Sequence alignment for CL0114

PF09011

A2E233_TRIVA/26-97--------------------------------------------------------------------------------
C3Z277_BRAFL/6-77--------------------------------------------------------------------------------
MAEL_XENTR/2-73--------------------------------------------------------------------------------
MAEL_HUMAN/2-73--------------------------------------------------------------------------------
B3S6M5_TRIAD/36-107--------------------------------------------------------------------------------
E7F0H8_DANRE/6-79--------------------------------------------------------------------------------
F7DZV4_ORNAN/34-106--------------------------------------------------------------------------------
Q66IB6_DANRE/7-78--------------------------------------------------------------------------------
V4ZPN8_TOXGO/64-141--------------------------------------------------------------------------------

PF00505

MTMC3_SCHPO/103-171--------------------------------------------------------------------------------
HMGH_IIV6/54-122--------------------------------------------------------------------------------
YF98_SCHPO/195-263--------------------------------------------------------------------------------
NHP6A_YEAST/21-89--------------------------------------------------------------------------------
UBF1_HUMAN/112-180--------------------------------------------------------------------------------
HMGL_SOYBN/44-113--------------------------------------------------------------------------------
LEF1_MOUSE/297-365--------------------------------------------------------------------------------
HMGL_WHEAT/42-111--------------------------------------------------------------------------------
TFAM_MOUSE/49-117--------------------------------------------------------------------------------
HMGH_STRPU/100-168--------------------------------------------------------------------------------
SRY_GORGO/60-128--------------------------------------------------------------------------------
SOX2_CHICK/39-107--------------------------------------------------------------------------------
HMGB1_RAT/95-163--------------------------------------------------------------------------------
TFAM_HUMAN/50-118--------------------------------------------------------------------------------
ABF2_YEAST/43-111--------------------------------------------------------------------------------
SSRP1_DROME/555-621--------------------------------------------------------------------------------
SOX4_HUMAN/59-127--------------------------------------------------------------------------------
SSRP1_HUMAN/547-615--------------------------------------------------------------------------------
MATD_NEUCR/147-215--------------------------------------------------------------------------------
A7AVG2_BABBO/23-92--------------------------------------------------------------------------------
B2ABG5_PODAN/169-237--------------------------------------------------------------------------------
G3GTI9_CRIGR/15-83--------------------------------------------------------------------------------
G4U6E3_NEUT9/116-184--------------------------------------------------------------------------------
I7MKQ6_TETTS/18-86--------------------------------------------------------------------------------
M2RF48_COCSN/126-193--------------------------------------------------------------------------------
Q23QF5_TETTS/161-229--------------------------------------------------------------------------------
Q57XJ9_TRYB2/118-186--------------------------------------------------------------------------------

PF08073

X1XTS3_ACYPI/144-197--------------------------------------------------------------------------------
T1JDG0_STRMM/147-200--------------------------------------------------------------------------------
E9FRV7_DAPPU/197-250--------------------------------------------------------------------------------
Q16K27_AEDAE/151-204--------------------------------------------------------------------------------
T1I428_RHOPR/17-70--------------------------------------------------------------------------------
H9G906_ANOCA/209-262--------------------------------------------------------------------------------
CHD3_CAEEL/97-150--------------------------------------------------------------------------------
U1MF28_ASCSU/95-147--------------------------------------------------------------------------------
J0XKG3_LOALO/9-60--------------------------------------------------------------------------------
H2W8R5_CAEJA/91-144--------------------------------------------------------------------------------
Q7PZN7_ANOGA/153-206--------------------------------------------------------------------------------
G4V7W2_SCHMA/80-133--------------------------------------------------------------------------------
K7H9V4_CAEJA/95-148--------------------------------------------------------------------------------
D6X1V1_TRICA/150-203--------------------------------------------------------------------------------
H3ENB4_PRIPA/94-144--------------------------------------------------------------------------------
W4Z592_STRPU/127-180--------------------------------------------------------------------------------
B7PLQ0_IXOSC/143-196--------------------------------------------------------------------------------
LE418_CAEEL/95-147--------------------------------------------------------------------------------
E5SBN8_TRISP/115-164--------------------------------------------------------------------------------
B4IXP0_DROGR/132-185--------------------------------------------------------------------------------
F6PLL0_MONDO/66-119--------------------------------------------------------------------------------
H2Y0G6_CIOIN/133-183--------------------------------------------------------------------------------
H9J096_BOMMO/143-196--------------------------------------------------------------------------------
K1RRH1_CRAGI/112-162--------------------------------------------------------------------------------
U6HHQ2_ECHMU/73-126--------------------------------------------------------------------------------
G0MX39_CAEBE/81-132--------------------------------------------------------------------------------
E0W1M0_PEDHC/141-194--------------------------------------------------------------------------------

PF06382

Q9VAF7_DROME/1-125M..............................................---------------............GRKRGR
Q9V3S3_DROME/1-146MSSNNVNECKSLWNGIISISAKDESPKGLTEMCNHPIRRAPQKCKPM---------------KSCAKPRRKAACAKATRP

PF04690

M0TDS3_MUSAM/5-158LPP.EHICYVHCNFCNTILAVSVPGNS...LFSIVAVRCGHCCNLLS..VNMGDLLQKL...PL.QD..........LQT
I1P2J5_ORYGL/20-212SPT.EQLCYVHCNCCDTILAVGVPCSS...LFKTVTVRCGHCANLLS..VNLRGLLL.....PAPAP..........AP.
YAB2_ORYSJ/6-161VPAPEHVCYVHCNFCNTIFAVSVPSNS...MLNIVTVRCGHCTSLLS..VNLRGLVQAL...PAEDH.............
K3YV50_SETIT/21-214SPT.EQLCYVHCNCCDTILAVGVPCSS...LFKTVTVRCGHCANLLS..VNLRGLLL.....PPAAP...........PA
M4ES51_BRARP/5-163LSS.DRVCYVLCNFCTTTLAVSVPYAS...LFTLVTVRCGHCTNLLS..LNIGVSLHQSSPPPIHQD..........LQP
W5GJ21_WHEAT/19-203SPT.EQLCYVHCNCCDAILAVGVPCSS...LFKTVTVRCGHCANLLS..VNLRALLL.....PPAAP...........P.
D7U7V5_VITVI/14-174PTS.DQLCYVHCNFCDTVLAVSVPCTS...LFKTVTVRCGHCTNLLS..VNMRGLLL.....P.AAN.............
K7K1G3_SOYBN/57-210DLP.EQICYVECGFCATILMVSVPSSS...LSMVVTVKCGHCTSVLS..VNMMKASFV....PF.HL..........LAS
B9HTW7_POPTR/9-170DPP.DQICYVQCGFCTTILLVSVPCSS...SSTVVTVICGHCSSLLS..VNLTKISFL....PF.NL..........LTS
B9RQ61_RICCO/5-157LVS.ERVCYVHCNFCNTILAVSVPSSN...LLTIVTVRCGHGANLLS..VNMGGSLQTF...PL.QD..........PQS
I1R7Z4_ORYGL/6-177APA.EQVCYVHCNFCNTILAVSVPGNS...MLNIVTVRCGHCTNLLS..VNLRGLMHSA...PALQD.............
M0TFF3_MUSAM/16-188SPS.EQLCYAYCNFCDTILAVSVPRSS...LFMTVTVKCGKCTNLLS..VNARGLLF.....PEVNQ.............
W1P3Y5_AMBTC/9-163EFP.EQLCYVQCTFCDTILLVSVPCSS...MLKMVTVRCGHCNNLLS..VNMKLRASFL...PL.HL..........ISS
D7U8S1_VITVI/5-156IAS.ERVCYVHCNFCNTILAVSVPCTS...VFNAVTIRCGHCANLLS..VNMGALLQTV...PL.HD..........LQK
K4AZ41_SOLLC/23-182.SG.EQLCYVQCNFCDTVLAVSVPCSS...FFKNVTVRCGHCTNLLS..VNI...IL.....PTAAN.............
I1IC11_BRADI/21-215SPT.EQLCYVHCNCCDTILAVGVPCSS...LYKTVAVRCGHCANLLS..VNLRGLLL.....PPAAP...........P.
K3Z9T7_SETIT/6-168APA.DHVCYVHCNFCNTVLAVSVPGNS...MLNIVTVRCGHCTNLLS..VNLRALMHSL...PEQDH...........QL
C5XS56_SORBI/20-212SPT.EQLCYVHCNCCDTILAVGVPCSS...LFKTVTVRCGHCANLLS..VNLRGLLL.....PPAAP...........P.
K4CNR9_SOLLC/17-179.PS.EQLCYVHCNVCDTVLAVSVPCTS...LFKTVTVRCGHCTNLLP......GWLL.....PSTNH.............
B9HLS8_POPTR/9-163DLP.DQICYVQCGFCTTILLVSVPCSS...LSTVVTVICGHCTSLFS..VNMKKFSFL....PF.NR..........STS
K4CBT7_SOLLC/7-163VAS.DQLCYIPCNFCNIVLAVSVPCSS...LFDIVTVRCGHCTNLWS..VNMAAAFQS....SSSAS..........WQN
B9GVI4_POPTR/13-176PSS.EQLCYVHCNICDTVLAVSVPCTS...LFKTVTVRCGHCTNLLP..VNMRGLLL.....P.SAN.............
YAB1_ORYSJ/5-157FTS.EHVCYVNCNYCNTILVVNVPNNC...SYNIVTVRCGHCTMVLS..MDLAPFHQART..VQDHQ..........VQN
B9IBX2_POPTR/15-176.SS.DQLCYVHCNFCDTVLAVSVPCSS...LFKTVTVRCGHCTNLFS..VNMRSLL......P.AAN.............
J3LF87_ORYBR/19-210SPT.EQLCYVHCNCCDTILAVGVPCSS...LFKTVTVRCGHCANLLS..VNLRGLLH.....PPPAP...........P.
K7LVV0_SOYBN/6-165MAT.ERVCYVHCNFCNTTLAVSVPCSS...LLTIVTVRCGHCANLLT..VNMGASLQTF...PS.QDTTQRFSTVGKLQR
M0S7H6_MUSAM/5-178VLP.EHICYVHCNFCNTVLAVSVPGNS...LLNIVTVRCGHCSNLLS..VNMGALLQAL...PF.QS..........LQH
M0RT32_MUSAM/18-181.PS.EQLCYVHCNLCDTVLAVSVPFTS...LFKTVTVRCGHCTNLLS..VNMRGLHL.....P.PAN.............
M0TBQ3_MUSAM/5-155VAP.EHICYVHCNFCNTILAVSVPGNK...LFNMVTVRCGHCANLLS..VHMGSVLHTL...PL.QD..........LQT
K7L9I2_SOYBN/9-163DLP.EQICYVQCGFCTTILMVSVPCSI...LSTVVTVRCGHCTSLLS..VNMKKASFV....PF.HL..........LAS
I1KFH5_SOYBN/6-162MAT.ERVCYVHCNFCNTILAVSVPYSS...LLTIVTVRCGHCANLLS..VNMGASLQAF...PP.QD..........PQS
I1IGA5_BRADI/8-173APA.EQVCYVHCNFCNTVLAVSVPGNS...MLSIVTVRCGHCTNLLS..VNLRGLMHSSAVVPAAQD.............
M0TPL1_MUSAM/17-180.PS.EQLCYVHCNFCDTVLAVSVPYTS...LFKTVTVRCGHCTNLLS..VNMRGLLL.....P.AAN.............
M0SR87_MUSAM/5-158ILP.ERICYVHCNFCNTVLAVSVPGNS...SFNNVAVRCGHCSILLS..VNMGDLLQRL...PF.QD..........FQK
B9SHC4_RICCO/9-171DLP.EQICYVQCGFCDTILLVSVPGSS...LSMVVTVRCGHCTSLLS..VNMMKVSFV....PFQQL..........LAS
M1A5M2_SOLTU/9-164SSS.ERVCYVHCNFCSTILAVSIPCNS...MMTIVTVRCGHCANLLS..VNIAPSLQSL...PI.QD..........LQR
I1IGA3_BRADI/8-179APA.EQVCYVHCNFCNTVLAVSVPGNS...MLSIVTVRCGHCTNLLS..VNLRGLMHSSAVVPAAQD.............
M0RP60_MUSAM/17-180.PS.EHLCYVHCNFCDTDLAVSVPYTS...LFKTVTVRCGHCTNLLS..VNMRALLL.....P.AAN.............
M0TTW3_MUSAM/5-159VLP.EQVCYVNCSFCNTVLVVNIPGNN...SFSIVTVRCGLCANILY..VNLEGLHGVL...PL.QN..........FQN
D7T1M7_VITVI/5-157ITP.ERVCYVHCNFCNTILAVSVPCTS...LFTIVTVRCGHCANLLS..VNMGALLQTV...PT.QD..........LQS
C5X9N5_SORBI/5-159FAS.EHACYVNCNYCNTILVVNVPNSC...SHNIVTVKCGHCTMVLS..MDLSPFHQQARTVPDNQV..........VQN
B9IMX9_POPTR/9-161.PH.EQLCYIPCNFCNIVLAVSVPCSN...LFDIVTVRCGHCTNLWS..VNMAAAFQSL.......S..........WQD
D7LCG5_ARALL/20-189SPS.EHLCYVQCNFCQTILAVSVPYTS...LFKTVTVRCGCCTNLLS..VNMRSYVL.....PASNQ.............
F2ELF4_HORVD/9-178.PA.EQVCYVHCNFCNTVLAVSVPGNS...MFNVVTVRCGHCTNLLS..VSLRGQVHSP..LPAAAQ.............
J3LZX6_ORYBR/28-218.EQ.EQLCYVHCNFCDTILAVGVPCSS...LFKTVTVRCGHCANLLS..VNLRGLLL.....PAAAT.............
B2YHV8_SOLLC/11-171PSS.ERVCYLQCNFCNTILAVSVPCSN...MLTLVTVRCGHCANMLS..VNIGSLIQAL...PL.QD..........VQK
I1J038_BRADI/28-220.EQ.EQLCYVHCNFCDTILAVGVPCSS...LFKTVAVRCGHCANLLS..VNLRSLLL.....PAAAP.............
W5G1Q5_WHEAT/9-179.PA.EQVCYVHCNFCNTVLAVSVPGNS...MLNIVTVRCGHCTNLLS..VSLRGQMHSP..VPPAAQ.............
B9HAJ0_POPTR/9-161.PN.EQLCYIPCNFCNIVLAVSVPCSS...LFDIVTVRCGHCTNIWS..VNMAAAFQSL.......S..........WQD
W1P736_AMBTC/16-193PSS.EHVCYLPCNFCNTILAVSVPCSS...LFKVVTVRCGHCTNLLS..VNMAAVLHAPSLTPAPAN..........LQH
W1NYE0_AMBTC/12-177TPS.EQLCYVHCNFCDTVLAVSVPCSS...LFKMVTVRCGHCTNVLS..VDTRGLLH.....PTAAT.............
D7TDI7_VITVI/9-164DLQ.EQICYVQCGFCTTILLVSVPYSS...LSMVVTVRCGHCASLLS..VNMMKASFV....PL.HL..........LAS
B9HXH8_POPTR/13-167.LSSDHLSYVRCNFCNTVLAVRIPFKR...MLDTVTVKCGHCNNLSF..LSTRS........PNLGN..........FLD
I1J7S5_SOYBN/16-179.PS.DQLCYVHCNFCDTVLAVSVPCTS...LFKTVTVRCGHCTNLLS..VNMRGLLL.....P.SAN.............
I1K9Q9_SOYBN/9-163DLP.EQICYIQCGFCNTILMVSVPCSS...LSMVVTVRCGHCTNLLS..VNMLKASFI....PF.HL..........LAS
B9HIG4_POPTR/11-164VPSSEHLCYVRCNFCNTVLAVGIPCKR...LLDTVTVKCGHCNNLSF..LSTRP........PNQGQ..........CLD
I1GPY5_BRADI/6-160APA.EHVCYVHCNFCNTILAVSVPSNS...MLNIVTVRCGHCTSLLS..VNLRGLIQSL...PVQDH.............
W5BCE7_WHEAT/28-220AEQ.EQLCYVHCNFCDTILAVGVPCSS...LFKTVAVRCGHCANLLS..VNLRNLLL.....PATAN.............
K3Y9G7_SETIT/25-222AEQ.EQLCYVHCKCCDTILAVGVPCSS...LFKTVTVRCGHCANLLS..VNLRGLLL.....PTAAA.............
W1NE60_AMBTC/5-156NAS.EHVCYVQCNLCNTILAVSVPGSC...LFTIVTVRCGHCTNLLS..MNMGALLQTI...PF.HD..........LQN
YAB2_ARATH/5-160FSS.ERVCYVHCSFCTTILAVSVPYAS...LFTLVTVRCGHCTNLLS..LNIGVSLHQTSAPPIHQD..........LQP
YAB3_ARATH/20-201SST.DQLCYVHCSFCDTVLAVSVPPSS...LFKTVTVRCGHCSNLLSVTVSMRALLL.....PSVSN.............
YAB4_ARATH/16-182DLP.GQICHVQCGFCTTILLVSVPFTS...LSMVVTVRCGHCTSLLS..VNLMKASFI....PL.HL..........LAS
B9III3_POPTR/5-159IAS.ERVCYVHCNFCNTILVVNIPCSANSILLNTVTVRCGRCANLLS..LNTGSLLQTSH..PQNSH.............
C5YSF3_SORBI/7-171APA.DHVCYVHCNFCNTVLAVSVPGNS...MLNIVTVRCGHCTNLLS..VNLRALMHSL...PEQDQ.............
I1LZN8_SOYBN/8-159VAP.EQLCYIPCNFCNIVLAVSVPCSS...LFDIVTVRCGHCTNLWS..VNMAAAFQSL.......S..........WQD

PF06244

R0KSX9_SETT2/56-190AEAAAEKAAEAARKKAEKEALLREEEASMPSK..PKGKAPKAEKKT..................................
Q9VE08_DROME/93-211.RQMIL..EEMEKKQRVIE.............AINEANKPMAARVVVQNH.IE...........................
G7YAF9_CLOSI/113-230TQAQIA..AARANLAAQLA...................ALNKKNQEQSEQELA...........................
I1RMC8_GIBZE/52-188KEAAAAKAAEAEKKKAEKAALEAEEDANNPVKG.PK.KSKAPVKKA..................................
D7KDN9_ARALL/102-226TEAELIRRREEEQVALAKK...........AEDSKKKQTRMAGEDEYEKMVLV...........................
A4HVI1_LEIIN/55-236KKREMEQKQEAKATRDAEKREQLEEEEREMNVKVPKKVAQRQIQKDLAKMLADYDKERTALRGGQHGAVVKPEKTEEAPL
E0VAF2_PEDHC/93-206TRAQIL..EETEKRNAAAT....................KKKEPVTHIDKPLE...........................
Q4X4X0_PLACH/118-277TQAQILQRLIEEKKKEMKD..................EKKKTGNVNVHEMELE...........................
R4GLN0_CHICK/95-212TRAQIE..ETIRKDQQQKE.............NA..DTA..EKEKTHLEVPLE...........................
CC124_DANRE/94-208TRAQIE..ETLQSKQNVK..................EIK..EKEKSHLDVPLE...........................
E1ZLB4_CHLVA/97-218TAHQLAQQREREQRQQQQL.............AAQRGQERVVGEAEYVASIDV...........................
C4R6B1_PICPG/35-173SEKDAKKAEELRKKQEREALLKQEEELISAKAKKSGKNAKNASKKGGIDDAFN...........................
B6AE18_CRYMR/93-218TKAEIAQRALKFAMQKSKR......................EYKESDNIDLLV...........................
C1MJE8_MICPC/96-225TQAEIADARKAEAKAAMIA...........KYARAKEAKKETSEEAYAAMVDV...........................
B3RRU8_TRIAD/93-212TRAKIQ..EIQDKEIRDRN.............KA.......QERAKEVSNELE...........................
B8MZC7_ASPFN/52-190KEAEEAKKADAARKKAERDALLAAEEASQPSK..PKGKSNQPVKKS..................................
B3L0Z8_PLAKH/94-214TQAQILQRLIEEKKKEIQE..................DKKKKNNLNVHEMELE...........................
K1R9I3_CRAGI/112-227TKAEID..KHIERERKEKE..................EAAKKEQKELEEPPIE...........................
W1NK94_AMBTC/105-225...ELERRRVQERAEINRR...........AEEAKKRQSRMADEEEYERMVSV...........................
F7EQ85_ORNAN/42-157TRSQIE..DMIRKDQQ.KE.............YE..DSV..EKPKSHLEVPLE...........................
E1FIM0_LOALO/91-211TQATIEANKRAEEERKREE.............EK..ERLLKEQRLGTEEEGIE...........................
G2YZ93_BOTF4/53-196AEAAALKQAELNRKKAEKEALLKAEEAAAPSG..PK.NSKKAEKKP..................................
C1DZF4_MICSR/101-216YKNMSAKDRLKMKFAAQKA..................AARTVDEDEYSSMVDV...........................
K4AM07_SETIT/140-266TEAELARRREEERLRLQRE...........AEAAKKRQARTADEEEYERVVLV...........................
D8RXZ7_SELML/110-229.....ERQREAEAARLAAL...........AAETKRREMRATDEQEYEKMVAV...........................
K3WDG6_PYTUL/143-255...QMRALREEEEAKNAKK....................PGKNAIQFDQPNFR...........................
W4XEG2_STRPU/98-219.RAQVE..ANQERMEKERE.............EA..AAAA.QKQATHLDAPLE...........................
H2XNC6_CIOIN/94-210.RADIEAQKQKEKAEKLVD.......................EKRVSLEDVLE...........................
B4LXA5_DROVI/93-212.RQQII..EELEKKQRVMD.............AINEANKPLAPRVVLQHNTIE...........................
H0X6K7_OTOGA/96-217TRAQIE..DTLRRDYQHKE.............AP..DPA..EKAKSHLEVPLE...........................
H0VY33_CAVPO/95-214TRAQIE..DSLRREQQHRE.............AP..EPVPTEKAKSHLEVPLE...........................
A8IUW8_CHLRE/93-216THYQLQQQREFEDQLKAAE...........AAERDMASRRELSADQYARQVET...........................
A0A023B3J2_GRENI/51-230RKAEADAKADEARRRREERALLERAEAESIQGTTKGATKKGASKPKVTQYQLL......................QRQLL
Q2AAB8_CAEEL/18-139TRAHIHIRKEDEERINREL.............EE..KRKQEAQKIEVAGDLLV...........................
A7RS85_NEMVE/80-201TRAQIT..EHQAKLAAEQE.................KLQKQKQQETIHDEPLE...........................
G1PAA5_MYOLU/97-214TRAQIEETLRRDHQHKEAQ...................EPAEKVKSHLEVPLE...........................
L8FWQ1_PSED2/53-192KEAEAAKKQELARKKAENDALLAEEEKSL..KSAPK.SSKAAPKK...................................
B9SR05_RICCO/102-226TEAELSRRREEEQAELAKK...........AEEMKKKQARTAAEEEYERMVLV...........................
C0H4Y8_PLAF7/94-214TQSEILQKLIEEKKKQLQE..................EKKKKENLNVHEMELE...........................
A7ATI8_BABBO/96-219TRAEILRMQALQAEARAKE...................AASNADNAYCDVTRA...........................
Q2H0K7_CHAGB/53-193KEAEAEKKAEQARKKAEREALLAEEEKNTPGRSAPK.NSKAAVRKT..................................
D7G657_ECTSI/124-250RQAQAEEARKAKAERAEKE.................AKAMRDSGIQMGDDSEL...........................
G1K3G0_XENTR/95-212TRAQIE..ETLHREEEEKG.............EP..DAI..EKPKTHLEIPLE...........................
W5J3U9_ANODA/92-211TRSQID..AEVEKRNRAIE.............TV..SSHPPKTIAEPKVAPLE...........................
Q7QBA5_ANOGA/92-210TRSQIE..ADLEKRQRAIE.............AS..AAVPSKPKVVEKEVPLE...........................
Q4Z043_PLABA/97-259TQAQILQRLIEEKKKEMKD..................EKKKTENTNIHEMELE...........................
D8TGY2_VOLCA/95-216..FQLHQQREFEDRLKEEM...........QAERDLAARREMSAEQYARQVET...........................
C4WUS4_ACYPI/84-202..TQIN..QKITRHQLMKE.............LDTPKNLKSQLTLEEEESSIE...........................
H3B1E2_LATCH/95-212TRAQIE..ETLKKEQQQQE.............NQ..QKD..EGQKSHLEVPLE...........................
U6I1Y6_ECHMU/96-211TQAQIA..AARARLNAQLA...................ALAPKRDVDNLAPLM...........................
T1IPE4_STRMM/95-207.RAQIV.TTVTEKQNKNKT.....................PDKVVYENEKPIE...........................
B0WCY1_CULQU/92-208TRSQIE..AEVEKRNRAIE.................SVNNPPKVVPAKVVPLE...........................
W5M4J7_LEPOC/96-211TRAQIE..ENLQKEPQQAS.................KEK..EKPKSHLDTPLE...........................
F0XUT2_GROCL/53-205KEAEAAKKAEQARKKSEREALLAEEERSLPGRAAPK.NAKSAGKKTSAAAAVT...........................
H9JVF1_BOMMO/95-209TRAQIS..QAKEKMAKPET..................AKPVPSKVVIEEPPLE...........................
G4LXI6_SCHMA/96-211TQAQIA..EAQKKLEAQLL...................ALNQTTQKSEPAELA...........................
M0SS42_MUSAM/102-227TEAELQRRREEERQRILQN...........AEVAKKQKSRSADEEEYDRIVMV...........................
K1X0I7_MARBU/53-191KEAEAAKKAEQARKKAEKDALLAEEEKGA..RALPK.NSKTAVKKS..................................
H2MLV9_ORYLA/86-202TLAQIE..ETLQNERGVEE.................PIR..SRQKSHLETPLE...........................
F2U6S5_SALR5/110-222....MEQEREAKRKAKEAE.....................RDKQKLTVQHFAE...........................
G3P1Q8_GASAC/96-213TRAQIE..EVLQNEVEQQQ.................ELK..PKEKSHLETPLE...........................
R4FK63_RHOPR/96-205....IQ..MAAEKRTKEIK..................EVAKPKVETHLTKPLE...........................
F4Q8R5_DICFS/125-243....IVSSTSSTSTTSTTS...................TTTSGVDSDDEIDLE...........................
Q16YV3_AEDAE/92-207TRAQID..AEVEKRNRAIE.................TVNNPPKPVVPKTPAIE...........................
I1FC80_AMPQE/19-212.RKSAAKREEDERKRQEEEDQYWRDDDKHVARKQDRKADRERKRQDQLDKKLEAKKLLEAEEQGLKGKASSRPPPKVTRA
E4X8S8_OIKDI/105-213QRAALE..AQSNKHKKAGA........................KIVVQNDEIA...........................
F9FFR7_FUSOF/51-188KEAQAAKAAEAEKKKAEKAALQAEDDANTPGKA.PK.KSKAPVKKS..................................
F0VKT5_NEOCL/92-218TRAQIQQRALLAAAQKKKA......................EEEEAKGSPAEM...........................
U6GKQ7_EIMAC/93-219TRAQILQRQLKAAAMEKEA......................SSPSDDGSLARL...........................
G6CMI5_DANPL/94-208TRAQIS..QMKERVIKAEP..................ERPVPSKVVVEDPPLE...........................
C3Z6B4_BRAFL/97-216TQAQIQ..AQLERLRQQAQ....................QKAKRPEQEEAPLE...........................
G0S5J0_CHATD/53-195KELEAQKKAEQARRKAEKEALLAAEEAAIGGRATLK.NSKHAIKKT..................................
M0VS67_HORVD/9-136TEAELVRRREEERLRLERE...........AEAAKKRAARTAEEEEYERVVLV...........................
A9U354_PHYPA/105-228...ELARRKEEEQSALAAQ...........SAAAKKKELRTSGPEEYERLVDV...........................
G9MTL1_HYPVG/52-190KEAEAAKKAEAAQKKAEKEALMKEEEASLNARAEPK.KSKTAVKKS..................................
U1NIQ3_ASCSU/92-212TQAAIEATKRLEEERRKEE.............EK..ERLLREKKIEAEREQVE...........................
I3K409_ORENI/96-214TRAQIE..ETLRNEQQQQE.............QD..QLK..PKEKSHLETPLE...........................
M1BLN4_SOLTU/98-222TEAELRQRKEAEQAALAKK...........AEEDKRRQSRMAAEEEYEKMVLV...........................
M4A2X1_XIPMA/96-212TRAQIQ..EILQNDQQQEL.................EIK..PIEKSHLETPLE...........................

PF14887

E9PLT2_HUMAN/66-150GKL-----------------------------------------------------------------------------
F6ZYJ1_XENTR/232-316AKL-----------------------------------------------------------------------------
H3CF76_TETNG/472-557SRL-----------------------------------------------------------------------------

PF09011

A2E233_TRIVA/26-97--------------------------------------------------------------------------------
C3Z277_BRAFL/6-77--------------------------------------------------------------------------------
MAEL_XENTR/2-73--------------------------------------------------------------------------------
MAEL_HUMAN/2-73--------------------------------------------------------------------------------
B3S6M5_TRIAD/36-107--------------------------------------------------------------------------------
E7F0H8_DANRE/6-79--------------------------------------------------------------------------------
F7DZV4_ORNAN/34-106--------------------------------------------------------------------------------
Q66IB6_DANRE/7-78--------------------------------------------------------------------------------
V4ZPN8_TOXGO/64-141--------------------------------------------------------------------------------

PF00505

MTMC3_SCHPO/103-171--------------------------------------------------------------------------------
HMGH_IIV6/54-122--------------------------------------------------------------------------------
YF98_SCHPO/195-263--------------------------------------------------------------------------------
NHP6A_YEAST/21-89--------------------------------------------------------------------------------
UBF1_HUMAN/112-180--------------------------------------------------------------------------------
HMGL_SOYBN/44-113--------------------------------------------------------------------------------
LEF1_MOUSE/297-365--------------------------------------------------------------------------------
HMGL_WHEAT/42-111--------------------------------------------------------------------------------
TFAM_MOUSE/49-117--------------------------------------------------------------------------------
HMGH_STRPU/100-168--------------------------------------------------------------------------------
SRY_GORGO/60-128--------------------------------------------------------------------------------
SOX2_CHICK/39-107--------------------------------------------------------------------------------
HMGB1_RAT/95-163--------------------------------------------------------------------------------
TFAM_HUMAN/50-118--------------------------------------------------------------------------------
ABF2_YEAST/43-111--------------------------------------------------------------------------------
SSRP1_DROME/555-621--------------------------------------------------------------------------------
SOX4_HUMAN/59-127--------------------------------------------------------------------------------
SSRP1_HUMAN/547-615--------------------------------------------------------------------------------
MATD_NEUCR/147-215--------------------------------------------------------------------------------
A7AVG2_BABBO/23-92--------------------------------------------------------------------------------
B2ABG5_PODAN/169-237--------------------------------------------------------------------------------
G3GTI9_CRIGR/15-83--------------------------------------------------------------------------------
G4U6E3_NEUT9/116-184--------------------------------------------------------------------------------
I7MKQ6_TETTS/18-86--------------------------------------------------------------------------------
M2RF48_COCSN/126-193--------------------------------------------------------------------------------
Q23QF5_TETTS/161-229--------------------------------------------------------------------------------
Q57XJ9_TRYB2/118-186--------------------------------------------------------------------------------

PF08073

X1XTS3_ACYPI/144-197--------------------------------------------------------------------------------
T1JDG0_STRMM/147-200--------------------------------------------------------------------------------
E9FRV7_DAPPU/197-250--------------------------------------------------------------------------------
Q16K27_AEDAE/151-204--------------------------------------------------------------------------------
T1I428_RHOPR/17-70--------------------------------------------------------------------------------
H9G906_ANOCA/209-262--------------------------------------------------------------------------------
CHD3_CAEEL/97-150--------------------------------------------------------------------------------
U1MF28_ASCSU/95-147--------------------------------------------------------------------------------
J0XKG3_LOALO/9-60--------------------------------------------------------------------------------
H2W8R5_CAEJA/91-144--------------------------------------------------------------------------------
Q7PZN7_ANOGA/153-206--------------------------------------------------------------------------------
G4V7W2_SCHMA/80-133--------------------------------------------------------------------------------
K7H9V4_CAEJA/95-148--------------------------------------------------------------------------------
D6X1V1_TRICA/150-203--------------------------------------------------------------------------------
H3ENB4_PRIPA/94-144--------------------------------------------------------------------------------
W4Z592_STRPU/127-180--------------------------------------------------------------------------------
B7PLQ0_IXOSC/143-196--------------------------------------------------------------------------------
LE418_CAEEL/95-147--------------------------------------------------------------------------------
E5SBN8_TRISP/115-164--------------------------------------------------------------------------------
B4IXP0_DROGR/132-185--------------------------------------------------------------------------------
F6PLL0_MONDO/66-119--------------------------------------------------------------------------------
H2Y0G6_CIOIN/133-183--------------------------------------------------------------------------------
H9J096_BOMMO/143-196--------------------------------------------------------------------------------
K1RRH1_CRAGI/112-162--------------------------------------------------------------------------------
U6HHQ2_ECHMU/73-126--------------------------------------------------------------------------------
G0MX39_CAEBE/81-132--------------------------------------------------------------------------------
E0W1M0_PEDHC/141-194--------------------------------------------------------------------------------

PF06382

Q9VAF7_DROME/1-125KEYC----------------------------------------------------------------------------
Q9V3S3_DROME/1-146KVKC----------------------------------------------------------------------------

PF04690

M0TDS3_MUSAM/5-158CNAA.A................................AHDGRTMACG.SPSKFNSTS........LFYSVPKD......
I1P2J5_ORYGL/20-212.ANQ.LHFG...PSLLSPT...SPHGLLDEV.A..FQTPSLLM..EQAASASLSS..ITGRSSSSCA..SNAPAMQM.P.
YAB2_ORYSJ/6-161.....LQDNLKMHNM.......................SFRENYSEYG......SSSRYGRVP......MMFS.......
K3YV50_SETIT/21-214.ASQ.LSFG...HSLLSPT...SPHGLLDEF.A..LQAPSILM..DQASAN.LSSAT.TGRSNSSCG..SNLPAAPM.P.
M4ES51_BRARP/5-163KQHI..................................ASSVTRKEWGSSSRSSNHFS........TTLSENVD......
W5GJ21_WHEAT/19-203.ANQ.LQFG...HSLLSPT...SPHGLLDEV.A..FQTPSLLM..DQASTNLXXXXXXXXXXXXXXX.............
D7U7V5_VITVI/14-174...Q.LHLG...HSLFSP......HNILEEIRS..PPSSMLIN...........................QPNPNEAV.M
K7K1G3_SOYBN/57-210LSH..LEP...............................KESSSEQ..DANKTLKR.......HNASMMTYSDC......
B9HTW7_POPTR/9-170LSHD.QEQ...............................KELLSPDEVNAQKGLDT.......QSSFIAISSDN......
B9RQ61_RICCO/5-157QKVQ.L................................NSEDLNKDTG.SSSKCNKVT........SFESADNE......
I1R7Z4_ORYGL/6-177...H.HHHHLQESGLSGCF...................RDQSGYPEFGFSAASSSSKL..RLPPAAAAMVSYSQ......
M0TFF3_MUSAM/16-188.....FRLG...HSFLTLP....HHKLSDEIPC..SPTSLLMDPTTMNTTTTTTTNTLVASVNRGT..............
W1P3Y5_AMBTC/9-163LTNQ...........................................................VPTLSLSLSQASQELRI
D7U8S1_VITVI/5-156ENLL.F..................................QASSKECG.SSSKFHKVA........AMDSSDNE......
K4AZ41_SOLLC/23-182...Q.LHLP...HSFFSP......HNLLDEIRN..NPPSLLMN..........................QQINPNESL.M
I1IC11_BRADI/21-215.ANQ.PQLS...HSLLSPT...SPHGLLDDV.A..FQTTSLLM..DQASGNNLSSGGFTGRSNSSCA..SNMPVMPM.PA
K3Z9T7_SETIT/6-168QLFD.SQENIK.HGING.........................NHLEFG.....SSSSKF.RLP......MMYSP......
C5XS56_SORBI/20-212.ANH.LNFG...HSLLSPT...SPHGLLDEL.A..LQAPSLLM..EQASAN.LSSSTMTGGSNSSCA..SNLPAGPM.P.
K4CNR9_SOLLC/17-179...HHHHFG...HTYFSP.....SHNLLDEISN..ATPNFLMN..........................QSNSAHEFVQL
B9HLS8_POPTR/9-163LSY....................................EDELRPE.FNAQKGLEM.......QNSFMAISSNN......
K4CBT7_SOLLC/7-163HQ....................................VPNYTAPEYRMDFGSSTKCNMNRMSMRTPITNNVHE......
B9GVI4_POPTR/13-176...Q.FHLG...HSFFSP.....SHNLLDEIPN..PTPNFLIN..........................Q.TNVNDFS.V
YAB1_ORYSJ/5-157RGF...........................................QGNNFGSYDIAS.RNQRTSTAMYPMPTS......
B9IBX2_POPTR/15-176...Q.FYLG...HGFFNP.....QINILEGMRSTGAPPSLMIN...........................QPNPNESV.M
J3LF87_ORYBR/19-210.ANQ.LHFG...PSLLSPT...SPHGLLDEM.A..FQAPSLLM..EQASASSLSG..ITGHSSSSCA..SNVPAMQT.P.
K7LVV0_SOYBN/6-165QHLS..................................VQEACSKELG.SSSKCK...........SFETVDHE......
M0S7H6_MUSAM/5-178ARRE.SKLPMSINYIVFLLVKAIIFDI...........CSQGNGVECG.SPSKCKRTS........LLCTMPKD......
M0RT32_MUSAM/18-181...Q.IHLT...HPCLIPS....HTSLLDELQC..QPPSLLLD..........................PSILNCNTM.A
M0TBQ3_MUSAM/5-155YSI...................................APNGNPMEYG.SSSKYAMTS........LMYSMKND......
K7L9I2_SOYBN/9-163LTH..LEP...............................KEGASDD..GANKSLNSYN.....NASIITTNSDC......
I1KFH5_SOYBN/6-162QKQL.LSF..............................EEPSSCKELGSSSSKCNKIA........PFHEAVEH......
I1IGA5_BRADI/8-173..HH.LQ......QVHGV....................DGFRDHPEFGSSSSSSSSSKF.RLPM.....VMFSP......
M0TPL1_MUSAM/17-180...Q.LHLS...HACLTPA....HHNLLDDLQC..PPPSLLLD..........................PSILNCSTT.A
M0SR87_MUSAM/5-158LQTC.NT...............................AAQGSRMECG.SPSKFSRSS........LLSTMPNY......
B9SHC4_RICCO/9-171LTHD.QQ................................KEEINLEGPDARKTLDIE......RSLSMAACSDD......
M1A5M2_SOLTU/9-164QNES.S................................IEDGMSRGYGSSSSSTNSFH........RFSPIPTD......
I1IGA3_BRADI/8-179..HH.LQANVSKQQVHGV....................DGFRDHPEFGSSSSSSSSSKF.RLPM.....VMFSP......
M0RP60_MUSAM/17-180...QLLHLS...HPCFTPP....HHNLLDELQC..PHPSLLLD..........................PSLL.CNAT.A
M0TTW3_MUSAM/5-159HNL...................................GSQHLHMDFGSSSNCTRLSVMNPVDYV...............
D7T1M7_VITVI/5-157QKQQ.L................................SCGDPSEDCG.SSSKCNKFS........AFESAEHE......
C5X9N5_SORBI/5-159RGF...........................................QYNNFGSYEQASSRNLRTP.SMYSVSNN......
B9IMX9_POPTR/9-161HVQ...................................ASNHISHDYRIDMGSSSKFN.NKISTRTPATNIVTQ......
D7LCG5_ARALL/20-189.....LQLQLGPHSYFNP......QDILEELRDAPSNMNMMMM..........................NQHPTMNDIPS
F2ELF4_HORVD/9-178.........AQESSLGKPSGINGFIRD...........HSVYNHPEFG..SSSTSSSKF.QLPT.....MMFSS......
J3LZX6_ORYBR/28-218AANQ.LPFG...QALLSPT...SPHGLLDEVPS..FQAPPSLMT.EQASPNVSS....ITSSNSSCA..NNAPATSMASA
B2YHV8_SOLLC/11-171LQRQ.QYTNVE...........................NNSSNYKAYGSSSSSSSKFN........RYSSIVSP......
I1J038_BRADI/28-220..NQ.LPFG...QSLISPTSPASPHGLLDEMSS..FQAPSSLLT.EQSSPNVSS....ITSSNNSSA..INTPA.TMSMP
W5G1Q5_WHEAT/9-179.........VQESSLSKPNGSNGFIRD...........HSVYNSPEFG.SSSSSSSSKF.RMPT.....MMFSS......
B9HAJ0_POPTR/9-161QVQ...................................ASNYNSHDYRIDLGSSSKCN.NKISMRTPAANIVTQ......
W1P736_AMBTC/16-193DQLL.RNQSLTGSHGY......................NRMMMMMTTMDSSSTSNNFNHDDINNKVLIPNESIA......
W1NYE0_AMBTC/12-177...Q.LHLG...HAFFSPT....PHNLLDECS...PPSSLLLDHPLMTPSNTGSASTRLQENEALH..............
D7TDI7_VITVI/9-164LSQ..DEP...............................KEGCPNE.EGAQKASDK.......RSPSMVASSDN......
B9HXH8_POPTR/13-167IDH.....................................HHLSLQGVSSNEKLLFKETQGFCTDFRKGEYSSS......
I1J7S5_SOYBN/16-179...Q.LHLG...HSFFTP......QNLLEEIRNA.PSTNMMMN..........................QLPNPNDLVMS
I1K9Q9_SOYBN/9-163LSH..LEP...............................KESSPEE..DANKTLNS.......HSASMMTYSDC......
B9HIG4_POPTR/11-164QYH......................................RLSLQGVSSNEKFLFKEKQGFCTDIRKGESSSS......
I1GPY5_BRADI/6-160.....SQESFRAHNI.......................SFRENYSDYG......SSSKY.RMP......MMFST......
W5BCE7_WHEAT/28-220...Q.LPFS...PSLLSPTSPASPHGLLDEMSS..FQAPSSLLT.DQASPNVSS....ITSSSNSCA..INTPAMSMMPP
K3Y9G7_SETIT/25-222.NNQ.LPFGGQQQALLSPT...SPHGLLDEMMP..FQQAPSLTSAEPASACVST....ITSINNSCGGRNNASAMSMAPP
W1NE60_AMBTC/5-156QSVA..................................PQERQRMEDGSSSKSIKDSE...........TIPSE......
YAB2_ARATH/5-160HRQH.T................................TSLVTRKDCASSSRSTNNLS............ENID......
YAB3_ARATH/20-201.......LG...HSFLPPPPPPPPPNLLEEMRSGGQNINMNMMMSHHASAHHPNEHLVMATRNG.....RSVDH......
YAB4_ARATH/16-182LSHL.DETGKEEVAA........................TDGVEEEAWKVNQEKEN.......SPTTLVSSSDN......
B9III3_POPTR/5-159......................................KQNLLYQDLSEGSQSSSTG............NKVSA......
C5YSF3_SORBI/7-171.....LQENIKVHGVNGTL...................HDQCGHLELG....SSSSSKF.RLP......MMYSP......
I1LZN8_SOYBN/8-159VQ....................................GSGHCNPEYRIDTGSTSKCN.NRIAMRAPTTHVTEE......

PF06244

R0KSX9_SETT2/56-190................................RGIDSALGSLD......GKPAALN........................
Q9VE08_DROME/93-211.........................E...NLNR.....S.MAD..........TDV........................
G7YAF9_CLOSI/113-230.........................P...NPNR.....V.EVD..........GAE........................
I1RMC8_GIBZE/52-188................................RGLD..LSQLD.DDK....PSDIN........................
D7KDN9_ARALL/102-226.........................T...NTNR.................DDSLIE........................
A4HVI1_LEIIN/55-236PSG..........................NVNR.....ERGVTLHAAAEQESNTIK........................
E0VAF2_PEDHC/93-206.........................E...NINR.....L.QVD..........GLE........................
Q4X4X0_PLACH/118-277.........................D...NINH.....IIRDEMNNYDECINGKK.....IIKKMMIFYIFVCSLNYNVW
R4GLN0_CHICK/95-212.........................E...NINR.....R.VLE....EG....TVE........................
CC124_DANRE/94-208.........................E...NVNR.....I.VPE....EG....TVE........................
E1ZLB4_CHLVA/97-218.........................E...NRNR.................EEGVVE........................
C4R6B1_PICPG/35-173.............................DFNK.....ASTID.....................................
B6AE18_CRYMR/93-218.........................E...NPNR.....VERDKQIEAKVSGIDYIS........................
C1MJE8_MICPC/96-225.........................K...NENK.....EDKIE.....................................
B3RRU8_TRIAD/93-212.........................E...NINH.....V.IAKEVAEGN....IVE........................
B8MZC7_ASPFN/52-190................................RGLD..LSQLD.DQPASRKGAALN........................
B3L0Z8_PLAKH/94-214.........................D...NINH.....IMRDEINDYDEYIN............................
K1R9I3_CRAGI/112-227.........................E...NINR.....L.QIE..........GEE........................
W1NK94_AMBTC/105-225.........................E...NINR.................DDSLIE........................
F7EQ85_ORNAN/42-157.........................E...NMNR.....R.VL.....EG....ELE........................
E1FIM0_LOALO/91-211.........................E...NVNQ.....L.KVE..........GET........................
G2YZ93_BOTF4/53-196.............................AVKRGLD..LSQLDDSPTSASPSSALN........................
C1DZF4_MICSR/101-216.........................K...NENK.....TDKID.....................................
K4AM07_SETIT/140-266.........................A...NTNR.................DDSVIE........................
D8RXZ7_SELML/110-229.........................E...NVNR.................AEDLIE........................
K3WDG6_PYTUL/143-255.........................E...NRNREIDMDIE........................................
W4XEG2_STRPU/98-219.........................E...NLNI.....R.LAQ.EEQDG....VVS........................
H2XNC6_CIOIN/94-210.........................E...NINQTVANSLTNAD..........AVE........................
B4LXA5_DROVI/93-212.........................E...NLNR.....S.LAD..........ANV........................
H0X6K7_OTOGA/96-217.........................E...NLNR.....R.GAD....LGLWGRSRA........................
H0VY33_CAVPO/95-214.........................E...NVNR.....R.VQD....EG....SVE........................
A8IUW8_CHLRE/93-216.........................E...NINR.................GIEGVD........................
A0A023B3J2_GRENI/51-230LQKTAQAAASPMARVVSAESMDLLVE...NVNH.....ARREEAFNAILAGDRLVD........................
Q2AAB8_CAEEL/18-139.........................E...NLNK.....L.EVE..........EGE........................
A7RS85_NEMVE/80-201.........................E...NPNQ.....K.MAELLEAEG....AVE........................
G1PAA5_MYOLU/97-214.........................E...NVNR..............RVLEEGSLE........................
L8FWQ1_PSED2/53-192..............................VSRGLD..LAQLD.DAPSGP.AKALN........................
B9SR05_RICCO/102-226.........................A...NTNR.................DDSIIE........................
C0H4Y8_PLAF7/94-214.........................D...NINH.....IHRNEQNNYDEYIY............................
A7ATI8_BABBO/96-219.............................NINH.....INLQERQMLEEHDIDLVK........................
Q2H0K7_CHAGB/53-193................................RGLD..LSQLD.DDGSGG.LSALN........................
D7G657_ECTSI/124-250.........................SGSANPNR.......................KGADGGDGGDW.............
G1K3G0_XENTR/95-212.........................E...NLNR.....R.ILE....EG....EVE........................
W5J3U9_ANODA/92-211.........................E...NLNR.....V.MAD..........TEV........................
Q7QBA5_ANOGA/92-210.........................E...NLNR.....V.MAD..........TEV........................
Q4Z043_PLABA/97-259.........................D...NLNH.....IIRDEMGNYDECINGKKKKKNNILHSFIIYFKYINILNLNLW
D8TGY2_VOLCA/95-216.........................E...NLNR.................GVEAVD........................
C4WUS4_ACYPI/84-202.........................E...NLNR.....L.TMH..........DEE........................
H3B1E2_LATCH/95-212.........................E...NINR.....L.VLE....EG....TVE........................
U6I1Y6_ECHMU/96-211.........................E...NPNR.....V.ADD..........VIE........................
T1IPE4_STRMM/95-207.........................E...NVNR.....L.TVD..........GEE........................
B0WCY1_CULQU/92-208.........................E...NLNR.....V.MAD..........TEV........................
W5M4J7_LEPOC/96-211.........................E...NVNR.....I.VPE....EG....SVE........................
F0XUT2_GROCL/53-205.............................APSRKLD..LSQLDGDDSS...LAAVN........................
H9JVF1_BOMMO/95-209.........................E...NLNR.....I.QLD..........GEL........................
G4LXI6_SCHMA/96-211.........................P...NPNR.....I.EKD..........GLE........................
M0SS42_MUSAM/102-227.........................E...NTNR.................DDSVIE........................
K1X0I7_MARBU/53-191.............................AVSRPLD..LSSLD.DAP....PAALN........................
H2MLV9_ORYLA/86-202.........................E...NINR.....I.VPE....EG....TVE........................
F2U6S5_SALR5/110-222.........................E...NPNK.....S.VAEHVQEQN....ITE........................
G3P1Q8_GASAC/96-213.........................E...NVNK.....I.IPE....EG....TVE........................
R4FK63_RHOPR/96-205.........................E...NINR.....L.TID..........GLE........................
F4Q8R5_DICFS/125-243.........................E...NINH.....ILREQRLAAGGNLSE...........................
Q16YV3_AEDAE/92-207.........................E...NLNR.....M.MAE..........TEV........................
I1FC80_AMPQE/19-212QIAESQASSGATPLPKSVVEVDPLIE...NPNH.....L.MQQ.RSLEG....HHD........................
E4X8S8_OIKDI/105-213.........................D...NINR.....L.EIE...........GD........................
F9FFR7_FUSOF/51-188................................RGLD..LAQLDGDDK....PSAIS........................
F0VKT5_NEOCL/92-218.........................ELQPNINH.....IIRQQTLQAREAGIEFMT........................
U6GKQ7_EIMAC/93-219.........................E..PNINH.....IMRAETLQAQLEGRDIVS........................
G6CMI5_DANPL/94-208.........................E...NLNR.....L.QIE..........GEV........................
C3Z6B4_BRAFL/97-216.........................E...NVNK.....L.IADQLAAEG....AVE........................
G0S5J0_CHATD/53-195................................RGLD..LSQLD.DNRSNKVLPALN........................
M0VS67_HORVD/9-136.........................A...NTNR.................DDSVIE........................
A9U354_PHYPA/105-228.........................A...NRNR.................EEDLLD........................
G9MTL1_HYPVG/52-190................................RGLD..LSQLD.DDK....LGAIS........................
U1NIQ3_ASCSU/92-212.........................E...NVNR.....L.EVE..........GES........................
I3K409_ORENI/96-214.........................E...NVNR.....V.IPE....EG....TVE........................
M1BLN4_SOLTU/98-222.........................T...NRNR.................DDSIIE........................
M4A2X1_XIPMA/96-212.........................E...NINR.....V.IAE....EG....SME........................

PF14887

E9PLT2_HUMAN/66-150--------------------------------------------------------------------------------
F6ZYJ1_XENTR/232-316--------------------------------------------------------------------------------
H3CF76_TETNG/472-557--------------------------------------------------------------------------------

PF09011

A2E233_TRIVA/26-97--------------------------P-PK-----------------PKRPPNAYNLYYLEMQPKMKAE......NP--.
C3Z277_BRAFL/6-77--------------------------K-NK-----------------PQR..NGFWVYMQEMIPEYKRQ.....GYQ--.
MAEL_XENTR/2-73--------------------------P-NK-----------------.KAARNAYFFFALDMIPELRRR.....GLQ--.
MAEL_HUMAN/2-73--------------------------P-NR-----------------.KASRNAYYFFVQEKIPELRRR.....GLP--.
B3S6M5_TRIAD/36-107--------------------------P-KK-----------------PKRARNSYLMYMTDRWNQAKES......GQ--.
E7F0H8_DANRE/6-79--------------------------P-GK-----------------PKGKMSAYAYFVKTCREEHNKK......NP--G
F7DZV4_ORNAN/34-106--------------------------P-KK-----------------PKGKMSAYAFFVQTCREEHKKK......NP--E
Q66IB6_DANRE/7-78--------------------------.-NK-----------------PKGKTSAYAFFVQTCRDEHKRK......SP--D
V4ZPN8_TOXGO/64-141--------------------------A-KR-----------------SRAAPSAYFLFAKKEQATIRQQLANESGRE--.

PF00505

MTMC3_SCHPO/103-171-----------------------------------------------TPRPPNAFILYRKEKHATLLKS------NP--S
HMGH_IIV6/54-122-----------------------------------------------PKRNKSSYLFFCQEIRPSIVAE------MP--D
YF98_SCHPO/195-263-----------------------------------------------KITDTMLFNHFSSIQKPKLKAE------GS--T
NHP6A_YEAST/21-89-----------------------------------------------PKRALSAYMFFANENRDIVRSE------NP--D
UBF1_HUMAN/112-180-----------------------------------------------PKKPLTPYFRFFMEKRAKYAKL------HP--E
HMGL_SOYBN/44-113-----------------------------------------------PKRPPSAFFVFMEEFRKVFNKE------HP--E
LEF1_MOUSE/297-365-----------------------------------------------IKKPLNAFMLYMKEMRANVVAE------CT--L
HMGL_WHEAT/42-111-----------------------------------------------PKRAPSAFFVFMGEFREEFKQK------NP--K
TFAM_MOUSE/49-117-----------------------------------------------PKKPMSSYLRFSTEQLPKFKAK------HP--D
HMGH_STRPU/100-168-----------------------------------------------PKRNLSAFFIFSGENRAAIKSV------HP--N
SRY_GORGO/60-128-----------------------------------------------VKRPMNAFIVWSRDQRRKMALE------NP--R
SOX2_CHICK/39-107-----------------------------------------------VKRPMNAFMVWSRGQRRKMAQE------NP--K
HMGB1_RAT/95-163-----------------------------------------------PKRPPSAFFLFCSEYRPKIKGE------HP--G
TFAM_HUMAN/50-118-----------------------------------------------PKKPVSSYLRFSKEQLPIFKAQ------NP--D
ABF2_YEAST/43-111-----------------------------------------------PKRPTSAYFLYLQDHRSQFVKE------NP--T
SSRP1_DROME/555-621-----------------------------------------------PKRATTAFMLWLNDTRESIKRE------NP--G
SOX4_HUMAN/59-127-----------------------------------------------IKRPMNAFMVWSQIERRKIMEQ------SP--D
SSRP1_HUMAN/547-615-----------------------------------------------PKRPMSAYMLWLNASREKIKSD------HP--G
MATD_NEUCR/147-215-----------------------------------------------TSRPRNQFVLYYQWLLDTLFSE------DP--S
A7AVG2_BABBO/23-92-----------------------------------------------PKRALSSYMFFAKEKRVEIIAE------NP--E
B2ABG5_PODAN/169-237-----------------------------------------------IPRPPNAYILYRKDQQAALKAA------NP--G
G3GTI9_CRIGR/15-83-----------------------------------------------VKRPMNAFMVWAQAARRKLADQ------YP--H
G4U6E3_NEUT9/116-184-----------------------------------------------IPRPPNAYILYRKDHHREIREQ------NP--G
I7MKQ6_TETTS/18-86-----------------------------------------------PKRPQTGFFIYKSEVFAKRRTE------CP--N
M2RF48_COCSN/126-193-----------------------------------------------.PRPMNCWIIFRDAMHKHLKAE------FP--H
Q23QF5_TETTS/161-229-----------------------------------------------PKRPLSAFFLFKQHNYEQVKKE------NP--N
Q57XJ9_TRYB2/118-186-----------------------------------------------PKPAVSSYLLFVADQREELKAK------NP--G

PF08073

X1XTS3_ACYPI/144-197----------------------SIDYT-DA-----------------DYQNLTTYKLFQQHVRPILAKE------NP--K
T1JDG0_STRMM/147-200----------------------NIEYS-DT-----------------DYLDFANYKLFSQHVRPILAKE------FP--K
E9FRV7_DAPPU/197-250----------------------EIDYE-NA-----------------EFQNLNNYKLFQQHVRPLLQKE------NP--K
Q16K27_AEDAE/151-204----------------------KIEYT-DE-----------------DYDNLVTYKNFHQHVRPILQKE------NP--K
T1I428_RHOPR/17-70----------------------QIEYS-ED-----------------DYQNLTTYKLFQQHVRPLLAKD------NP--K
H9G906_ANOCA/209-262----------------------DHVFT-EE-----------------DYHTLTNYKAFSQFMRPLIAKK------NP--K
CHD3_CAEEL/97-150----------------------DVDYE-QE-----------------EFQSITNLKNFSSLVKPYILKV------NP--G
U1MF28_ASCSU/95-147----------------------PLDFT-EE-----------------DYNTVTTAKTFAARVRPLLQAA------NP--K
J0XKG3_LOALO/9-60----------------------.NNFT-EE-----------------DINSITSAKAFALRVRPQLQAA------NP--K
H2W8R5_CAEJA/91-144----------------------EIDFE-QE-----------------EFQKVTNLKVFSNIIKPLVLKV------NP--G
Q7PZN7_ANOGA/153-206----------------------KIEYT-EE-----------------DFENLVTFKMFQTHVRPILTKE------NP--R
G4V7W2_SCHMA/80-133----------------------EMTYS-TE-----------------DFENWTIQKLFDQYVRPLIANK------NP--N
K7H9V4_CAEJA/95-148----------------------EVDYD-QA-----------------ELQGVSSIKAFTAVIRQQLLEA------NP--G
D6X1V1_TRICA/150-203----------------------ELEYT-ES-----------------DFQNLTTYKLFQQHVRPLLTKE------NP--K
H3ENB4_PRIPA/94-144----------------------.ANLE-DE-----------------DYTTITTLKAFTNRVRPTLQTA------NP--K
W4Z592_STRPU/127-180----------------------EMEYT-ES-----------------DYDELINYKLYTDNIRPLVLEN------AP--K
B7PLQ0_IXOSC/143-196----------------------PMEYT-DA-----------------DYQNLTSYKLFSQHVRPLVTKA------NP--K
LE418_CAEEL/95-147----------------------EFDYD-EE-----------------EFQGISNLKTFSSIIKPQILEA------NP--G
E5SBN8_TRISP/115-164----------------------.LNYL-DD-----------------DFQGITNYKAFNTKVRPMILES------NP--K
B4IXP0_DROGR/132-185----------------------EIEYS-EE-----------------DLQSLTTYKAFMQHVRPILQKE------NP--K
F6PLL0_MONDO/66-119----------------------DHVFS-EE-----------------DYRTLTNYKAFSQFVRPLIAAK------NP--K
H2Y0G6_CIOIN/133-183----------------------EHEHD-EQ-----------------DYSTLTTYRLFSQHIKPMLARV------YP--R
H9J096_BOMMO/143-196----------------------DIQYA-DA-----------------DYENLTTYKLFQQHVRPMLVKE------NP--K
K1RRH1_CRAGI/112-162----------------------DIPFD-DD-----------------DYISLNNYKLFKQHVQPIIQKA------NP--K
U6HHQ2_ECHMU/73-126----------------------ELTYS-TD-----------------DFENWTVQKLFNQYVQPLIVEK------NP--H
G0MX39_CAEBE/81-132----------------------.LDYD-GH-----------------LFHGISGIKSFQALIRPVVLHH------NP--G
E0W1M0_PEDHC/141-194----------------------QIKYT-EQ-----------------DFQDLSSYKLFQQHIRPLLAKD------NP--K

PF06382

Q9VAF7_DROME/1-125--------------------PPIYKRQ-KV-----------------ARVTNNGYLNFMTEYKKRFYGL------SP---
Q9V3S3_DROME/1-146--------------------APRQKCS-KQ-----------------GPVTNNAYLNFVRSFRKKHCNL------KP---

PF04690

M0TDS3_MUSAM/5-158.......QQQI........-MLPMRPP.EK-----------------RHRVPSAYNRFIKEEIQRIKAN------NP--D
I1P2J5_ORYGL/20-212PAKP..VQQEPELPKNAP.-ASANRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
YAB2_ORYSJ/6-161.......KNDTEH......-MLHVRPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
K3YV50_SETIT/21-214AAKPPAVQQEPELAK.SA.-PSVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
M4ES51_BRARP/5-163.......REAPR.......-MPPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAG------NP--A
W5GJ21_WHEAT/19-203AAKP..AQQETEQSAKSA.-PSANRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
D7U7V5_VITVI/14-174PVRG..VDEIPK.P.....-PVVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--G
K7K1G3_SOYBN/57-210.........EEEDAIPMS.-NVVNKPP.EK-----------------RQRTPSAYNCFIKEEIKRLKAE------NP--D
B9HTW7_POPTR/9-170.......DEDIDKVNPVN.-RVINKPP.EK-----------------RQRAPSAYNCFIKEEIRRLKTE------NP--N
B9RQ61_RICCO/5-157.........PPR.......-MPPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAS------NP--D
I1R7Z4_ORYGL/6-177.......QNQQLEQ.....-ALHARPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
M0TFF3_MUSAM/16-188.......DDKLRRT.....-PVLNKPL.EK-----------------RQRIPSAYNRFIKDEIQRIKAV------NP--D
W1P3Y5_AMBTC/9-163DTPINTSSPKKDEITPP..-KHVNKPP.EK-----------------RHRAPSAYNRFIKEEIQRLKAR------EP--T
D7U8S1_VITVI/5-156.........QPR.......-MLPKGAAQEK-----------------KQRVPSAYNRFIKEEIQRIKAN------NP--D
K4AZ41_SOLLC/23-182PVRG.GVDEIPK.P.....-PVANRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
I1IC11_BRADI/21-215ATKP..AQQETEQTTKSA.-PSTNKPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
K3Z9T7_SETIT/6-168.......QNEHHLLQEQ..-TLNARPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
C5XS56_SORBI/20-212AAKP..VQQEPELPKTTA.-PSVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
K4CNR9_SOLLC/17-179PARP.GFDDLPRPP.....-PVVNRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAG------NP--D
B9HLS8_POPTR/9-163........DEDDRINQVN.-RVINKPP.EK-----------------RQRGPSAYNRFIKEEIRRIKTE------NP--R
K4CBT7_SOLLC/7-163.................E.-RIVNRPP.EK-----------------RQRVPSAYNQFIKEEIQRIKAN------NP--D
B9GVI4_POPTR/13-176PVRGMADHELPR.P.....-PVINRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
YAB1_ORYSJ/5-157.......QQQ.........-VSPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKTS------NP--E
B9IBX2_POPTR/15-176PIRG..VEEIPK.P.....-PVVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
J3LF87_ORYBR/19-210PAKP..VQQEPELPKNAP.-TSVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
K7LVV0_SOYBN/6-165........QQPR.......-IPPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAS------NP--D
M0S7H6_MUSAM/5-178.......QEQ.........-TLPMHPP.EK-----------------RHRAPSAYNRFIKEEIQRIKAN------NP--D
M0RT32_MUSAM/18-181PVKG.VGEELPR.T.....-PVVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
M0TBQ3_MUSAM/5-155.......RQQ.........-ALPVRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAN------NP--N
K7L9I2_SOYBN/9-163.........EEENVTQIS.-NVVHKPP.EK-----------------RQRTPSAYNRFIKEEIKRLKSE------NP--N
I1KFH5_SOYBN/6-162........EQPR.......-IPPIRPT.EK-----------------RHRVPSAYNRFIKEEIQRIKAS------NP--D
I1IGA5_BRADI/8-173.......QNDLLQEH....-TLHSRPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
M0TPL1_MUSAM/17-180PVKG.VEEVLPR.S.....-PVVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
M0SR87_MUSAM/5-158.......QEQ.........-MLPTRPP.EK-----------------RQRVPSAYNKFIKEEIQRIKAK------NP--E
B9SHC4_RICCO/9-171.......NKLEEDKNPVN.-RVINKPP.EK-----------------RQRAPSAYNRFIKEEIRRLKAE------NP--D
M1A5M2_SOLTU/9-164.......HDQPR.......-SPPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAS------NP--D
I1IGA3_BRADI/8-179.......QNDLLQEH....-TLHSRPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
M0RP60_MUSAM/17-180PVKG.VEEELPR.T.....-PVVNRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
M0TTW3_MUSAM/5-159.......QQQMQLIHRKL.-FSAT....EK-----------------R.RAPSAYNRFIKEEIRRLKTK------NP--N
D7T1M7_VITVI/5-157.........QPR.......-MPPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAS------NP--D
C5X9N5_SORBI/5-159.......QPQ.........-VPPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKTS------NP--E
B9IMX9_POPTR/9-161.................E.-RVVNRPP.EK-----------------RQRVPSAYNQFIKEEIQRIKAN------NP--E
D7LCG5_ARALL/20-189FMDLHQQHEIPKA......-PPVNRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAG------NP--D
F2ELF4_HORVD/9-178.......QNDLLHEQ....-TLHARPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
J3LZX6_ORYBR/28-218TKAT...QREPQQPKNA..-SSANRTS.EK-----------------RQRVPSAYNRFIKDEIQRIKAS------NP--D
B2YHV8_SOLLC/11-171.......QIEPK.......-IPSIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAS------NP--D
I1J038_BRADI/28-220PEKA..AQREPQTRKNAS.-SGSTKHP.EK-----------------RQRVPSAYNRFIKDEIQRIKAN------NP--D
W5G1Q5_WHEAT/9-179.......QNDLLQEQ....-TLHARPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
B9HAJ0_POPTR/9-161.................E.-RVVNRPP.EK-----------------RQRVPSAYNQFIKEEIQRIKAN------NP--D
W1P736_AMBTC/16-193.......EKEER.......-TVVNRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAS------NP--D
W1NYE0_AMBTC/12-177...................-SPVSRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAG------NP--D
D7TDI7_VITVI/9-164.........EEDDIVPVH.-HVVNKPP.EK-----------------RQRAPSAYNRFIKEEIRRLKAE------NP--K
B9HXH8_POPTR/13-167.......STSSEPLVPKV.-PFVVKPP.EK-----------------KHRLPSTYNRFMKEEIQRIKAA------NP--E
I1J7S5_SOYBN/16-179TMRG.GPEETPK.P.....-PSANRPP.EK-----------------RQRVPSAYNRFIKDEIQRIKAG------NP--D
I1K9Q9_SOYBN/9-163.........EEEDIIPMSH-HVVNKPP.EK-----------------RQRTPSAYNCFIKEEIKRLKAE------NP--E
B9HIG4_POPTR/11-164.......STSSEQPVPTV.-PFVVKPP.EK-----------------KHRLPSAYNRFMKEEIKRIKAA------DP--E
I1GPY5_BRADI/6-160.......KSDQEH......-TLHVRPP.EK-----------------RQRVPSAYNRFIKEEIRRIKTN------NP--D
W5BCE7_WHEAT/28-220PEKP..AQREPQQRKSA..-ASGTKHP.EK-----------------RQRVPSAYNRFIKDEIQRIKAN------NP--D
K3Y9G7_SETIT/25-222PLKP..APQEPQLPKSA..-ASGNRTA.EK-----------------RQRVPSAYNRFIKDEIQRIKAS------NP--D
W1NE60_AMBTC/5-156.......NEEPR.......-TIPNRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAR------NP--E
YAB2_ARATH/5-160.......REAPR.......-MPPIRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAC------NP--E
YAB3_ARATH/20-201......LQEMPR.P.....-PPANRPP.EK-----------------RQRVPSAYNRFIKEEIQRIKAG------NP--D
YAB4_ARATH/16-182.........EDEDVSRVY.-QVVNKPP.EK-----------------RQRAPSAYNCFIKEEIRRLKAQ------NP--S
B9III3_POPTR/5-159.......LEPSQNEQPSR.-TVAVHAATGK-----------------KQRTPSAYNRFIKEEIRRIKEK------NP--E
C5YSF3_SORBI/7-171.......QNEHLLQEQT..-LNNARPP.EK-----------------RQRVPSAYNRFIKEEIRRIKAN------NP--D
I1LZN8_SOYBN/8-159...................-RVVNRPP.EK-----------------RQRVPSAYNQFIKEEIQRIKAN------NP--D

PF06244

R0KSX9_SETT2/56-190................ASG.IDNALDALDI....TGNRQDKVDRHP.ERRFKAAYAAYEEQRLGDMKDD------K...G
Q9VE08_DROME/93-211................ASN.IDEAIVVLSV......N.DSEEDKHP.EKRMRAAYKTFEANNLPRIKAE------NP..S
G7YAF9_CLOSI/113-230................ART.VEDAIAILNV....DDDSTMDLDRHP.ERRLKAAYSAYEEKMLPILREE------NP..G
I1RMC8_GIBZE/52-188................ASG.IDNALDALSL....TNKDDGKVDRHP.ERRYPAAYAKYEERRLDEMKKD------GSGVG
D7KDN9_ARALL/102-226................AHT.VDEALARITV......SDNLPVDRHP.EKRLKASFKAYEEAELPRLKEE------KP..G
A4HVI1_LEIIN/55-236................ASGTVADVVAALEKGGNASGAAEIPDNRHI.GKRAKVLYKAFYSEHLEQVKGE------KP..G
E0VAF2_PEDHC/93-206................ART.VNDAIAILSI......K.DAELDKHP.EKRMKAAYTAYEAANLPRIKSE------NP..T
Q4X4X0_PLACH/118-277RMVRVIYYVFIFYFCLATG.IDNIISSLGNVSFEK............TKKVKAAYKKYEEENLPLVKEE------YK..N
R4GLN0_CHICK/95-212................ART.IEDAIAVLSV......A.NDV.DRHP.ERRMKAAFTAFEEVNLPRLKQE------NP..N
CC124_DANRE/94-208................ART.IEDAIAVLST......K.EDL.DRHP.ERRMKAAYTAFEEANMPRVKME------NP..N
E1ZLB4_CHLVA/97-218................ARS.VDAALEALTL.......DSPGADRHP.EKRAKAAWEAYYAEQLEILKQD------KP..G
C4R6B1_PICPG/35-173................ASG.ISDALGALDLLKSDAGVSQADIDRHP.ERRVKAAYAAFQERRIPELKLE------NP..G
B6AE18_CRYMR/93-218................ASS.LDDALAILTL......GDKSYVDKHP.EKRMKAAWLTFLDNNMPQLKSE------FP..N
C1MJE8_MICPC/96-225................ASG.IDAAVEAMTGMSVGGGVGRGGSGAKPGTTNMKAAYAMFEEQELPRLKEE------RP..G
B3RRU8_TRIAD/93-212................ARS.VEDAITALSI......S.EGKIDRHP.ERRLKAAYTAYEEQELPRLREE------HS..N
B8MZC7_ASPFN/52-190................ASG.IDNALDALSL....TGKESSKIDRHP.ERRFKAAYAAYEARRMPEVEQE------NP..G
B3L0Z8_PLAKH/94-214................ATG.IDNAISALDNVSFER............TKKVKVAYKKFEEENLPLIKEQ------YK..G
K1R9I3_CRAGI/112-227................ARS.VTQALSVLSN......Q.AEEVDQHP.EKRMKAAYKKYEETNLPILKQE------NP..N
W1NK94_AMBTC/105-225................AHS.VEDALALMSV.......DPLPVDKHP.ERRLKASFKAFEEAELRKLKEE------KP..G
F7EQ85_ORNAN/42-157................ART.IEDALALLSV......S.DDS.DRHP.ERRMKAAFAAFEEQHLPRLKKE------NP..N
E1FIM0_LOALO/91-211................ART.VTEAINILSI......G.KSTIDRHP.EKRVKAAYQEFEEKMLPRLREE------YP..T
G2YZ93_BOTF4/53-196................ASN.IDDALDALAL....TSNTKEKIDRHP.ERRFKAAYAEFEQRRLEEMDND------GSGAG
C1DZF4_MICSR/101-216................ASG.IDAAVDAMGALGVGGAAPVL.......TTNHKAAFKAFEERELPRLKEE------RP..G
K4AM07_SETIT/140-266................ARS.VEDAIAKMTI....AAEPALPPDRHP.ERRLKVSYKAFEEAEVAKLKEE------KP..G
D8RXZ7_SELML/110-229................ARS.VEAAIAQMAI......PDELPVDRHP.EKRARASYKAFEEVELAKLKAD------KP..G
K3WDG6_PYTUL/143-255................ARS.IDAALGALTT.......SDKELEKHP.ERRAKAAYKAFEEAMMPELKQD------YP..G
W4XEG2_STRPU/98-219................ARD.VGEAISALSV......K.DADLVKHP.EKRVKAAYAAYEEVNLPILKAQ------NP..S
H2XNC6_CIOIN/94-210................ARS.VSDAISALSV........KEELDRHP.ERRLKASFKKFEEEYMPKLKAE------NP..N
B4LXA5_DROVI/93-212................ATN.VDQALAVLSV......K.DNDDDKHP.EKRMRAAYKTFEANNLQRIKAE------NP..S
H0X6K7_OTOGA/96-217................SRA.LT.PLSTLSV......S.EEAGDRHP.ERRMRAAFTAFEEAQLPRLKQE------NP..N
H0VY33_CAVPO/95-214................ART.IEDAIAVLSV......A.EEA.DRHP.ERRMRAAFTAFEEAQLPRLKQE------NP..N
A8IUW8_CHLRE/93-216................ARG.VDXPHTCPPI.......PAPPPPTSH.HRRMKAAWKAYEERMLPQLKEE------KP..G
A0A023B3J2_GRENI/51-230................ASG.IDEALEQLSS....ADAADRKVDMHP.ERRAKAAYKAYEARELETLKSQ------LP..G
Q2AAB8_CAEEL/18-139................ARN.VDDALKVLGE....EKA.LDD.DKHP.EKRMRAAYLAFEEARLPELKLN------HP..T
A7RS85_NEMVE/80-201................ARS.VEEAIATLSV........EQKIEKHP.EKRLKAAYAEFEERELPRLKQE------NP..N
G1PAA5_MYOLU/97-214................ART.IEDEVLVPSL...PGVVGGRPGSQPP.E...SAAMRGFENQ.LPRLKQR------EPP.T
L8FWQ1_PSED2/53-192................ATG.IDNALDALTL....TSGDSSKVEKHP.ERRYKAAYAAFEERRLAEMEVD------GSGAG
B9SR05_RICCO/102-226................ART.VEDAIAQMSV......TDSLPVDKHP.ERRLKASFKAFEEAELPKLKAE------KP..G
C0H4Y8_PLAF7/94-214................ATG.IDNVISALENVSFEK............TKSVKAAYKKYEEENLPIVKEE------HK..G
A7ATI8_BABBO/96-219................ASG.LDEVLEALSI........GPRKDVNA.EKRMKAAYDAFSEAKMAELKEE------YP..N
Q2H0K7_CHAGB/53-193................ASG.IDNALDALSL....TSRTDAKIDRHP.ERRYKAAYAIFEERRLGEMDAD------GSGAG
D7G657_ECTSI/124-250................ASG.IDAAIGSLSL......EGAGPAERHP.EKRLKAALAAYEERELPALKEE------KP..G
G1K3G0_XENTR/95-212................ART.VEDAIAALSM......S.KEL.DRHP.ERRMKAAFTAFEEINMPRIKQE------NP..N
W5J3U9_ANODA/92-211................AQT.IDQAIAVLSV......SGEGGADRHP.EKRMKAAYKAYEEEQLVRLKQE------YP..S
Q7QBA5_ANOGA/92-210................AQT.IDQAIAVLSV......G.DPSADRHP.EKRMKAAYKAYEEEELKRLKLE------NP..S
Q4Z043_PLABA/97-259RMI.TSYYI.IFYFCLATG.IDNIINSLGNVSFEK............TKKVKAAYKKYEEENLPLVKEE------YK..N
D8TGY2_VOLCA/95-216................ARG.VDAALKVLTV.......KEEEADKHP.EKRMKAAWKAYEERNLPILKQD------KP..G
C4WUS4_ACYPI/84-202................ART.VDEALNMLNP......T.QKLLDKHP.EKRLKAAYTAFEAENLPRLRLE------NP..S
H3B1E2_LATCH/95-212................ART.IEDAIAVLGS......A.EEI.DRHP.ERRMKAAYAAFEEITLPQLKLE------NP..N
U6I1Y6_ECHMU/96-211................ART.VEDAIKALNV......TGDSPTEKHP.ERRLKAAYLAYEEKMLPELRKE------YP..G
T1IPE4_STRMM/95-207................ART.IEAAISVLSS......K.DEEVDRHP.ERRVKAAYAAFEAENLPRVKAE------NP..H
B0WCY1_CULQU/92-208................AQT.IDQALAVLAV......K.DGGDDKHP.EKRMKAAYKAFEEEQLAILKQE------HP..S
W5M4J7_LEPOC/96-211................ART.IEDAIAVLST......A.DES.DRHP.ERRMKAAYTAFEELHLPRLKKE------NP..N
F0XUT2_GROCL/53-205................ASG.IDNALDALSL.DHDAASGAGAIDRHP.ERRFKAAYAAFEERRLEEMDND------GSGKG
H9JVF1_BOMMO/95-209................AQT.VDEALAILSD........KPEVDRHP.EKRLKAAFTAFEQINLPRLKAE------NP..S
G4LXI6_SCHMA/96-211................ART.VEEAITILSV......NGEGDGDRHP.EKRLKAAYQAFEERMMPQLKAE------NP..N
M0SS42_MUSAM/102-227................AHS.VEDAISRMAL.....SEPALPTDRHP.ERRLKASFKAFEEAELPKLKEE------KP..G
K1X0I7_MARBU/53-191................ATG.IDNALDALSL....TTEANAKIDKHP.ERRFKAAFAAFEERRLKEMESD------GSGQG
H2MLV9_ORYLA/86-202................VRS.IEDAIAVLST.....GP.EDL.DRHP.ERRMKSAFAAYDEENMPRLKQE------NP..N
F2U6S5_SALR5/110-222................ART.VEEAISVLRI...GGA......QALP.TKRM..SYAEFEEQNLEAFKAD------NP..T
G3P1Q8_GASAC/96-213................ART.IEDAISVLST....GGP.EEL.DHHP.ERRMKAAYAAFEEANLPRLKQE------NP..N
R4FK63_RHOPR/96-205................ART.VDEALEILG.........DDSIDRHP.EKRMKAAYLAFEESRLPELKEE------FP..S
F4Q8R5_DICFS/125-243................ATG.VDEAIKVLGG.........PTSDQHP.ERRLKAAFAKYQEDNLPILRKE------NP..S
Q16YV3_AEDAE/92-207................AQT.IDQAIAVLNV........KDGEDRHP.EKRMKAAFKAYEDEQLPIMKQE------YP..S
I1FC80_AMPQE/19-212................AAT.VDEAIAVLKV....GGL.DQGLDRHP.ERRMKASYAAFEEREIARLKTE------NP..N
E4X8S8_OIKDI/105-213................ARN.VEEAIDVLTG...DGK....KADKHP.EKRMKAAFNDFEQKRYKGLKAE------NP..T
F9FFR7_FUSOF/51-188................ASG.IDNALDALAL....TGGKDDKVDRHP.ERRYPAAYAKYEERRLEEMKKD------GSGVG
F0VKT5_NEOCL/92-218................ATS.IDEALAAMSL........SEGADRHP.ERRMKAAYKAYEETWLPRLKAE------NP..S
U6GKQ7_EIMAC/93-219................ASN.LDDALSQLAV......ADSPAEDRHP.ERRMRAAYRAYEEQMMPRLKAE------NP..T
G6CMI5_DANPL/94-208................AQS.VDEALAILSD........KTDVDKHP.EKRLKAAYTAFEEINLPRLKAE------NP..S
C3Z6B4_BRAFL/97-216................ARS.VEEAISVLSV......K.EAALDKHP.ERRMKAAYNKYEEENLPRLKQE------NP..N
G0S5J0_CHATD/53-195................ASG.IDNALDALSL...ATDKDAEKIDRHP.ERRFAAAYAKFEARRLAEMDAD------GSGAG
M0VS67_HORVD/9-136................ASG.VDEAIVRLSL...VDSEAALPADRHP.ERRLKASFKAFEEAELPRLKEE------KP..G
A9U354_PHYPA/105-228................ARD.LETALAQIGT....LNAPELPADRHP.ERRLKASYKAFEEVELPALKEE------KP..G
G9MTL1_HYPVG/52-190................ASG.IDNALDALSL...TAGGDDSKIDQHP.ERRFAAAYHRYEERRLAEMKAD------GSGTG
U1NIQ3_ASCSU/92-212................ARS.VSEAIKVLSM......E.SPTVDRHP.EKRLKAAYQAFEERMLPRLKEE------HP..T
I3K409_ORENI/96-214................ART.IEDAIAVLSV.....GP.EDL.DRHP.ERRMKAAFSAYEQANMPRLKQE------NP..N
M1BLN4_SOLTU/98-222................AST.VDDAIAHLAI......SDSLPPDRHP.EKRLRAAFKAFEEAELRALKEE------KP..G
M4A2X1_XIPMA/96-212................ART.IEEAISVLST.....GP.EDL.DRHP.ERRMKAAFTAFEEANMPRLKME------NP..N

PF14887

E9PLT2_HUMAN/66-150-----------------------------------------------PESPKRAEEIWQQSVIGDYLAR-----------
F6ZYJ1_XENTR/232-316-----------------------------------------------PETPKTAEEIWQQSVIGDYLAR-----------
H3CF76_TETNG/472-557-----------------------------------------------PDPPKTAQEIWQQSVIGDYMAR-----------

PF09011

A2E233_TRIVA/26-97.LIGGNDVSKLIGQQWGALSDEQKKPYIEKA----------------------------------------NEIREQFRR
C3Z277_BRAFL/6-77MPNGMADVVKLAHPSWKAMPEMEKQEYERQA----------------------------------------KELKKSASA
MAEL_XENTR/2-73.VSGVREAIPLCSEDWALLSADQKEAYAEKA----------------------------------------RLLKNDPDS
MAEL_HUMAN/2-73.VARVADAIPYCSSDWALLREEEKEKYAEMA----------------------------------------REWRAAQGK
B3S6M5_TRIAD/36-107.VPEIREFTEESSSNWRNMSEEEKEEYHQRA----------------------------------------QIDRNRFSR
E7F0H8_DANRE/6-79VTVNFSEFSKKCSERWKTMSPKEKTKFEDLA----------------------------------------KQDKARYDQ
F7DZV4_ORNAN/34-106VPVNFAEFSKKCSERWKTMSGKEKSKFDEMA----------------------------------------KADKVRYDR
Q66IB6_DANRE/7-78VPVNFSEFSKKCSERWKSLNASDKVKFEDMA----------------------------------------KADKVRYDR
V4ZPN8_TOXGO/64-141.RIPLGEVQKALSEKWRNISSAEREAYYEEA----------------------------------------REKKQEYQQ

PF00505

MTMC3_SCHPO/103-171IN..NSQVSKLVGEMWRNESKEVRMRYFKMS----------------------------------------EFYKAQHQK
HMGH_IIV6/54-122IK..PNQVMVHLGKKWSELPLEDRKKYDVMA----------------------------------------VEDRKRYLA
YF98_SCHPO/195-263LK..GQALKKTLEDTWNNLTEEEKKPYHEGL----------------------------------------LAAREKARE
NHP6A_YEAST/21-89IT..FGQVGKKLGEKWKALTPEEKQPYEAKA----------------------------------------QADKKRYES
UBF1_HUMAN/112-180MS..NLDLTKILSKKYKELPEKKKMKYIQDF----------------------------------------QREKQEFER
HMGL_SOYBN/44-113NK.AVSAVGKAAGAKWKTMSDAEKAPYVAKS----------------------------------------EKRKVEYEK
LEF1_MOUSE/297-365KE..SAAINQILGRRWHALSREEQAKYYELA----------------------------------------RKERQLHMQ
HMGL_WHEAT/42-111NK.SVAAVGKAAGERWKSLSESEKAPYVAKA----------------------------------------NKLKGEYNK
TFAM_MOUSE/49-117AK..LSELVRKIAALWRELPEAEKKVYEADF----------------------------------------KAEWKAYKE
HMGH_STRPU/100-168WS..VGDIAKELAVRWRAMTAGEKIPFDKGA----------------------------------------AKDKERYIK
SRY_GORGO/60-128MR..NSEISKQLGYQWKMLTEAEKWPFFQEA----------------------------------------QKLQAMHRE
SOX2_CHICK/39-107MH..NSEISKRLGAEWKLLSEAEKRPFIDEA----------------------------------------KRLRALHMK
HMGB1_RAT/95-163LS..IGDVAKKLGEMWNNTAADDKQPYEKKA----------------------------------------AKLKEKYEK
TFAM_HUMAN/50-118AK..TTELIRRIAQRWRELPDSKKKIYQDAY----------------------------------------RAEWQVYKE
ABF2_YEAST/43-111LR..PAEISKIAGEKWQNLEADIKEKYISER----------------------------------------KKLYSEYQK
SSRP1_DROME/555-621IK..VTEIAKKGGEMWKEL..KDKSKWEDAA----------------------------------------AKDKQRYHD
SOX4_HUMAN/59-127MH..NAEISKRLGKRWKLLKDSDKIPFIREA----------------------------------------ERLRLKHMA
SSRP1_HUMAN/547-615IS..ITDLSKKAGEIWKGMSKEKKEEWDRKA----------------------------------------EDARRDYEK
MATD_NEUCR/147-215LS..ARNISQIVAGLWNSEHPAAKARFRELA----------------------------------------EMEVHRHRA
A7AVG2_BABBO/23-92IAKDVAAIGKMIGAAWNALSDEEKKPYERMS----------------------------------------DEDRVRYER
B2ABG5_PODAN/169-237IP..NNDISVMTGGMWKKESPEVRAEYQRRA----------------------------------------SEIKAKLMS
G3GTI9_CRIGR/15-83LH..NAELSKTLGKLWRLLNESEKRPFVEEA----------------------------------------ERLRVQHKK
G4U6E3_NEUT9/116-184LH..NNEISVIVGNMWRDEQPHIREKYFNMS----------------------------------------NEIKTRMLL
I7MKQ6_TETTS/18-86LK..VPEIVSKISEEYKALPEKEKQKYEEAY----------------------------------------RKEKATYDK
M2RF48_COCSN/126-193LT..IQEISTQCSQIWHNLSPEAKRPWQDAA----------------------------------------QSAKEEHLR
Q23QF5_TETTS/161-229AK..ITELTSMIAEKWKAVGEKEKKKYETLQ----------------------------------------SEAKAKYEK
Q57XJ9_TRYB2/118-186MQ..NTAILQTLGKMWSDASDDVKEHYRKKA----------------------------------------EEDKARFRR

PF08073

X1XTS3_ACYPI/144-197VV--IAKMMMLVAAKWRDFCQQNP--------------------------------------------------------
T1JDG0_STRMM/147-200LT--MSKMVSLLAAKWREFLQSNP--------------------------------------------------------
E9FRV7_DAPPU/197-250VP--MSKLMMLVAAKWREFSATIP--------------------------------------------------------
Q16K27_AEDAE/151-204VP--MSKLMMLVAAKWREFTEENP--------------------------------------------------------
T1I428_RHOPR/17-70VP--IGKMMMLVAAKWRDFCNSNP--------------------------------------------------------
H9G906_ANOCA/209-262IP--MSKMMTIMGAKWREFSANNP--------------------------------------------------------
CHD3_CAEEL/97-150TN--VTKMYPLFQVKYKEFQDHMT--------------------------------------------------------
U1MF28_ASCSU/95-147AL--SVKIQQVISAKYREYQEEM.--------------------------------------------------------
J0XKG3_LOALO/9-60AL--FTKLQQLVQAKYREFQEEM.--------------------------------------------------------
H2W8R5_CAEJA/91-144TN--VSKMYPLFQVKYKEFQDHMT--------------------------------------------------------
Q7PZN7_ANOGA/153-206VP--MAKLMMLVAAKWREFCTLNP--------------------------------------------------------
G4V7W2_SCHMA/80-133AS--KEDVQKVLDAKWKEFAIMNP--------------------------------------------------------
K7H9V4_CAEJA/95-148TN--LSKMYPLQQVKYREFQEHMT--------------------------------------------------------
D6X1V1_TRICA/150-203VP--MSKLMMLVAAKWREFSNINP--------------------------------------------------------
H3ENB4_PRIPA/94-144AN--STKLLPIIQAKYREFQEE..--------------------------------------------------------
W4Z592_STRPU/127-180LH--SQKLVNLLAALWKEFAANNP--------------------------------------------------------
B7PLQ0_IXOSC/143-196IA--MAKIVLLISAKWHEFLRDNP--------------------------------------------------------
LE418_CAEEL/95-147TN--VSKMYPMFQVKYKEYQDHM.--------------------------------------------------------
E5SBN8_TRISP/115-164IA--KARLVTLMATKWKEFQE...--------------------------------------------------------
B4IXP0_DROGR/132-185IA--ATKLMMLVAAKWREFCESNP--------------------------------------------------------
F6PLL0_MONDO/66-119IA--VSKMMMVLGAKWREFSTNNP--------------------------------------------------------
H2Y0G6_CIOIN/133-183LP--ISRTLTIVAAMWREFSN...--------------------------------------------------------
H9J096_BOMMO/143-196VP--VSKLMMLVAAKWRMFCETNP--------------------------------------------------------
K1RRH1_CRAGI/112-162VA--MAKMVTLIGAKWREFAQ...--------------------------------------------------------
U6HHQ2_ECHMU/73-126VP--KEHIVQILDAKWKEFAIMNP--------------------------------------------------------
G0MX39_CAEBE/81-132AV--HAKILRLIQEKFEEFQNHM.--------------------------------------------------------
E0W1M0_PEDHC/141-194VP--VSKLMMLVAAKWREFSCMNP--------------------------------------------------------

PF06382

Q9VAF7_DROME/1-125-----QDMVHYAAKQWTQLSMAEKEAFKSKKPSTITLKSPAQYVACEMKSDVAGGQQSSCQRQSPSARLRESERRSSRSK
Q9V3S3_DROME/1-146-----RELIAKAAKAWARLSENRKDRYRR..............MACKVTT.....................SERH..KRR

PF04690

M0TDS3_MUSAM/5-158IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
I1P2J5_ORYGL/20-212IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
YAB2_ORYSJ/6-161IS--HREAFSTAAKNWAHFPNIHFGL------------------------------------------------------
K3YV50_SETIT/21-214IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
M4ES51_BRARP/5-163IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
W5GJ21_WHEAT/19-203IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
D7U7V5_VITVI/14-174IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
K7K1G3_SOYBN/57-210MA--HREAFSTAAKNWANFPPT....------------------------------------------------------
B9HTW7_POPTR/9-170MA--HKEAFSTAAKNWAHCPHVHYK.------------------------------------------------------
B9RQ61_RICCO/5-157IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
I1R7Z4_ORYGL/6-177IS--HREAFSTAAKNWAHYPNIHFGL------------------------------------------------------
M0TFF3_MUSAM/16-188IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
W1P3Y5_AMBTC/9-163IT--HKEAFSAAAKNWAHFPRIPFN.------------------------------------------------------
D7U8S1_VITVI/5-156IS--HKEAFSTAAKNWAHFPHIHFGL------------------------------------------------------
K4AZ41_SOLLC/23-182IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
I1IC11_BRADI/21-215IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
K3Z9T7_SETIT/6-168IS--HREAFSTAAKNWAHYPNIHFGL------------------------------------------------------
C5XS56_SORBI/20-212IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
K4CNR9_SOLLC/17-179IS--HREAFSAAAKNWAHFPHIQFGL------------------------------------------------------
B9HLS8_POPTR/9-163IA--HKEAFSTAAKNWAHSPLVQY..------------------------------------------------------
K4CBT7_SOLLC/7-163IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
B9GVI4_POPTR/13-176IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
YAB1_ORYSJ/5-157IS--HREAFSAAAKNWAHLPRLHFGL------------------------------------------------------
B9IBX2_POPTR/15-176IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
J3LF87_ORYBR/19-210IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
K7LVV0_SOYBN/6-165IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
M0S7H6_MUSAM/5-178IS--HREAFSTAAKNWAHFPRIHFGL------------------------------------------------------
M0RT32_MUSAM/18-181IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
M0TBQ3_MUSAM/5-155IS--HKEAFSAAAKNWAHFPHIHIGR------------------------------------------------------
K7L9I2_SOYBN/9-163MA--HKEAFSTAAKNWANFPP.....------------------------------------------------------
I1KFH5_SOYBN/6-162IS--HREAFSSAAKNWAHFPHIHFGL------------------------------------------------------
I1IGA5_BRADI/8-173IS--HREAFSTAAKNWAHYPNIHCGL------------------------------------------------------
M0TPL1_MUSAM/17-180IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
M0SR87_MUSAM/5-158IS--HREAFSTAAKNWAHFPHIQFGL------------------------------------------------------
B9SHC4_RICCO/9-171MA--HKEAFSTAAKNWANNPPIHYK.------------------------------------------------------
M1A5M2_SOLTU/9-164IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
I1IGA3_BRADI/8-179IS--HREAFSTAAKNWAHYPNIHCGL------------------------------------------------------
M0RP60_MUSAM/17-180IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
M0TTW3_MUSAM/5-159IS--HKEAFSRAAKNWAHFPEIHMGL------------------------------------------------------
D7T1M7_VITVI/5-157IT--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
C5X9N5_SORBI/5-159IS--HREAFSAAAKNWAHLPRLHFGL------------------------------------------------------
B9IMX9_POPTR/9-161IS--HREAFSTAAKNWAHFPHIQFGL------------------------------------------------------
D7LCG5_ARALL/20-189IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
F2ELF4_HORVD/9-178IS--HREAFSTAAKNWAHYPNIHFGL------------------------------------------------------
J3LZX6_ORYBR/28-218IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
B2YHV8_SOLLC/11-171IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
I1J038_BRADI/28-220IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
W5G1Q5_WHEAT/9-179IS--HREAFSTAAKNWAHYPNIHFGL------------------------------------------------------
B9HAJ0_POPTR/9-161IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
W1P736_AMBTC/16-193IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
W1NYE0_AMBTC/12-177IT--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
D7TDI7_VITVI/9-164MT--HKEAFSTAAKNWAHFPAIQ...------------------------------------------------------
B9HXH8_POPTR/13-167IP--HREAFSTAAKNWARY.......------------------------------------------------------
I1J7S5_SOYBN/16-179IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
I1K9Q9_SOYBN/9-163MT--HKEAFSTAAKNWANFPQT....------------------------------------------------------
B9HIG4_POPTR/11-164IP--HREAFSTAAKNWAR........------------------------------------------------------
I1GPY5_BRADI/6-160IS--HREAFSTAAKNWAHFPNIHFGL------------------------------------------------------
W5BCE7_WHEAT/28-220IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
K3Y9G7_SETIT/25-222IT--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
W1NE60_AMBTC/5-156IT--HREAFSTAAKNWAHFPHLHYGL------------------------------------------------------
YAB2_ARATH/5-160IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------
YAB3_ARATH/20-201IS--HREAFSAAAKNWAHFPHIHFGL------------------------------------------------------
YAB4_ARATH/16-182MA--HKEAFSLAAKNWAHFPPAHNK.------------------------------------------------------
B9III3_POPTR/5-159IS--HREAFSNAAKNWAHLPHTQSG.------------------------------------------------------
C5YSF3_SORBI/7-171IS--HREAFSTAAKNWAHYPNIHFGL------------------------------------------------------
I1LZN8_SOYBN/8-159IS--HREAFSTAAKNWAHFPHIHFGL------------------------------------------------------

PF06244

R0KSX9_SETT2/56-190LR--RQQKIDLIRKEFEKHPDNPFNQ------------------------------------------------------
Q9VE08_DROME/93-211LR--MSQWKQLLMKEWNKSPDNPFNQ------------------------------------------------------
G7YAF9_CLOSI/113-230LR--ISQLKQLIFKKFQTAPENPKNQ------------------------------------------------------
I1RMC8_GIBZE/52-188LR--LDQRKTRIRKEFEKHPDNPFNQ------------------------------------------------------
D7KDN9_ARALL/102-226LT--HTQYKDLIWKMWKKSPDNPLNQ------------------------------------------------------
A4HVI1_LEIIN/55-236LR--RTQYNDIIWEMWQKSPTNPF..------------------------------------------------------
E0VAF2_PEDHC/93-206LR--LSQLKQILNKDWMRAPENPLNQ------------------------------------------------------
Q4X4X0_PLACH/118-277LK--LSQYKQILWKKFKKSADNPMNQ------------------------------------------------------
R4GLN0_CHICK/95-212MR--LSQLKQLLKKEWMKSPENPMNQ------------------------------------------------------
CC124_DANRE/94-208MR--LSQLKQQLKKEWTKSPENPLNQ------------------------------------------------------
E1ZLB4_CHLVA/97-218LR--LMQYKSMIFERWQKDPRNPRNQ------------------------------------------------------
C4R6B1_PICPG/35-173LR--KQQLENLCYKEFQKSPENPMN.------------------------------------------------------
B6AE18_CRYMR/93-218YK--RSQLLQILQRRWKKAPENPCNQ------------------------------------------------------
C1MJE8_MICPC/96-225LK--MSQYKEALHKAFQKSPMNPQN.------------------------------------------------------
B3RRU8_TRIAD/93-212LR--LSQVKQLVKKNWQKSPDNPMNQ------------------------------------------------------
B8MZC7_ASPFN/52-190LR--RQQRIELIKKEFDKSEENPFNQ------------------------------------------------------
B3L0Z8_PLAKH/94-214LK--LSQFKQILWKQFKKSPDNPMNQ------------------------------------------------------
K1R9I3_CRAGI/112-227MK--LSQLKQMLWKDWQKSPENPLNQ------------------------------------------------------
W1NK94_AMBTC/105-225LT--HTQYKDMIWKLWKKSPDNPLNQ------------------------------------------------------
F7EQ85_ORNAN/42-157MR--LSQLKQLLKKEWMKSPENPMNQ------------------------------------------------------
E1FIM0_LOALO/91-211YR--LSQLKQVLKKQWQKSPENPLNQ------------------------------------------------------
G2YZ93_BOTF4/53-196LR--KNQRQERIRKEFEKSPLNPYNQ------------------------------------------------------
C1DZF4_MICSR/101-216LK--MSQYNEALSKMWKKDPTNPAN.------------------------------------------------------
K4AM07_SETIT/140-266LT--LHQYKDIIWKLWKKSPDNPLNQ------------------------------------------------------
D8RXZ7_SELML/110-229LT--HTQYKDLLWKLWKKSPDNPLNQ------------------------------------------------------
K3WDG6_PYTUL/143-255LK--LSQYKQKLSEMWRRSPENPLNQ------------------------------------------------------
W4XEG2_STRPU/98-219LR--LSQLKQMLKKDWMKSPENPMNQ------------------------------------------------------
H2XNC6_CIOIN/94-210LK--LSQLRQTLRKMWQKSPENPMNQ------------------------------------------------------
B4LXA5_DROVI/93-212LR--MSQWKQLLMKEWNKSPENPFNQ------------------------------------------------------
H0X6K7_OTOGA/96-217MR--LSQLKQLLKKEWLRSPDNPMNQ------------------------------------------------------
H0VY33_CAVPO/95-214MR--LSQLKQLLKKEWLRSPENPMNQ------------------------------------------------------
A8IUW8_CHLRE/93-216LK--MSQYKDMLWKTWQKAPDNPLNA------------------------------------------------------
A0A023B3J2_GRENI/51-230LK--RSQYIERIQKAWAKSPENPLNK------------------------------------------------------
Q2AAB8_CAEEL/18-139FR--LSQLKQILKKEWQKSPENPLNA------------------------------------------------------
A7RS85_NEMVE/80-201LR--LSQLKQMLRKDWMKSPENPLNA------------------------------------------------------
G1PAA5_MYOLU/97-214LR--LSQLKQLLKKEWLRSPDNPN..------------------------------------------------------
L8FWQ1_PSED2/53-192LR--QNQKKERIRKEFEKSPENPFNN------------------------------------------------------
B9SR05_RICCO/102-226LT--HNQYKDMIWKLWKKSPDNPLNQ------------------------------------------------------
C0H4Y8_PLAF7/94-214LK--LSQYKQMLWKQFKKSAENPMNQ------------------------------------------------------
A7ATI8_BABBO/96-219LK--YSQYKDMIFKAWKKSPANPM..------------------------------------------------------
Q2H0K7_CHAGB/53-193LR--MNQKKERIKKEFERSPDNPFNQ------------------------------------------------------
D7G657_ECTSI/124-250LK--LRQYKQMIFEQFQKSPENPVNK------------------------------------------------------
G1K3G0_XENTR/95-212MR--LSQLKQLLKKEWMKSPENPMNQ------------------------------------------------------
W5J3U9_ANODA/92-211LK--LSQLKQMIFKNWQKAPENPMNQ------------------------------------------------------
Q7QBA5_ANOGA/92-210LK--LSQLKQMIFKNWQKAPENPLNQ------------------------------------------------------
Q4Z043_PLABA/97-259LK--LSQYKQILWKKFKKSADNPMNQ------------------------------------------------------
D8TGY2_VOLCA/95-216LK--MSQYKDMLWKSWQKAPENPLNQ------------------------------------------------------
C4WUS4_ACYPI/84-202MR--LSQVKQLMNKEWMKSPDNPINQ------------------------------------------------------
H3B1E2_LATCH/95-212MR--LSQLKQLLKKEWMKSPDNPMNQ------------------------------------------------------
U6I1Y6_ECHMU/96-211MR--HSQLTQMIFKSFQTAPENPKNQ------------------------------------------------------
T1IPE4_STRMM/95-207LR--LSQWKEIVKKDWMKSPKNPLIQ------------------------------------------------------
B0WCY1_CULQU/92-208LK--LSQLKQMIFKDWQKSPQNPLNQ------------------------------------------------------
W5M4J7_LEPOC/96-211MR--LSQLKQQLKKEWTKSPDNPLNQ------------------------------------------------------
F0XUT2_GROCL/53-205LR--LNQRKERLRKEFEKSPENPFNQ------------------------------------------------------
H9JVF1_BOMMO/95-209LR--LSQLKELLKKEWHKSPQNPLNQ------------------------------------------------------
G4LXI6_SCHMA/96-211MR--HSQLKQLVFKMFQTSPENPKNQ------------------------------------------------------
M0SS42_MUSAM/102-227LT--LNQYKDMVWKLWKKSPDNPLNQ------------------------------------------------------
K1X0I7_MARBU/53-191LR--QNQKKERIRKEFEKSEENPFNQ------------------------------------------------------
H2MLV9_ORYLA/86-202MR--LSQLKQQLKKEWAKSPENPLNQ------------------------------------------------------
F2U6S5_SALR5/110-222LR--LSQVKAAVKKAWQRSPSNPANQ------------------------------------------------------
G3P1Q8_GASAC/96-213MR--LSQLKQQLKKEWMKSPENPLNQ------------------------------------------------------
R4FK63_RHOPR/96-205LK--LSQLKQKIRKEWQKSSENPVNS------------------------------------------------------
F4Q8R5_DICFS/125-243LK--FTQVKDLLWKQWLKSPENPMNQ------------------------------------------------------
Q16YV3_AEDAE/92-207LK--LSQLKQMIFKEWQKSPQNPMNQ------------------------------------------------------
I1FC80_AMPQE/19-212LR--LSQVKQLVRKEWMKSPENPMNQ------------------------------------------------------
E4X8S8_OIKDI/105-213LK--RSQLKELLWKEWQKSPENPINQ------------------------------------------------------
F9FFR7_FUSOF/51-188LR--LDQRKTRIRKEFEKHPDNPFNQ------------------------------------------------------
F0VKT5_NEOCL/92-218LK--RSQLIEMLSKQWRKAPENPMNQ------------------------------------------------------
U6GKQ7_EIMAC/93-219LK--RSQLLELLSKQWKKAPENPLNQ------------------------------------------------------
G6CMI5_DANPL/94-208LR--LSQLKQMLRKEWLKSPQNPLNQ------------------------------------------------------
C3Z6B4_BRAFL/97-216MR--LSQLKQMLKKDWMKSPENPMNQ------------------------------------------------------
G0S5J0_CHATD/53-195LR--LNQKKERIRKEFEKSPENPFNQ------------------------------------------------------
M0VS67_HORVD/9-136LT--LKQYKDMIWKLWKKSPDNPLNK------------------------------------------------------
A9U354_PHYPA/105-228LT--HTQYKDMLWKMWKKSPDNPLNQ------------------------------------------------------
G9MTL1_HYPVG/52-190LR--LEQRKQRIRKEFDKSPENPFNQ------------------------------------------------------
U1NIQ3_ASCSU/92-212FR--LSQLKQLLKKEWQKSPDNPLNQ------------------------------------------------------
I3K409_ORENI/96-214MR--LSQLKQQLKKEWAKAPENPLNQ------------------------------------------------------
M1BLN4_SOLTU/98-222LT--HTQYKDLIWKLWKKSPDNPLNQ------------------------------------------------------
M4A2X1_XIPMA/96-212MR--MSQLKQQLKKEWAKSPENPLNQ------------------------------------------------------

PF14887

E9PLT2_HUMAN/66-150FKNDRVKALKAMEMTWNNMEKKEKLMWIKKA----------------------------------------AEDQKRYER
F6ZYJ1_XENTR/232-316FKNDRAKALKCMEATWLNMEKKEKIMWIKKA----------------------------------------AEDQKRYER
H3CF76_TETNG/472-557FKSDRSKAQKAMEATWSNMEKKEKIMWIKKA----------------------------------------AEDQKRYER

PF09011

A2E233_TRIVA/26-97ENPNWH---------------
C3Z277_BRAFL/6-77TAGRLD---------------
MAEL_XENTR/2-73TSTYND---------------
MAEL_HUMAN/2-73DPGPSE---------------
B3S6M5_TRIAD/36-107EMMTYN---------------
E7F0H8_DANRE/6-79EMMHYN---------------
F7DZV4_ORNAN/34-106EMKDY.---------------
Q66IB6_DANRE/7-78EMKTY.---------------
V4ZPN8_TOXGO/64-141EALWHD---------------

PF00505

MTMC3_SCHPO/103-171MYPGYK---------------
HMGH_IIV6/54-122SKEANK---------------
YF98_SCHPO/195-263ARRRRS---------------
NHP6A_YEAST/21-89EKELYN---------------
UBF1_HUMAN/112-180NLARFR---------------
HMGL_SOYBN/44-113NMRAYN---------------
LEF1_MOUSE/297-365LYPGWS---------------
HMGL_WHEAT/42-111AIAAYN---------------
TFAM_MOUSE/49-117AVSKYK---------------
HMGH_STRPU/100-168AMAEYK---------------
SRY_GORGO/60-128KYPNYK---------------
SOX2_CHICK/39-107EHPDYK---------------
HMGB1_RAT/95-163DIAAYR---------------
TFAM_HUMAN/50-118EISRFK---------------
ABF2_YEAST/43-111AKKEFD---------------
SSRP1_DROME/555-621EMRNYK---------------
SOX4_HUMAN/59-127DYPDYK---------------
SSRP1_HUMAN/547-615AMKEYE---------------
MATD_NEUCR/147-215ENPHLY---------------
A7AVG2_BABBO/23-92EKAEY.---------------
B2ABG5_PODAN/169-237AHPHYR---------------
G3GTI9_CRIGR/15-83DHPDYK---------------
G4U6E3_NEUT9/116-184EHPDYR---------------
I7MKQ6_TETTS/18-86QNDQWK---------------
M2RF48_COCSN/126-193QHPNYK---------------
Q23QF5_TETTS/161-229DMQAYE---------------
Q57XJ9_TRYB2/118-186EVDEYK---------------

PF08073

X1XTS3_ACYPI/144-197---------------------
T1JDG0_STRMM/147-200---------------------
E9FRV7_DAPPU/197-250---------------------
Q16K27_AEDAE/151-204---------------------
T1I428_RHOPR/17-70---------------------
H9G906_ANOCA/209-262---------------------
CHD3_CAEEL/97-150---------------------
U1MF28_ASCSU/95-147---------------------
J0XKG3_LOALO/9-60---------------------
H2W8R5_CAEJA/91-144---------------------
Q7PZN7_ANOGA/153-206---------------------
G4V7W2_SCHMA/80-133---------------------
K7H9V4_CAEJA/95-148---------------------
D6X1V1_TRICA/150-203---------------------
H3ENB4_PRIPA/94-144---------------------
W4Z592_STRPU/127-180---------------------
B7PLQ0_IXOSC/143-196---------------------
LE418_CAEEL/95-147---------------------
E5SBN8_TRISP/115-164---------------------
B4IXP0_DROGR/132-185---------------------
F6PLL0_MONDO/66-119---------------------
H2Y0G6_CIOIN/133-183---------------------
H9J096_BOMMO/143-196---------------------
K1RRH1_CRAGI/112-162---------------------
U6HHQ2_ECHMU/73-126---------------------
G0MX39_CAEBE/81-132---------------------
E0W1M0_PEDHC/141-194---------------------

PF06382

Q9VAF7_DROME/1-125TLCRSA---------------
Q9V3S3_DROME/1-146RICQQY---------------

PF04690

M0TDS3_MUSAM/5-158---------------------
I1P2J5_ORYGL/20-212---------------------
YAB2_ORYSJ/6-161---------------------
K3YV50_SETIT/21-214---------------------
M4ES51_BRARP/5-163---------------------
W5GJ21_WHEAT/19-203---------------------
D7U7V5_VITVI/14-174---------------------
K7K1G3_SOYBN/57-210---------------------
B9HTW7_POPTR/9-170---------------------
B9RQ61_RICCO/5-157---------------------
I1R7Z4_ORYGL/6-177---------------------
M0TFF3_MUSAM/16-188---------------------
W1P3Y5_AMBTC/9-163---------------------
D7U8S1_VITVI/5-156---------------------
K4AZ41_SOLLC/23-182---------------------
I1IC11_BRADI/21-215---------------------
K3Z9T7_SETIT/6-168---------------------
C5XS56_SORBI/20-212---------------------
K4CNR9_SOLLC/17-179---------------------
B9HLS8_POPTR/9-163---------------------
K4CBT7_SOLLC/7-163---------------------
B9GVI4_POPTR/13-176---------------------
YAB1_ORYSJ/5-157---------------------
B9IBX2_POPTR/15-176---------------------
J3LF87_ORYBR/19-210---------------------
K7LVV0_SOYBN/6-165---------------------
M0S7H6_MUSAM/5-178---------------------
M0RT32_MUSAM/18-181---------------------
M0TBQ3_MUSAM/5-155---------------------
K7L9I2_SOYBN/9-163---------------------
I1KFH5_SOYBN/6-162---------------------
I1IGA5_BRADI/8-173---------------------
M0TPL1_MUSAM/17-180---------------------
M0SR87_MUSAM/5-158---------------------
B9SHC4_RICCO/9-171---------------------
M1A5M2_SOLTU/9-164---------------------
I1IGA3_BRADI/8-179---------------------
M0RP60_MUSAM/17-180---------------------
M0TTW3_MUSAM/5-159---------------------
D7T1M7_VITVI/5-157---------------------
C5X9N5_SORBI/5-159---------------------
B9IMX9_POPTR/9-161---------------------
D7LCG5_ARALL/20-189---------------------
F2ELF4_HORVD/9-178---------------------
J3LZX6_ORYBR/28-218---------------------
B2YHV8_SOLLC/11-171---------------------
I1J038_BRADI/28-220---------------------
W5G1Q5_WHEAT/9-179---------------------
B9HAJ0_POPTR/9-161---------------------
W1P736_AMBTC/16-193---------------------
W1NYE0_AMBTC/12-177---------------------
D7TDI7_VITVI/9-164---------------------
B9HXH8_POPTR/13-167---------------------
I1J7S5_SOYBN/16-179---------------------
I1K9Q9_SOYBN/9-163---------------------
B9HIG4_POPTR/11-164---------------------
I1GPY5_BRADI/6-160---------------------
W5BCE7_WHEAT/28-220---------------------
K3Y9G7_SETIT/25-222---------------------
W1NE60_AMBTC/5-156---------------------
YAB2_ARATH/5-160---------------------
YAB3_ARATH/20-201---------------------
YAB4_ARATH/16-182---------------------
B9III3_POPTR/5-159---------------------
C5YSF3_SORBI/7-171---------------------
I1LZN8_SOYBN/8-159---------------------

PF06244

R0KSX9_SETT2/56-190---------------------
Q9VE08_DROME/93-211---------------------
G7YAF9_CLOSI/113-230---------------------
I1RMC8_GIBZE/52-188---------------------
D7KDN9_ARALL/102-226---------------------
A4HVI1_LEIIN/55-236---------------------
E0VAF2_PEDHC/93-206---------------------
Q4X4X0_PLACH/118-277---------------------
R4GLN0_CHICK/95-212---------------------
CC124_DANRE/94-208---------------------
E1ZLB4_CHLVA/97-218---------------------
C4R6B1_PICPG/35-173---------------------
B6AE18_CRYMR/93-218---------------------
C1MJE8_MICPC/96-225---------------------
B3RRU8_TRIAD/93-212---------------------
B8MZC7_ASPFN/52-190---------------------
B3L0Z8_PLAKH/94-214---------------------
K1R9I3_CRAGI/112-227---------------------
W1NK94_AMBTC/105-225---------------------
F7EQ85_ORNAN/42-157---------------------
E1FIM0_LOALO/91-211---------------------
G2YZ93_BOTF4/53-196---------------------
C1DZF4_MICSR/101-216---------------------
K4AM07_SETIT/140-266---------------------
D8RXZ7_SELML/110-229---------------------
K3WDG6_PYTUL/143-255---------------------
W4XEG2_STRPU/98-219---------------------
H2XNC6_CIOIN/94-210---------------------
B4LXA5_DROVI/93-212---------------------
H0X6K7_OTOGA/96-217---------------------
H0VY33_CAVPO/95-214---------------------
A8IUW8_CHLRE/93-216---------------------
A0A023B3J2_GRENI/51-230---------------------
Q2AAB8_CAEEL/18-139---------------------
A7RS85_NEMVE/80-201---------------------
G1PAA5_MYOLU/97-214---------------------
L8FWQ1_PSED2/53-192---------------------
B9SR05_RICCO/102-226---------------------
C0H4Y8_PLAF7/94-214---------------------
A7ATI8_BABBO/96-219---------------------
Q2H0K7_CHAGB/53-193---------------------
D7G657_ECTSI/124-250---------------------
G1K3G0_XENTR/95-212---------------------
W5J3U9_ANODA/92-211---------------------
Q7QBA5_ANOGA/92-210---------------------
Q4Z043_PLABA/97-259---------------------
D8TGY2_VOLCA/95-216---------------------
C4WUS4_ACYPI/84-202---------------------
H3B1E2_LATCH/95-212---------------------
U6I1Y6_ECHMU/96-211---------------------
T1IPE4_STRMM/95-207---------------------
B0WCY1_CULQU/92-208---------------------
W5M4J7_LEPOC/96-211---------------------
F0XUT2_GROCL/53-205---------------------
H9JVF1_BOMMO/95-209---------------------
G4LXI6_SCHMA/96-211---------------------
M0SS42_MUSAM/102-227---------------------
K1X0I7_MARBU/53-191---------------------
H2MLV9_ORYLA/86-202---------------------
F2U6S5_SALR5/110-222---------------------
G3P1Q8_GASAC/96-213---------------------
R4FK63_RHOPR/96-205---------------------
F4Q8R5_DICFS/125-243---------------------
Q16YV3_AEDAE/92-207---------------------
I1FC80_AMPQE/19-212---------------------
E4X8S8_OIKDI/105-213---------------------
F9FFR7_FUSOF/51-188---------------------
F0VKT5_NEOCL/92-218---------------------
U6GKQ7_EIMAC/93-219---------------------
G6CMI5_DANPL/94-208---------------------
C3Z6B4_BRAFL/97-216---------------------
G0S5J0_CHATD/53-195---------------------
M0VS67_HORVD/9-136---------------------
A9U354_PHYPA/105-228---------------------
G9MTL1_HYPVG/52-190---------------------
U1NIQ3_ASCSU/92-212---------------------
I3K409_ORENI/96-214---------------------
M1BLN4_SOLTU/98-222---------------------
M4A2X1_XIPMA/96-212---------------------

PF14887

E9PLT2_HUMAN/66-150ELSEMRAPPAAT.NSSKKMKF
F6ZYJ1_XENTR/232-316ELSDMRSAPTPT.TAGKKVKF
H3CF76_TETNG/472-557ELYEMRSPAAAAIASGKKMKF

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window