------------------------------
Q1QK36_NITHX/92-360--------------------------------------------------------------------------------
A8LXF0_SALAI/84-339--------------------------------------------------------------------------------
Q1DFL5_MYXXD/100-338--------------------------------------------------------------------------------
Q1LAW9_RALME/87-313--------------------------------------------------------------------------------
Q0RAR1_FRAAA/151-401--------------------------------------------------------------------------------
Q2J8W8_FRASC/88-337--------------------------------------------------------------------------------
Q9HN16_HALSA/81-322--------------------------------------------------------------------------------
A7NFV7_ROSCS/391-632--------------------------------------------------------------------------------
Q1B9V9_MYCSS/90-325--------------------------------------------------------------------------------
Q6N414_RHOPA/73-354--------------------------------------------------------------------------------
Q8KF88_CHLTE/91-313--------------------------------------------------------------------------------
Q9X7Z2_STRCO/66-306--------------------------------------------------------------------------------
Q82C69_STRAW/73-314--------------------------------------------------------------------------------
A6W4J4_KINRD/75-318--------------------------------------------------------------------------------
Q8NNL7_CORGL/75-325--------------------------------------------------------------------------------
A6LI36_PARD8/70-300--------------------------------------------------------------------------------
Q1BEU7_MYCSS/84-314--------------------------------------------------------------------------------
Q2T300_BURTA/118-340--------------------------------------------------------------------------------
Q0S7Q3_RHOSR/72-303--------------------------------------------------------------------------------
O69571_MYCLE/80-324--------------------------------------------------------------------------------
Q0S430_RHOSR/96-330--------------------------------------------------------------------------------
Q1BJ26_BURCA/118-340--------------------------------------------------------------------------------
A0QW28_MYCS2/90-325--------------------------------------------------------------------------------
A9W380_METEP/98-320--------------------------------------------------------------------------------
Q8KF86_CHLTE/520-743--------------------------------------------------------------------------------
A4X3Z6_SALTO/69-305--------------------------------------------------------------------------------
P71970_MYCTU/94-329--------------------------------------------------------------------------------
A7AAB1_9PORP/77-308--------------------------------------------------------------------------------
A0PTL6_MYCUA/80-324--------------------------------------------------------------------------------
A5FWG6_ACICJ/133-359--------------------------------------------------------------------------------
A4QI28_CORGB/146-378--------------------------------------------------------------------------------
Q8EXK5_LEPIN/120-368--------------------------------------------------------------------------------
Q6NG43_CORDI/98-348--------------------------------------------------------------------------------
A4LNL6_BURPE/93-323--------------------------------------------------------------------------------
A4F662_SACEN/84-314--------------------------------------------------------------------------------
A4YMG5_BRASO/52-323--------------------------------------------------------------------------------
A6CF56_9PLAN/79-322--------------------------------------------------------------------------------
Q8FNR9_COREF/132-368--------------------------------------------------------------------------------
Q8FNS1_COREF/85-333--------------------------------------------------------------------------------
A1UKF4_MYCSK/110-340--------------------------------------------------------------------------------
Q2IKA8_ANADE/104-327--------------------------------------------------------------------------------
Q8NNL6_CORGL/93-341--------------------------------------------------------------------------------
A7I755_METB6/60-298--------------------------------------------------------------------------------
Q1AS45_RUBXD/75-307--------------------------------------------------------------------------------
A3PTP0_MYCSJ/72-303--------------------------------------------------------------------------------
Q0SHP5_RHOSR/98-332--------------------------------------------------------------------------------
A1TAY8_MYCVP/79-323--------------------------------------------------------------------------------
Q0KDP9_CUPNH/92-320--------------------------------------------------------------------------------
Q7MTZ4_PORGI/65-295--------------------------------------------------------------------------------
A4XDG1_SALTO/368-608--------------------------------------------------------------------------------
Q73W67_MYCPA/92-327--------------------------------------------------------------------------------
A1KHU9_MYCBP/103-334--------------------------------------------------------------------------------
A0JZG6_ARTS2/141-392--------------------------------------------------------------------------------
A8M762_SALAI/67-302--------------------------------------------------------------------------------
Q2G5A3_NOVAD/106-326--------------------------------------------------------------------------------
Q8A2B6_BACTN/67-296--------------------------------------------------------------------------------
Q0C0G8_HYPNA/93-341--------------------------------------------------------------------------------
Q394F5_BURS3/104-334--------------------------------------------------------------------------------
Q1ITA1_KORVE/92-336--------------------------------------------------------------------------------
Q4JVC2_CORJK/78-310--------------------------------------------------------------------------------
Q5Z2C4_NOCFA/88-323--------------------------------------------------------------------------------
Q0S1F1_RHOSR/88-319--------------------------------------------------------------------------------
Q7UFG8_RHOBA/89-337--------------------------------------------------------------------------------
Q5YR74_NOCFA/76-310--------------------------------------------------------------------------------
Q82B65_STRAW/52-287--------------------------------------------------------------------------------
A6WEV4_KINRD/63-293--------------------------------------------------------------------------------
Q6A9X9_PROAC/81-311--------------------------------------------------------------------------------
A4JSX6_BURVG/118-340--------------------------------------------------------------------------------
Q46XY5_CUPPJ/144-366--------------------------------------------------------------------------------
B2U6Q0_RALPJ/105-334--------------------------------------------------------------------------------
Q8A2B7_BACTN/70-300--------------------------------------------------------------------------------
A1K2E7_AZOSB/76-322--------------------------------------------------------------------------------
Q1LQN5_RALME/107-328--------------------------------------------------------------------------------
Q82AJ1_STRAW/66-309--------------------------------------------------------------------------------
A4F642_SACEN/68-304--------------------------------------------------------------------------------
Q6NEL0_CORDI/90-330--------------------------------------------------------------------------------
Q89QR1_BRAJA/100-368--------------------------------------------------------------------------------
Q4JVV2_CORJK/84-315--------------------------------------------------------------------------------
A5ESS8_BRASB/89-311--------------------------------------------------------------------------------
A4TCS8_MYCGI/75-310--------------------------------------------------------------------------------
Q5YTA9_NOCFA/80-311--------------------------------------------------------------------------------
Q73WN6_MYCPA/105-337--------------------------------------------------------------------------------
Q8FNS2_COREF/71-313--------------------------------------------------------------------------------
A4Z0F4_BRASO/98-322--------------------------------------------------------------------------------
Q1AX69_RUBXD/44-303--------------------------------------------------------------------------------
Q5YQC7_NOCFA/78-313--------------------------------------------------------------------------------
Q8FPI8_COREF/95-327--------------------------------------------------------------------------------
Q6M3Q3_CORGL/95-331--------------------------------------------------------------------------------
B2U6P6_RALPJ/116-345--------------------------------------------------------------------------------
Q1BEU6_MYCSS/107-340--------------------------------------------------------------------------------
Q0B1Z4_BURCM/118-340--------------------------------------------------------------------------------
Q2J4C1_FRASC/151-408--------------------------------------------------------------------------------
Q2IYK2_RHOP2/73-354--------------------------------------------------------------------------------
A8L2W5_FRASN/98-313--------------------------------------------------------------------------------
A3TJ63_9MICO/77-315--------------------------------------------------------------------------------
Q133X5_RHOPS/73-354--------------------------------------------------------------------------------
Q4JU29_CORJK/82-316--------------------------------------------------------------------------------
Q2CA47_9RHOB/80-334--------------------------------------------------------------------------------
A6LBC6_PARD8/70-301--------------------------------------------------------------------------------
A0K2K9_ARTS2/112-358--------------------------------------------------------------------------------
Q0BA39_BURCM/102-332--------------------------------------------------------------------------------
Q20YY7_RHOPB/103-326--------------------------------------------------------------------------------
A4T4C3_MYCGI/71-305--------------------------------------------------------------------------------
Q1LQN6_RALME/104-332--------------------------------------------------------------------------------
A1R1N0_ARTAT/81-341--------------------------------------------------------------------------------
Q0B8R5_BURCM/84-310--------------------------------------------------------------------------------
A0NV37_9RHOB/121-344--------------------------------------------------------------------------------
Q2K4Q8_RHIEC/84-305--------------------------------------------------------------------------------
Q0FSE7_9RHOB/90-316--------------------------------------------------------------------------------
Q2J920_FRASC/92-305--------------------------------------------------------------------------------
A4YMG3_BRASO/104-327--------------------------------------------------------------------------------
A1RC95_ARTAT/101-341--------------------------------------------------------------------------------
Q82GI4_STRAW/88-314--------------------------------------------------------------------------------
Q135L9_RHOPS/90-313--------------------------------------------------------------------------------
A7I7Y5_METB6/97-335--------------------------------------------------------------------------------
A3XXU2_9VIBR/89-316--------------------------------------------------------------------------------
Q53IC1_STRGR/68-304--------------------------------------------------------------------------------
Q8FLP5_COREF/222-454--------------------------------------------------------------------------------
Q3L9S4_RHOE4/54-285--------------------------------------------------------------------------------
A4FR42_SACEN/78-325--------------------------------------------------------------------------------
A3S009_RALSL/111-339--------------------------------------------------------------------------------
Q023J8_SOLUE/86-296--------------------------------------------------------------------------------
Q9CBX0_MYCLE/105-336--------------------------------------------------------------------------------
A4FGU5_SACEN/82-312--------------------------------------------------------------------------------
A1U9Z3_MYCSK/75-305--------------------------------------------------------------------------------
Q82NJ1_STRAW/66-299--------------------------------------------------------------------------------
Q6NF60_CORDI/70-290--------------------------------------------------------------------------------

PF03155

ALG8_HUMAN/19-514-----------------------------......TDFEV------------------------------HRNWLAITHS
ALG8_SCHPO/12-497-----------------------------......TDFEV------------------------------HRNWLAITHS
ALG6_HUMAN/12-491-----------------------------GKPPMFGDYEA------------------------------QRHWQEITFN
ALG6_DROME/10-465-----------------------------DSPPMHGDYEA------------------------------QRHWQEITVN
ALG8_YEAST/49-570-----------------------------......TDFDV------------------------------HRNWLAITNK
ALG6_YEAST/44-531-----------------------------GSPPLYGDFEA------------------------------QRHWMEITQH
ALG6_CAEEL/54-494-----------------------------SQPPMYGDYEA------------------------------QRHWMEITVN
ALG6_SCHPO/33-487-----------------------------NTPPMYGDFEA------------------------------QRHWMELTLH
ALG8_DROME/10-485-----------------------------......TDFEV------------------------------HRNWLAITHS

PF01277

OLEO2_ORYSJ/32-149--------------------------------------------------------------------------------
OLEO2_ARATH/50-167--------------------------------------------------------------------------------
O04925_SESIN/24-138--------------------------------------------------------------------------------
OLEO1_SOYBN/52-169--------------------------------------------------------------------------------
OLEO1_ORYSJ/28-138--------------------------------------------------------------------------------
OLEO1_PRUDU/22-132--------------------------------------------------------------------------------
OLEO2_BRANA/41-151--------------------------------------------------------------------------------
O82308_ARATH/49-159--------------------------------------------------------------------------------
OLNB6_BRANA/26-143--------------------------------------------------------------------------------
Q39273_BRARP/16-133--------------------------------------------------------------------------------
Q43123_DAUCA/35-149--------------------------------------------------------------------------------
OLEO6_GOSHI/39-156--------------------------------------------------------------------------------
OLEO_HELAN/32-149--------------------------------------------------------------------------------
Q39952_HELAN/39-155--------------------------------------------------------------------------------
OLEO4_ARATH/48-165--------------------------------------------------------------------------------

PF13231

A7JBB4_FRATL/52-209-------------------------------------------------------------------------------K
A4IZH3_FRATW/52-209-------------------------------------------------------------------------------K
Q65D63_BACLD/64-222-------------------------------------------------------------------------------D
B6BJT1_9PROT/53-210-------------------------------------------------------------------------------D
C6VYQ4_DYAFD/49-207-------------------------------------------------------------------------------S
B4UIB9_ANASK/72-232-------------------------------------------------------------------------------D
A3WX64_9BRAD/52-213-------------------------------------------------------------------------------D
A3WSX1_9BRAD/82-243-------------------------------------------------------------------------------D
B9QSP7_9RHOB/49-210-------------------------------------------------------------------------------K
B8FAL6_DESAA/67-226-------------------------------------------------------------------------------S
D5UN54_TSUPD/63-221-------------------------------------------------------------------------------D
A5N5X9_CLOK5/66-224-------------------------------------------------------------------------------D
A7BVV3_9GAMM/62-229-------------------------------------------------------------------------------E
D1CDY5_THET1/40-195-------------------------------------------------------------------------------V
Q1MLH5_RHIL3/48-207-------------------------------------------------------------------------------S
C6PVM5_9CLOT/66-224-------------------------------------------------------------------------------D
B1KTS9_CLOBM/66-224-------------------------------------------------------------------------------D
C6PQH7_9CLOT/67-225-------------------------------------------------------------------------------D
A3JRQ6_9RHOB/50-209-------------------------------------------------------------------------------S
Q0SVE9_CLOPS/70-234-------------------------------------------------------------------------------D
D8JQE0_HYPDA/66-226-------------------------------------------------------------------------------D
D7DXP9_NOSA0/73-233-------------------------------------------------------------------------------H
D1PQJ0_9FIRM/71-229-------------------------------------------------------------------------------Y
B9JC29_AGRRK/54-216-------------------------------------------------------------------------------S
C6E5J9_GEOSM/42-185-------------------------------------------------------------------------------G
D5SV69_PLAL2/52-212-------------------------------------------------------------------------------K
Q3SN70_NITWN/82-243-------------------------------------------------------------------------------D
Q83DW3_COXBU/61-221-------------------------------------------------------------------------------K
B4CZL5_9BACT/47-209-------------------------------------------------------------------------------S
D5SQG0_PLAL2/83-244-------------------------------------------------------------------------------S
Q2NGP0_METST/64-225-------------------------------------------------------------------------------D
Q97GW4_CLOAB/66-224-------------------------------------------------------------------------------D
Q1QI25_NITHX/77-238-------------------------------------------------------------------------------D
F0Q666_ACIAP/58-215-------------------------------------------------------------------------------K
B9XGL1_9BACT/266-427-------------------------------------------------------------------------------S
A3DI20_CLOTH/61-226-------------------------------------------------------------------------------N
A5FIR4_FLAJ1/49-207-------------------------------------------------------------------------------S
D2R091_PIRSD/75-235-------------------------------------------------------------------------------K
D1RGG4_LEGLO/47-206-------------------------------------------------------------------------------D
A1TJR6_ACIAC/58-215-------------------------------------------------------------------------------K
B7ACT9_9BACE/61-222-------------------------------------------------------------------------------Y
E6VI19_RHOPX/75-235-------------------------------------------------------------------------------K
B6J193_COXB2/61-221-------------------------------------------------------------------------------K
D5WL10_BURSC/70-234-------------------------------------------------------------------------------K
D1Z262_METPS/82-248-------------------------------------------------------------------------------V
A4T8Q0_MYCGI/81-241-------------------------------------------------------------------------------D
A9KCN2_COXBN/61-221-------------------------------------------------------------------------------K
D2ALV5_FRATE/52-209-------------------------------------------------------------------------------K
D3HR46_LEGLN/60-219-------------------------------------------------------------------------------D
A3IU57_9CHRO/67-225-------------------------------------------------------------------------------D
B4U611_HYDS0/73-230-------------------------------------------------------------------------------S
C6B1B7_RHILS/48-207-------------------------------------------------------------------------------S
B9AES9_METSM/66-231-------------------------------------------------------------------------------Y
Q97MK3_CLOAB/67-225-------------------------------------------------------------------------------D
A7GA58_CLOBL/66-224-------------------------------------------------------------------------------D
B4AQA7_FRANO/52-209-------------------------------------------------------------------------------K
D2ZPT9_METSM/66-231-------------------------------------------------------------------------------Y
A0Q5B8_FRATN/52-209-------------------------------------------------------------------------------K
Q5X5F8_LEGPA/45-205-------------------------------------------------------------------------------D
A5N7W9_CLOK5/72-230-------------------------------------------------------------------------------D
Q89E32_BRAJA/157-318-------------------------------------------------------------------------------D
Q5NHK7_FRATT/52-209-------------------------------------------------------------------------------K
A5HYJ2_CLOBH/66-224-------------------------------------------------------------------------------D
Q2YBZ2_NITMU/191-351-------------------------------------------------------------------------------D
A6LZW3_CLOB8/77-235-------------------------------------------------------------------------------I
C4V6B9_9FIRM/60-218-------------------------------------------------------------------------------D
D9SE28_GALCS/50-205-------------------------------------------------------------------------------D
A5EQY0_BRASB/42-203-------------------------------------------------------------------------------D
B9E1D0_CLOK1/82-240-------------------------------------------------------------------------------D
C1FRH4_CLOBJ/66-224-------------------------------------------------------------------------------D
A7FQV4_CLOB1/66-224-------------------------------------------------------------------------------D
A9ZIV6_COXBE/61-221-------------------------------------------------------------------------------K
Q2Y860_NITMU/404-564-------------------------------------------------------------------------------D
A6LU67_CLOB8/66-224-------------------------------------------------------------------------------D
Q14J09_FRAT1/52-209-------------------------------------------------------------------------------K
D5U4D2_BRAM5/61-220-------------------------------------------------------------------------------D
B8FN25_DESAA/52-212-------------------------------------------------------------------------------D
A0NV08_9RHOB/41-201-------------------------------------------------------------------------------D
Q3SQJ3_NITWN/52-213-------------------------------------------------------------------------------D
B5ZQB2_RHILW/48-207-------------------------------------------------------------------------------S
B1IEW1_CLOBK/66-224-------------------------------------------------------------------------------D
B9DZF8_CLOK1/66-224-------------------------------------------------------------------------------D
Q89IJ6_BRAJA/52-213-------------------------------------------------------------------------------D
Q5ZVN3_LEGPH/45-205-------------------------------------------------------------------------------D
A7JKU9_FRANO/52-209-------------------------------------------------------------------------------K
C7HDF1_CLOTM/37-202-------------------------------------------------------------------------------N
A4YN48_BRASO/43-204-------------------------------------------------------------------------------D
B3E0D1_METI4/59-219-------------------------------------------------------------------------------T
Q5WWU1_LEGPL/45-205-------------------------------------------------------------------------------D
Q46CM8_METBF/81-238-------------------------------------------------------------------------------I
C6YNI6_FRATL/52-209-------------------------------------------------------------------------------K
A7G0J8_CLOBH/66-224-------------------------------------------------------------------------------D
B6J844_COXB1/61-221-------------------------------------------------------------------------------K
B9XAA6_9BACT/62-222-------------------------------------------------------------------------------D
A7JGP5_FRANO/52-209-------------------------------------------------------------------------------K
C9LD10_9BACT/72-232-------------------------------------------------------------------------------Y
Q13A52_RHOPS/52-213-------------------------------------------------------------------------------D
A9NC67_COXBR/61-221-------------------------------------------------------------------------------K
A5ULR9_METS3/66-231-------------------------------------------------------------------------------Y
A5IBP9_LEGPC/45-205-------------------------------------------------------------------------------D
Q643D0_STRHY/35-195-------------------------------------------------------------------------------D
Q0AIT0_NITEC/408-568-------------------------------------------------------------------------------D
B1Q920_CLOBO/66-224-------------------------------------------------------------------------------D
D6SQ65_9DELT/50-203-------------------------------------------------------------------------------D
D1NNY9_CLOTM/61-226-------------------------------------------------------------------------------N
A9DP59_9FLAO/58-220-------------------------------------------------------------------------------I

PF02366

PMT3_YEAST/62-306-----------------------------GKFGSYYLRHE-----------FYHDVH..PPLGKMLVGLSGY.....LAG
POMT1_HUMAN/20-289-----------------------------GQYISFYMKQI-----------FFLDDS.GPPFGHMVLALGGY.....LGG
P73015_SYNY3/18-249-----------------------------AKFASDYWLGN-----------DFFPSH..PPLSHYLIALAMG.....LGQ
Y1220_AQUAE/1-229-----------------------------NES..FYADSA-----------KNMLKS..GEFLTPVYNGEIR.....LNK
ARNT_SALTY/3-237-----------------------------DET..RYAEIS-----------REMLAS.GDWIVPHFL..GLR.....YFE
Y1704_AQUAE/1-215-----------------------------DEGRNFYATLH-----------MLRTGD..FIVPYYNCN...Y.....RFE
P73065_SYNY3/8-275-----------------------------TVPAWDQSNHL-----------SYGLEYLQALRSPEFLSGEWWRSFWMLSP
PMT1_YEAST/54-297-----------------------------GGFASQYIRGT-----------YFMDVH..PPLAKMLYAGVAS.....LGG
PMT1_CANAL/70-313-----------------------------GGFARKYILGT-----------FFMDVH..PPLAKMLFGAVGA.....IGG
PMT1_SCHPO/38-284-----------------------------YNYAVDYVNNK-----------LLMDVY..PPLGKLLFSLVAA.....LTG
PMT2_YEAST/69-313-----------------------------GKFGSYYLRHE-----------FYHDVH..PPLGKMLVGLSGY.....LAG
POMT2_HUMAN/62-306-----------------------------GKMGSYYINRT-----------FFFDVH..PPLGKMLIGLAGY.....LSG
PMT5_YEAST/50-293-----------------------------GTFVSQYVNNI-----------FFTDVH..PPLVAMLYATVSS.....VFG
P73712_SYNY3/7-243-----------------------------DRTEARYAEIG-----------RKMAET..GDWITPQIDYGVP.....FWG
POMT1_DROME/178-421-----------------------------GKYISMYMRNI-----------FFFDQH..PPLGKQLIAGLVS.....LAG
PMT4_YEAST/57-305-----------------------------GKFASYYLERS-----------YFFDVH..PPFAKMMIAFIGW.....LCG
PMT4_SCHPO/63-310-----------------------------GKFASYYLQGK-----------YFFDLH..PPFAKLLLALVAK.....LAG
ARNT_ECOLI/3-237-----------------------------DET..RYAEIS-----------REMLAS.GDWIVPHLL..GLR.....YFE
Q9UVB5_CANAX/96-357-----------------------------GKFGSQYLKRQ-----------FYFDVH..PPLGKLLIGLSGY.....LAD
Q9V2H8_PYRAB/2-224-----------------------------NSL..TYDGAL-----------YIDIARNLAKDLGNFTYQGIY.....MMY
O57832_PYRHO/2-228-----------------------------NSL..TYDGAL-----------YINIARSLTKSVTSFTYQGIY.....MMY
PMT6_YEAST/70-314-----------------------------GKFGSYYIKHE-----------YYHDVH..PPLGKMLIALSEW.....MAG

PF11028

Q0VAA1_HUMAN/52-218-------------------------------------------------------------------------------A
Q1AWM2_RUBXD/47-207-------------------------------------------------------------------------------A
A4AMM0_MARSH/37-218-------------------------------------------------------------------------------G
A6EKQ0_9SPHI/34-217-------------------------------------------------------------------------------V
B3EAC9_GEOLS/36-215-------------------------------------------------------------------------------A
Q1AXH9_RUBXD/53-213-------------------------------------------------------------------------------P
A5UPI3_ROSS1/45-212-------------------------------------------------------------------------------P
A0LXN9_GRAFK/37-218-------------------------------------------------------------------------------G
A1ZG62_9BACT/40-223-------------------------------------------------------------------------------P
A3U548_CROAH/37-218-------------------------------------------------------------------------------G
B5EH69_GEOBB/37-216-------------------------------------------------------------------------------A
Q650J9_BACFR/35-217-------------------------------------------------------------------------------G
A4BY73_9FLAO/37-218-------------------------------------------------------------------------------G
A9AXK7_HERA2/53-217-------------------------------------------------------------------------------P
A1ARZ9_PELPD/68-247-------------------------------------------------------------------------------A
Q11YB8_CYTH3/35-217-------------------------------------------------------------------------------P
A2TUA8_9FLAO/37-219-------------------------------------------------------------------------------G
U679_DICDI/139-316-------------------------------------------------------------------------------A
Q74D30_GEOSL/39-218-------------------------------------------------------------------------------A
A1BIY5_CHLPD/34-214-------------------------------------------------------------------------------P
A3XHT8_LEEBM/37-219-------------------------------------------------------------------------------G
A1ZGE8_9BACT/35-219-------------------------------------------------------------------------------P
Q3AU50_CHLCH/34-214-------------------------------------------------------------------------------P
A6GWD8_FLAPJ/36-227-------------------------------------------------------------------------------G
A6LGG9_PARD8/35-217-------------------------------------------------------------------------------G
Q39VU9_GEOMG/36-214-------------------------------------------------------------------------------A
A7NFU7_ROSCS/53-220-------------------------------------------------------------------------------P
Q1AXH6_RUBXD/44-204-------------------------------------------------------------------------------P
Q0YR30_9CHLB/34-214-------------------------------------------------------------------------------P
Q8KAY9_CHLTE/41-221-------------------------------------------------------------------------------P
Q7MT47_PORGI/37-229-------------------------------------------------------------------------------G
Q2S0T5_SALRD/34-228-------------------------------------------------------------------------------M
A5G4Z0_GEOUR/37-216-------------------------------------------------------------------------------A
A6EJD1_9SPHI/35-210-------------------------------------------------------------------------------G
A5ZCC1_9BACE/37-219-------------------------------------------------------------------------------G
B3ENQ9_CHLPB/34-214-------------------------------------------------------------------------------P
Q1VT32_9FLAO/37-218-------------------------------------------------------------------------------G
A9AUQ8_HERA2/39-195-------------------------------------------------------------------------------A
A3J436_9FLAO/37-218-------------------------------------------------------------------------------G
B4S581_PROA2/34-214-------------------------------------------------------------------------------P
A4CGC2_ROBBH/37-219-------------------------------------------------------------------------------A
A6EQ18_9BACT/37-218-------------------------------------------------------------------------------G
A3I1E4_9BACT/35-218-------------------------------------------------------------------------------P
Q26HV6_FLABB/36-213-------------------------------------------------------------------------------G
Q3B6C0_PELLD/34-214-------------------------------------------------------------------------------P

PF02516

STT3A_HUMAN/17-484-----------------------------HEFDPYFNYRT-----------TRFLAEEGF........YKFHNWFDDRAW
STT3_CAEEL/19-506-----------------------------HEFDPWFNYRA-----------THHMVQHGF........YKFLNWFDERAW
STT3_YEAST/15-475-----------------------------HEFDPWFNYRA-----------TKYLVNNSF........YKFLNWFDDRTW
STT3_SCHPO/23-509-----------------------------HEFDPWFNFRA-----------SKILVEQGF........YNFLNWFDERSW
O30195_ARCFU/14-430-----------------------------..YDPYYHMRL-----------VEAIVLEGY........RPSFDYYIN...
O29918_ARCFU/7-427-----------------------------..YDSYYHMRL-----------VEVMVKESF........RPDYDYYIN...
O29867_ARCFU/18-493-----------------------------..NDPWYYYRL-----------IENTIHN..........FPHRIWFDPFTY
O86154_CAMJU/9-478-----------------------------SEFNEYFFNNQ-----------LMIISNDGY.......AFAEGARDMIAGF
O27660_METTH/24-582-----------------------------SEMDSYYNYRL-----------TMNYLTKGIMG...DTLVDGKPYDLHS.Y
O27928_METTH/21-478-----------------------------YEPDSYYNYRL-----------TANILDHGHPG...DKIINGTPWDLHSN.
O26520_METTH/3-426-----------------------------YDMDSYYNLRL-----------ASNLLNEGE........LSEGGWDRYS.Y
O27920_METTH/13-461-----------------------------QESDSYYNYRL-----------TENLAIRGIPG...DAVIGGKIWDLHS.Y
Y1525_METJA/33-650-----------------------------LALDPYYYLRL-----------SENLYNNGHCGDTIKVVDGKETPYDLYQY
O74088_PYRHO/25-586-----------------------------PDPDTFYHFEI-----------YKLVLKEG...........LPRYYPMS.D
O58981_PYRHO/1-510-----------------------------LGYDPYFHLAY-----------IEEVNKVG...........KWINFLTFAG

PF09852

A6W4W4_KINRD/38-458-----------------------------SWASGR.LPYS-----------AIRGL.................PLLGEHF
A3YXU8_9SYNE/20-501-----------------------------SGLHGH.PFES-----------TLSSQLSTNVIH.AGEPPSLGYHRLGQHF
D1N9S5_9BACT/168-612-----------------------------RLAFAENRSFA-----------DF....................LAVAGHW
Q119E7_TRIEI/30-487-----------------------------LISQGL.PPIS-----------SFLEV.................HHLGNHA
Q3B035_SYNS9/33-452-----------------------------LIGRGL.EPVS-----------SMEHV.................HVLADHG
A3IP01_9CHRO/25-454-----------------------------LISQGK.PPIV-----------SFSED.................HILGDHA
A4CQE1_SYNPV/54-483-----------------------------LIGSGR.DPIS-----------SMEDV.................HVLADHG
Q1CZA2_MYXXD/39-471-----------------------------RLSLAEPNPWI-----------SARQV.................FIFNDHF
A7NHC7_ROSCS/32-505-----------------------------SATRGEPLLYS-----------RPEGSRA...............SRLAGHV
A2CD09_PROM3/29-458-----------------------------LASQGL.PPYS-----------SMEGV.................HLLADHG
Q7U446_SYNPX/31-511-----------------------------NCLQGH.PFES-----------TLSSQLSTNVIH.AGELPSVDYERLGQHF
Q05VV8_9SYNE/33-513-----------------------------STAQGR.PFES-----------SLSSVLSGAVAI.GGALPWVDYLHLGQHA
Q2JTX8_SYNJA/28-474-----------------------------LISRGE.VPFS-----------TIRGI.................HILGDHA
A5GS07_SYNR3/40-521-----------------------------NSGHGR.WFAS-----------SLSSQLSSAVLH.GGLAPDPSYQRLGQHY
A5Z658_9FIRM/175-610-----------------------------NMRQTG.SVAT-----------TLERNRLL..............SHFGVHF
Q9V170_PYRAB/28-443-----------------------------STLNGK.FMYN-----------TVEAQLYSAP............NHFAVHF
Q684B0_9VIRU/32-510-----------------------------LTAQKL.....-----------......................AHLNNPL
D1N6C4_9BACT/168-601-----------------------------RLAFGENRSWS-----------DF....................LAVAGHW
O59243_PYRHO/26-442-----------------------------SLSGGK.LFYN-----------TVEFQLYNVQ............THFGVHF
Q8U0H2_PYRFU/26-441-----------------------------SLSEGK.LFYN-----------TVEFQLYEVH............THFGVHF
Q119E6_TRIEI/27-490-----------------------------LISQGK.SPIS-----------SFLGY.................HHLGNHA
Q82RR9_STRAW/82-508-----------------------------SYAHGH.LPVA-----------ELKGP....GF...........PLLGDHF
Q4J6X7_SULAC/32-488-----------------------------STIYGGKIFYD-----------AANFLSFGAL............SGLAIHP
Q3AH29_SYNSC/39-458-----------------------------LIGSGA.APIS-----------SMEQV.................HVLADHG
Q053B8_LEPBL/83-522-----------------------------PTIEGK.FFQT-----------QYYGPNENA.............NFLSHHM
A5URL3_ROSS1/78-571-----------------------------NTTQGRFLEIS-----------HYRHTD................HLWGMDF
Q4J7K9_SULAC/43-493-----------------------------SASQGK.PFYD-----------TINLLFRGIP............YGLAIHP
A3Z9V0_9SYNE/14-434-----------------------------LIGSGH.APIS-----------SMENV.................HVLADHG
A6C4J1_9PLAN/210-689-----------------------------NFSHGK.GFRS-----------YLDQG.................LFWGEHI
Q9HK92_THEAC/39-557-----------------------------NTMHGH.VMYA-----------NPLLI.................NSFSEHF
A0YNX7_LYNSP/16-470-----------------------------LISQGK.PPIS-----------SFLNI.................HHMGNHA
A5GNZ8_SYNPW/38-520-----------------------------NSLHGR.WFES-----------SLSSQLSTNVVH.AGELPFVGYERLGQHF
Q0I6Z8_SYNS3/30-459-----------------------------QISRGL.EPRS-----------SMLGL.................HHMGNHG
A7BAH1_9ACTO/37-495-----------------------------AYSRFE.APIV-----------PIKGPGY...............NLLGDHF
Q4J7K8_SULAC/16-462-----------------------------STLHGR.IFYD-----------SPNFTYYGVI............SGLGIHP
A5GR01_SYNR3/37-521-----------------------------SALGGR.PFES-----------TLASELSSPVLLDKTALPTLGYLHLGQHF
A0YZD5_LYNSP/29-458-----------------------------LLSQGQ.KPFV-----------TFRGL.................HILGDHG
Q97AA6_THEVO/27-454-----------------------------HALSTRPIV..-----------...........................YW
A0YTH5_LYNSP/32-516-----------------------------NNSHGR.FFQS-----------SLSSALSTNVVH.QGEYPDVSYHRLGQHF
A3IHC1_9CHRO/29-461-----------------------------LISQGK.IPIS-----------SFLNI.................HILGDHA
Q8F2H0_LEPIN/76-512-----------------------------PTTDGN.FFQT-----------QYYGSHENA.............NFLSHHM
P73520_SYNY3/35-464-----------------------------LISQGE.YPRV-----------SFRGF.................HILGDHA
O58892_PYRHO/28-449-----------------------------TAAEGK.LFYN-----------TPEAQGLGWELPSS........SHFGVHF
Q063N9_9SYNE/10-492-----------------------------NSLDGH.WLES-----------TLSSQLSTNVIH.DGAVPSVGYARLGQHF
Q7U443_SYNPX/37-518-----------------------------NGLRGH.PFES-----------TLSSQLSTNVIH.SGELPALGYHRLGQHF
Q3AH28_SYNSC/37-517-----------------------------ATAQGR.PFES-----------SLSSVLSGAVVV.GDGLPSIDYLHLGQHA
A4CQE4_SYNPV/18-500-----------------------------NSLHGH.WFES-----------SLSSQLSTNVVH.AGQLPFVGYERLGQHF
Q7VDJ5_PROMA/39-469-----------------------------LQSVGE.PPYS-----------SMTGL.................HLMADHG
A5V1J1_ROSS1/34-511-----------------------------STLRGEPLIVT-----------SPQGNV................SRLAGHF
Q7U444_SYNPX/29-448-----------------------------LISQGL.PPIS-----------SMEHV.................HVLADHG
A0YNX8_LYNSP/40-494-----------------------------LISQGK.PPIS-----------SILGF.................HHMGNHG
Q10XG3_TRIEI/32-516-----------------------------NSMHGH.FFQS-----------SLSSALSTNVVH.QGQVSEVYYHRLGQHF
A2CD11_PROM3/38-518-----------------------------STARGH.FFES-----------SLSSELSAAVAN.QDALPSIDYLHLGQHA

PF03901

GPI10_TRYBB/4-432--------------------------------TVE.APDE-----------WWQSTEVA.YNMVFGKGHLPWEW..RYGL
SMP3_YEAST/6-401--------------------------------YI..HPDE-----------HFQCIEILAMQFMKVKGTIPWEFKSKFAA
GPI10_SCHPO/4-414--------------------------------TFF.QPDE-----------FYQSLEVA.HHFIFRYGFLTWEW..TSAI
ALG9_SCHPO/16-438--------------------------------ID..DCDE-----------VYNYWEPL.HYLLYGYGLQTWEYSPEYAI
ALG9_ARATH/48-451--------------------------------IH..DCDE-----------VFNYWEPL.HYILYKSGFQTWEYSSNFAL
Q9LEQ5_ARATH/40-428--------------------------------TYF.NPDE-----------HWQSLEVA.HRTIFGYGYMTWEW..KRGI
ALG9_YEAST/10-414--------------------------------IS..DCDE-----------TFNYWEPL.NLLVRGFGKQTWEYSPEYSI
ALG12_CAEEL/6-405--------------------------------....KVEE-----------SFNVQATHDLMFHLPTNLSNYDHSQFPGV
GPI10_YEAST/16-484--------------------------------TFF.QADE-----------FWQALEPA.HWKAFKYGELTWEW..KFGV
SMP3_SCHPO/9-412--------------------------------SSYIHPDE-----------HLQSFQIFANKLFGWKVELPWEFTTKKPI
Q9VBV8_DROME/75-498--------------------------------IA..DCDE-----------TFNYWEPL.HYIINGHGLQTWEYSPQFGL
PIGB_HUMAN/62-449--------------------------------TSF.VPDE-----------YWQSLEVS.HHMVFNYGYLTWEW..TERL
PIGB_DROME/5-396--------------------------------TYY.VPDE-----------YWQSLEVA.HKLTFGYGYLTWEW..VQGI
ALG9_MOUSE/60-482--------------------------------IS..DCDE-----------TFNYWEPT.HYLIYGKGFQTWEYSPVYAI
PIGZ_DROME/18-541--------------------------------LGYVHPDE-----------FFQSVEVMTGDHFRLEHTRTWEFNNSLPV
YTH3_CAEEL/55-472--------------------------------IN..DCDE-----------VYNYWEPL.HLFLYGEGFQTWEYSPVYAI

PF09913

Q1JHK3_STRPD/71-454.-------------------------...RISKDVDKLIK-----------QSGKTFITSNLKATKHSTREYSYPYIKGT
Q1MP06_LAWIP/21-414.-------------------------...SIRGDIPFHKE-----------HKFDYKTLYHHLTTPINERETTFITFSTQ
A4AI52_9ACTN/32-415.-------------------------...VLQSSCYAFYS-----------DESAACQSR.LDYNSDRLVETNRGNFVGA
A4VVV9_STRSY/36-414.-------------------------...AADFTYSEPEI-----------HAVDSTEYSSLFTKIRDFSKDKLSIDFS.
A5CTF3_CLAM3/34-413.-------------------------...SDPSACARHDG-----------DRTADCAPGFPAGDAADRIVSTETSAGL.
A2RHT4_LACLM/28-400.-------------------------...LPFTTVTKMMK-----------EGTYFKNFFETKLPVISKSKVADKRALGT
A0LS06_ACIC1/16-395.-------------------------...QGNPACIAFQP-----------EQSAACLPRWTAQSGLTEALTYVGG....
Q5Z3D8_NOCFA/116-537H-------------------------...DYQENPEEPGA-----------MVADPGAYERLRSADIGTELRPIWFTNTA
Q5M3E5_STRT2/28-432.-------------------------...QSMRTISKSLG-----------EPTSEVISFHWSNGFKDISDTRIVKTKDG
A7BEG1_9ACTO/22-395.-------------------------...KEYVTCYAFDH-----------DNSALCTLNASDEELAPTLRWDDGN....
A5UMR8_METS3/71-461.-------------------------...KTIASVTTFFD-----------NAGANVFNTHADDDKIDHTPSYFNSAFAQ
A1W3H2_ACISJ/39-436.-------------------------...ARWANSHFERS-----------SAFSLSQARQVSAALADNEGMARASFPSS
A6BHE0_9FIRM/204-596.-------------------------...DSNMGLYFIRE-----------EYPTKESYIRFVKGALGKNSDTITTKEGL
Q032N2_LACLS/44-428.-------------------------...DQFVNQKPAYQ-----------NGDYFKKYFETEVQRMPMSKLPRSTVYPK
Q6AGK9_LEIXX/24-391.-------------------------...VANGSCYAFKP-----------HESASCQ.....GSATRARTTDRGNFHGL
Q03JM9_STRTD/69-443.-------------------------...SVFAYDSLRNP-----------AKKDKNYWLNVEHKKSKISGVKTG.....
O05375_AGGAC/17-398.-------------------------...MKMLSIYEGIP-----------YRSENKVTHFLENEAQNVAWEKEYILDES
A5UN71_METS3/84-467.-------------------------...YIQDYFFEMNQ-----------AKAGTTVIMYDFNKPINDSWGYWPASTN.
A3CP01_STRSV/1-366.-------------------------...TYKWMDKIPST-----------PNVSPAEYKQLFSEKIDLAQEEFTFGFN.
A7VGI6_9CLOT/233-636.-------------------------...KMEDMLANGVE-----------SNSYYQLAHHTFERPDDQELIAVPYVDSS
Q83YS3_STRGN/66-446.-------------------------...LISEDFFDIYD-----------QIKSPLTKTNLFNEGQTDKKVDFGRTTDY
Q01XM3_SOLUE/38-442K-------------------------PR.ELVRDLIPHPG-----------SVSPEVPSLNLGNLDVRHRWLPWSIIGSS
Q83H24_TROWT/46-427H-------------------------GKGSRHGNLYCFLN-----------GVSPECQNKWLGNTDHKMQDTGRVNFGNN
Q9CIZ8_LACLA/68-463.-------------------------...DTLRNPAAEHA-----------KNGFPNKFFSDEHEASTYSGKKIG.....
Q2JAW9_FRASC/81-503.-------------------------...AAGLPCDLFRD-----------WVSVACLDRPRPRPPATRALSYVGT....
A2V6Y4_9NOCA/100-508G-------------------------...DYNRKPVEPER-----------FAADPVAYRLLGSAPVTSATKPMWFTNTA
Q0RGM1_FRAAA/18-412.-------------------------...RAGFPCNLFRN-----------WLSVSCLDRPHSRPPATRALSYVGT....
Q1N997_9SPHN/34-430.-------------------------...IHRIDFPTDVP-----------ATVRVFDVDQLRRSAAADARRTGTDFADF
A7BEE9_9ACTO/34-400.-------------------------...TSHAQCEAFSP-----------ERSHACIKDYSDDTMFPSYRYNDGQ....
A5G180_ACICJ/39-445.-------------------------...VLRASLSEFRP-----------LRHRLLTPADRARAAAIPWSSGPPVYFVA
Q97N14_CLOAB/17-411.-------------------------...NLSEDIKAKSN-----------KKQDINKIKYYLNLPLNKNKVAFNDFRSA
A4AI53_9ACTN/26-395.-------------------------...VANPACFAYDA-----------DESAACQDR.IDFTAGATEETERGNFAGG
A5UKJ8_METS3/70-455.-------------------------...INNYFHQMTYS-----------QGSTLLDNTSFMHQDITHCKSFFTSVFSQ
A3XYG2_9VIBR/1-400.-------------------------...IELGYLPIAFK-----------PDMKVDTQLSLVLNSIEWGGNSWGDTRNV

PF04922

ALG10_YEAST/63-458-------------------------------------------------------------LTYLKGKWT..QWDPKITT
O02332_CAEEL/40-377-------------------------------------------------------------RSYCSGNYS...WNPLITT
Q9LZ85_ARATH/22-450-------------------------------------------------------------QQYCNGNFR..SWDPMITT
AG10B_RAT/28-428-------------------------------------------------------------QRYCEGRFSLSQWDPMITT
ALG10_SCHPO/24-398-------------------------------------------------------------QRFCRKDW...DWDPAITT

PF07220

D4HSK9_LEPIR/4-673I-------------------------SYYS.NIFKSIQYH-----------SFFEKIGNDKKIKKSFSLFKLIGFIKNKF
Q8VTZ1_LEPIR/1-667L-------------------------NISKQNLDRSLNFN-----------IQTDL....EQQKRPFFLFKEKYSFMDKF

PF04188

GPI18_YEAST/2-433-----------------------------PSEINSYWNKY-----------FWNKLLSWDSVFFIKNITSKNGKPQFEHE
GPI18_SCHPO/63-464-----------------------------SRLAESNIFRT-----------LFISWIRWDAIYFVD..MAVNG.SLFEQE
PIGV_HUMAN/8-493-----------------------------SGFVDQLVEGL-----------LGG.LSHWDAEHFLF..IAEHG.YLYEHN
O65394_ARATH/12-492-----------------------------PFLVANAASRS-----------LEN.SVVWDSVYFLR..ITECG.YEYEQT

PF02364

P87204_ASPFM/843-1663-----------------------------SLSTPMPEPLP-----------VDNMPTFTVLIPHYSEKILLSLREIIRED
FKS1_CRYNV/778-1595-----------------------------SLTTSIPAPIP-----------VDAMPTFTVLVPHYSEKILLSLREIIREE
BGS2_SCHPO/843-1667-----------------------------SLATPIPEPIP-----------VDAMPTFTVLVPHYGEKILLSLKEIIREQ
O13429_CANAX/305-1090-----------------------------SLSSPLPEPFP-----------VVSTPTFTVLIPHYSEKILLSLQDLIKEQ
FKS1_YEAST/807-1632-----------------------------SLSTPIPEPLP-----------VDNMPTFTVLTPHYAERILLSLREIIRED
FKS3_YEAST/693-1543-----------------------------SLATPISEPVP-----------VDCMPTFTVLVPHYSEKILLGLKEIIREE
O13423_CANAX/599-1410-----------------------------SLSTPMPEVGP-----------VHLMPSFTVLIPHYSEKITLSLREIIREE
CALSC_ARATH/875-1655-----------------------------SLFMNMPHAPQ-----------VEKMMAFSVLTPYYSEEVVYSKEQLRNET
BGS4_SCHPO/871-1707-----------------------------SLATPIPEPVP-----------VDNMPTFTVLIPHYAEKILLSLREIIREE

PF04602

EMBA_MYCLE/4-679-----------------------------QITAPLVSGTP-----------RALDISIPCSAMATLPDSV....GLVVST
EMBA_MYCSM/13-666-----------------------------ELTAPLVAGAP-----------RALDVTIPCRAVAELPADG....GVVFST
EMBC_MYCSM/6-669-----------------------------SVDAPLIGYVA-----------TDLTVTVPCQAAAGLVGPENRNRSVLLST
EMBC_MYCTU/20-683-----------------------------SVEAPLIGYVA-----------TDLNITVPCQAAAGLAGSQNTGKTVLLST
EMBB_MYCLE/15-674-----------------------------SVTAPLISLTP-----------VDITATVPCAVVAALPPSG....GVVLGT
EMBA_MYCAV/4-680-----------------------------QITAPLVSGAP-----------RALDISIPCPAVATLPADG....GLVVST
EMBB_MYCSM/17-676-----------------------------NVTAPLISQAP-----------LELTATVPCSVVRDLPPEG....GLVFGT

PF05208

NT53_DROME/48-470---------------------GDTGPLVYPAAFVY--IY--------------------------------SALY-----
ALG3_ARATH/35-401---------------------GDTGPLVYPAGFLY--VY--------------------------------SAVQ-----
ALG3_HUMAN/45-406---------------------GDTGPLVYPAGFVY--IF--------------------------------MGLY-----
NT56_DROVI/47-475---------------------GDTGPLVYPAAFVY--IY--------------------------------SGLY-----
ALG3_SCHPO/26-384---------------------GCTGPLVYPGGHVF--LY--------------------------------TLLY-----
ALG3_YEAST/46-417---------------------GGTGPLVYPAGHVL--IY--------------------------------KMMY-----
ALG3_NEUCR/36-404---------------------GGTGPLVYPAAHVY--IY--------------------------------TGLY-----

PF14897

C6IU65_9BACE/1-365.....................MAVEG.....IYDY..FV--------------------------------EEIK-----
F0G7H3_9BURK/30-339.....................RTLEP.....GFVW..LV--------------------------------RALE-----
B1FZW1_9BURK/26-338.....................YGGEP.....LFNA..YA--------------------------------RLLW-----
D0MGT8_RHOM4/10-327.....................SGLEP.....ASWI..LM--------------------------------YVLN-----
B5S941_RALSL/18-319.....................GFVEP.....GFVV..IA--------------------------------RALN-----
E0NV04_9BACT/31-360.....................WPFEP.....GFTV..LM--------------------------------LVSK-----
D8DUW1_PREBR/31-358....................SKYWEP.....GYTL..LN--------------------------------LIVK-----
C3WBU3_FUSMR/30-360V..................LHSGYEL.....GFQI..YT--------------------------------SFIK-----
E5BUG7_9FUSO/30-365SI.................FHSGYEA.....GFQL..YS--------------------------------SIIK-----
C3Q046_9BACE/40-371GI................VFDCGYEK.....GFIL..YS--------------------------------ILIK-----
A6L8S3_PARD8/36-371FFIIT..........TTGVEFDAVEP.....GYIL..YQ--------------------------------SVVK-----
D7NC58_9BACT/29-366YLHSSV.........FGFSPALKFEW.....GYQV..LM--------------------------------HILI-----
C3WFM0_FUSMR/30-347.....................SNLEIRGVEKLFLF..IV--------------------------------YTLK-----
D0YWK6_LISDA/28-370FLTN............GFSPSVYFDF.....GFKL..LI--------------------------------SIIK-----
B9CW40_9PAST/29-365F..................SAIYFEP.....GFKL..FM--------------------------------SSLK-----
E5WYZ4_9BACE/30-356.....................SLLEP.....AFKL..WV--------------------------------WFWK-----
F0R6C6_BACSH/27-352IN................EQIFSIEA.....LFII..LS--------------------------------NLCK-----
E4VT48_BACFG/28-352S...................EVYVEP.....SYAI..LN--------------------------------IIVG-----
C6W3U8_DYAFD/27-360DDP...............VFLLRMEP.....GYVQ..FV--------------------------------KFLR-----
A9VRB1_BACWK/31-355.....................TNQEK.....GYFI..LN--------------------------------KIFN-----
D7VWT5_9FLAO/18-361MLHM............EGTENLDVEW.....LYTL..IN--------------------------------KILL-----
C6WZX9_FLAB3/31-373ALF..............RPNTEEIEW.....IFVL..IN--------------------------------KLVF-----
E4TAL9_RIEAD/31-371AFFS.............GSERLEVEW.....LYVL..IG--------------------------------KYVY-----
F0NZQ8_WEEVC/30-359VHM..............FAKMIGVES.....GYIY..MN--------------------------------RLFY-----
Q5L9T0_BACFN/34-354.....................ELFEP.....GYNT..VV--------------------------------WLGN-----
Q1ID93_PSEE4/39-369.....................YDFEL.....GFRV..LA--------------------------------GLLR-----
Q64Q37_BACFR/30-355VIDH.............NYVHASLEV.....LFYG..FT--------------------------------GFIA-----
E1W1Z9_HAEP3/34-354....................QWPLEI.....GFYY..LN--------------------------------KLYS-----
B0NP44_BACSE/33-342.....................YIDEP.....GFLL..LQ--------------------------------NSAR-----
Q93NP8_ECOLX/36-347.....................GRIDITYDKYFFGY..LS--------------------------------TLFS-----
Q64WD5_BACFR/26-339.....................GSREL.....GFNL..IL--------------------------------DFLR-----
Q6XQ50_ECOLX/22-344GD.................GFFFYEP.....LFSL..LI--------------------------------ILSN-----
E2NIN8_9BACE/9-341.....................STMEP.....LYLI..LN--------------------------------LILS-----
D0TB70_9BACE/50-382L...................NERIEP.....LYQI..VN--------------------------------HIPF-----
D0TIG3_9BACE/46-381.....................DIIEP.....GFYW..IC--------------------------------KIIG-----
Q6AIA7_DESPS/40-375.....................LTKDL.....IYYL..FL--------------------------------PIVN-----
D2QJN3_SPILD/45-378.....................REIEF.....GYEF..MN--------------------------------VVLN-----
C3J824_9PORP/33-348VFS...............SHSQHMSK.....IWKT..YN--------------------------------EVL.-----
E4KSW1_9PORP/26-344.....................QAFEP.....LWRN..LI--------------------------------LGMR-----
B2RK66_PORG3/26-344.....................HNFEL.....IWQW..IN--------------------------------KAFH-----
D9YZ33_PROMI/30-361VIDSDN.........LSIFSTSRFEF.....LFIF..IS--------------------------------YIA.-----
E7FXC0_ERYRH/30-380.....................NNMDI.....FYNL..IA--------------------------------KTSY-----
Q077R9_ECOLX/28-346.....................TNFEL.....GFDI..IF--------------------------------NYGK-----
Q077Q9_ECOLX/28-345.....................TNFEL.....GFDI..IF--------------------------------NLFK-----
E7FV64_ERYRH/21-356.....................SNIEL.....GFRI..FI--------------------------------FIFK-----
E6RKK7_PSEU9/21-338.....................VPVEP.....SFSL..LS--------------------------------ELLG-----
A9QSJ8_LACLK/28-353.....................GDKSP.....IYTS..YS--------------------------------EFLK-----
B5L3N1_ECOLX/27-351.....................DKYDI.....SYTL..IV--------------------------------YLCS-----
C7H3X4_9FIRM/29-345.....................NDIEIYWIEAGSRA..YI--------------------------------HLLG-----
A7VCQ8_9CLOT/30-383....................TIGYEI.....GYCY..FT--------------------------------RFLH-----
B3JEB8_9BACE/29-364IFSYW..........RYGPDTTKMEP.....GYML..LN--------------------------------ILIK-----
D6D462_9BACE/28-360IFTF............TRGMAEPIEP.....GYVL..LN--------------------------------ALVK-----
C3HRH2_BACTU/24-343.....................WFSEP.....GLVY..IM--------------------------------DFMK-----
C3WQZ8_9FUSO/25-352IP.................DLEGLEI.....GYVL..LN--------------------------------LIFF-----
E3HB27_ILYPC/34-350.....................DLFNLGRSGLGLKI..LN--------------------------------LLAN-----
E4VYN5_BACFG/26-349.....................YYAEP.....GYYI..YM--------------------------------LGFK-----
C7PMN8_CHIPD/32-372EF................FDPMHFEI.....GYVY..LS--------------------------------SIVK-----
Q5L965_BACFN/30-358MF.................LLFRMEP.....GYIL..FN--------------------------------SVIK-----
Q1WTE3_LACS1/26-359.....................HTYEI.....GYAL..LN--------------------------------SLAK-----
B7AIU7_9BACE/32-363.....................STGQY.....FFDI..TN--------------------------------SLFR-----
B6W1S5_9BACE/36-375.....................EGTQL.....LFDC..LN--------------------------------ELLK-----
E2N8R2_9BACE/38-379.....................NGYEL.....VFFH..IC--------------------------------NILN-----
B5CXR1_9BACE/33-352Y...................QEKGEF.....LFYY..II--------------------------------KICN-----
C3JAP3_9PORP/26-357.....................FSNEY.....VFLS..II--------------------------------KLSK-----
C6I9C7_9BACE/28-351.....................DNGEL.....LFVF..LI--------------------------------QSCH-----
E7DWN5_SALCE/28-357F...................YQNKEY.....LFYA..YV--------------------------------KFFQ-----
A0KM85_AERHH/26-353.....................ESGEY.....FFYY..LN--------------------------------IFLK-----
A6XVI1_VIBCL/26-352.....................NSGEY.....FFYY..SN--------------------------------IFLN-----
A7M0P5_BACOV/26-361.....................RLVEGDNRGTGETL..FY--------------------------------GFMQ-----
B7BCK8_9PORP/38-375YY................TIRDDLEI.....GFEF..VT--------------------------------RLMA-----
D7IN83_9BACE/23-359IGV..............VTDEYIKEP.....GWVL..LS--------------------------------YLFK-----
Q4JYP9_STRPN/26-355.....................YFSDH.....AYNF..FA--------------------------------DWFS-----
E7DWN9_SALCE/36-394TSF..............SEVWEQSDN.....RYLV..IN--------------------------------TII.-----
A9NH20_ACHLI/15-352I...................ETNFEK.....GYRF..IE--------------------------------NFFY-----
Q4KYP9_ECOLX/2-316.....................YLYEL.....SVRF..FR--------------------------------DILN-----
B2EAJ6_BIFAN/21-365.....................DNTEY.....LYMA..LI--------------------------------KTCN-----
E4SMU8_LACAR/20-350.....................ERTSS.....GWAY..LS--------------------------------NIGL-----
D0DSK0_LACFE/28-347.....................TSAKN.....VYGM..LA--------------------------------VFFH-----
A6GZ52_FLAPJ/21-343.....................FKFEG.....GYNI..LM--------------------------------YGFK-----
B0KTY9_PSEPG/11-328.....................WGKEV.....GYGY..LN--------------------------------ILAN-----
E1WTD5_BACF6/21-369.....................WGYEP.....SFFL..FC--------------------------------MLGN-----
Q8GP42_STRTR/34-383.....................SQTEW.....LYNQ..LM--------------------------------ILFN-----
C7TKZ8_LACRL/24-354.....................DNFEK.....GYTF..LA--------------------------------KLFF-----
B2GF40_LACF3/21-364.....................SPFER.....GYTW..MS--------------------------------KLFF-----
Q03WA2_LEUMM/21-358.....................GGFEL.....GYSY..IS--------------------------------HWFL-----
C8TTX0_ECO26/24-340.....................LYAEI.....GYRW..LI--------------------------------YGVK-----
C7XF82_9PORP/42-366....................VSTFSQ.....FFVF..LF--------------------------------SVCD-----
C7XB09_9PORP/32-356VN................DPLVALEP.....IYVW..YI--------------------------------QLIS-----
A7AJ45_9PORP/41-378.....................VHLEP.....VYYW..LI--------------------------------RNVT-----
E4TA21_RIEAD/26-353.....................LAVEL.....VHIK..LI--------------------------------EFVH-----
C4UE48_YERAL/24-352.....................SIFEF.....GFVY..FF--------------------------------KFLL-----
B3I2Q9_ECOLX/24-358.....................TSFEF.....GFVI..IL--------------------------------KLLL-----
D7PEY6_SALCE/24-353.....................LSFEP.....GFVI..FL--------------------------------KALL-----
C1M671_9ENTR/24-355.....................SWFEP.....GFLL..FY--------------------------------SLLR-----
E6ALG7_ECOLX/22-354.....................IMFEP.....GYEL..IV--------------------------------SLFG-----
A6TBF0_KLEP7/23-340.....................FFYEP.....GYLW..CM--------------------------------SLFS-----
E2SY53_9RALS/25-362.....................PDFEP.....LFTI..WM--------------------------------WLFS-----
A6MF01_ECOLX/23-335.....................WIYEP.....GFTF..IL--------------------------------FVNK-----
B7AUK2_9FIRM/25-372.....................SYFAL.....GYRA..LS--------------------------------KALY-----
C9BE41_ENTFC/31-354....................EGFKEA.....GNSL..FI--------------------------------YIG.-----
A5G608_GEOUR/41-362.....................DTVEF.....AFRA..LL--------------------------------WIND-----
C6X1R8_FLAB3/21-351.....................LALEW.....CMYF..FP--------------------------------NLFR-----
A7ZNK7_ECO24/20-336.....................LYTEP.....LSKI..IF--------------------------------RLSF-----
A3D6K3_SHEB5/9-323LHN..............SFLSLNIEP.....FYFF..IN--------------------------------KTLA-----
B5L3F9_ECOLX/24-340.....................YSYRG.....GYFFDWIV--------------------------------NFFV-----
C3WK26_9FUSO/25-344LFE...............YNNYYFEK.....GYVF..LN--------------------------------MLVS-----
B8EDA7_SHEB2/32-359INIESI........RKSVVASFGIEP.....GIVL..LS--------------------------------SFLR-----
E0SFU5_DICD3/23-330YAE...............IFRNGVDP.....VFVS..LM--------------------------------RPFT-----
Q6FFU5_ACIAD/13-316.....................SLKDP.....FFLI..IN--------------------------------KFFS-----
E4TIN4_CALNY/56-394L..................SLINTEP.....IFLL..IA--------------------------------KIVH-----
B5L3A6_SHIDY/54-384F...................GDGLEF.....MFLA..IM--------------------------------KFIG-----
C7X5V3_9PORP/26-352.....................KEYEP.....LFAL..IR--------------------------------DTLS-----
E3DJ50_ERWSE/35-367VA.................DIYRYEN.....FFML..LA--------------------------------WLAS-----
C0H3N7_ERWST/32-370V..................ACFRYEP.....LIFA..MA--------------------------------WLTS-----
E7NQN0_TREPH/28-357V..................EQQHAEI.....GYSY..FQ--------------------------------AIVK-----
Q8A831_BACTN/29-353.....................VSPDK.....GFSA..FV--------------------------------LIVR-----
C6I3T9_9BACE/28-349.....................GSADI.....GFNL..IC--------------------------------LFLS-----
Q1V7L3_VIBAL/26-356IPS...............SGEKPTES.....LYAF..LT--------------------------------LFIK-----
C7M7Z9_CAPOD/10-347LNPI............QFYAFTGMEI.....GFGW..YC--------------------------------FLIS-----
B5L3D3_ECOLX/36-361VQ................GGEADFEY.....GFNI..LF--------------------------------WGVR-----
F1Z115_9STRE/49-372LNQ...............LLTTRFQN.....GLYV..LM--------------------------------YVIK-----
A7V5U7_BACUN/28-354TS.................EDFFVEP.....GYVL..LS--------------------------------SLLR-----
Q8A715_BACTN/26-366LLD..............PEYRILMEP.....LFWI..LG--------------------------------SLCK-----
D7ITP9_9BACE/25-344.....................ETMEA.....GFSE..LI--------------------------------RIIK-----
E2N1D0_CAPSP/33-355.....................DDIEI.....GFQW..FA--------------------------------EFIK-----
D7PDX4_ECOLX/28-352AS................IRDIHGEV.....GYLF..LS--------------------------------SIFK-----
A8U9G3_9LACT/24-350VF................NGKIEAES.....GFLF..LN--------------------------------YLFK-----
C7TKU1_LACRL/24-347.....................GQVEP.....GFLF..LR--------------------------------NVFN-----
E0NTF2_9BACT/25-352HAD..............TIPFGYSEI.....GYFY..LA--------------------------------SIIK-----
F0KIR6_ACICP/24-352.....................IHAEI.....GFRL..LS--------------------------------FLGH-----
C2BGA1_9FIRM/29-360VL................NFSYPVEF.....SFRL..AS--------------------------------YLIN-----
B6W8F8_9FIRM/29-359VF.................SAYPVEI.....GFRI..SS--------------------------------YLIN-----
C7RFF5_ANAPD/29-361LF................DFTYPVEF.....AFRF..FA--------------------------------LLVN-----
Q5LH99_BACFN/15-335Y...................NATYEK.....GFYT..LF--------------------------------YFLK-----
A7V5D6_BACUN/28-344.....................VPSEP.....FTIL..VF--------------------------------AIIR-----
D3SAJ3_THISK/38-360GE.................AGMRYEP.....LYAL..LN--------------------------------LAAT-----
E5CFC4_9BACE/25-346.....................LTDEP.....GFYY..LK--------------------------------LVLS-----
C6X0C5_FLAB3/28-350ILAS............GQVITSNMEK.....GYIA..LM--------------------------------YVAT-----
C4ZJE6_THASP/44-373FSDL............TFRFFQGFEP.....GFVA..LN--------------------------------IILN-----
E5YGM0_9ENTR/19-338.....................SAIEP.....TYIL..LS--------------------------------KVFF-----
C6ITG0_9BACE/26-335Y...................TYSIEP.....VWLI..IN--------------------------------KILY-----
A5ZI18_9BACE/28-334.....................IRLEP......LSQ..IF--------------------------------CIIA-----
Q0HKL4_SHESM/27-338.....................YSSEI.....ANYT..LF--------------------------------TLSY-----
D6E918_9ACTN/24-356LNPNILD.......NANLIYPYDFEN.....GWVV..LN--------------------------------WLLA-----
F0SY68_SYNGF/34-364ITD..............SVRFFNIEY.....SFRV..LS--------------------------------FISH-----
C9KPH1_9FIRM/27-363.....................VWPEP.....SFQI..LC--------------------------------QFLR-----
B6A8T0_ECOLX/28-355.....................DGIEL.....GFYY..IN--------------------------------YILA-----
E2DNR6_ECOLX/32-354.....................VTTEI.....GYYL..IN--------------------------------YLVV-----
D2TQI7_CITRI/31-353.....................VSTEI.....GFYF..IN--------------------------------YIVV-----
E5V9C7_9BACE/31-351.....................SGYEY.....GFRI..IV--------------------------------NILK-----
A6L9H3_PARD8/32-354.....................DEHEI.....GFQL..LG--------------------------------KLMN-----
Q4K0T2_STRPN/28-349.....................VKFEL.....LDKL..VV--------------------------------YIGY-----
E0NHN7_PEDAC/40-361.....................VKVEA.....LYRW..VI--------------------------------KIGY-----
A1A378_BIFAA/27-350.....................PPMEP.....IFKW..LN--------------------------------GLCI-----
F0K0J0_LACD2/31-347.....................ARIDI.....FTYW..VM--------------------------------KVMA-----
E1WLK7_BACF6/35-350.....................TYMEP.....GFQW..VV--------------------------------LFLE-----
E0RX92_BUTPB/42-359.....................VPTEV.....GFNV..LA--------------------------------RVIY-----
C3R7I4_9BACE/28-352FSDFL..........SDSLSFPGYEF.....GWII..IN--------------------------------YIV.-----
D5DBJ5_BACMD/39-371Y...................EGIIET.....GIAS..IY--------------------------------DLA.-----
C2EVS6_9LACO/30-364.....................QYIEN.....GYIL..LN--------------------------------SFAQ-----
C0C0E8_9CLOT/30-354YA.................DKYLIET.....GYMI..YN--------------------------------KILG-----
E7GJ39_CLOSY/47-379NQN...............FSYFYIEP.....GYYA..LN--------------------------------KIFP-----
Q8XN60_CLOPE/30-345.....................GGYEL.....GFVL..FL--------------------------------AILK-----
A9VPZ7_BACWK/36-350.....................NSKDV.....GFSI..LQ--------------------------------MILK-----
C2UYS5_BACCE/36-350.....................TNKDM.....GFNI..FQ--------------------------------MVLK-----
C3ADI9_BACMY/38-352.....................EGKDM.....GFNV..LQ--------------------------------MILK-----
C2WEM9_BACCE/36-357.....................DSPDV.....GFLI..MT--------------------------------WLLN-----
E3DVZ3_BACA1/36-363GA.................GKAAVDP.....GFTA..FI--------------------------------WLLN-----
E5W8D3_9BACI/36-363GT.................GKSSTDP.....GFTA..LL--------------------------------WILN-----
B0P2K8_9CLOT/37-362.....................VNKDK.....GFFV..IS--------------------------------VLFK-----
B0ACE3_9FIRM/38-368D...................GSRRDP.....GFLF..IS--------------------------------VLIK-----
A6NPS1_9FIRM/35-361L...................DILHNP.....LFYL..IT--------------------------------SLFR-----
F0HVE5_LACDL/23-357....................KLPSQI.....AFLA..IT--------------------------------KFIS-----
C2EGY8_9LACO/41-362.....................KQMGH.....IFAL..IT--------------------------------KFLT-----
Q0TSM6_CLOP1/32-355.....................DRYEI.....GYLY..LN--------------------------------KMLS-----
F0PU56_BACT0/28-368FD.................NPTRYEL.....GYVI..FS--------------------------------KIAS-----
C6I5R5_9BACE/29-346....................AIKAEI.....GYSF..FM--------------------------------KLVS-----
Q64Y60_BACFR/31-360.....................YTYEA.....GFML..LS--------------------------------KIIS-----
C4L730_EXISA/28-346FEI...............VFTESEDP.....GFYL..FQ--------------------------------RLIQ-----
B0P9K3_9FIRM/54-410LFS..............PNNIYRFEP.....GFSL..LT--------------------------------YLFS-----
E1YWT9_9BACE/27-350....................WEQFEP.....GYVL..FN--------------------------------QLIR-----
C9RN08_FIBSS/27-350.....................GMVEF.....GYVL..FS--------------------------------TVVK-----
C7M4A6_CAPOD/29-353.....................FIMEI.....GYLF..LN--------------------------------YLVR-----
Q39W09_GEOMG/33-369.....................NHFDI.....GFYL..LN--------------------------------FVIA-----
D1JP75_9BACE/28-362.....................NSFDV.....GYLF..FN--------------------------------AIIR-----
C9PY95_9BACT/28-358T...................EPLFEV.....GYYL..FM--------------------------------LPIR-----
E4RNL6_HALSL/27-346.....................VRTEP.....LYAI..FN--------------------------------WIIY-----
B5Q3Y8_SALVI/23-348FMS..............PGNRHDFEI.....GYVL..YV--------------------------------KLIR-----
B9KB09_THENN/26-382M..................LEHYFEP.....LYKL..LA--------------------------------IIVK-----
B2V0T8_CLOBA/35-358.....................FNKFP.....GYAL..YN--------------------------------TVVA-----
Q1WCS9_STRTR/30-358.....................AESNW.....GYVI..YN--------------------------------KLIG-----
C4Z668_EUBE2/44-362Y...................ADNAEA.....GYLL..FN--------------------------------NLVA-----
E0S0Y2_BUTPB/32-367Y...................W..........IYNL..WV--------------------------------YLIR-----
Q048A4_LACDB/46-398.....................HYYEP.....GFYL..LN--------------------------------LLVA-----
E2DZE7_ECOLX/24-353S..................LSYGQEI.....GFML..LM--------------------------------KLFH-----
E1LFZ3_STRMT/29-357.....................SRFEL.....GYLL..FN--------------------------------IFLR-----
D0BKU5_9LACT/28-356.....................SRFEL.....GYVF..TN--------------------------------QFIR-----
D7YPG3_ECOLX/25-334.....................LPNEIFNYGYGYYS..LN--------------------------------MFVK-----
E4VU68_BACFG/30-357AL.................AIPKYGI.....IYLF..YN--------------------------------KILT-----
D2RIR8_ACIFV/29-352.....................TRFEP.....GYSL..LN--------------------------------YIIS-----
E4MD95_9BACT/23-351....................YKTAEF.....IWLA..ML--------------------------------RYFR-----
C4GCL9_9FIRM/28-345.....................SWVEP.....LYVW..MN--------------------------------KAVI-----
B1C3W9_9FIRM/29-372.....................NPFEK.....GYLL..LN--------------------------------WILS-----
F2M2L7_LACAL/34-380AVNFSSLKAWLDMSGVAGFITQNLEK.....GFLL..VE--------------------------------YIST-----
D1JXK2_9BACE/23-363IE.................TERNLDK.....GYLF..LY--------------------------------WIAS-----
D3HZQ1_9BACT/22-355.....................HQFEK.....GFSW..IM--------------------------------AKFK-----
B0NR62_BACSE/28-357TW.................TDKSMEI.....GYEI..SV--------------------------------SLCK-----
D5EVG6_PRER2/7-324.....................GLIDP.....LFGL..LI--------------------------------GVFK-----
D1PQ73_9FIRM/29-362.....................VHGEI.....GYQF..LT--------------------------------NVFR-----
B1SB73_9BIFI/27-361.....................YNFEA.....GYCL..LN--------------------------------GAIY-----
A6QAG6_SULNB/27-344.....................KHGDP.....AYWL..LQ--------------------------------VWVY-----
A6DEM7_9PROT/26-341.....................KRPEI.....LHYL..LN--------------------------------WIAA-----
E4PS23_MARAH/27-342.....................SGGDP.....GYYL..LN--------------------------------WLVG-----
Q0A657_ALHEH/27-342.....................LASDP.....GYYL..VN--------------------------------WLVA-----
B7RW64_9GAMM/32-347.....................QYTDP.....GYYL..LN--------------------------------WVVA-----
Q8DJL9_THEEB/21-349.....................TVNDF.....GYHL..IN--------------------------------KLAG-----
B6QYQ8_9RHOB/29-346.....................DFTDV.....GYSF..IN--------------------------------WLAF-----
A7HKI9_FERNB/29-353....................IWLSDF.....GYNF..IN--------------------------------WFSS-----
F2ALR7_RHOBT/67-386.....................TRSEP.....GYWI..LN--------------------------------ELIH-----
E3I7S4_RHOVT/25-342.....................SGPEP.....GYWL..LL--------------------------------TQLH-----
E8KJL4_9PAST/2-248.....................................IL--------------------------------SIIT-----
F0QJB5_ACIBD/26-342FK................EALFFFEP.....GYSL..LN--------------------------------ILGN-----
Q5QWV6_IDILO/29-338.....................TTPEL.....GYKY..LN--------------------------------VLSG-----
Q1QWW7_CHRSD/27-347VT.................QQGWWEP.....AYAF..IA--------------------------------YFSN-----
F2UUT5_ACTVI/30-361.....................SRFEY.....GYVV..LN--------------------------------YLVS-----
B5L3I2_ECOLX/31-358.....................LAIEP.....GYYF..FS--------------------------------YVSS-----
Q8KN52_PSEAI/26-351.....................FEFDV.....GFEY..LC--------------------------------SGFN-----
B0MX13_9BACT/23-361.....................VSYEI.....GYVW..LN--------------------------------DICG-----
E5VCV4_9BACE/29-372LNKLTV.........SYVFDNANRQP.....GWIF..LI--------------------------------SILK-----
D1JV57_9BACE/29-369LDVLRI.........RDLFVNSNRQP.....GWVI..LV--------------------------------ALFK-----
D2ETY6_9BACE/27-359.....................VFFDP.....GWLL..LN--------------------------------SIIK-----
D0TG79_9BACE/26-371I..................GYRSERP.....GWIL..LT--------------------------------SFLK-----
D0TBD4_9BACE/31-353.....................EQFAP.....GYSL..LC--------------------------------ALSY-----
A6LBP7_PARD8/27-381.....................SDFESVMKMPLWVL..LQ--------------------------------ATCK-----
C7XEA9_9PORP/27-380F..................SDVRYEP.....FWIL..LN--------------------------------VCCK-----
D1W6W5_9BACT/26-352QHG..............AFLLFKGEP.....GYII..LN--------------------------------ILIS-----
D9RS75_PREMB/26-353DSF..............LYNFYSSEI.....GYTL..LN--------------------------------VIIS-----
D1W1V4_9BACT/26-351SIG...............FLFFGGEQ.....GYGL..LT--------------------------------IIIA-----
D3IIR5_9BACT/26-355TAY..............IFELYPSEF.....GFSW..LN--------------------------------VAIS-----
D3I859_9BACT/26-352DAS..............IFTLYPSEI.....GYIG..SN--------------------------------VLIS-----
F0F6A4_9BACT/26-352DAT..............ILKLYPSEF.....GYAG..FN--------------------------------ILIS-----
D8DZP1_PREBR/31-354AYI...............FQQWPKET.....AYIW..IN--------------------------------IAIA-----
E1KTN9_9BACT/26-351SSS..............IYQAYNTEF.....GYIG..LN--------------------------------WAIA-----
D7NAB4_9BACT/26-352LES..............PIMGYQSEI.....SYVI..WN--------------------------------SLVA-----
C9PWW7_9BACT/24-345YE................YLGHDNEV.....GYQY..FN--------------------------------VLFS-----
E1GYB6_9BACT/25-352AS................ISGYYKEY.....GYVL..LN--------------------------------ILIS-----
D1XZD4_9BACT/28-352NKI..............IYLVGGKEY.....GYFF..WQ--------------------------------ILLS-----
D1PWT1_9BACT/24-349LY................YLVQGKEF.....GYFY..WQ--------------------------------VIVS-----
C9LKD9_9BACT/25-350SDF...............LLLFGNEP.....LYGL..LN--------------------------------SFVG-----
E6MMW3_9BACT/21-348NDA..............FHFYFGHEP.....AFGL..FL--------------------------------AFIG-----
E5V8M3_9BACE/69-395VF................NDDSTTEP.....LYKI..FM--------------------------------FILR-----
B7GUM4_BIFLS/44-384FG.................IDKPIPL.....GFAL..LA--------------------------------WLCA-----
A5ZDF0_9BACE/31-358LQINNNI.......YSILFASAELEP.....LYYF..LS--------------------------------YLAV-----
E9SGC4_RUMAL/37-488.....................YTTEP....LGYSF..MA--------------------------------YITS-----
E6UEJ4_RUMA7/36-384.....................YTTEP....LGYAT..LA--------------------------------YITA-----
E4RXS3_LEAB4/31-353N...................SPTSEY.....GYII..LN--------------------------------YICS-----
E3PBR1_ECOH1/28-364....................VFNYEP.....GFVL..LS--------------------------------YISV-----
B3IUU1_VIBPA/26-360L..................YASGLEI.....GYIA..IL--------------------------------SFSA-----
D8MET7_LEUGT/28-370QQ................NGLIGSDV.....GWTF..IN--------------------------------STIK-----
A6ASH6_VIBHA/21-345.....................TAKEV.....GYYF..IV--------------------------------MFSD-----
D9YYZ5_PROMI/24-338.....................NRLEL.....IPRL..LI--------------------------------EIAI-----
C4K321_HAMD5/34-350.....................NNFEP.....LFVV..IT--------------------------------SLIQ-----
Q4K041_STRPN/27-373YLNTSWY......RIWRFLSVKDFER.....GFTL..VV--------------------------------YVTT-----
C5S1B5_9PAST/27-372YLNFEWF......GEWRPVLVSEFEI.....GFTT..LV--------------------------------YFIA-----
E6MFB5_9FIRM/30-370....................IKTVEP.....LYVL..LN--------------------------------FLIT-----
C5F8C9_LACPA/30-390YAY..............LKNVNNTEF.....GYAA..LN--------------------------------FITS-----
D1NRU3_9BIFI/51-371.....................SHYDP.....LFNW..II--------------------------------ALFA-----
C8WKZ6_EGGLE/32-357.....................NQHDP.....LSIL..FA--------------------------------HVAN-----
D4V5L6_BACVU/25-369.....................RDLEP.....LLMA..YN--------------------------------AVLR-----
C3WC57_FUSMR/29-349I..................KDSRFEI.....LYLF..LN--------------------------------GMIK-----

PF10131

Q0AV03_SYNWW/415-1038GAIIAVILTVQLVL-LSHAMIAAVYC-----LSLA--LF....AFFLW-----------VFQGCSV-----KDLA-----
Q5JIL5_PYRKO/62-622RYLAASAVAISVIS-LIH..HSAMVP-----LVIT--GL....VLLFE-----------NFRKTRV-----LSNF-----
Q9UY38_PYRAB/63-619RYLIASALGISIVA-LTH..YSILPL-----LIIT--GI....LILWD-----------DLRTMTA-----LGNG-----
Q97FZ3_CLOAB/258-879WSILPMTLFMTLIT-MTHLMVAAMVV-----TASF--VF....LFIYS-----------II.FKKV-----IKPL-----
Q0AV07_SYNWW/2-631SRAVLIVLLSACLI-LSHAMHAFITC-----LAMG--VL....VLMLV-----------VLRRTKL-----KTFL-----
Q8TXR3_METKA/68-665RHLAYATLLLVPAC-YSHPLGGLLSG-----GLIL--TRGIAEAVLRE-----------KLRTPRF-----LLQS-----
A0LQQ1_SYNFM/80-828RSLFRNSLLEGLAA-LSNGYPLLQFG-----FASS--YF....LL...-----------...RGRF-----IPYL-----
Q97FY2_CLOAB/253-873ASIIAMAGIMLLII-MCHLMVAAMLG-----ITTF--IF....LLIYA-----------VL.SKKF-----LRSI-----
A7VEP1_9CLOT/75-690RAAVGLFVCMTLMS-FTHLMVTAIMG-----VSAF--LY....LLIDQ-----------IW.NKDT-----RRKI-----
Q97G45_CLOAB/90-699RDYLRLAMLMSILT-LTHAMISAIVG-----MALF--IV....GLAYA-----------IS.KKRY-----YENI-----

PF09586

A4VYG6_STRSY/15-836QGPILYYITLTCLF.IQNYYFGYMVA-----IFLT--LW----TLVQLS..........WIDSQRI.....KRFI-----
Q1WT54_LACS1/18-862RKMKTYPLLLALML.IDNYYMAYMIC-----IFLV--LF----FIWYQITYT.......TKFKEFL.....SRTW-----
Q8DRZ1_STRMU/67-904KVSIKYTLVLALMF.VVQFYTAYMAC-----IFVI--FY----SFYYILAQK.......SAFLFKA.....KQLL-----
A7GVH5_BACCN/15-865RKKGLFLFATALML.ASNFYFAFITS-----IFIY--IY----AFFQY...FTTQQN..KTIQSFL.....TYYI-----
A7VEC6_9CLOT/153-972GDYKLYVLSLFYAL.MCNYYMSFMIC-----IFLV--MV----FLLTNH..........KSVKRFF.....TDGF-----
Q3EWS4_BACTI/59-905KKRGLFLIAATLML.ASNFYFAFITS-----IFIF--IY----ALFQY...FATQKN..KTIVSFL.....TYYI-----
Q74LA0_LACJO/18-861RHWTLYIVLLACAI.IFNYYIGYMIC-----IFMV--IA----FCAYTINNF.......KDKKIFI.....QQII-----
Q74LA1_LACJO/22-868NVWLAYSILLACAI.IFNYYIGYMIC-----IFLV--IL----FLAYTVNNF.......ENRKTFL.....HQFT-----
A8AU67_STRGC/17-840KNRVLYFTSLSILF.IQNYYFGYMMA-----IFLI--FW----FFVQTT..........WDFKNRI.....KTFL-----
Q03YY3_LEUMM/16-848QTWWRYSVLLAITI.ITNYYIGFMVA-----IFIV--LY----FLWRLT..W.......PNVKHRL.....TILW-----
Q8DRQ9_STRMU/18-837RGIFLYFLTLTCLF.IQNYYFGFMTA-----IFLT--LW----FFTQVS..........WDIRNRM.....KRLS-----
Q4L5U5_STAHJ/10-841QKFGLFIVTITLIM.INNFYFAYYLC-----LIGA--GY----ILLRI...IFKHS...KDIIPRG.....KALL-----
Q03G85_PEDPA/13-851NQIKIFVTTMSLMV.IINYYFAYMIG-----IFTL--IY----FLWRASPL.........SWKKI.........F-----
Q030D0_LACLS/14-856GKRWLYFVSLLILF.IQNYYFGFMVA-----IFLV--LY----FLARMT...........YEKWPW.....TKVL-----
A5VKU5_LACRD/18-849NRVGTYIAWLAVIL.IDNYYMGWMIA-----IFTF--LF----FLW.QTPAL.......ASWRQRG.....VIFL-----
Q8DRY9_STRMU/26-950RKPFKYIIVLALTM.LLHFYMGYMIC-----LFVA--LY----TCYYAAPKLAEIGD..WKIKITA...FFKPVL-----
Q38WC5_LACSS/15-827KKPTLYIVTLTVSI.LTNYYLGYMTC-----LFAV--LY----MISLVIKQRQPQQTWLQLMKQQA.....RVIW-----
Q8DWP3_STRA5/16-839RKPILYFLSLTALF.IQNYYFGFMTA-----IFTS--LY----FIVQITRN........TDSKVAF.....KQFL-----
Q03NT2_LACBA/19-858GKRGSYIVWLTLAF.ISNYYMGYMVS-----LFII--LM----FCFLVTDGF.......VNWKKVR.....IQSY-----
A5M1N1_STRPN/14-831KKLLLYFTSLSILF.IQNYYFGYMTV-----LFLI--FW----YLCQIS..........WDFKTRK.....SSVL-----
Q38VZ4_LACSS/17-848QRFWLYPLSLAALL.IINYYMGYMVC-----LFVV--AY----FFWASVHHF.......KTWRQTC.....LVYL-----
Q03RN6_LACBA/20-858GKWRTYVIWLTLML.VVNYYMAYMIC-----LFMV--LA----FCWLAVDRF.......STWRHFG.....KQAG-----
Q5FIZ5_LACAC/21-848KKN..HLILITFLLWFTNFYTAFMAL-----FFGL--LY----LLTQLF..F.......INKDKRG.....AIFI-----
Q4L5U4_STAHJ/19-851RKIGLFIFAVAITL.FSNFYFTYYQA-----IVLG--IY----FILRV...VFQYR...HDIVSRW.....QKCY-----
A7VCC3_9CLOT/56-904KWQLRYTLLLACAF.LFNYYFAFYIC-----LFIV--CY----FFMQDW..........KNAKNLW.....SGVC-----
Q839W8_ENTFA/19-846RKPTLLFVSYFLLF.ITNYYFGFMIG-----LFSF--LY----YFARTF..........TDWQRYK.....SRIV-----
Q5M231_STRT2/16-841NKRGLYFLSLTCLF.IQNYYFGYMMS-----IFLT--LY----TIIQLITI........TGWKSKI.....LHFI-----
Q82ZW8_ENTFA/12-828RKWGLYSITLFLAI.VTNYYMGYMIC-----LFAV--LY----SIYWFFKKNTKA....HAIRQFF.....KQSP-----
A7VV10_9CLOT/13-832GSMLLLTIAYTLLF.IAQFYIAYMVG-----IFSL--LY----FAGLCV..........VEKRFSL.....RTIG-----
Q8NYY9_STRP8/14-837NKTRTYYLSISLLF.IQNYYFGYMIA-----LFCI--LY----ALVCLLRL........NDFNKMF.....IAFV-----
Q5HPU9_STAEQ/10-840FKVGLFILTVSLIL.INNFYFAYYFL-----IIGI--GY----TLIRI...IYRHP...KDSLTRW.....QASL-----
A5Z3G2_9FIRM/23-866KKCKMYCISLALAI.FSNYYIGLMIC-----IFSI--IY----FVYLFCIVEFDETV..EKTKARL.....LILK-----
Q5WFJ9_BACSK/12-844ENPFWLIAAMSLSL.INNFYFSYVHF-----IFLS--VY----ALLRW...LIRFP...EDRLTIN.....VQLR-----
Q74IE5_LACJO/19-843KKHYFYLTTITFLLWLTNFYTGFMVL-----FFGL--LY----FITALI..N.......HSFSSK.......IIF-----
Q03HY9_PEDPA/14-831QRWGLLFISWFLML.VTNFYIAFMVG-----LFIG--IY----YLMKLIT.........LKVQQWW.....INIG-----
Q038D6_LACC3/14-842GRVMAYIGWLAAAL.IINFYTGYMIA-----LFLI--LY----AIYWLIAHT.......STWQHFW.....RSGL-----
Q3XYV7_ENTFC/19-847KRPKLLFISYLLLF.LSSFYMGFMIG-----VFSF--LY----FIARLL..........TNWSEYK.....KTIV-----
Q931T0_STAAM/19-851RKIGIFIVAIALTL.FSNFYFSYYQA-----IIIG--CY----YLYRL...IFTYK...YDIVSRT.....QKFI-----
Q814J9_BACCR/15-862RKKGLFLFATALML.ASNFYFAFITS-----IFIY--IY----AFFQY...FATQQN..KTIKTFI.....IYYI-----
Q041X2_LACGA/19-844RRHYFYLTMITFLLWLTNFYTGFMVL-----FFGL--LY----FINTLL..N.......SSFSKKQ......IIL-----
A7Z2M8_BACA2/11-842KKPAWFIFACALTL.INNFYFAYINL-----IFIG--IY----ILFRW...VIPLE...GNETKRL.....TQCR-----
Q03TF4_LACBA/23-880HHYGLYTISLTITI.FCNYYLGYMTC-----LFSV--LY----FIYLIIEHQPTPTPFKDVWRMHR.....AAIR-----
Q8CSU8_STAES/19-850RKIGWFIFAIAYTL.FSNFYFSYYEA-----IVIG--FY----FIYRF...AIPHE...KDIVNRW.....QKLY-----
Q046D7_LACGA/22-883NKWLTYSILLACAI.IFNYYIGYMIC-----IFMV--II----FLAYTINNF.......KDIKLFF.....HQFL-----
Q5WJL1_BACSK/14-845QKPWWLIAAIALSL.VNNFYFAYINF-----LFIG--LY----ALLRF...FFPLA...DHESSIK.....QQLR-----
A3CRC9_STRSV/17-843KGRVLYFTTLSILF.IQNYYFGYMMA-----IFLV--FW----YLLQLS..........WDFKNRI.....KSLL-----
Q65M97_BACLD/11-842KRTALFITACSLTL.INNFYFAYINL-----IFIA--IY----IIFRW...LIRLDP..EKEAPRW.....KQFR-----
Q04EK1_OENOB/16-850QKYLPFVLIFAFSI.IDNFYIAYMIG-----IFLP--MF----AIWQISRYY.......SKFLNQS.....LIFL-----
Q03QV8_LACBA/14-985KSWIPLAIFTGLAL.ISNFYFAYILA-----LGSL--VY----AVLRY...........LAIRQTVSLPHWRVLW-----
Q49X29_STAS1/10-840GKIGFFIIIVAITL.INNFYFAYYQL-----LTGL--IY----LTIRL...VFRHQ...ADIIPRF.....KSFM-----
A5ZUP3_9FIRM/20-900EKPYIFIWSVALAG.LSNFYFFYMLG-----IFMV--LY----AAVRY...FEQFED..RSLKNIG.....RWLG-----
Q03A73_LACC3/16-850HRLIPYVVPLSLSF.ITNYYIGFMVA-----IFSA--LY----FCWQWAIHH.......QP..QLL.....RKIA-----
A8FB68_BACP2/11-842GKPAWFIAACSLML.INNFYFAYIHF-----IFLA--IY----LVFRY...MIKL....RSEERGW.....KVFW-----
Q049H9_LACDB/23-844EKN..HLVLITFLLWLTNFYTGYMTL-----LFGL--LY----LLVGLA..T.......NREPKKR.......FW-----
Q03TW7_LACBA/17-837GRTVAYFGWLFVSV.VTDYYLGYMTC-----LFIV--AY----FGYVITAEWPKG....QSVRAWWHQQR.GLIW-----
Q49X28_STAS1/19-851KKIGLFIFAIALTL.FSNFYFSYYEA-----IVLL--AY----VAYRF...IFPHP...TDLVSRK.....QQLI-----

PF05007

GPI14_YEAST/127-386------ISTRG---------------------------------------------------------------------
GPI14_SCHPO/112-368------ISTRG---------------------------------------------------------------------
PIGM_TRYB2/134-410------VSTRG---------------------------------------------------------------------
PIGM_RAT/140-408------VSSRG---------------------------------------------------------------------
Q17515_CAEEL/146-405------ISARG---------------------------------------------------------------------
Q9W2E4_DROME/177-450------ISTRG---------------------------------------------------------------------

PF06728

A8N7A6_COPC7/15-379QE.GLWLFNHG.I...........DP-----YAGG--T.--------------------FR..........HSPL-----
Q5CYY5_CRYPI/10-436LE.FCALKEYG.I...........ST-----YYES--KR--------------------VN..........FPAV-----
B6AHL5_CRYMR/12-437KD.SCTLIKSG.I...........SP-----YVSY--N.--------------------IR..........FPVL-----
B0E7Z2_ENTDS/6-295........................QP-----....--..--------------------............NETL-----
B8A6Z1_ORYSI/11-376AE.GYWLKQAS.M...........SP-----YA..--..--------------------................-----
Q9LN74_ARATH/14-421AE.GYWLKQSS.L...........SP-----YAGS--M.--------------------YH..........GSPL-----
B9RC32_RICCO/30-452AE.GYWLKQLS.I...........SP-----YAGS--M.--------------------YH..........GSPL-----
B9GKM7_POPTR/14-432AE.GYWLKQSS.I...........SP-----YAGS--M.--------------------YH..........GSPL-----
A9TIH7_PHYPA/73-514AE.GYWLKEYG.K...........SP-----YAGS--A.--------------------YH..........GSPL-----
B3N7C2_DROER/10-386QE.GIFLLQSG.I...........DP-----YQGD--L.--------------------VH..........ESPL-----
B4N1B7_DROWI/10-386QE.GVFLLEHD.I...........DP-----YSGD--L.--------------------VH..........ESPL-----
B4KI55_DROMO/10-386QE.GVFLLQQG.V...........DP-----YRGD--L.--------------------VH..........ESPL-----
Q16H22_AEDAE/9-388IE.GAYLYANG.T...........NP-----YEGD--L.--------------------YH..........QNPF-----
B0W4N5_CULQU/8-388VE.GAYLYANG.T...........NP-----YDGD--L.--------------------YH..........QNPF-----
Q7Q3W6_ANOGA/8-396EE.GAYLYANG.V...........NP-----YDGD--V.--------------------YH..........KNPL-----
B7QL74_IXOSC/11-391TE.GLYLQRMQ.M...........SP-----YDGD--V.--------------------FH..........EPPL-----
PIGU_CRIGR/10-394VE.GLSLLDLG.V...........SP-----YSGA--V.--------------------FH..........ETPL-----
Q4RLI5_TETNG/10-394VE.GLALLDLG.V...........SP-----YSGD--V.--------------------FH..........ETPL-----
Q28CK0_XENTR/10-394VE.GMALLDLG.V...........SP-----YSGD--L.--------------------FH..........ETPL-----
A7S3Y0_NEMVE/14-406EE.GLSLLSHG.V...........SP-----YSGD--V.--------------------VH..........ESPL-----
C1BQW5_9MAXI/19-392LE.GAKMSSMG.L...........DP-----YSGV--I.--------------------VH..........ETPL-----
C1BTB5_9MAXI/14-387VE.GVMMSKLG.Y...........DP-----YSGV--I.--------------------VH..........ETPL-----
Q54T45_DICDI/55-469VE.GLHLRELG.L...........SP-----YAGS--A.--------------------YH..........QPPL-----
Q758M8_ASHGO/10-356QE.GVFLLQNN.L...........PV-----YDGG--V.--------------------VH..........HLPL-----
C5DB98_LACTC/10-356QE.GVFLLQND.F...........PL-----YSGG--V.--------------------MH..........HAPL-----
Q6CPH2_KLULA/10-358QE.GAYLLLHN.L...........PI-----YDGG--V.--------------------VH..........HVPL-----
Q6KCB8_SACBA/10-360QE.GIYLLRNN.I...........QV-----YNHG--V.--------------------VH..........HPPI-----
C5DUS6_ZYGRC/10-359NE.GIFLLRNG.F...........PL-----YDGG--V.--------------------VH..........HPPL-----
A7TF02_VANPO/11-360QE.GIFLLNNG.F...........PL-----YSGG--V.--------------------VH..........QSPL-----
Q6FSI7_CANGA/9-374SE.GVFLYDNG.F...........PL-----YNGG--V.--------------------VH..........HSPL-----
C5MHK2_CANTT/9-395QE.SFYYFNHN.I...........NL-----YDGG--I.--------------------NN..........HPPL-----
Q5AGH5_CANAL/13-440QE.SIFYFLYN.I...........EL-----YNGG--V.--------------------NH..........TPPI-----
A5E2K6_LODEL/111-490QE.AFFFLNSS.I...........DL-----YDGG--V.--------------------NH..........HPPL-----
Q6BPY5_DEBHA/9-390KE.AFYYLQHN.I...........DL-----YDGG--V.--------------------NH..........HPPL-----
A3LVF4_PICST/9-390LE.AFYYLHHN.I...........NL-----YDGG--V.--------------------NH..........HPPL-----
C4Y9V1_CLAL4/8-389RE.AVYFLQNG.M...........DA-----YDGG--L.--------------------VH..........HPPL-----
C4R1V8_PICPG/4-353QE.EFFLQHIR.H...........T.-----....--..--------------------VT..........TSPL-----
C0RYW5_PARBP/12-388QE.GVFLYTRN.V...........SP-----YDGG--V.--------------------YH..........QAPI-----
C5FSQ4_ARTOC/12-388QE.GLFLYLRN.V...........SP-----YDGG--V.--------------------FH..........QAPI-----
B6H480_PENCW/12-387QE.GLFLYTRN.V...........SP-----YDGG--V.--------------------FH..........QAPL-----
A2QI87_ASPNC/12-388QE.GLFLYMRN.V...........SP-----YDGG--V.--------------------FH..........QAPL-----
B6QEM6_PENMQ/12-390QE.GLFLYTRN.V...........SP-----YEGG--V.--------------------FH..........QAPL-----
B2WBA6_PYRTR/13-388QE.GVFLHTHN.V...........SP-----YDGG--V.--------------------FH..........QAPL-----
B2A9S5_PODAN/16-388.Q.GLFLYNHN.V...........SP-----YDGG--V.--------------------YH..........QAPL-----
Q6MUS3_NEUCS/16-392QE.GLFLYNHN.V...........SP-----YDGG--V.--------------------YH..........QAPL-----
Q6C5L4_YARLI/7-382QE.GLYLYKQG.I...........DP-----YDGG--I.--------------------FH..........QSPL-----
Q55ZX0_CRYNB/19-375QE.GVFIYEHG.T...........SP-----YSGG--T.--------------------FY..........HSPI-----
B0D118_LACBS/9-373QE.GIYLFNHD.I...........DI-----YSGG--T.--------------------FR..........HSPL-----
Q4PGW0_USTMA/31-470ME.THHLFRHPPIPVASSRSLLPSDP-----YSAG--T.--------------------VH..........HTPL-----
PIGU_SCHPO/10-372RE.GLYLYENG.L...........DP-----YSGG--V.--------------------FY..........QSPL-----
B6K154_SCHJY/14-372KE.GYYLYKKG.I...........DP-----YEGV--V.--------------------FF..........QSPF-----
Q22672_CAEEL/31-382KD.SIAMVDDG.L...........NP-----FEAK--N.--------------------MH..........FPPL-----
A8X654_CAEBR/27-380KD.GIAMLDDG.L...........DP-----FETK--N.--------------------MH..........FLPL-----
Q01AL0_OSTTA/12-375REAAYAVRALGVS...........SA-----YDGS--A.--------------------YH..........GHPA-----
C1EBB5_MICSR/13-406RE.GHALWGMG.Q...........SP-----YGGS--A.--------------------LH..........APPL-----
C1MV77_MICPC/13-431RE.GDALRRLG.Q...........SP-----YAGS--A.--------------------LH..........APPL-----
C5L3N8_PERM5/23-419QEAVAALSKGA.............DP-----YAAS--L.--------------------FH..........QPPL-----
Q4UC96_THEAN/14-414HE.YIELFRCSNY...........KS-----YMKS--RP--------------------FYYFIIKRLTFMYPDL-----
Q4YTZ9_PLABA/82-516YDSYILSKRYK.............DI-----YSFL--V.--------------------LR..........INPI-----
Q8IE19_PLAF7/127-560YDSYVLRILKK.............DM-----YSSL--V.--------------------IR..........INPI-----
B3L8S4_PLAKH/95-534YESDILGRLSA.............DV-----YSSL--T.--------------------VR..........INPL-----
B6KRJ9_TOXGO/75-514RE.ALTLHALS.F...........SP-----YTGG--V.--------------------YR..........QQPL-----
A0DGJ7_PARTE/1-357RE.AKYLIANN.Y...........NP-----YNTD--G.--------------------IF..........QKPL-----
B8C4L2_THAPS/71-579SDDVVRKAKGGYS...........AI-----YTPG--TR--------------------IV..........SPPL-----

PF09594

PIME_MYCS2/91-321------------------------PP-----FAAI--V---------------------------------FYPL.H...
A0JZG9_ARTS2/73-321------------------------PP-----FAAL--L---------------------------------FALL.A...
Q73YN6_MYCPA/82-326------------------------PP-----LAAI--V---------------------------------FCPF.A...
Q2MF52_STRLV/80-314------------------------PP-----FAAL--F---------------------------------LWPL.H...
A5ERG5_BRASB/100-323------------------------PP-----PFLF--V---------------------------------AALL.A...
B1K2K9_BURCC/104-334------------------------PP-----SYLL--A---------------------------------VTPL.A...
Q1BSC4_BURCA/94-319------------------------PP-----TFLL--V---------------------------------ILPF.G...
E0TET4_PARBH/112-335------------------------PP-----TFAL--L---------------------------------MSPL.K...
Q1QK36_NITHX/92-360------------------------PP-----LSAI--L---------------------------------LAIP.S...
A8LXF0_SALAI/84-339------------------------PP-----FAGL--A---------------------------------MLPM.A...
Q1DFL5_MYXXD/100-338------------------------AP-----ITAP--L---------------------------------FLPF.T...
Q1LAW9_RALME/87-313------------------------PP-----TFLL--V---------------------------------VLPL.G...
Q0RAR1_FRAAA/151-401------------------------DR-----RSAV--F---------------------------------.........
Q2J8W8_FRASC/88-337------------------------PP-----IAAV--L---------------------------------FTPF.A...
Q9HN16_HALSA/81-322------------------------PP-----VAVA--L---------------------------------FVPQ.A...
A7NFV7_ROSCS/391-632------------------------PP-----FYGM--L---------------------------------FVPF.V...
Q1B9V9_MYCSS/90-325------------------------PP-----GGTL--L---------------------------------LAPF.G...
Q6N414_RHOPA/73-354------------------------PP-----TFAL--L---------------------------------MGPF.AHPL
Q8KF88_CHLTE/91-313------------------------PP-----SFYF--V---------------------------------VLPL.A...
Q9X7Z2_STRCO/66-306------------------------PP-----AAAF--A---------------------------------VLSP.G...
Q82C69_STRAW/73-314------------------------PP-----FAAL--L---------------------------------FTPL.T...
A6W4J4_KINRD/75-318------------------------PT-----FSAV--L---------------------------------SIPL.A...
Q8NNL7_CORGL/75-325------------------------PP-----FGAL--V---------------------------------FTPL.....
A6LI36_PARD8/70-300------------------------GI-----PFTA--I---------------------------------IAPF.S...
Q1BEU7_MYCSS/84-314------------------------PP-----FAAL--L---------------------------------FYPL.H...
Q2T300_BURTA/118-340------------------------PP-----QTLL--L---------------------------------VAPL.G...
Q0S7Q3_RHOSR/72-303------------------------AP-----FAAI--L---------------------------------FAPM.A...
O69571_MYCLE/80-324------------------------PP-----LAAI--A---------------------------------FCPF.A...
Q0S430_RHOSR/96-330------------------------PP-----FAAL--V---------------------------------FFPL.H...
Q1BJ26_BURCA/118-340------------------------PP-----TMLL--L---------------------------------VLPL.G...
A0QW28_MYCS2/90-325------------------------PP-----GGTL--L---------------------------------LAPF.G...
A9W380_METEP/98-320------------------------PP-----PFNL--V---------------------------------VAVL.A...
Q8KF86_CHLTE/520-743------------------------PP-----SYYL--L---------------------------------ILPL.A...
A4X3Z6_SALTO/69-305------------------------PP-----FGAL--L---------------------------------LSPF.A...
P71970_MYCTU/94-329------------------------PP-----GGTL--L---------------------------------MAPF.G...
A7AAB1_9PORP/77-308------------------------GP-----IFAL--V---------------------------------IAPF.S...
A0PTL6_MYCUA/80-324------------------------PP-----LSAV--V---------------------------------FSPF.A...
A5FWG6_ACICJ/133-359------------------------PP-----PSLL--T---------------------------------TLPL.....
A4QI28_CORGB/146-378------------------------PV-----VDVI--P---------------------------------FHTL.P...
Q8EXK5_LEPIN/120-368------------------------PP-----TFAF--L---------------------------------LIPI.S...
Q6NG43_CORDI/98-348------------------------SP-----GATA--L---------------------------------LSPI.G...
A4LNL6_BURPE/93-323------------------------PP-----TLLV--L---------------------------------VTPL.A...
A4F662_SACEN/84-314------------------------PP-----FALL--P---------------------------------LAPF.A...
A4YMG5_BRASO/52-323------------------------PL-----IYLL--P---------------------------------YVVR.H...
A6CF56_9PLAN/79-322------------------------PP-----SANL--I---------------------------------AVPF.A...
Q8FNR9_COREF/132-368------------------------PP-----IAAV--V---------------------------------FTPL.L...
Q8FNS1_COREF/85-333------------------------PP-----IGAA--L---------------------------------FAPF.GY..
A1UKF4_MYCSK/110-340------------------------PP-----FAAL--L---------------------------------FYPL.H...
Q2IKA8_ANADE/104-327------------------------PP-----QALL--V---------------------------------VYPL.A...
Q8NNL6_CORGL/93-341------------------------PP-----IGAI--L---------------------------------FAPW.GY..
A7I755_METB6/60-298------------------------PP-----HTLF--F---------------------------------FWLL.Q...
Q1AS45_RUBXD/75-307------------------------PP-----LWVL--L---------------------------------SAPL.G...
A3PTP0_MYCSJ/72-303------------------------PP-----FAAI--L---------------------------------FRPL.T...
Q0SHP5_RHOSR/98-332------------------------PP-----LAAV--V---------------------------------FSPL.S...
A1TAY8_MYCVP/79-323------------------------PP-----LAAV--A---------------------------------FAPF.A...
Q0KDP9_CUPNH/92-320------------------------PP-----TFLL--F---------------------------------VMPL.S...
Q7MTZ4_PORGI/65-295------------------------GP-----VFSI--L---------------------------------FAPF.A...
A4XDG1_SALTO/368-608------------------------QP-----GMAL--F---------------------------------GLPR.A...
Q73W67_MYCPA/92-327------------------------PP-----GGTL--L---------------------------------MAPF.G...
A1KHU9_MYCBP/103-334------------------------PP-----FAAV--V---------------------------------FYPL.H...
A0JZG6_ARTS2/141-392------------------------PP-----FAAV--L---------------------------------FSLL.A...
A8M762_SALAI/67-302------------------------PP-----FAAL--V---------------------------------MLPM.A...
Q2G5A3_NOVAD/106-326------------------------PP-----PYLF--L---------------------------------VAPL.G...
Q8A2B6_BACTN/67-296------------------------GI-----SFTA--L---------------------------------ISPF.A...
Q0C0G8_HYPNA/93-341------------------------LP-----IVAY--L---------------------------------FAPF.G...
Q394F5_BURS3/104-334------------------------PP-----TNLL--L---------------------------------VTPL.S...
Q1ITA1_KORVE/92-336------------------------TP-----FSVL--P---------------------------------MIPF.T...
Q4JVC2_CORJK/78-310------------------------SP-----GATL--L---------------------------------LSPL.S...
Q5Z2C4_NOCFA/88-323------------------------PP-----LAAL--F---------------------------------FAPL.A...
Q0S1F1_RHOSR/88-319------------------------PP-----SGTL--L---------------------------------MAPI.A...
Q7UFG8_RHOBA/89-337------------------------SP-----VILL--M---------------------------------HAPL.A...
Q5YR74_NOCFA/76-310------------------------PP-----FAAL--V---------------------------------LAPF.A...
Q82B65_STRAW/52-287------------------------TP-----FGGL--V---------------------------------LKPL.T...
A6WEV4_KINRD/63-293------------------------PP-----FAAI--L---------------------------------FVPL.L...
Q6A9X9_PROAC/81-311------------------------PP-----FAAI--A---------------------------------LTPL.A...
A4JSX6_BURVG/118-340------------------------PP-----TMLL--L---------------------------------VAPL.G...
Q46XY5_CUPPJ/144-366------------------------PP-----TFLI--L---------------------------------VLPL.G...
B2U6Q0_RALPJ/105-334------------------------PP-----TFLL--L---------------------------------IYPI.G...
Q8A2B7_BACTN/70-300------------------------GI-----PFTL--L---------------------------------IAPF.S...
A1K2E7_AZOSB/76-322------------------------PP-----PSIA--F---------------------------------FLPL.A...
Q1LQN5_RALME/107-328------------------------PP-----MSLW--F---------------------------------VLPF.G...
Q82AJ1_STRAW/66-309------------------------PP-----AAAL--A---------------------------------ILSP.A...
A4F642_SACEN/68-304------------------------PP-----FAAI--L---------------------------------FTPL.T...
Q6NEL0_CORDI/90-330------------------------PP-----FAAL--A---------------------------------FVPF.T...
Q89QR1_BRAJA/100-368------------------------PP-----LPAI--L---------------------------------LAIP.S...
Q4JVV2_CORJK/84-315------------------------PP-----FSGV--I---------------------------------FRVL.P...
A5ESS8_BRASB/89-311------------------------PP-----TFLL--A---------------------------------LIPL.G...
A4TCS8_MYCGI/75-310------------------------PP-----GGTL--I---------------------------------IAPF.G...
Q5YTA9_NOCFA/80-311------------------------PP-----GGTL--L---------------------------------IAPI.A...
Q73WN6_MYCPA/105-337------------------------PP-----FAAI--V---------------------------------FYPL.H...
Q8FNS2_COREF/71-313------------------------PP-----FGAV--V---------------------------------FTPL.....
A4Z0F4_BRASO/98-322------------------------PP-----FFFA--I---------------------------------AAIT.A...
Q1AX69_RUBXD/44-303------------------------PP-----GSLP--V---------------------------------FVPP.A...
Q5YQC7_NOCFA/78-313------------------------PP-----FAAL--V---------------------------------FSPL.H...
Q8FPI8_COREF/95-327------------------------NP-----GATL--L---------------------------------LAPL.G...
Q6M3Q3_CORGL/95-331------------------------PP-----ISAA--L---------------------------------FVPL.A...
B2U6P6_RALPJ/116-345------------------------PP-----TFLP--F---------------------------------IAPF.G...
Q1BEU6_MYCSS/107-340------------------------PA-----FAAM--V---------------------------------FYPL.H...
Q0B1Z4_BURCM/118-340------------------------PP-----TMLM--F---------------------------------VLPL.G...
Q2J4C1_FRASC/151-408------------------------DM-----RSAV--F---------------------------------.........
Q2IYK2_RHOP2/73-354------------------------PP-----FFAL--L---------------------------------MGPF.AYPL
A8L2W5_FRASN/98-313------------------------PY-----LVSL--P---------------------------------FVPL.S...
A3TJ63_9MICO/77-315------------------------PP-----FAAL--L---------------------------------AIPL.A...
Q133X5_RHOPS/73-354------------------------PP-----TFAL--L---------------------------------MGPF.AYPL
Q4JU29_CORJK/82-316------------------------PP-----ISAV--L---------------------------------FTPL.A...
Q2CA47_9RHOB/80-334------------------------PP-----LWAV--V---------------------------------ASWIAP...
A6LBC6_PARD8/70-301------------------------GI-----LFSL--I---------------------------------IAPF.A...
A0K2K9_ARTS2/112-358------------------------PV-----LMGI--I---------------------------------AGLT.A...
Q0BA39_BURCM/102-332------------------------PP-----TYLL--L---------------------------------VTPL.A...
Q20YY7_RHOPB/103-326------------------------PP-----FFFA--V---------------------------------AMAV.A...
A4T4C3_MYCGI/71-305------------------------TP-----FSAL--V---------------------------------FAPL.E...
Q1LQN6_RALME/104-332------------------------PP-----TFLL--V---------------------------------VLPL.A...
A1R1N0_ARTAT/81-341------------------------PI-----LALI--P---------------------------------MGLA.A...
Q0B8R5_BURCM/84-310------------------------PP-----TFLL--V---------------------------------VIPF.G...
A0NV37_9RHOB/121-344------------------------PP-----TFQM--L---------------------------------QMSF.A...
Q2K4Q8_RHIEC/84-305------------------------PP-----ISAL--L---------------------------------FQTF.G...
Q0FSE7_9RHOB/90-316------------------------PP-----HMFP--V---------------------------------AQLA.A...
Q2J920_FRASC/92-305------------------------PY-----LTAM--P---------------------------------FAPL.S...
A4YMG3_BRASO/104-327------------------------PP-----PFLF--V---------------------------------AAFV.A...
A1RC95_ARTAT/101-341------------------------PV-----LIGI--I---------------------------------AGVT.A...
Q82GI4_STRAW/88-314------------------------PP-----FAAL--L---------------------------------FVPT.T...
Q135L9_RHOPS/90-313------------------------PP-----VLLL--L---------------------------------TAPL.A...
A7I7Y5_METB6/97-335------------------------PP-----HTLY--F---------------------------------FVILDQ...
A3XXU2_9VIBR/89-316------------------------SP-----QMLV--V---------------------------------LAPF.S...
Q53IC1_STRGR/68-304------------------------PP-----FAAL--V---------------------------------FTPL.S...
Q8FLP5_COREF/222-454------------------------PL-----VETL--P---------------------------------FNSL.P...
Q3L9S4_RHOE4/54-285------------------------SP-----FAAI--I---------------------------------FAPM.A...
A4FR42_SACEN/78-325------------------------PP-----FAAI--L---------------------------------FAPL.A...
A3S009_RALSL/111-339------------------------PP-----TFLL--L---------------------------------VLPL.S...
Q023J8_SOLUE/86-296------------------------LP-----FYAA--W---------------------------------ISPL.R...
Q9CBX0_MYCLE/105-336------------------------PP-----FAAV--V---------------------------------FYPL.H...
A4FGU5_SACEN/82-312------------------------PP-----FALL--P---------------------------------LAPL.A...
A1U9Z3_MYCSK/75-305------------------------TP-----FSAL--C---------------------------------FLPL.I...
Q82NJ1_STRAW/66-299------------------------PP-----FAAL--G---------------------------------MLPM.A...
Q6NF60_CORDI/70-290------------------------TP-----FAGL--I---------------------------------FKFL.S...

PF03155

ALG8_HUMAN/19-514LPISQWYYEATSE.----------..-----.WTL--D---------------------------------YPPFFA---
ALG8_SCHPO/12-497LPISEWYKSSISE.----------..-----.WTL--D---------------------------------YPPFFA---
ALG6_HUMAN/12-491LPVKQWYFNSSDNN----------LQ-----YWGL--D---------------------------------YPPLTA---
ALG6_DROME/10-465LAVGEWYTNSSNND----------LQ-----YWGL--D---------------------------------YPPLTA---
ALG8_YEAST/49-570LPISEWYYEHTSQ.----------..-----.WTL--D---------------------------------YPPFFA---
ALG6_YEAST/44-531LPLSKWYWYD....----------LQ-----YWGL--D---------------------------------YPPLTA---
ALG6_CAEEL/54-494LPIEQWYLNGTHND----------LL-----YWGL--D---------------------------------YPPITA---
ALG6_SCHPO/33-487TPVSQWYFRD....----------LQ-----WWGL--D---------------------------------YPPLTA---
ALG8_DROME/10-485LPLNQWYVDATSE.----------..-----.WTL--D---------------------------------YPPFFA---

PF01277

OLEO2_ORYSJ/32-149------------------------SA-----SQAL--T---------------------------------VATL-----
OLEO2_ARATH/50-167------------------------SS-----TQVL--S---------------------------------LLIG-----
O04925_SESIN/24-138------------------------ST-----SQVL--A---------------------------------VVTL-----
OLEO1_SOYBN/52-169------------------------TT-----SQVL--