Sequence alignment for CL0115

PF04140

Q9EWQ7_STRCO/75-167--------------------------------------------------------------------------------
Q99YI2_STRP1/81-173--------------------------------------------------------------------------------
P91402_CAEEL/171-267--------------------------------------------------------------------------------
Q9KF68_BACHD/72-166--------------------------------------------------------------------------------
MAM4_SCHPO/121-215--------------------------------------------------------------------------------
Q9CM58_PASMU/75-167--------------------------------------------------------------------------------
Q9XCY1_RHOCE/72-164--------------------------------------------------------------------------------
ICMT_HUMAN/161-257--------------------------------------------------------------------------------
STE14_YEAST/123-219--------------------------------------------------------------------------------
Q99X02_STAAM/73-164--------------------------------------------------------------------------------
ICMT_XENLA/165-261--------------------------------------------------------------------------------
Q9RTL5_DEIRA/91-184--------------------------------------------------------------------------------

PF04191

A4HJV7_LEIBR/438-543--------------------------------------------------------------------------------
PEMT_HUMAN/89-192--------------------------------------------------------------------------------
CHO2_ASPCL/504-608--------------------------------------------------------------------------------
A1CQK4_ASPCL/70-170--------------------------------------------------------------------------------
A1UQ07_MYCSK/81-184--------------------------------------------------------------------------------
A3CKP0_STRSV/68-171--------------------------------------------------------------------------------
A3LQ40_PICST/106-209--------------------------------------------------------------------------------
CHO2_PICST/449-558--------------------------------------------------------------------------------
A4AA40_9GAMM/36-141--------------------------------------------------------------------------------
A4GJI8_9BACT/30-133--------------------------------------------------------------------------------
A4GK25_9BACT/30-133--------------------------------------------------------------------------------
A4HJL2_LEIBR/106-210--------------------------------------------------------------------------------
CHO2_MAGO7/497-601--------------------------------------------------------------------------------
CHO2_PICGU/462-570--------------------------------------------------------------------------------
CHO2_LODEL/480-589--------------------------------------------------------------------------------
A5UZK8_ROSS1/43-144--------------------------------------------------------------------------------
A6FZ22_9DELT/133-240--------------------------------------------------------------------------------
A6S8E2_BOTFB/75-178--------------------------------------------------------------------------------
A6U6D6_SINMW/33-136--------------------------------------------------------------------------------
A6ZQ31_YEAS7/97-200--------------------------------------------------------------------------------
CHO2_YEAS7/470-578--------------------------------------------------------------------------------
A7TIE1_VANPO/140-243--------------------------------------------------------------------------------
CHO22_VANPO/452-560--------------------------------------------------------------------------------
CHO21_VANPO/439-547--------------------------------------------------------------------------------
A8MZ66_HUMAN/126-222--------------------------------------------------------------------------------
A8NIW8_COPC7/92-195--------------------------------------------------------------------------------
CHO2_MALGO/537-642--------------------------------------------------------------------------------
A8PVU2_MALGO/102-205--------------------------------------------------------------------------------
A9B4Y9_HERA2/33-137--------------------------------------------------------------------------------
A9V3D6_MONBE/125-229--------------------------------------------------------------------------------
CHO2_LACBS/492-596--------------------------------------------------------------------------------
B0EDH3_ENTDS/91-196--------------------------------------------------------------------------------
B1MLL6_MYCA9/108-208--------------------------------------------------------------------------------
B1WZT5_CYAA5/96-194--------------------------------------------------------------------------------
B2AR50_PODAN/95-198--------------------------------------------------------------------------------
CHO2_PODAN/496-600--------------------------------------------------------------------------------
B2JAT8_NOSP7/42-145--------------------------------------------------------------------------------
B2VTC6_PYRTR/87-190--------------------------------------------------------------------------------
CHO2_PYRTR/425-530--------------------------------------------------------------------------------
B3RI13_TRIAD/89-192--------------------------------------------------------------------------------
B5J185_9RHOB/16-119--------------------------------------------------------------------------------
B5XDB0_SALSA/119-222--------------------------------------------------------------------------------
CHO2_SCHJY/478-583--------------------------------------------------------------------------------
B6QQY2_PENMQ/89-189--------------------------------------------------------------------------------
B8KMW4_9GAMM/36-141--------------------------------------------------------------------------------
B8LBH8_THAPS/30-132--------------------------------------------------------------------------------
B8PB22_POSPM/91-194--------------------------------------------------------------------------------
CHO2_CANDC/471-580--------------------------------------------------------------------------------
C0C2L6_9CLOT/84-187--------------------------------------------------------------------------------
C4G5P4_ABIDE/68-162--------------------------------------------------------------------------------
CHO2_PICPG/450-564--------------------------------------------------------------------------------
C4R5S7_PICPG/98-201--------------------------------------------------------------------------------
CHO2_CLAL4/444-555--------------------------------------------------------------------------------
C5DC91_LACTC/106-209--------------------------------------------------------------------------------
CHO2_LACTC/450-558--------------------------------------------------------------------------------
C5DZ83_ZYGRC/102-205--------------------------------------------------------------------------------
CHO2_ZYGRC/430-538--------------------------------------------------------------------------------
C5G0L0_ARTOC/115-215--------------------------------------------------------------------------------
D7VS98_9SPHI/49-154--------------------------------------------------------------------------------
C6SSR2_STRMN/68-171--------------------------------------------------------------------------------
C6WWJ2_METML/43-146--------------------------------------------------------------------------------
C7GC66_9FIRM/86-188--------------------------------------------------------------------------------
C7YM51_NECH7/94-197--------------------------------------------------------------------------------
CHO2_NECH7/505-609--------------------------------------------------------------------------------
C8PGT3_9PROT/79-173--------------------------------------------------------------------------------
CHO2_SORMK/496-600--------------------------------------------------------------------------------
E3I110_RHOVT/77-175--------------------------------------------------------------------------------
D2U841_XANAP/75-178--------------------------------------------------------------------------------
D2V512_NAEGR/65-168--------------------------------------------------------------------------------
D2VYZ6_NAEGR/455-563--------------------------------------------------------------------------------
D3AX06_POLPA/89-193--------------------------------------------------------------------------------
D3BED6_POLPA/557-662--------------------------------------------------------------------------------
D3BN57_POLPA/99-202--------------------------------------------------------------------------------
CHO2_SCHPO/491-596--------------------------------------------------------------------------------
CHO1_SCHPO/110-213--------------------------------------------------------------------------------
Q01DA1_OSTTA/648-751--------------------------------------------------------------------------------
Q0AM70_MARMM/72-173--------------------------------------------------------------------------------
Q0AQW8_MARMM/72-173--------------------------------------------------------------------------------
CHO2_PHANO/462-567--------------------------------------------------------------------------------
Q0UN81_PHANO/69-173--------------------------------------------------------------------------------
Q11IW9_MESSB/45-148--------------------------------------------------------------------------------
Q1GIY9_SILST/78-176--------------------------------------------------------------------------------
Q4P2D8_USTMA/99-202--------------------------------------------------------------------------------
Q4PA66_USTMA/318-424--------------------------------------------------------------------------------
Q4V0H0_XANC8/96-199--------------------------------------------------------------------------------
PEMTL_DICDI/82-186--------------------------------------------------------------------------------
PEM2_DICDI/98-201--------------------------------------------------------------------------------
Q55Q20_CRYNB/618-724--------------------------------------------------------------------------------
Q55UT8_CRYNB/146-249--------------------------------------------------------------------------------
Q5ZJB1_CHICK/134-237--------------------------------------------------------------------------------
Q64EH3_9ARCH/57-160--------------------------------------------------------------------------------
Q66KT1_XENLA/89-192--------------------------------------------------------------------------------
Q6C649_YARLI/97-200--------------------------------------------------------------------------------
CHO2_YARLI/531-635--------------------------------------------------------------------------------
CHO2_KLULA/451-559--------------------------------------------------------------------------------
Q6CV75_KLULA/106-209--------------------------------------------------------------------------------
Q6FUV4_CANGA/106-209--------------------------------------------------------------------------------
CHO2_CANGA/431-540--------------------------------------------------------------------------------
Q752Z0_ASHGO/100-203--------------------------------------------------------------------------------
Q7MUP1_PORGI/82-176--------------------------------------------------------------------------------
Q7YRH5_PIG/89-192--------------------------------------------------------------------------------
Q7ZVZ2_DANRE/120-223--------------------------------------------------------------------------------
Q86IF9_DICDI/521-626--------------------------------------------------------------------------------
Q8TN26_METAC/121-221--------------------------------------------------------------------------------
Q98I61_RHILO/42-146--------------------------------------------------------------------------------

PF06966

Q10E47_ORYSJ/24-252---------------------------------------------------FFIITALLRFDKVTDFAGSTNFIILAILT
Q8PAZ9_XANCP/20-250---------------------------------------------------GWLWQRRSGNAGPVDVLWAGCLAVAAPYC
Q9A3U2_CAUCR/70-299---------------------------------------------------LWAVSLRTKDVSFIDAWWGPSMALLAWST
Q9VSM5_DROME/25-264---------------------------------------------------FFLINSVLQMDKLTDFAGGVNFIIISLLT
Q9CHY6_LACLA/17-245---------------------------------------------------WFLIATSKKNYGLIDIAWGGGFVLTAVVS
Q7CY59_AGRT5/19-248---------------------------------------------------AWALQRATGSSGWIDTVWSASVGLGGVLA
O81042_ARATH/64-303---------------------------------------------------FWVIGLLQSSHWMIDVYWTVIPVMLVHYF
Q8LEY8_ARATH/24-252---------------------------------------------------FFVITALFKFDQVTDFAGSTNFVILAVLT
O53731_MYCTU/17-243---------------------------------------------------AFAIGRRIGRYNVVDVVWGLGFVAVAVAA
YJD4_SCHPO/61-314---------------------------------------------------LWGVSVWTKNTSQVDRLWPILPTAFSLHF
Q8Y9D9_LISMO/16-244---------------------------------------------------WFIISKIKGKYSLVDIAWGGGFVVVAWTG
Q984A1_RHILO/21-257---------------------------------------------------AWLVAIRTGSSGWVDAIWSFAVGIIGAFL

PF02544

Q19605_CAEEL/97-243--------------------------------------------------------------------------------
YN67_SCHPO/146-295--------------------------------------------------------------------------------
Q20344_CAEEL/97-243--------------------------------------------------------------------------------
S5A1_RAT/110-259--------------------------------------------------------------------------------
S5A2_HUMAN/105-254--------------------------------------------------------------------------------
PORED_CAEEL/189-309--------------------------------------------------------------------------------
Q23431_CAEEL/103-253--------------------------------------------------------------------------------
DET2_ARATH/111-262--------------------------------------------------------------------------------
TSC13_YEAST/154-310--------------------------------------------------------------------------------
S5A1_HUMAN/110-259--------------------------------------------------------------------------------

PF01222

LBR_CHICK/175-609EEIYAEKKIFEAIKTPEKPSSK....TKELEFGGRFGTFMLMFFLPATVLYLVLMCKQDDPSLMNFPPLPALESLWETKV
ERG24_NEUCR/17-490RQQHYEFGG.PIGAFGITFGLPILVHVFNLFCNDISGCPAPSLLHPKSLDLAQLKREIGWPDNGVFGL.....FSWSATL
STS1_SCHPO/7-453KSAPREFGG.AKGALAIMTGFP....CLMYYLWACSKFNDSQFIKPESFTIAGFQNFFRTLGHYIYVG...AY..PTRYA
ERG4_YEAST/34-473NEIEYEFGG.TTGVIGMLIGFP....LLMYYMWICAEFYHGKVALPKAG..ESWMHFIKHLYQLVLEN...GI..PEKYD
ERG24_YEAST/8-438RTTEFEFGG.LIGALGISIGLP....VFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKP..LRYYLG........NREL

PF07298

C5N9K5_BURML/5-192--------------------------------------------------------------------------------
A9ANX9_BURM1/3-190--------------------------------------------------------------------------------
Q1BPV3_BURCA/3-190--------------------------------------------------------------------------------
A4JQ26_BURVG/3-190--------------------------------------------------------------------------------
B2JUD7_BURP8/3-190--------------------------------------------------------------------------------
A1VI53_POLNA/3-190--------------------------------------------------------------------------------
Q12HL7_POLSJ/3-190--------------------------------------------------------------------------------
A2SBS8_METPP/3-190--------------------------------------------------------------------------------
Q223I4_RHOFD/3-190--------------------------------------------------------------------------------
A1K5T7_AZOSB/6-191--------------------------------------------------------------------------------
A1WT38_HALHL/3-190--------------------------------------------------------------------------------
A6VV32_MARMS/3-191--------------------------------------------------------------------------------
A6GLJ7_9BURK/5-192--------------------------------------------------------------------------------
A3UJ56_9RHOB/3-182--------------------------------------------------------------------------------
Q0AQE8_MARMM/3-183--------------------------------------------------------------------------------
A3JNN0_9RHOB/3-184--------------------------------------------------------------------------------
Q2CI37_9RHOB/3-180--------------------------------------------------------------------------------
A1AZI2_PARDP/3-180--------------------------------------------------------------------------------
A3V560_9RHOB/3-179--------------------------------------------------------------------------------
A3VBW4_9RHOB/3-178--------------------------------------------------------------------------------
A4EI42_9RHOB/3-182--------------------------------------------------------------------------------
Q28U80_JANSC/6-185--------------------------------------------------------------------------------
A4EZ57_9RHOB/3-179--------------------------------------------------------------------------------
A3TV37_9RHOB/3-178--------------------------------------------------------------------------------
A3K3K6_9RHOB/3-179--------------------------------------------------------------------------------
Q0FNF9_9RHOB/3-178--------------------------------------------------------------------------------
Q5LXD7_SILPO/5-179--------------------------------------------------------------------------------
Q1GLH3_SILST/3-179--------------------------------------------------------------------------------
A4WNN0_RHOS5/3-178--------------------------------------------------------------------------------
A6DVY9_9RHOB/3-178--------------------------------------------------------------------------------
A6FLU6_9RHOB/3-178--------------------------------------------------------------------------------
A3SVP9_9RHOB/4-183--------------------------------------------------------------------------------
A8LJK3_DINSH/5-184--------------------------------------------------------------------------------
Q169U5_ROSDO/3-182--------------------------------------------------------------------------------
A0Z9H8_9GAMM/3-179--------------------------------------------------------------------------------
B1KG57_SHEWM/3-185--------------------------------------------------------------------------------
Q1KL82_9BACT/3-184--------------------------------------------------------------------------------
A4A3P3_9GAMM/3-185--------------------------------------------------------------------------------
A4SIT4_AERS4/3-186--------------------------------------------------------------------------------
A0KG00_AERHH/3-186--------------------------------------------------------------------------------
Q6N9Q3_RHOPA/31-253--------------------------------------------------------------------------------
Q07S45_RHOP5/22-244--------------------------------------------------------------------------------
Q219Y9_RHOPB/14-236--------------------------------------------------------------------------------
Q5LUC0_SILPO/7-220--------------------------------------------------------------------------------
A1B4I1_PARDP/5-167--------------------------------------------------------------------------------
A3PL51_RHOS1/6-228--------------------------------------------------------------------------------
A4WR63_RHOS5/6-228--------------------------------------------------------------------------------
A3VCT1_9RHOB/6-228--------------------------------------------------------------------------------
A4EUV2_9RHOB/5-226--------------------------------------------------------------------------------
Q0C1Y5_HYPNA/14-233--------------------------------------------------------------------------------
Q169M4_ROSDO/6-220--------------------------------------------------------------------------------
A3VZT2_9RHOB/6-219--------------------------------------------------------------------------------
A6DZE5_9RHOB/5-218--------------------------------------------------------------------------------
A8LNX8_DINSH/42-256--------------------------------------------------------------------------------
A0NZJ4_9RHOB/28-242--------------------------------------------------------------------------------
A9CGK0_AGRT5/3-221--------------------------------------------------------------------------------
Q2JYB9_RHIEC/5-223--------------------------------------------------------------------------------
Q92Z13_RHIME/3-221--------------------------------------------------------------------------------
Q9Z3V3_9RHIZ/48-266--------------------------------------------------------------------------------
B0U8Q9_METS4/2-221--------------------------------------------------------------------------------
Q2VYZ8_MAGSA/17-229--------------------------------------------------------------------------------
Q60BH7_METCA/3-224--------------------------------------------------------------------------------
A7HZ42_PARL1/3-227--------------------------------------------------------------------------------
B2T4H1_BURPP/6-224--------------------------------------------------------------------------------
Q1NFY6_9SPHN/3-221--------------------------------------------------------------------------------
A3WFN8_9SPHN/7-218--------------------------------------------------------------------------------
A5P993_9SPHN/6-220--------------------------------------------------------------------------------
Q1GUJ7_SPHAL/6-226--------------------------------------------------------------------------------
Q2GC12_NOVAD/7-219--------------------------------------------------------------------------------
Q8DMH0_THEEB/15-236--------------------------------------------------------------------------------
A0YMQ9_LYNSP/24-245--------------------------------------------------------------------------------
Q113R6_TRIEI/12-233--------------------------------------------------------------------------------
Q8YQ81_NOSS1/13-234--------------------------------------------------------------------------------
A0ZJY3_NODSP/15-236--------------------------------------------------------------------------------
Q9ALA6_SYNE7/12-229--------------------------------------------------------------------------------
Q2JR62_SYNJA/13-234--------------------------------------------------------------------------------
Q7V3C9_PROMP/9-231--------------------------------------------------------------------------------
Q31D33_PROM9/9-231--------------------------------------------------------------------------------
A3Z341_9SYNE/15-237--------------------------------------------------------------------------------
A9BD06_PROM4/12-234--------------------------------------------------------------------------------
A2BZX4_PROM1/12-234--------------------------------------------------------------------------------
Q1N166_9GAMM/3-185--------------------------------------------------------------------------------
A4BAE5_9GAMM/3-182--------------------------------------------------------------------------------
A0YFY7_9GAMM/3-183--------------------------------------------------------------------------------
A8FT27_SHESH/3-183--------------------------------------------------------------------------------
Q1MDD4_RHIL3/3-191--------------------------------------------------------------------------------
A9CI20_AGRT5/3-191--------------------------------------------------------------------------------
Q92UK4_RHIME/3-191--------------------------------------------------------------------------------
A0NMT3_9RHOB/3-193--------------------------------------------------------------------------------
A3WZG1_9BRAD/2-188--------------------------------------------------------------------------------
Q89MZ5_BRAJA/5-191--------------------------------------------------------------------------------
Q2IXB1_RHOP2/5-191--------------------------------------------------------------------------------
Q07LA3_RHOP5/5-191--------------------------------------------------------------------------------
A7IF98_XANP2/3-187--------------------------------------------------------------------------------
A9W8R2_METEP/3-196--------------------------------------------------------------------------------
B0UL45_METS4/3-192--------------------------------------------------------------------------------
Q0C445_HYPNA/3-190--------------------------------------------------------------------------------
Q3JDP5_NITOC/3-187--------------------------------------------------------------------------------
A6FBV0_9GAMM/3-187--------------------------------------------------------------------------------
Q9AAA0_CAUCR/3-186--------------------------------------------------------------------------------
Q11KH3_MESSB/3-188--------------------------------------------------------------------------------
Q1YKP8_MOBAS/14-200--------------------------------------------------------------------------------

PF04140

Q9EWQ7_STRCO/75-167-------------------------------------------------------------------------------M
Q99YI2_STRP1/81-173-------------------------------------------------------------------------------L
P91402_CAEEL/171-267-------------------------------------------------------------------------------W
Q9KF68_BACHD/72-166-------------------------------------------------------------------------------A
MAM4_SCHPO/121-215-------------------------------------------------------------------------------A
Q9CM58_PASMU/75-167-------------------------------------------------------------------------------L
Q9XCY1_RHOCE/72-164-------------------------------------------------------------------------------L
ICMT_HUMAN/161-257-------------------------------------------------------------------------------V
STE14_YEAST/123-219-------------------------------------------------------------------------------V
Q99X02_STAAM/73-164-------------------------------------------------------------------------------L
ICMT_XENLA/165-261-------------------------------------------------------------------------------V
Q9RTL5_DEIRA/91-184-------------------------------------------------------------------------------A

PF04191

A4HJV7_LEIBR/438-543----------------------------------------------------------------------------FVMM
PEMT_HUMAN/89-192----------------------------------------------------------------------------AYSL
CHO2_ASPCL/504-608----------------------------------------------------------------------------LRHV
A1CQK4_ASPCL/70-170----------------------------------------------------------------------------L...
A1UQ07_MYCSK/81-184----------------------------------------------------------------------------PIQV
A3CKP0_STRSV/68-171----------------------------------------------------------------------------LTIY
A3LQ40_PICST/106-209----------------------------------------------------------------------------VKAA
CHO2_PICST/449-558----------------------------------------------------------------------------LRVF
A4AA40_9GAMM/36-141----------------------------------------------------------------------------MRHG
A4GJI8_9BACT/30-133----------------------------------------------------------------------------LSIF
A4GK25_9BACT/30-133----------------------------------------------------------------------------LSIL
A4HJL2_LEIBR/106-210----------------------------------------------------------------------------MRGT
CHO2_MAGO7/497-601----------------------------------------------------------------------------LKHV
CHO2_PICGU/462-570----------------------------------------------------------------------------LRSF
CHO2_LODEL/480-589----------------------------------------------------------------------------LRIF
A5UZK8_ROSS1/43-144----------------------------------------------------------------------------GALI
A6FZ22_9DELT/133-240----------------------------------------------------------------------------VAVL
A6S8E2_BOTFB/75-178----------------------------------------------------------------------------VQYA
A6U6D6_SINMW/33-136----------------------------------------------------------------------------SSAM
A6ZQ31_YEAS7/97-200----------------------------------------------------------------------------WTKL
CHO2_YEAS7/470-578----------------------------------------------------------------------------SQLI
A7TIE1_VANPO/140-243----------------------------------------------------------------------------VKMV
CHO22_VANPO/452-560----------------------------------------------------------------------------TQII
CHO21_VANPO/439-547----------------------------------------------------------------------------SHVI
A8MZ66_HUMAN/126-222----------------------------------------------------------------------------AYSL
A8NIW8_COPC7/92-195----------------------------------------------------------------------------ASKI
CHO2_MALGO/537-642----------------------------------------------------------------------------LRYV
A8PVU2_MALGO/102-205----------------------------------------------------------------------------VRVL
A9B4Y9_HERA2/33-137----------------------------------------------------------------------------PFNW
A9V3D6_MONBE/125-229----------------------------------------------------------------------------IFFA
CHO2_LACBS/492-596----------------------------------------------------------------------------LRHT
B0EDH3_ENTDS/91-196----------------------------------------------------------------------------LVNI
B1MLL6_MYCA9/108-208----------------------------------------------------------------------------WLVI
B1WZT5_CYAA5/96-194----------------------------------------------------------------------------FRLI
B2AR50_PODAN/95-198----------------------------------------------------------------------------VTYA
CHO2_PODAN/496-600----------------------------------------------------------------------------LKHV
B2JAT8_NOSP7/42-145----------------------------------------------------------------------------VALA
B2VTC6_PYRTR/87-190----------------------------------------------------------------------------IKYS
CHO2_PYRTR/425-530----------------------------------------------------------------------------FRHV
B3RI13_TRIAD/89-192----------------------------------------------------------------------------FKFI
B5J185_9RHOB/16-119----------------------------------------------------------------------------TWLL
B5XDB0_SALSA/119-222----------------------------------------------------------------------------VFYT
CHO2_SCHJY/478-583----------------------------------------------------------------------------FRHV
B6QQY2_PENMQ/89-189----------------------------------------------------------------------------I...
B8KMW4_9GAMM/36-141----------------------------------------------------------------------------FQGV
B8LBH8_THAPS/30-132----------------------------------------------------------------------------ITTF
B8PB22_POSPM/91-194----------------------------------------------------------------------------DTLV
CHO2_CANDC/471-580----------------------------------------------------------------------------LRIF
C0C2L6_9CLOT/84-187----------------------------------------------------------------------------IFSF
C4G5P4_ABIDE/68-162----------------------------------------------------------------------------LQFY
CHO2_PICPG/450-564----------------------------------------------------------------------------LRFI
C4R5S7_PICPG/98-201----------------------------------------------------------------------------FRYL
CHO2_CLAL4/444-555----------------------------------------------------------------------------LRIF
C5DC91_LACTC/106-209----------------------------------------------------------------------------VRKA
CHO2_LACTC/450-558----------------------------------------------------------------------------TQII
C5DZ83_ZYGRC/102-205----------------------------------------------------------------------------IAVA
CHO2_ZYGRC/430-538----------------------------------------------------------------------------TQFI
C5G0L0_ARTOC/115-215----------------------------------------------------------------------------L...
D7VS98_9SPHI/49-154----------------------------------------------------------------------------VFES
C6SSR2_STRMN/68-171----------------------------------------------------------------------------WGIY
C6WWJ2_METML/43-146----------------------------------------------------------------------------VCRE
C7GC66_9FIRM/86-188----------------------------------------------------------------------------YFAK
C7YM51_NECH7/94-197----------------------------------------------------------------------------VQAA
CHO2_NECH7/505-609----------------------------------------------------------------------------LKHV
C8PGT3_9PROT/79-173----------------------------------------------------------------------------AWFW
CHO2_SORMK/496-600----------------------------------------------------------------------------LKHV
E3I110_RHOVT/77-175----------------------------------------------------------------------------WRFL
D2U841_XANAP/75-178----------------------------------------------------------------------------PARW
D2V512_NAEGR/65-168----------------------------------------------------------------------------IMYG
D2VYZ6_NAEGR/455-563----------------------------------------------------------------------------TQLV
D3AX06_POLPA/89-193----------------------------------------------------------------------------ATLL
D3BED6_POLPA/557-662----------------------------------------------------------------------------WRQI
D3BN57_POLPA/99-202----------------------------------------------------------------------------LQTV
CHO2_SCHPO/491-596----------------------------------------------------------------------------LRHA
CHO1_SCHPO/110-213----------------------------------------------------------------------------VQGI
Q01DA1_OSTTA/648-751----------------------------------------------------------------------------QFDP
Q0AM70_MARMM/72-173----------------------------------------------------------------------------ISLA
Q0AQW8_MARMM/72-173----------------------------------------------------------------------------VSLA
CHO2_PHANO/462-567----------------------------------------------------------------------------LRHV
Q0UN81_PHANO/69-173----------------------------------------------------------------------------SSNT
Q11IW9_MESSB/45-148----------------------------------------------------------------------------ILFA
Q1GIY9_SILST/78-176----------------------------------------------------------------------------LRYA
Q4P2D8_USTMA/99-202----------------------------------------------------------------------------VKPV
Q4PA66_USTMA/318-424----------------------------------------------------------------------------LRHT
Q4V0H0_XANC8/96-199----------------------------------------------------------------------------PLRW
PEMTL_DICDI/82-186----------------------------------------------------------------------------ANMI
PEM2_DICDI/98-201----------------------------------------------------------------------------VEVL
Q55Q20_CRYNB/618-724----------------------------------------------------------------------------LRHV
Q55UT8_CRYNB/146-249----------------------------------------------------------------------------IKAA
Q5ZJB1_CHICK/134-237----------------------------------------------------------------------------AYYS
Q64EH3_9ARCH/57-160----------------------------------------------------------------------------PYTY
Q66KT1_XENLA/89-192----------------------------------------------------------------------------VYYL
Q6C649_YARLI/97-200----------------------------------------------------------------------------VKPL
CHO2_YARLI/531-635----------------------------------------------------------------------------LKYI
CHO2_KLULA/451-559----------------------------------------------------------------------------NTIT
Q6CV75_KLULA/106-209----------------------------------------------------------------------------FTYV
Q6FUV4_CANGA/106-209----------------------------------------------------------------------------ITNI
CHO2_CANGA/431-540----------------------------------------------------------------------------SQII
Q752Z0_ASHGO/100-203----------------------------------------------------------------------------VRYA
Q7MUP1_PORGI/82-176----------------------------------------------------------------------------AWFL
Q7YRH5_PIG/89-192----------------------------------------------------------------------------GYRL
Q7ZVZ2_DANRE/120-223----------------------------------------------------------------------------VYYA
Q86IF9_DICDI/521-626----------------------------------------------------------------------------WRQI
Q8TN26_METAC/121-221----------------------------------------------------------------------------YIVI
Q98I61_RHILO/42-146----------------------------------------------------------------------------GFVP

PF06966

Q10E47_ORYSJ/24-252LAL......KGA.WHFRQVVLTVLVVIWGLRLGLFLLMR.ILQWG..EDKRFDEMRDNLG...........KLAV.FWIF
Q8PAZ9_XANCP/20-250AWM......SEG.ALLPRVLVAVLGGVWGARLAWHLGVR.VFGDP.HEDGRYRALREHWNGD.......QRKFLG.FFLA
Q9A3U2_CAUCR/70-299LL.......QGA.HTPHGLLLTGLCTLWAARLGLYLLWR.WRKHG..ADRRYVAIFAHYEKTKRWNFAT.TSLII.VFGL
Q9VSM5_DROME/25-264FFLGQIDRPSKA.YDSRQLMVTLFVCLWGARLSGYLLYR.IVKLG..RDKQFEDTRRNI...........IRYAV.FWTF
Q9CHY6_LACLA/17-245YLF......SPR.ITIQNSLILVLVILWGVRLAIHLGRR.NWNKP..EDYRYTNMRKRWGNN....FPKLKAFLT.VFMV
Q7CY59_AGRT5/19-248VLF......AEG.DGWRRAVVFFLVVVWSLRLAGHIGMR.TRGGG..EDPRYAKLIEEWGSA......ASLRLFI.FLQI
O81042_ARATH/64-303ASH.....PLSQYNKLRSMIVITLTWIWSIRLTHNYFRRENWEWGAREDWRFNDLRKQYGKH....WWWL.SFFS.VYVS
Q8LEY8_ARATH/24-252LVL......KAS.WHFRQIVLTLLVVVWGLRLGIFLLMR.ILQWG..EDRRFDEQRGNIV...........RLII.FWTL
O53731_MYCTU/17-243ATL......GHG.DPVRRWLLLALVSTWGLRLSWHMYRK.TAGQG..EDPRYADLLR..GAT.....PVQ.ALRK.VFGL
YJD4_SCHPO/61-314LFYG....LGYNIASRRLMIMAFLQTLWSARLTYNYYRKGGYNRG.AEDYRWVRVRQIMPK.....WIYPLFHYFYIHIF
Q8Y9D9_LISMO/16-244FLT......TFS.VTTQSITILILVTLWGVRLFWHLARR.NWNKP..EDYRYVNMRKRWGTT....LVNLKAFLN.VFVL
Q984A1_RHILO/21-257ALVP....FVEGDNDHRRWLVALLALVWSLRLGVHIAGR.TIGDS.RDDPRYRQLKQQWGAS.......SSSRLFWFLQV

PF02544

Q19605_CAEEL/97-243----------------------------------------------------------------TKSPVAIVAAATF.FC
YN67_SCHPO/146-295----------------------------------------------------------------ATMPLRNIFKNCAHYH
Q20344_CAEEL/97-243----------------------------------------------------------------TKSPLLIVAAAVA.FC
S5A1_RAT/110-259----------------------------------------------------------------KPTLLVTFVLAFL.FC
S5A2_HUMAN/105-254----------------------------------------------------------------RPYPAILILRGTA.FC
PORED_CAEEL/189-309----------------------------------------------------------------DDISLTQWAGAVL.FW
Q23431_CAEEL/103-253----------------------------------------------------------------NQSPVKIVIMAFG.FS
DET2_ARATH/111-262----------------------------------------------------------------NGFPITIAALAFT.FN
TSC13_YEAST/154-310----------------------------------------------------------------ATMPIFNLFKNCFHYW
S5A1_HUMAN/110-259----------------------------------------------------------------KPMPLLACTMAIM.FC

PF01222

LBR_CHICK/175-609FGVFLLWFFFQALFYLLPIGKVVEGLPLS..NPRKLQYRINGFYA...FLLTAAAIGTLLYFQ.FELHYLYDHFVQFAVS
ERG24_NEUCR/17-490WTLG..YYALSLVQYRFLPGHHVEGTELS..TGGRLKYKLNAFNSAMCTLAILAAGTIAQGAEFPVWTFISDNFAQIISA
STS1_SCHPO/7-453FLVFWSFCIVQAVMYLTLPGVRTQGLPLKHRNNERLPYLCNAIWS...FYTTIVILAVLHVTHVFPITTFIDMFGPLMSV
ERG4_YEAST/34-473WTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWT...LYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTC
ERG24_YEAST/8-438WTVYCLWYGILAVLDVILPGRVMKGVQLR..DGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCII

PF07298

C5N9K5_BURML/5-192-----------------------------------VLILGLVIFLGTHSIRLVAGDWRAAQI.ATLGEPRWKGIYALASV
A9ANX9_BURM1/3-190-----------------------------------VLIAGLAIFLGVHSIRIVAEGWRAAMV.ARFGANGWRARFSVVSI
Q1BPV3_BURCA/3-190-----------------------------------VLILGLAIFLGVHSIRIVADGWRSATI.ERIGEKGWKGGYAIASI
A4JQ26_BURVG/3-190-----------------------------------VLILGLAIFLGVHSIRIVASRWRAATI.ARVGERGWKAGYSVASL
B2JUD7_BURP8/3-190-----------------------------------ILILGLLIFLGGHSVRIFAEGWRKATI.ERMGAKNWKAAYSVVSL
A1VI53_POLNA/3-190-----------------------------------MLILGLVLFLGVHSTRIVADGWRTAMI.GRLGEKRWKGLYALVSL
Q12HL7_POLSJ/3-190-----------------------------------VLILGLILFLGVHSTRIVADGWRTQMI.AKVGEKPWKGVYALLSI
A2SBS8_METPP/3-190-----------------------------------VLILGLVLFLGTHSVRIFAEPWRTRTL.ARVGEARWKAAYAVVSL
Q223I4_RHOFD/3-190-----------------------------------YLILGLIVFLGVHSVRIVADDWRTQTR.ARIGPLAWKGLYSVLSL
A1K5T7_AZOSB/6-191-----------------------------------VLVLGLLLFLGPHSLRIFADDWRHRRV.AALGEKRWKGIYAAVAA
A1WT38_HALHL/3-190-----------------------------------ILLLGLILFLGTHSVRVVADDWRSNQI.AAYGEIPWKTAYSALSL
A6VV32_MARMS/3-191-----------------------------------ILVMGLVIFFFVHSVRLVAPNWREKSM.AIHGEMRWKMRFGMITL
A6GLJ7_9BURK/5-192-----------------------------------ILVAGLALFLGMHATRIPDDQRRSGMI.ARLGKGKYRGIYTAVSI
A3UJ56_9RHOB/3-182-----------------------------------VLITGLVIFIGVHLTR..VLGIKALMV.RVTGEALFAIFYSVLST
Q0AQE8_MARMM/3-183-----------------------------------VLTAGLVLFLGVHCLRL.VPGLRDTLQ.ARLGATPYKLTYTVISL
A3JNN0_9RHOB/3-184-----------------------------------VMIIGLLLWVVLHLFKRFSPRVRYDLS.VIFGQDIPKGTLAILII
Q2CI37_9RHOB/3-180-----------------------------------WLVLGVALWWAAHFFKRLAPRAR.....ARMGERG.KGAVALALV
A1AZI2_PARDP/3-180-----------------------------------ILILGLALWWGAHLFKRLAPQRR.....AVMGDRG.KGVVAGLLA
A3V560_9RHOB/3-179-----------------------------------LLILGLALWAGAHLWKRLAPASR.....AGMGDKG.RMIVALSAV
A3VBW4_9RHOB/3-178-----------------------------------VLILGVLIWTLAHLFKRIAPEAR.....ANMGDKA.KGPVALLSL
A4EI42_9RHOB/3-182-----------------------------------LLIAGVALWWAAHLFKRVAPGPR.....AKLGEPG.KGLVKVLIV
Q28U80_JANSC/6-185-----------------------------------LLIAGLALWVAAHAWKRVAPAHR.....ASFGDKG.KGIVAGLVV
A4EZ57_9RHOB/3-179-----------------------------------LLVLGILIWWGAHLFKRVAPGIR.....EPMGQRG.KGLVALALL
A3TV37_9RHOB/3-178-----------------------------------LLVLGVLLWWAAHLFKRVAPGPR.....ARMGTAG.KGAVALALV
A3K3K6_9RHOB/3-179-----------------------------------LLILGVALWWAAHLFKRIAPGVR.....EPMGNKG.KGVVALALV
Q0FNF9_9RHOB/3-178-----------------------------------LLILGVALWWGAHLFKRLAPAQR.....AALGDKG.KGPVALALL
Q5LXD7_SILPO/5-179-----------------------------------LLILGIAVWWAAHLFKRAMPARR.....AAMGDRG.KGMVALALL
Q1GLH3_SILST/3-179-----------------------------------LLILGIILWWGAHLFKRVAPAQR.....ASLGDKG.RGLVALVLL
A4WNN0_RHOS5/3-178-----------------------------------LLICGVALWSAAHLFKRVAPGLR.....APLGNAG.KGVAALLLV
A6DVY9_9RHOB/3-178-----------------------------------YLILGLILWIAAHLFKRVAPDLR.....ARMGNAG.KGVAALGIL
A6FLU6_9RHOB/3-178-----------------------------------YLILGLVLWTAGHFFKRLAPDMR.....AGMGNAG.KGVAAVIIL
A3SVP9_9RHOB/4-183-----------------------------------LLILGLILWVGAHYFRRFMPDQR.....AAMGRRG.KGIIAVAIV
A8LJK3_DINSH/5-184-----------------------------------VLIAGLALWAGAHYFKRLMPAQR.....AAMGDKG.KAVVAVAIV
Q169U5_ROSDO/3-182-----------------------------------LLIAGLILWIAAHYFKRLMPQQR.....AAMGNAG.KGGVAVAII
A0Z9H8_9GAMM/3-179-----------------------------------LLVAGVLLWSVAHLFKRVVPDAR.....AAMGDAG.RGIMSIAIL
B1KG57_SHEWM/3-185-----------------------------------MLLVGLLLWSLVHFIPSATPSLKQSWI.AKTSDKGYMLSFSILII
Q1KL82_9BACT/3-184-----------------------------------LLIVGIVVWCIVHLFPSIAPTRRQALH.ARLGN.GYRGLFALLIL
A4A3P3_9GAMM/3-185-----------------------------------LLVAGVVLFTGTHLFLGLAPDKVSAAR.QGWGEGPLKGLVTVFTV
A4SIT4_AERS4/3-186-----------------------------------LLTLGVLLFTLIHLYPCFAAAHRTRLR.DRLGENRYKGLFSLLVF
A0KG00_AERHH/3-186-----------------------------------LLTLGVLLFTLIHLYPCFAGAHRARLR.ERLGENRYKGLFSLLVF
Q6N9Q3_RHOPA/31-253-----------------------------------EFVAAFAVFLLSHAIPA.RPAVRARLV.GALGERGFLIAYSIESL
Q07S45_RHOP5/22-244-----------------------------------EFCAAFAVFLLSHAIPA.RPQVRAALI.AALGERWFLVVYSIVAL
Q219Y9_RHOPB/14-236-----------------------------------EFIAAFAVFLASHAVPS.RPAVRAAMV.ARLGERGFLALYSGVSL
Q5LUC0_SILPO/7-220-----------------------------------EFVAALAVFLLSHVIPV.RPPVRPWLV.ARLGARGFGIAYSLFSI
A1B4I1_PARDP/5-167-----------------------------------EFALALAAFLGSHVIPA...RLRGPLV.ARLGKAGYIAGYSLLSL
A3PL51_RHOS1/6-228-----------------------------------EFAAALAAFFASHLLPA.RPGVRERLI.ALLGRPVYFALYGTVSL
A4WR63_RHOS5/6-228-----------------------------------EFAAALAAFFGSHLLPA.RPGVRERLT.GLLGRRLYFALYGTVSL
A3VCT1_9RHOB/6-228-----------------------------------EYTLALVAFTASHFVPR.IGDLRGRLI.GRVGRRAYFSVYGLLSL
A4EUV2_9RHOB/5-226-----------------------------------GFAFAMGAFLGSHFLPR.IGGIREKLI.VRLGRRIYFAGYGILSL
Q0C1Y5_HYPNA/14-233-----------------------------------EFLGAALVFLVSHALPA.RPGIRIRLV.SLLGRWAYLALYSAVSL
Q169M4_ROSDO/6-220-----------------------------------TFAGVFALFFATHSIPV.RPPVKKRLV.RHLGAKGFTTAYSALSL
A3VZT2_9RHOB/6-219-----------------------------------EFIAAFGVFFLSHSIPV.RPKVKAWLV.ARVGQRGFTLGYSLLSL
A6DZE5_9RHOB/5-218-----------------------------------EFIAAFGGFFLSHSVPV.RPKVKAWLV.ERLGPRGFTLGYSLLSL
A8LNX8_DINSH/42-256-----------------------------------EFILAFTVFFLSHGVPV.RPPMRPWLE.ARLGARGFTLAYSALSL
A0NZJ4_9RHOB/28-242-----------------------------------NFIAAFLVFFASHMVLV.RPPVRPVLV.ALLSPRGFSLCYSLLSL
A9CGK0_AGRT5/3-221-----------------------------------ELVAALSLFVALHSVPA.VPAVRGRLI.AAVGRPAYLGAYSVVSL
Q2JYB9_RHIEC/5-223-----------------------------------EFLAAFALFVALHSIPA.VPTIRAEII.RRVGRPVYFVGYSAAST
Q92Z13_RHIME/3-221-----------------------------------EFLLALFVFLTLHSIPA.IPAIRERLL.FLLGRAGYFSLYSFASI
Q9Z3V3_9RHIZ/48-266-----------------------------------QLYLSLIAFLLLHSVPA.LPPVRAGII.ATIGRKTYLALYSTIST
B0U8Q9_METS4/2-221-----------------------------------EFAAALATFLVAHSVPA.VPRLRGRLV.ARLGRRAYLVAYSALSL
Q2VYZ8_MAGSA/17-229-----------------------------------HLVLSVAAFLGAHSLSN.WKPLRGPIE.ARYGKAGFYAGYSVVST
Q60BH7_METCA/3-224-----------------------------------NLALAMLFFVGIHFLIS.GTSLRDRLV.AYRGEQAFRAAFSVLSL
A7HZ42_PARL1/3-227-----------------------------------QLWAAAAFFLGIHLVIA.GSGARGRIV.ATIGERAWLALFSLASI
B2T4H1_BURPP/6-224-----------------------------------AVAAAAIAFVGSHFLL..SHPLRRPLV.GAIGEAAFLGVYSLSAF
Q1NFY6_9SPHN/3-221-----------------------------------MVMSAAIAFVGTHFLL..SHPLRAPLV.ARVGEKGFLGLYSLVAF
A3WFN8_9SPHN/7-218-----------------------------------TLIAANAAFVGTHFIM..SHPLRAPMV.KMFGDLGFQVVYSVISI
A5P993_9SPHN/6-220-----------------------------------SLIAASLAFVGTHFAL..SHPLRAPLA.GRIGENGFRGLYSVVAL
Q1GUJ7_SPHAL/6-226-----------------------------------LLITTCVLFVGTHLLM..SHPLRAGLA.SRLGERGFQIVYSIVAI
Q2GC12_NOVAD/7-219-----------------------------------PLAAATSCFVGSHFLL..SGPLRRVIA.KSLGRPTYLTIYSLVAI
Q8DMH0_THEEB/15-236-----------------------------------IMVGLLLLFAIAHSG...LASLRPWAE.KRLGARLYRIFFASVSL
A0YMQ9_LYNSP/24-245-----------------------------------VMLGLLFGFAIAHSG...LAALRPWGE.QKIGPRLYRIVFALVSL
Q113R6_TRIEI/12-233-----------------------------------IILGLLLSFAIAHSG...LAALRSWAE.NKIGPRLYRILFALVSL
Q8YQ81_NOSS1/13-234-----------------------------------VMLGLQLTFAIAHSG...GAALRPWAE.KYTGPRLYRIFFALVSL
A0ZJY3_NODSP/15-236-----------------------------------VMLGLQLAFAIAHSG...GAALRPWAE.KHIGARLYRICFALVSL
Q9ALA6_SYNE7/12-229-----------------------------------IMLALLLLFAIAHSG...LAALRPWGE.TKIGARGYRILFALVSL
Q2JR62_SYNJA/13-234-----------------------------------IMLGMILGFACAHSG...LAHLRPWGE.AWLGSRLYRLLFALVSL
Q7V3C9_PROMP/9-231-----------------------------------LILGLILIFAVIHSG...GAALRSRAE.AFMGARLWRLLFVSLSL
Q31D33_PROM9/9-231-----------------------------------VILLLILIFAVIHSG...GAALRIKAE.SLMGPRLWRLCFVFLSL
A3Z341_9SYNE/15-237-----------------------------------VMLALLLAFALIHSG...GAALRSRAE.ARIGARAWRLIFAALSI
A9BD06_PROM4/12-234-----------------------------------VMLLLLVSFAVIHSG...GAALRVKAE.SLIGPRAWRLIFASLSI
A2BZX4_PROM1/12-234-----------------------------------VMILLLFCFAVIHSG...GAALRVKAE.SVIGARAWRLIFAFASI
Q1N166_9GAMM/3-185-----------------------------------LLVAGLILFFGTHLIPS.IPGMKSALT.NIVGVKGYRPVFALLSL
A4BAE5_9GAMM/3-182-----------------------------------LLLIGLLVFFAIHILS..STPLRDHLV.GALGAMPYKGVYALISF
A0YFY7_9GAMM/3-183-----------------------------------TLIIGMAIFVGIHLLPA.AHTVRLALI.RKIGENGYKGIYSLLAI
A8FT27_SHESH/3-183-----------------------------------VLLSGMVLFIAIHLFPT.QVQARQALI.GKLGRVPYLALFSTISL
Q1MDD4_RHIL3/3-191-----------------------------------LLIVGIILFLGVHLVRVLLPDFRRSII.ASLGEKGWRAAYSIASI
A9CI20_AGRT5/3-191-----------------------------------FLVLCLALFLLTHLLKVVAPQFRARMI.AAMGEGPFKGVYSLVSL
Q92UK4_RHIME/3-191-----------------------------------ILVLGIIIFLGMHLVRVVAPGFRAGII.DSRGKGTWMGLYTIVSL
A0NMT3_9RHOB/3-193-----------------------------------LLIAGLVLFLGIHTLPV.FPATRNGLV.SRLGETGYKGVFTLLSF
A3WZG1_9BRAD/2-188-----------------------------------VMIAGLVMSLGVHLVAT.RRGFRARLI.SSYGEGPYKIGFSLISA
Q89MZ5_BRAJA/5-191-----------------------------------VMILGLVLFFAAHVFTT.KREARAQAI.ARLGEGTYKILYALVSL
Q2IXB1_RHOP2/5-191-----------------------------------VMILGLVLFIGTHVVTT.QRDLRGRLI.GIGGEAVYKIGYAVLAI
Q07LA3_RHOP5/5-191-----------------------------------LMILGLALFIGVHGITT.QRDLRARLI.GIGGEAVYKLIYAILAI
A7IF98_XANP2/3-187-----------------------------------MMLFGLLVFLGIHVVGS.LRGLRAKLI.AQVGEAAYKGFFSLLAI
A9W8R2_METEP/3-196-----------------------------------VMILGLVLFLGTHAFSM.ARAKRGEVI.GRIGEGRFKLGYTLLSV
B0UL45_METS4/3-192-----------------------------------VLLLGLALFLGTHAFTM.LRGPRAALI.ARVGEGPYKLGYSVLAL
Q0C445_HYPNA/3-190-----------------------------------YLILGLIIFFGAHLFSAFRSRAPGRDIREKLGYGPYMGLYTLVSA
Q3JDP5_NITOC/3-187-----------------------------------QFLLGLALFFGMHSISIVALPLRDQL..AAKSEIGWKILYGSVSL
A6FBV0_9GAMM/3-187-----------------------------------LLIIGLLLFLGMHSISIFALDFRNRQI..EKNHLAWKAGYSIIAL
Q9AAA0_CAUCR/3-186-----------------------------------ILVLGLVLFLGIHSVRILAAPLRDAQV.AA.NPKRWRGLYSLVAA
Q11KH3_MESSB/3-188-----------------------------------VLVLGLVLFLGVHSVRIAAPQFRDRVV.GSRGLGAWKGIYSLAAF
Q1YKP8_MOBAS/14-200-----------------------------------ILILGLVIFLGVHSLRIVAEPTRDRLL.ARFGENQFKGIYSVLSL

PF04140

Q9EWQ7_STRCO/75-167LAL..ALSAQALRW-----------------------------------------------------------------W
Q99YI2_STRP1/81-173LLM...LLSVAVLY-----------------------------------------------------------------E
P91402_CAEEL/171-267IGTLGCIIGEIFRK-----------------------------------------------------------------V
Q9KF68_BACHD/72-166IPFAWFLFAQILRL-----------------------------------------------------------------W
MAM4_SCHPO/121-215LGFL..CLGQYLRS-----------------------------------------------------------------S
Q9CM58_PASMU/75-167AIL...VFAIAMLF-----------------------------------------------------------------Y
Q9XCY1_RHOCE/72-164LAL..FVLLQAGRV-----------------------------------------------------------------W
ICMT_HUMAN/161-257TGLLMVVFGECLRK-----------------------------------------------------------------A
STE14_YEAST/123-219LGCLLVILGQYTRT-----------------------------------------------------------------I
Q99X02_STAAM/73-164VIL...IFAYIMLF-----------------------------------------------------------------M
ICMT_XENLA/165-261IGLIMVLFGEVLRK-----------------------------------------------------------------C
Q9RTL5_DEIRA/91-184LLL..FLALQPLRY-----------------------------------------------------------------W

PF04191

A4HJV7_LEIBR/438-543VGMLLVGINGYVSW-----------------------------------------------------------------S
PEMT_HUMAN/89-192.GLALLGLGVVLVL-----------------------------------------------------------------S
CHO2_ASPCL/504-608LGAGLISLQIWTSV-----------------------------------------------------------------S
A1CQK4_ASPCL/70-170.GAVLFGIGSILVL-----------------------------------------------------------------T
A1UQ07_MYCSK/81-184LGVVLAAIGILAAF-----------------------------------------------------------------G
A3CKP0_STRSV/68-171LGILISLAGFALRV-----------------------------------------------------------------Y
A3LQ40_PICST/106-209.AVATFGLGNIFVL-----------------------------------------------------------------T
CHO2_PICST/449-558VGLLLIFTQSWINS-----------------------------------------------------------------S
A4AA40_9GAMM/36-141LSALALTFGIVIAL-----------------------------------------------------------------L
A4GJI8_9BACT/30-133FGIFVVLLGIILVY-----------------------------------------------------------------I
A4GK25_9BACT/30-133LGIFIILTGIFLVY-----------------------------------------------------------------I
A4HJL2_LEIBR/106-210.GTALLLSGTTLVV-----------------------------------------------------------------S
CHO2_MAGO7/497-601TGTGLVALQIWTAV-----------------------------------------------------------------S
CHO2_PICGU/462-570LGALLILTQVWINS-----------------------------------------------------------------S
CHO2_LODEL/480-589IGTLLIFTQTWINA-----------------------------------------------------------------S
A5UZK8_ROSS1/43-144VGVVLCGCGAMLAG-----------------------------------------------------------------A
A6FZ22_9DELT/133-240AGVLLLIPALWTMY-----------------------------------------------------------------S
A6S8E2_BOTFB/75-178.SYALLAAGNTLVL-----------------------------------------------------------------S
A6U6D6_SINMW/33-136IGWACIPVALIGLA-----------------------------------------------------------------V
A6ZQ31_YEAS7/97-200.GVALFGLGQVLVL-----------------------------------------------------------------S
CHO2_YEAS7/470-578FGLILVALQTWCDK-----------------------------------------------------------------E
A7TIE1_VANPO/140-243.GVTLFGFGQLLVL-----------------------------------------------------------------T
CHO22_VANPO/452-560FGGILCAIQMWCNS-----------------------------------------------------------------E
CHO21_VANPO/439-547FGLLLCAIQIWCNV-----------------------------------------------------------------E
A8MZ66_HUMAN/126-222.GLALLGLGVVLVL-----------------------------------------------------------------S
A8NIW8_COPC7/92-195.AVVLFGLGQLFVI-----------------------------------------------------------------T
CHO2_MALGO/537-642LGVLLILVHMWSAR-----------------------------------------------------------------S
A8PVU2_MALGO/102-205.AVVLIASGTVFVL-----------------------------------------------------------------S
A9B4Y9_HERA2/33-137LGLVIGIAGLAVAI-----------------------------------------------------------------S
A9V3D6_MONBE/125-229VGAATVLVGTVLTS-----------------------------------------------------------------A
CHO2_LACBS/492-596LGALLVGLHVWASM-----------------------------------------------------------------E
B0EDH3_ENTDS/91-196IAIPIQIFGWILSI-----------------------------------------------------------------S
B1MLL6_MYCA9/108-208VGEVLTIGGLGMAT-----------------------------------------------------------------L
B1WZT5_CYAA5/96-194IGGILLISGFFLAF-----------------------------------------------------------------W
B2AR50_PODAN/95-198.AYALLALGNILVI-----------------------------------------------------------------S
CHO2_PODAN/496-600IGVSLIALQLWTSS-----------------------------------------------------------------S
B2JAT8_NOSP7/42-145LGVLAIICAGLIVT-----------------------------------------------------------------S
B2VTC6_PYRTR/87-190.AIPLFLMGNTLVL-----------------------------------------------------------------T
CHO2_PYRTR/425-530LGAGMIALQVWTAM-----------------------------------------------------------------S
B3RI13_TRIAD/89-192.GTALMVVGTILVL-----------------------------------------------------------------T
B5J185_9RHOB/16-119VGIAPIVMGVVIAG-----------------------------------------------------------------V
B5XDB0_SALSA/119-222.GAALMALGSVLVV-----------------------------------------------------------------T
CHO2_SCHJY/478-583LGLTFIALHIYTSV-----------------------------------------------------------------S
B6QQY2_PENMQ/89-189.AYGLFATGNVLVL-----------------------------------------------------------------S
B8KMW4_9GAMM/36-141LSALLLLIGVAVAL-----------------------------------------------------------------M
B8LBH8_THAPS/30-132LGPSMILLGLFIVY-----------------------------------------------------------------K
B8PB22_POSPM/91-194.PAALFAIGQVFVV-----------------------------------------------------------------T
CHO2_CANDC/471-580LGLLLVYTQFWINF-----------------------------------------------------------------S
C0C2L6_9CLOT/84-187IGICIIYIGIVIRV-----------------------------------------------------------------G
C4G5P4_ABIDE/68-162LGLFLFTIGILLCI-----------------------------------------------------------------I
CHO2_PICPG/450-564LAALMILGQFLTVH-----------------------------------------------------------------Q
C4R5S7_PICPG/98-201.GIASFLFGNVLVL-----------------------------------------------------------------S
CHO2_CLAL4/444-555LGLLLIITQVMINT-----------------------------------------------------------------S
C5DC91_LACTC/106-209.GMVLSAFGQVLVA-----------------------------------------------------------------T
CHO2_LACTC/450-558FGFLLCWLQKWCDD-----------------------------------------------------------------E
C5DZ83_ZYGRC/102-205.GRFLAIIGQVLVA-----------------------------------------------------------------T
CHO2_ZYGRC/430-538FGLLLCAVQTWCNA-----------------------------------------------------------------E
C5G0L0_ARTOC/115-215.AYGLFATGNVLVL-----------------------------------------------------------------S
D7VS98_9SPHI/49-154FCLLISLAGLLIRA-----------------------------------------------------------------Y
C6SSR2_STRMN/68-171LGILLMILGIIFRV-----------------------------------------------------------------Y
C6WWJ2_METML/43-146VGVLLFVLSSFLAR-----------------------------------------------------------------W
C7GC66_9FIRM/86-188IGMLITAVGICIRI-----------------------------------------------------------------K
C7YM51_NECH7/94-197.ALTLFAVGNVLVV-----------------------------------------------------------------T
CHO2_NECH7/505-609LGAGLVALQLWTAF-----------------------------------------------------------------S
C8PGT3_9PROT/79-173IGAVIYVAAFAGFI-----------------------------------------------------------------K
CHO2_SORMK/496-600VGLGLIALQVWTAT-----------------------------------------------------------------S
E3I110_RHOVT/77-175AGMICVVIGFGFTI-----------------------------------------------------------------Y
D2U841_XANAP/75-178LGCALLIGGLALRL-----------------------------------------------------------------W
D2V512_NAEGR/65-168.GYALQVIGSLLVM-----------------------------------------------------------------G
D2VYZ6_NAEGR/455-563AGIILILLNIYQST-----------------------------------------------------------------S
D3AX06_POLPA/89-193.GNSCFIFGILLNI-----------------------------------------------------------------W
D3BED6_POLPA/557-662IGILLILLNVWSSV-----------------------------------------------------------------S
D3BN57_POLPA/99-202.SYALYAIGGILVG-----------------------------------------------------------------A
CHO2_SCHPO/491-596LGFGLIALHIYTSV-----------------------------------------------------------------S
CHO1_SCHPO/110-213.AKLIFCFGSVLVL-----------------------------------------------------------------S
Q01DA1_OSTTA/648-751ISIIMIVCGYGLST-----------------------------------------------------------------S
Q0AM70_MARMM/72-173LGGGLFLGGAYVIF-----------------------------------------------------------------L
Q0AQW8_MARMM/72-173AGGLLLVAGAGVIA-----------------------------------------------------------------A
CHO2_PHANO/462-567LGAGLLLLQLWTST-----------------------------------------------------------------S
Q0UN81_PHANO/69-173LPIPLFLTGNTLVL-----------------------------------------------------------------T
Q11IW9_MESSB/45-148AGWLIGLAGLSINI-----------------------------------------------------------------A
Q1GIY9_SILST/78-176VGLPLMVMAFGITL-----------------------------------------------------------------W
Q4P2D8_USTMA/99-202.AALLFASGNIFVL-----------------------------------------------------------------S
Q4PA66_USTMA/318-424LGLLLVALHVWTAN-----------------------------------------------------------------S
Q4V0H0_XANC8/96-199GACALIAGGLGLRV-----------------------------------------------------------------W
PEMTL_DICDI/82-186.GDSCFIFGILLNI-----------------------------------------------------------------W
PEM2_DICDI/98-201.SYILYGFGGILVL-----------------------------------------------------------------A
Q55Q20_CRYNB/618-724LGLSLIALHIWSAV-----------------------------------------------------------------S
Q55UT8_CRYNB/146-249.AIALFASGQTFVI-----------------------------------------------------------------T
Q5ZJB1_CHICK/134-237.GLAIMAVGTLFVI-----------------------------------------------------------------S
Q64EH3_9ARCH/57-160LGILLILFGFVLNL-----------------------------------------------------------------R
Q66KT1_XENLA/89-192.SWMLIGAGGVLVV-----------------------------------------------------------------S
Q6C649_YARLI/97-200.AIVLFAVGNVLVL-----------------------------------------------------------------T
CHO2_YARLI/531-635LGALLIALHGWTSK-----------------------------------------------------------------S
CHO2_KLULA/451-559FGLLLLAIQIWCNT-----------------------------------------------------------------E
Q6CV75_KLULA/106-209.GIAYIAFGQLLVL-----------------------------------------------------------------S
Q6FUV4_CANGA/106-209.GYAFLIVGQILVI-----------------------------------------------------------------S
CHO2_CANGA/431-540FGLICCALQIWCNT-----------------------------------------------------------------E
Q752Z0_ASHGO/100-203.GAGLFVFGQVLVL-----------------------------------------------------------------S
Q7MUP1_PORGI/82-176AGMVVYVLSLVLFV-----------------------------------------------------------------R
Q7YRH5_PIG/89-192.GLALLGVGSVFVL-----------------------------------------------------------------S
Q7ZVZ2_DANRE/120-223.GAALMAVGSLLVI-----------------------------------------------------------------S
Q86IF9_DICDI/521-626LGLMLILINLWSSL-----------------------------------------------------------------S
Q8TN26_METAC/121-221AGDMLVVLGYFLIF-----------------------------------------------------------------L
Q98I61_RHILO/42-146VGGVLIVAAAAVLL-----------------------------------------------------------------H

PF06966

Q10E47_ORYSJ/24-252QAVWVWTVSLPVTIVNASDSD------------------------------------------P.....SI.EARDIIGW
Q8PAZ9_XANCP/20-250QAMVVVLFSVPFLAA.ASNPN------------------------------------------P.....AW.SVWSSLAI
Q9A3U2_CAUCR/70-299QAVLSYFVALPVQLGQGP...------------------------------------------.....GVL.GGLAYAGA
Q9VSM5_DROME/25-264QAVWVYIVSLPVIIINSPRHS------------------------------------------QPRAPKTM.TTLDSTGT
Q9CHY6_LACLA/17-245QYLLLIIISLPIIQVN.SNVN------------------------------------------S.....QF.YWWQILGI
Q7CY59_AGRT5/19-248QAIAAFILVLAVYLATG..NG------------------------------------------Q.....VFPRVIDVFAT
O81042_ARATH/64-303QQIFLIGICLPLYVIHS....------------------------------------------.I..DEPL.NIWDFISS
Q8LEY8_ARATH/24-252QAVWVWTVSLPLTLVNASDGG------------------------------------------G.....SL.KPADVIGW
O53731_MYCTU/17-243QGLLTLFVSFPLQLSAVTGPT------------------------------------------P....KPL.LAVGGVGL
YJD4_SCHPO/61-314QVLHLYLLASPTYIAMLAGNE------------------------------------------R.....AF.GAWDWIAL
Q8Y9D9_LISMO/16-244QGVLLFIIALPITHSFA.NET------------------------------------------A.....TF.AWWQILGI
Q984A1_RHILO/21-257QAAAAFLLAMSI.MAAAHKPA------------------------------------------P.....EL.GPGDWIGV

PF02544

Q19605_CAEEL/97-243AYNGFLQGYWNAFYQP.....------------------------------------------...EEPWTT..RKLVGS
YN67_SCHPO/146-295LLSGLFLA..YFIYGPWH...------------------------------------------...ANDYIKPNHLLFLI
Q20344_CAEEL/97-243TYNGTLQGVWNSYYQL.....------------------------------------------...EEELTY..RHLIGS
S5A1_RAT/110-259TFNGYVQSRYLSQFAVY....------------------------------------------...AEDWVTHPCFLTGF
S5A2_HUMAN/105-254TGNGVLQGYYLIYCAEY....------------------------------------------...PDGWYTDIRFSLGV
PORED_CAEEL/189-309ICN.......WKQHQL.....------------------------------------------...AEQIAN........
Q23431_CAEEL/103-253VLNGFIQGTWNAFYQPE....------------------------------------------...FDTLHPKFFVFLGA
DET2_ARATH/111-262LLNGYIQARWVSHYKD..DYE------------------------------------------...DGNWFW.WRFVIGM
TSC13_YEAST/154-310VLSGLISFGYFGYGFPFGNAK------------------------------------------LFKYYSYLKLDDLSTLI
S5A1_HUMAN/110-259TCNGYLQSRYLSHCAVY....------------------------------------------...ADDWVTDPRFLIGF

PF01222

LBR_CHICK/175-609AAAFSMALSIYLYIRSLKAPE..........EDLAPGGNSGYLVYDFFTGHELNPRIG.....SFDLKYFCELRPGLIGW
ERG24_NEUCR/17-490NILFAFALAIFVYVRSFDVKPGNKD.....MRQLAAGGVTGSLIYDFYIGRELNPRITLPLIGQVDIKEFMEMRPGLLGW
STS1_SCHPO/7-453AIITAFVCTFVLYTGTLLFGDRLFD.........KPHRLSGNPIYDAFMGACLNPRLG....KLLDFKMFFEVRIPWFIL
ERG4_YEAST/34-473AIISGFAFSIILYLWTLFISH.............DYHRMTGNHLYDFFMGAPLNPRWG.....ILDLKMFFEVRLPWFTL
ERG24_YEAST/8-438SILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLG.....PLDIKMFSELRPGMLLW

PF07298

C5N9K5_BURML/5-192IGFALIIWGYGLAR------------------------------------------------AD.TASLWFPP..LGIRH
A9ANX9_BURM1/3-190VGFALIIRGYGLAR------------------------------------------------EN.AALLWVSP..VGVRH
Q1BPV3_BURCA/3-190VGFVLIIWGYGIAR------------------------------------------------AG.ATLLWVSP..VGVRH
A4JQ26_BURVG/3-190IGLVLIVRGYGIAR------------------------------------------------DS.ATLLWVSP..VGVRH
B2JUD7_BURP8/3-190VGLVLIIWGYGIAR------------------------------------------------RE.PVVLWTSP..AWSPH
A1VI53_POLNA/3-190VGFGLVIWGFGLAR------------------------------------------------QQ.PVQWWAPP..FATRH
Q12HL7_POLSJ/3-190AGFVLLVWGYGLAR------------------------------------------------QS.PVVLWTPP..VGMRH
A2SBS8_METPP/3-190IGFVLLAWGYGLAR------------------------------------------------QQ.PVLLWTPP..VAMRH
Q223I4_RHOFD/3-190LGFALIVWGFGLAR------------------------------------------------QQ.PVQLWSPP..VALRH
A1K5T7_AZOSB/6-191VGLVLVVWGYGLTR------------------------------------------------DV.PVAIWSAP..VWTRH
A1WT38_HALHL/3-190VGLIIAIYGYGLTR------------------------------------------------VD.AVWVWMPP..NWTAH
A6VV32_MARMS/3-191IAVGLIVMGYSQTR------------------------------------------------LE.PVWLWFPP..VWTRH
A6GLJ7_9BURK/5-192IGLVLIVYGYGQAR------------------------------------------------LD.PVFVWNPP..AAMRH
A3UJ56_9RHOB/3-182IGLTLIVYGQILAH------------------------------------------------PS..VTLWQPP..AWTRT
Q0AQE8_MARMM/3-183IGFGLIIYGKVIAH------------------------------------------------PT..PSIWTTP..GWGHQ
A3JNN0_9RHOB/3-184LGLVMIIFGYLHAS------------------------------------------------FQ...PIYEPP..SWGGI
Q2CI37_9RHOB/3-180VSIVLMVIGYRMAD------------------------------------------------GT...VYWSRT..PALTG
A1AZI2_PARDP/3-180LSVVLMVVGYRQAD------------------------------------------------GP...YWWGAS..APLKG
A3V560_9RHOB/3-179LGIVLMVIGYKMAD------------------------------------------------GA...VYWGRT..AAMTG
A3VBW4_9RHOB/3-178VGIVLMVIGYRMWD------------------------------------------------GS...AYWGRS..PAMVG
A4EI42_9RHOB/3-182VSIVLMVLGYRAAD------------------------------------------------GA...VYWGRD..PMWVG
Q28U80_JANSC/6-185LSVILMVIGYRGAE------------------------------------------------GA...FYWGRS..PALVG
A4EZ57_9RHOB/3-179AGVVLMVLGYRSAE------------------------------------------------SY...ELALYP..PFLQH
A3TV37_9RHOB/3-178VSIVLMIFGYRAAE------------------------------------------------GA...FFWGRH..PATVG
A3K3K6_9RHOB/3-179ASILLMIFGYRMAD------------------------------------------------GA...FFWGRH..PATVG
Q0FNF9_9RHOB/3-178AAILLMIFGYRMAE------------------------------------------------GA...FFWGRH..PATVG
Q5LXD7_SILPO/5-179GSVVLMVIGYRMTD------------------------------------------------YI...HVWAPP..SYLTH
Q1GLH3_SILST/3-179VSVVLMVLGYRGTE------------------------------------------------YI...HVWAPA..PFLVH
A4WNN0_RHOS5/3-178ASVVMMVVGYRQAD------------------------------------------------FI...SIYTPA..PGMGH
A6DVY9_9RHOB/3-178AGLVLMVIGYRQAD------------------------------------------------FI...NVWYPP..SWTVH
A6FLU6_9RHOB/3-178AGLVLMIIGYRGAE------------------------------------------------FI...NLWYPP..TWTVH
A3SVP9_9RHOB/4-183AALVMIIIGYRGAE------------------------------------------------FI...PVWTPP..PFLTH
A8LJK3_DINSH/5-184ASIVLMVIGYRGAE------------------------------------------------FV...FLWSPP..AFMTH
Q169U5_ROSDO/3-182ASLVLMVMGYRAAE------------------------------------------------FI...PVWQPP..AFMMH
A0Z9H8_9GAMM/3-179ASMVLMYLGYSHAA------------------------------------------------TD...FYWGRS..SARVG
B1KG57_SHEWM/3-185SSLCLIVFGWRAAP------------------------------------------------IE...FVYTLP..QSTKP
Q1KL82_9BACT/3-184ASLVLIVIGWRSAA------------------------------------------------PS...AVYVPP..LLGSP
A4A3P3_9GAMM/3-185AGMALIVLGWRSSD------------------------------------------------SA...WLYTTP..SAIRG
A4SIT4_AERS4/3-186VAFGLILAGWRSSS------------------------------------------------PM...PLYFPP..AWGPA
A0KG00_AERHH/3-186IAIACIIAGWRTAS------------------------------------------------PL...PLYFLP..VWGPT
Q6N9Q3_RHOPA/31-253LVLTWLIVATERAP------------------------------------------------FV...ELWPFE..TWQMW
Q07S45_RHOP5/22-244AVLAWLIVAAGRAP------------------------------------------------FV...ELWPFE..PWQMW
Q219Y9_RHOPB/14-236LVLAWLIGAAGRAP------------------------------------------------LL...PLWPFE..PWQML
Q5LUC0_SILPO/7-220AVLGWLILAAARAP------------------------------------------------YV...EVIPPL..PALRW
A1B4I1_PARDP/5-167ALLYWLILAAGRAP------------------------------------------------FV...EIWPQE..PWMRW
A3PL51_RHOS1/6-228LVLGWLILAAGRAP------------------------------------------------FV...ELWPQT..PATRW
A4WR63_RHOS5/6-228LVLAWVIVAAGRAP------------------------------------------------YV...ELWPQT..PASRW
A3VCT1_9RHOB/6-228ALLVWVIVAAGRAP------------------------------------------------FV...EVWPQA..PWMRW
A4EUV2_9RHOB/5-226VLLAWVIHAAGQAP------------------------------------------------YV...KLWPQE..SWMRW
Q0C1Y5_HYPNA/14-233ALFAWLIIAAGRAP------------------------------------------------YV...WLWFWG..PHGLW
Q169M4_ROSDO/6-220CILALLIWAAGQAP------------------------------------------------FV...LLWAEA..AWHRP
A3VZT2_9RHOB/6-219AVLAWVIGAAGRAP------------------------------------------------FV...LLWGWA..AWQGP
A6DZE5_9RHOB/5-218GVLAWVIGAAGRAP------------------------------------------------FV...PLWDWA..PWQGY
A8LNX8_DINSH/42-256GVLAWLIGAAGRAP------------------------------------------------FV...PLWDWA..PWQAH
A0NZJ4_9RHOB/28-242AILWWLIVAARDAP------------------------------------------------YV...ALWSWE..PWQTF
A9CGK0_AGRT5/3-221LTLSWVFHAALSVD------------------------------------------------YI...PLWDVA..PWQAH
Q2JYB9_RHIEC/5-223LALIWVFSAALALD------------------------------------------------YI...PLWELT..PGNAA
Q92Z13_RHIME/3-221LALAWVLYAALDVD------------------------------------------------HI...PLWQPS..AWQAW
Q9Z3V3_9RHIZ/48-266LLLAWVFHAALNTP------------------------------------------------YV...ELWEPA..GSHAM
B0U8Q9_METS4/2-221ALLAWLIVAARRAG------------------------------------------------TV...ALWEPA..RWQWA
Q2VYZ8_MAGSA/17-229ILLVWVIAAALNSP------------------------------------------------TV...VVWEQQ..PWMRW
Q60BH7_METCA/3-224LALGWVVFAYRQAP------------------------------------------------YV...ETWGQL..TGFKP
A7HZ42_PARL1/3-227AGISWLAYSFNEAV------------------------------------------------AGPNHLYWVPP..LWALH
B2T4H1_BURPP/6-224VTLGWLIVAYIKAP------------------------------------------------LS..APLWPVG..DVLWA
Q1NFY6_9SPHN/3-221ATLGWLVMAYRSAS------------------------------------------------VT..EMLWPVG..DGLWA
A3WFN8_9SPHN/7-218ATLAWVYFAFKAAP------------------------------------------------PS...DLPGSG..QVGWI
A5P993_9SPHN/6-220GTFVWAVTAFRAVG------------------------------------------------PG.DAPLWHGM.SEVLWA
Q1GUJ7_SPHAL/6-226ATFILVVQAWRGMP------------------------------------------------PE..PPLWPVG..DGLWA
Q2GC12_NOVAD/7-219ATLTWAIVAFDRAP------------------------------------------------AA..PALWDGT.NAVAWA
Q8DMH0_THEEB/15-236PLATILILYFLAHR------------------------------------------------YD.GVQLWQLQEVPGMGA
A0YMQ9_LYNSP/24-245PLAVVLIIYFFNHR------------------------------------------------YD.GVQLWQVKQYPFVIP
Q113R6_TRIEI/12-233PLAVILIIYFFNHR------------------------------------------------YD.GLQLWQLQGVPIVKP
Q8YQ81_NOSS1/13-234PLAVILIIYFFNHR------------------------------------------------YD.GLQLWQVQNVPGVQA
A0ZJY3_NODSP/15-236PLAVILIIYFFNHR------------------------------------------------YD.GLQLWLVQSVPGVRE
Q9ALA6_SYNE7/12-229PLAVVTISYFILHR------------------------------------------------YD.GALLWQLQGIPWIAP
Q2JR62_SYNJA/13-234SLAPLLLIYFLNHR------------------------------------------------YD.GVILWDLHAVPGIHT
Q7V3C9_PROMP/9-231PSALILISYFLAHR------------------------------------------------YD.GIRLWNFQGNHYVFL
Q31D33_PROM9/9-231PSAIILISYFLAHR------------------------------------------------YD.GIRLWNFQGNSFVFI
A3Z341_9SYNE/15-237PSAVVVIGYFLAHR------------------------------------------------YD.GLQLWNLQAVPGMVP
A9BD06_PROM4/12-234PAAGVLIIYFLAHR------------------------------------------------YD.GIRLWNLQGVPGMVQ
A2BZX4_PROM1/12-234PSAVILVGYFIAHR------------------------------------------------YD.GVRFWNFQGISELIP
Q1N166_9GAMM/3-185AGLVLIVLGYQERP------------------------------------------------TQ.ILHKWYAP..HWARH
A4BAE5_9GAMM/3-182IGLGLIIAGKARAP------------------------------------------------FE...PVWDAW..PALRP
A0YFY7_9GAMM/3-183VGLGMIIYGKAIAS------------------------------------------------YD...ALWYPP..VWSRH
A8FT27_SHESH/3-183IGFVLIINGFGMAS------------------------------------------------KE...QLWQPL..SFARP
Q1MDD4_RHIL3/3-191ATLILLIYGFGQAR------------------------------------------------QV.TGVLYNPP..VWMAH
A9CI20_AGRT5/3-191ITLGLVIYAFGEAR------------------------------------------------QE.TGMLWNPP..VFMSH
Q92UK4_RHIME/3-191VGLCLIIYGFSQAR------------------------------------------------GE.TGMLYDPP..TFLRH
A0NMT3_9RHOB/3-193VGLGLIVYGYGVAR------------------------------------------------FEGPPVLYEPP..FWLRH
A3WZG1_9BRAD/2-188VGVALTLWGFLSYR------------------------------------------------ATGMIDVWHPP..RVMKH
Q89MZ5_BRAJA/5-191AGLALIIWGFGHYR------------------------------------------------ATGWIDVWYPP..KAMKH
Q2IXB1_RHOP2/5-191LGIVLISYGFGAYR------------------------------------------------EDGLIDLWFPP..VWTKH
Q07LA3_RHOP5/5-191GGIGLIAYGFGEYR------------------------------------------------ADGLIQIWHPP..VWTKH
A7IF98_XANP2/3-187SGLLLTAYGFALWR------------------------------------------------ASGAPDLWDPP..LGMTH
A9W8R2_METEP/3-196LGLILTVYGYGLYR------------------------------------------------QEGMIPVWSPP..LWTRH
B0UL45_METS4/3-192VGLIVLGIGYGRYR------------------------------------------------SEGYIDIWSPP..VWTRH
Q0C445_HYPNA/3-190VGLGLFLWGFGAMR------------------------------------------------PA..PILYTPP..AGLAH
Q3JDP5_NITOC/3-187IGIILISRGYVDLR------------------------------------------------QA.PTLLYVSP..IWLHH
A6FBV0_9GAMM/3-187IGFFLIVQGYGQAK------------------------------------------------LA.PTLLYVTP..SWLGH
Q9AAA0_CAUCR/3-186AGLGLIIWGWIVYR------------------------------------------------PA.APQLYDPP..AWGRH
Q11KH3_MESSB/3-188LGLVLIVWGYWLAR------------------------------------------------QN.PVVLYTPA..TWMQH
Q1YKP8_MOBAS/14-200VGLMLIIYGYGAAR------------------------------------------------MT.TVLLYAPP..PGLGH

PF04140

Q9EWQ7_STRCO/75-167CIATLGPYWNTRVIV..V----PG--------------------------------------------------------
Q99YI2_STRP1/81-173VTRILGDIWTVKLML..A----KD--------------------------------------------------------
P91402_CAEEL/171-267GMVHAGLAFTHRLAMTKR----SD--------------------------------------------------------
Q9KF68_BACHD/72-166ALSSLGRFWNTRIMI..L----PD--------------------------------------------------------
MAM4_SCHPO/121-215AMVQAGQSFSHIVASKRN----KD--------------------------------------------------------
Q9CM58_PASMU/75-167VIYELKEIWTVKLYI..L----PE--------------------------------------------------------
Q9XCY1_RHOCE/72-164VVASLGPYWTTRIIT..L----PG--------------------------------------------------------
ICMT_HUMAN/161-257AMFTAGSNFNHVVQNEKS----DT--------------------------------------------------------
STE14_YEAST/123-219AMHTAGHSFSHIVKTKKE----SD--------------------------------------------------------
Q99X02_STAAM/73-164VIKTLGGIWTLKLFI..L----PN--------------------------------------------------------
ICMT_XENLA/165-261AMLTAGSNFNHIVQNEKS----DS--------------------------------------------------------
Q9RTL5_DEIRA/91-184VMHTLGRYWNTRILI..V----PG--------------------------------------------------------

PF04191

A4HJV7_LEIBR/438-543IYKAIGDYGYFYGDFFI.----DK--------------------------------------------------------
PEMT_HUMAN/89-192SFFALGFAGTFLGDYFG.----IL--------------------------------------------------------
CHO2_ASPCL/504-608IYESLGEFGWFYGDFFF.----D.--------------------------------------------------------
A1CQK4_ASPCL/70-170SMYALGVTGTYLGDYFG.----IL--------------------------------------------------------
A1UQ07_MYCSK/81-184AQMALGASWRIGVDQ...----SE--------------------------------------------------------
A3CKP0_STRSV/68-171AVNYLGKNFTLAVQT...----TD--------------------------------------------------------
A3LQ40_PICST/106-209SMYALGVTGTYLGDYFG.----IL--------------------------------------------------------
CHO2_PICST/449-558IIDSIGYFGWFYGDFFI.----PK--------------------------------------------------------
A4AA40_9GAMM/36-141GVKAFRQAGTTVDPRYPE----RS--------------------------------------------------------
A4GJI8_9BACT/30-133SLKKLSKMETTFIPD...----GE--------------------------------------------------------
A4GK25_9BACT/30-133SLKKLSKMETTFIPD...----GQ--------------------------------------------------------
A4HJL2_LEIBR/106-210SFLRLGVTGTYLGDYFD.----IL--------------------------------------------------------
CHO2_MAGO7/497-601IYDELGEFGWFFGDFFF.----N.--------------------------------------------------------
CHO2_PICGU/462-570IIDSIGYFGWFYGDFFL.----P.--------------------------------------------------------
CHO2_LODEL/480-589IIDLIGYFGWFYGDFFI.----PK--------------------------------------------------------
A5UZK8_ROSS1/43-144GLLHLGANLTPFPRP...----RD--------------------------------------------------------
A6FZ22_9DELT/133-240VKRYFGFARALGGDHFF.----ER--------------------------------------------------------
A6S8E2_BOTFB/75-178SMWALGVTGTYLGDYFG.----IL--------------------------------------------------------
A6U6D6_SINMW/33-136ARRQFSKASAEIMTF...----DT--------------------------------------------------------
A6ZQ31_YEAS7/97-200SMYKLGITGTYLGDYFG.----IL--------------------------------------------------------
CHO2_YEAS7/470-578TRLAISDFGWFYGDFFL.----..--------------------------------------------------------
A7TIE1_VANPO/140-243SMYQLGITGTYLGDYFG.----IL--------------------------------------------------------
CHO22_VANPO/452-560IRAAISDFGWFYGDFFL.----..--------------------------------------------------------
CHO21_VANPO/439-547TRDAISDFGWFYGDFFL.----..--------------------------------------------------------
A8MZ66_HUMAN/126-222SFFALGFAGTFLGDYFG.----IL--------------------------------------------------------
A8NIW8_COPC7/92-195STWQLGITGTFLGDYFG.----IL--------------------------------------------------------
CHO2_MALGO/537-642SYRVLGPFGWLYGDFFI.----DA--------------------------------------------------------
A8PVU2_MALGO/102-205SMWMLGITGTYLGDYFG.----IL--------------------------------------------------------
A9B4Y9_HERA2/33-137SARHFRQMGTNIMTF...----GQ--------------------------------------------------------
A9V3D6_MONBE/125-229SFIRLGIFGTYMGEFFG.----VM--------------------------------------------------------
CHO2_LACBS/492-596SFEVLGVFGWFFGDFFM.----EE--------------------------------------------------------
B0EDH3_ENTDS/91-196SFYRLGFKGTYEGDCFG.----FL--------------------------------------------------------
B1MLL6_MYCA9/108-208VVAQNNYAAASITV....----ES--------------------------------------------------------
B1WZT5_CYAA5/96-194AVKAISIHDSL.......----GL--------------------------------------------------------
B2AR50_PODAN/95-198STWQLGITGTFLGDYFG.----IL--------------------------------------------------------
CHO2_PODAN/496-600IYESLGEFGWFYGDFFF.----E.--------------------------------------------------------
B2JAT8_NOSP7/42-145AFRTMNRAQTEVNPS...----RP--------------------------------------------------------
B2VTC6_PYRTR/87-190SMWALGVTGTYLGDYFG.----IL--------------------------------------------------------
CHO2_PYRTR/425-530IYESLGEFGWFCGDFFF.----DP--------------------------------------------------------
B3RI13_TRIAD/89-192SYWRLGFTGTFLGDYFG.----IL--------------------------------------------------------
B5J185_9RHOB/16-119AARQFTKAKTNIVPL...----TI--------------------------------------------------------
B5XDB0_SALSA/119-222SFLALGFTGTFLGDYFG.----IL--------------------------------------------------------
CHO2_SCHJY/478-583IFDDLGNFGWFYGDFFL.----PV--------------------------------------------------------
B6QQY2_PENMQ/89-189SMWALGVTGTYLGDYFG.----IL--------------------------------------------------------
B8KMW4_9GAMM/36-141GVMSFRQARTTVDPRYPQ----QA--------------------------------------------------------
B8LBH8_THAPS/30-132SASDLKNNLSPYPVP...----SE--------------------------------------------------------
B8PB22_POSPM/91-194STWALGVTGTFLGDYFG.----IL--------------------------------------------------------
CHO2_CANDC/471-580IIDSIGYFGWFYGDFFI.----PK--------------------------------------------------------
C0C2L6_9CLOT/84-187AVLSLKRNFTLDVQT...----KN--------------------------------------------------------
C4G5P4_ABIDE/68-162SVVCFAFPNDE.......----..--------------------------------------------------------
CHO2_PICPG/450-564MIDSIGLFGWYYGDFFI.----GV--------------------------------------------------------
C4R5S7_PICPG/98-201SMWKLGITGTYLGDYFG.----IL--------------------------------------------------------
CHO2_CLAL4/444-555IVDSIGYFGWFYGDFFI.----PK--------------------------------------------------------
C5DC91_LACTC/106-209SMYQLGVTGTYLGDYFG.----IL--------------------------------------------------------
CHO2_LACTC/450-558ILTAISEFGWFYGDFFL.----..--------------------------------------------------------
C5DZ83_ZYGRC/102-205SMWKLRITGTYLGDYFG.----IL--------------------------------------------------------
CHO2_ZYGRC/430-538IRSAISDFGWFYGDFFL.----..--------------------------------------------------------
C5G0L0_ARTOC/115-215SMWALGITGTYLGDYFG.----IL--------------------------------------------------------
D7VS98_9SPHI/49-154TVGYSPKNTSGRNTAQG.----QV--------------------------------------------------------
C6SSR2_STRMN/68-171AINYLGKAFTLTVQA...----TD--------------------------------------------------------
C6WWJ2_METML/43-146SFITMRKIGTSGNPR...----ET--------------------------------------------------------
C7GC66_9FIRM/86-188AVLTLKKAFTLNVQI...----SK--------------------------------------------------------
C7YM51_NECH7/94-197STWRLGITGTFLGDYFG.----IL--------------------------------------------------------
CHO2_NECH7/505-609VYDSLGEFGWFCGDFFF.----D.--------------------------------------------------------
C8PGT3_9PROT/79-173AFHDYAAAPAD.......----..--------------------------------------------------------
CHO2_SORMK/496-600IYESLGEFGWFYGDFFF.----D.--------------------------------------------------------
E3I110_RHOVT/77-175GYFDLGIENTY.......----GA--------------------------------------------------------
D2U841_XANAP/75-178AIRVLARWFTVDLTI...----QH--------------------------------------------------------
D2V512_NAEGR/65-168AYYQLGITGTYLGDYFG.----IL--------------------------------------------------------
D2VYZ6_NAEGR/455-563THEVLGDHGWFYGDFFYT----ET--------------------------------------------------------
D3AX06_POLPA/89-193TLYCLGIKGMYNGDSFG.----HI--------------------------------------------------------
D3BED6_POLPA/557-662TLEVLGEFGWFYGDFFI.----DE--------------------------------------------------------
D3BN57_POLPA/99-202TYYRLGITGTYLGDYFG.----IL--------------------------------------------------------
CHO2_SCHPO/491-596IYEDLGQYGWFYGDFFL.----PS--------------------------------------------------------
CHO1_SCHPO/110-213SMYKLGLVGTYLGDYFG.----FL--------------------------------------------------------
Q01DA1_OSTTA/648-751AAVALGMDQTYFGVELG.----EV--------------------------------------------------------
Q0AM70_MARMM/72-173GRYAYGSQERVYG.....----LL--------------------------------------------------------
Q0AQW8_MARMM/72-173GRIAYGSQKRVYG.....----LL--------------------------------------------------------
CHO2_PHANO/462-567IYDSLGEFGWFCGDFFF.----DP--------------------------------------------------------
Q0UN81_PHANO/69-173SMYALGVTGTYLGDYFG.----IL--------------------------------------------------------
Q11IW9_MESSB/45-148ALRRLRLAKTTVMPT...----RS--------------------------------------------------------
Q1GIY9_SILST/78-176GYRFLGLDNTY.......----CD--------------------------------------------------------
Q4P2D8_USTMA/99-202SMWALGVTGTYLGDYFG.----IL--------------------------------------------------------
Q4PA66_USTMA/318-424SYEVLGPFGWLYGDFFV.----DE--------------------------------------------------------
Q4V0H0_XANC8/96-199AIQVLARWFTVDVTI...----QA--------------------------------------------------------
PEMTL_DICDI/82-186TLKALGIKGMYNGDSFG.----HI--------------------------------------------------------
PEM2_DICDI/98-201AYLKLGITGTYLGDYFG.----IL--------------------------------------------------------
Q55Q20_CRYNB/618-724SYEVLGDFGWLYSDFFLI----EQ--------------------------------------------------------
Q55UT8_CRYNB/146-249SMWALGVTGTYLGDYFG.----IL--------------------------------------------------------
Q5ZJB1_CHICK/134-237SFLALGFTGTFLGDYFG.----IL--------------------------------------------------------
Q64EH3_9ARCH/57-160ADALFKKSKTTVQPH...----ET--------------------------------------------------------
Q66KT1_XENLA/89-192SFLALGFVGTYLGDYFG.----IL--------------------------------------------------------
Q6C649_YARLI/97-200SMYALGVTGTYLGDYFG.----IL--------------------------------------------------------
CHO2_YARLI/531-635IHDSLGHFGWFYGDFFL.----D.--------------------------------------------------------
CHO2_KLULA/451-559IFHSIKEFGWFYGDFFL.----..--------------------------------------------------------
Q6CV75_KLULA/106-209SMYQLGITGTYLGDYFG.----IL--------------------------------------------------------
Q6FUV4_CANGA/106-209SMYQLGITGTYLGDYFG.----IL--------------------------------------------------------
CHO2_CANGA/431-540IRSAISDFGWFYGDFFL.----..--------------------------------------------------------
Q752Z0_ASHGO/100-203SMWRLGVTGTYLGDYFG.----IL--------------------------------------------------------
Q7MUP1_PORGI/82-176AFHNYVATPAG.......----..--------------------------------------------------------
Q7YRH5_PIG/89-192SFLALGFTGTFLGDYFG.----IL--------------------------------------------------------
Q7ZVZ2_DANRE/120-223SFLALGVTGTFLGDYFG.----IL--------------------------------------------------------
Q86IF9_DICDI/521-626TFEVLGEFGWFYGDFFI.----ED--------------------------------------------------------
Q8TN26_METAC/121-221VFRENPFAAATIQV....----SS--------------------------------------------------------
Q98I61_RHILO/42-146AFARFALEGLGTPAPVA.----PT--------------------------------------------------------

PF06966

Q10E47_ORYSJ/24-252IMWLIGAGMEAIADQQKL----TF....----------------------------------------------------
Q8PAZ9_XANCP/20-250VVWLIAVGGEALADRQLS----AH....----------------------------------------------------
Q9A3U2_CAUCR/70-299ALTIVGILFETIGDAQLT----AF....----------------------------------------------------
Q9VSM5_DROME/25-264GMFIVGLLAETYADLQKF----SF....----------------------------------------------------
Q9CHY6_LACLA/17-245IIWIFGFIFEVFGDRQLE----VF....----------------------------------------------------
Q7CY59_AGRT5/19-248VVALTALAGEALSDAQLS----KF....----------------------------------------------------
O81042_ARATH/64-303AICLTGIVMAYFADTQLH----EFVTGN----------------------------------------------------
Q8LEY8_ARATH/24-252TMWVFGFLIEAAADQQKL----SF....----------------------------------------------------
O53731_MYCTU/17-243AVWLVGITFEAVGDWQLW----VF....----------------------------------------------------
YJD4_SCHPO/61-314ELFMFMFVLEMLADQQQW----DYYEAR----------------------------------------------------
Q8Y9D9_LISMO/16-244VIWIIGFIFEVGGDLQLE----NF....----------------------------------------------------
Q984A1_RHILO/21-257AIWVVAIGGEALADRQLN----AF....----------------------------------------------------

PF02544

Q19605_CAEEL/97-243LMYCTGMYINHKSDTILR....EL--------------------------------------------------------
YN67_SCHPO/146-295VGWAFAVLSNFRTHIILR....DL--------------------------------------------------------
Q20344_CAEEL/97-243ILYFSGMFINHKSDNILM....TL--------------------------------------------------------
S5A1_RAT/110-259ALWLVGMVINIHSDHILR....NL--------------------------------------------------------
S5A2_HUMAN/105-254FLFILGMGINIHSDYILR....QL--------------------------------------------------------
PORED_CAEEL/189-309.........TRKGPRGLI......--------------------------------------------------------
Q23431_CAEEL/103-253WLFVIGFITHCVSDLHLI....TL--------------------------------------------------------
DET2_ARATH/111-262VVFITGMYINITSDRTLV....RL--------------------------------------------------------
TSC13_YEAST/154-310GLFVLSELWNFYCHIKLRLWGDYQ--------------------------------------------------------
S5A1_HUMAN/110-259GLWLTGMLINIHSDHILR....NL--------------------------------------------------------

PF01222

LBR_CHICK/175-609VVINLAMLLAEMKIHNQSMPSLSMILVNSFQLLYVVDALWNEEAVLTTMDITHDGFGFMLAFGDLVWVPFVYSLQAFYLV
ERG24_NEUCR/17-490IILNCAFIAKQYRLYGYVTDSILFITAI..QAFYVFDGIYMEPAVLTTMDITTDGFGFMLSFGDVVWVPFMYSTQTRYLS
STS1_SCHPO/7-453FFISVGAAVRQYETYGTVSPQVLFVCLG..HYLYANACSKGEQLIVPTWDMAYEKFGFMLIFWNMAGVPFTYSHCTLYLF
ERG4_YEAST/34-473YFITLGACLKQWETYGYVTPQLGVVMLA..HWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLY
ERG24_YEAST/8-438LLINLSCLHHHYLKTGKINDALVLVNFL..QGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLS

PF07298

C5N9K5_BURML/5-192LTGLLTAIAFVLLVAAYVPGTR..--------------------------------------------------------
A9ANX9_BURM1/3-190LTGMLTAIAFVLLAAAYVPRNR..--------------------------------------------------------
Q1BPV3_BURCA/3-190LTGMLTAVAFVLIAASYVPRNR..--------------------------------------------------------
A4JQ26_BURVG/3-190LTGMLTAIAFVLIAASYVPRNR..--------------------------------------------------------
B2JUD7_BURP8/3-190LTGVLTLIAFILFPAAHAPGNH..--------------------------------------------------------
A1VI53_POLNA/3-190LAWLLTALAFILLAAAYVPRNA..--------------------------------------------------------
Q12HL7_POLSJ/3-190VAALLMLLAFILLVATYVPRNA..--------------------------------------------------------
A2SBS8_METPP/3-190IAALLTLVAFVLLAAAYVPGNG..--------------------------------------------------------
Q223I4_RHOFD/3-190LASLLTLLSFVLLAAAYVPGNI..--------------------------------------------------------
A1K5T7_AZOSB/6-191LAAVLTLPAFVLLVAAYLPGSH..--------------------------------------------------------
A1WT38_HALHL/3-190LMALVMIPAFILLFSAYGPANR..--------------------------------------------------------
A6VV32_MARMS/3-191LAGLLVLVALFFVGSALVPHTT..--------------------------------------------------------
A6GLJ7_9BURK/5-192IAALLMLVSFIMLAACYVPTNH..--------------------------------------------------------
A3UJ56_9RHOB/3-182VALVAVPVSLVLIFATYLPSH...--------------------------------------------------------
Q0AQE8_MARMM/3-183AALFAVPVGIILLTSAYAPGH...--------------------------------------------------------
A3JNN0_9RHOB/3-184AAAALMFLALLLAGSSMSKTL...--------------------------------------------------------
Q2CI37_9RHOB/3-180INNLLVLLAFYLFAASGAKTW...--------------------------------------------------------
A1AZI2_PARDP/3-180INNLLVLVAFYFFAADGMKTR...--------------------------------------------------------
A3V560_9RHOB/3-179INNLLMLFAFYLYAASGAKTR...--------------------------------------------------------
A3VBW4_9RHOB/3-178INNLLMLFAVYLFAASGMKTW...--------------------------------------------------------
A4EI42_9RHOB/3-182INNLLMILAFYFYAASAAKDAKIW--------------------------------------------------------
Q28U80_JANSC/6-185INNILMVLAFYIYAVGGPKGDRVW--------------------------------------------------------
A4EZ57_9RHOB/3-179VNNLLMLLALYFTSPGPSKGA...--------------------------------------------------------
A3TV37_9RHOB/3-178INNLMMVAALYLTSPGPKKGA...--------------------------------------------------------
A3K3K6_9RHOB/3-179INNLIMLFALYLTSPGPKKGA...--------------------------------------------------------
Q0FNF9_9RHOB/3-178INNLLMIAALYLTSPGPKKGA...--------------------------------------------------------
Q5LXD7_SILPO/5-179ANNLLVLVAIWMMSPAGTKGK...--------------------------------------------------------
Q1GLH3_SILST/3-179VNNTLMLFALYFTSPGPNKGA...--------------------------------------------------------
A4WNN0_RHOS5/3-178ANNLLMLFALIIFGAGMAKGW...--------------------------------------------------------
A6DVY9_9RHOB/3-178INNLMMLGAVFLYGMSATKGR...--------------------------------------------------------
A6FLU6_9RHOB/3-178LNNLLMLIAVFVYGMSATRGR...--------------------------------------------------------
A3SVP9_9RHOB/4-183LNNLLMVLAFWVYGSSAAKGAKAW--------------------------------------------------------
A8LJK3_DINSH/5-184VNNTLMLFALWVYGSSAAKGAKAW--------------------------------------------------------
Q169U5_ROSDO/3-182VNNTLMLFALWVYGSSAAKGAKAW--------------------------------------------------------
A0Z9H8_9GAMM/3-179INNVLMLLAIYFMVAAATKSW...--------------------------------------------------------
B1KG57_SHEWM/3-185IAVVLMLIASMLFAAAKQKTN...--------------------------------------------------------
Q1KL82_9BACT/3-184AVSVLMLIAFVLFVAARAKTN...--------------------------------------------------------
A4A3P3_9GAMM/3-185FASALAILAIYLLVVSNRPSA...--------------------------------------------------------
A4SIT4_AERS4/3-186LVIGVMPVALILFFSGQGPNH...--------------------------------------------------------
A0KG00_AERHH/3-186LMMAVMPIALILFCSGQGPNH...--------------------------------------------------------
Q6N9Q3_RHOPA/31-253VPNLALPLACQFAAFGIGAANPLS--------------------------------------------------------
Q07S45_RHOP5/22-244APNLTLPLVCVLAAFGVGAANPLS--------------------------------------------------------
Q219Y9_RHOPB/14-236APNLAMPFVCLLAAFGVGAANPLS--------------------------------------------------------
Q5LUC0_SILPO/7-220VPILIMLPVCLLAVAGLRAVNPLS--------------------------------------------------------
A1B4I1_PARDP/5-167LVNLAMPVAVLAAAIGGMAG....--------------------------------------------------------
A3PL51_RHOS1/6-228VPNLSAPVVWTLVVQGIGLPWPWT--------------------------------------------------------
A4WR63_RHOS5/6-228VPNVTSPIFWTLVVLGIRLPWPWT--------------------------------------------------------
A3VCT1_9RHOB/6-228APNLLMPLAAVLIVNGIGIAQPFT--------------------------------------------------------
A4EUV2_9RHOB/5-226LVNLAMPFVFLLTTCGIGVKNPHT--------------------------------------------------------
Q0C1Y5_HYPNA/14-233LANGLMALALLLVIGGTAIANPFS--------------------------------------------------------
Q169M4_ROSDO/6-220AILVGMLAACLILAASIGQPNPFS--------------------------------------------------------
A3VZT2_9RHOB/6-219VTVSLMLVVCVILGLAIARPNPFS--------------------------------------------------------
A6DZE5_9RHOB/5-218VTLGVMLAVCIILALAIGRPNPFS--------------------------------------------------------
A8LNX8_DINSH/42-256LVLAAMLPVCVIIALTLGRPNPFS--------------------------------------------------------
A0NZJ4_9RHOB/28-242VPVLMMLPVCLILAFGIGVPNPFS--------------------------------------------------------
A9CGK0_AGRT5/3-221VTFLAAPIGLFFVLAGLLSVNPLS--------------------------------------------------------
Q2JYB9_RHIEC/5-223AAFVLAPFGIFLVIAGLLSANPLS--------------------------------------------------------
Q92Z13_RHIME/3-221LTMIAAPVGVFLVLAGLFSVNPLS--------------------------------------------------------
Q9Z3V3_9RHIZ/48-266VTLVFAPLGMFLVLAGLFSPNPTS--------------------------------------------------------
B0U8Q9_METS4/2-221VPLALMPVALFLIAAGLFAANPLS--------------------------------------------------------
Q2VYZ8_MAGSA/17-229VPPLVMPVACLFWMLGLSQKNPFS--------------------------------------------------------
Q60BH7_METCA/3-224IAAVLMLVSFIFVVAGLTTPNPTA--------------------------------------------------------
A7HZ42_PARL1/3-227LSPLVILVATFFVVVGITTPNPTA--------------------------------------------------------
B2T4H1_BURPP/6-224MATVLMLIASVLLMGSLI.RNPAL--------------------------------------------------------
Q1NFY6_9SPHN/3-221LATIIMLLASVLLMGSLV.GNPAM--------------------------------------------------------
A3WFN8_9SPHN/7-218IATLLTLPAMVLFAGSVM.GNPAL--------------------------------------------------------
A5P993_9SPHN/6-220IGTVVMLLASVLLAGSFL.RNPAL--------------------------------------------------------
Q1GUJ7_SPHAL/6-226LASLIVLFASILFVGSLV.GNPAL--------------------------------------------------------
Q2GC12_NOVAD/7-219LASVLTIVSLAFFIPSFA.GNPVL--------------------------------------------------------
Q8DMH0_THEEB/15-236LVWGLSALSFLFLYPATFNLLEIA--------------------------------------------------------
A0YMQ9_LYNSP/24-245LVWGLSAVSFVFLYPATFNLLEIA--------------------------------------------------------
Q113R6_TRIEI/12-233IVWTFSAISFLFLYPSTFNLLEIA--------------------------------------------------------
Q8YQ81_NOSS1/13-234VVWVSSAISFLFLYPATFNLLEIA--------------------------------------------------------
A0ZJY3_NODSP/15-236VVWVLSAISFLFLYPATFNLLEIA--------------------------------------------------------
Q9ALA6_SYNE7/12-229LVWVLTAISFLLLYPATFNLLEIA--------------------------------------------------------
Q2JR62_SYNJA/13-234TVVLLSALSFFFLYPATFNLLEIA--------------------------------------------------------
Q7V3C9_PROMP/9-231LVWILTAISFLFLYPATYNLLEIP--------------------------------------------------------
Q31D33_PROM9/9-231IVWSLTAISFLFLYPATYNLLEIP--------------------------------------------------------
A3Z341_9SYNE/15-237LIWTLTAISFLFLYPATYNLLEIP--------------------------------------------------------
A9BD06_PROM4/12-234IVWCLTALSFLFLYPATYNLLEIP--------------------------------------------------------
A2BZX4_PROM1/12-234VIWILSAISFLFLYPATYNLLEIP--------------------------------------------------------
Q1N166_9GAMM/3-185LMMLAMLVAFILLPAAHMKTN...--------------------------------------------------------
A4BAE5_9GAMM/3-182ATLPLMWACFVLLPAAHMKTN...--------------------------------------------------------
A0YFY7_9GAMM/3-183LVWAVMLPALILIVAANVPGN...--------------------------------------------------------
A8FT27_SHESH/3-183LVHAIMPLVFILLISAYLDTY...--------------------------------------------------------
Q1MDD4_RHIL3/3-191ISITLMLIAMICLVASLLPAGH..--------------------------------------------------------
A9CI20_AGRT5/3-191IAVTLMLPAMICLIASLIPAGH..--------------------------------------------------------
Q92UK4_RHIME/3-191IALLLMLVAFIVLAAGFLPAGR..--------------------------------------------------------
A0NMT3_9RHOB/3-193VTMLFMVPVFIFLVAAYVPSR...--------------------------------------------------------
A3WZG1_9BRAD/2-188IAEALILPSIILVVASYVRGR...--------------------------------------------------------
Q89MZ5_BRAJA/5-191ITLALMLPAVILVVASYLRGR...--------------------------------------------------------
Q2IXB1_RHOP2/5-191LTALLMLPMAILLAAAYSRGR...--------------------------------------------------------
Q07LA3_RHOP5/5-191IAALLMLPATILFVAAYLRGR...--------------------------------------------------------
A7IF98_XANP2/3-187LTKLLMVFACIALVASEVPSH...--------------------------------------------------------
A9W8R2_METEP/3-196LAVLLTLFAFISLAAAYLPGH...--------------------------------------------------------
B0UL45_METS4/3-192LALLLVLVAFVAFAAAYLPGR...--------------------------------------------------------
Q0C445_HYPNA/3-190LNLVLMLPALILLAAAYTPTGR..--------------------------------------------------------
Q3JDP5_NITOC/3-187VVTILLLPTFILFLAPYFPGR...--------------------------------------------------------
A6FBV0_9GAMM/3-187VSALLMLPVFILFIAPYFPGK...--------------------------------------------------------
Q9AAA0_CAUCR/3-186AAMLLVWLAFILLPTANAPAGR..--------------------------------------------------------
Q11KH3_MESSB/3-188LTLLLMLPVFPLMAASHRPGR...--------------------------------------------------------
Q1YKP8_MOBAS/14-200LALLLVPVAFVLVASAYLPTGR..--------------------------------------------------------

PF04140

Q9EWQ7_STRCO/75-167---------------------------------------------------------------TR----------PVGAG
Q99YI2_STRP1/81-173---------------------------------------------------------------HK----------YVDHW
P91402_CAEEL/171-267---------------------------------------------------------------HR----------LVKDG
Q9KF68_BACHD/72-166---------------------------------------------------------------AN----------VIASG
MAM4_SCHPO/121-215---------------------------------------------------------------HL----------LVTDG
Q9CM58_PASMU/75-167---------------------------------------------------------------HH----------INRSF
Q9XCY1_RHOCE/72-164---------------------------------------------------------------AP----------LIRRG
ICMT_HUMAN/161-257---------------------------------------------------------------HT----------LVTSG
STE14_YEAST/123-219---------------------------------------------------------------HV----------LVKTG
Q99X02_STAAM/73-164---------------------------------------------------------------HP----------IIKSG
ICMT_XENLA/165-261---------------------------------------------------------------HT----------LVTSG
Q9RTL5_DEIRA/91-184---------------------------------------------------------------GQ----------RVTSG

PF04191

A4HJV7_LEIBR/438-543---------------------------------------------------------------VP..A......KLNYSG
PEMT_HUMAN/89-192---------------------------------------------------------------KE..A.......RVTVF
CHO2_ASPCL/504-608---------------------------------------------------------------AS...P.....KLTYNG
A1CQK4_ASPCL/70-170---------------------------------------------------------------MD..A.......PVTGF
A1UQ07_MYCSK/81-184---------------------------------------------------------------RT..A.......LVISG
A3CKP0_STRSV/68-171---------------------------------------------------------------SQ..Q.......LVDHG
A3LQ40_PICST/106-209---------------------------------------------------------------MN..E.......RVTGF
CHO2_PICST/449-558---------------------------------------------------------------SY..SSM...QHLTKAG
A4AA40_9GAMM/36-141---------------------------------------------------------------SE..........LVVIG
A4GJI8_9BACT/30-133---------------------------------------------------------------PI..K.......LVVDG
A4GK25_9BACT/30-133---------------------------------------------------------------PN..K.......LVIDG
A4HJL2_LEIBR/106-210---------------------------------------------------------------MD..E.......RVTAF
CHO2_MAGO7/497-601---------------------------------------------------------------NR...T.....KLTYRS
CHO2_PICGU/462-570---------------------------------------------------------------TS..PQR...SHLTKAG
CHO2_LODEL/480-589---------------------------------------------------------------SQ..SFA...NHLTKAG
A5UZK8_ROSS1/43-144---------------------------------------------------------------DG..R.......LVQHG
A6FZ22_9DELT/133-240---------------------------------------------------------------YR..TM.....PMVREG
A6S8E2_BOTFB/75-178---------------------------------------------------------------MD..K.......MVTGF
A6U6D6_SINMW/33-136---------------------------------------------------------------PR..N.......LVTDG
A6ZQ31_YEAS7/97-200---------------------------------------------------------------MD..E.......RVTGF
CHO2_YEAS7/470-578---------------------------------------------------------------....SNYISTRKLTSQG
A7TIE1_VANPO/140-243---------------------------------------------------------------MD..E.......RVTAF
CHO22_VANPO/452-560---------------------------------------------------------------....INYISERRLTSQG
CHO21_VANPO/439-547---------------------------------------------------------------....TNYITTRKLTSQG
A8MZ66_HUMAN/126-222---------------------------------------------------------------KE..A.......RVTVF
A8NIW8_COPC7/92-195---------------------------------------------------------------MD..H.......RVEGF
CHO2_MALGO/537-642---------------------------------------------------------------YP...K.....RLSYTG
A8PVU2_MALGO/102-205---------------------------------------------------------------MD..H.......MVTGF
A9B4Y9_HERA2/33-137---------------------------------------------------------------PD..R.......LVISG
A9V3D6_MONBE/125-229---------------------------------------------------------------LS..E.......KITTF
CHO2_LACBS/492-596---------------------------------------------------------------FP...T.....HLEYTG
B0EDH3_ENTDS/91-196---------------------------------------------------------------FD..E.......MITSF
B1MLL6_MYCA9/108-208---------------------------------------------------------------GQ..T.......VTATG
B1WZT5_CYAA5/96-194---------------------------------------------------------------EG..E.......LITKG
B2AR50_PODAN/95-198---------------------------------------------------------------MD..K.......MVTGF
CHO2_PODAN/496-600---------------------------------------------------------------SP...R.....PPTYNS
B2JAT8_NOSP7/42-145---------------------------------------------------------------TT..A.......IVSDG
B2VTC6_PYRTR/87-190---------------------------------------------------------------MD..E.......PVTTF
CHO2_PYRTR/425-530---------------------------------------------------------------PS...K.....SLTYNG
B3RI13_TRIAD/89-192---------------------------------------------------------------LE..E.......RVTTF
B5J185_9RHOB/16-119---------------------------------------------------------------ST..A.......LVTNG
B5XDB0_SALSA/119-222---------------------------------------------------------------ME..E.......KVKGF
CHO2_SCHJY/478-583---------------------------------------------------------------QS...P.....KLSYRG
B6QQY2_PENMQ/89-189---------------------------------------------------------------MD..A.......PVTGF
B8KMW4_9GAMM/36-141---------------------------------------------------------------TT..........LVIHG
B8LBH8_THAPS/30-132---------------------------------------------------------------KG..A.......LIDSG
B8PB22_POSPM/91-194---------------------------------------------------------------MD..H.......RVEGF
CHO2_CANDC/471-580---------------------------------------------------------------SQ..SSI...KNITTAG
C0C2L6_9CLOT/84-187---------------------------------------------------------------SQ..Q.......LIKTG
C4G5P4_ABIDE/68-162---------------------------------------------------------------....G.......LNING
CHO2_PICPG/450-564---------------------------------------------------------------LS..SHKSEVTTLSRSG
C4R5S7_PICPG/98-201---------------------------------------------------------------ME..D.......RVTSF
CHO2_CLAL4/444-555---------------------------------------------------------------ASVLPQR...AHLSKGG
C5DC91_LACTC/106-209---------------------------------------------------------------MD..N.......IVTAF
CHO2_LACTC/450-558---------------------------------------------------------------....TNYISSRKLNSRG
C5DZ83_ZYGRC/102-205---------------------------------------------------------------MD..E.......IVTDF
CHO2_ZYGRC/430-538---------------------------------------------------------------....SNYIPTKSLTSHG
C5G0L0_ARTOC/115-215---------------------------------------------------------------MD..A.......PVTGF
D7VS98_9SPHI/49-154---------------------------------------------------------------AD..T.......LNTTG
C6SSR2_STRMN/68-171---------------------------------------------------------------NQ..K.......LISSG
C6WWJ2_METML/43-146---------------------------------------------------------------ST..A.......LAING
C7GC66_9FIRM/86-188---------------------------------------------------------------EQ..Q.......LITNG
C7YM51_NECH7/94-197---------------------------------------------------------------MD..E.......MVTGF
CHO2_NECH7/505-609---------------------------------------------------------------QQ...A.....KLTYKS
C8PGT3_9PROT/79-173---------------------------------------------------------------....K.......AAQGG
CHO2_SORMK/496-600---------------------------------------------------------------SK...R.....QLTYTS
E3I110_RHOVT/77-175---------------------------------------------------------------DE..G.......LVTGG
D2U841_XANAP/75-178---------------------------------------------------------------GQ..R.......LVGHG
D2V512_NAEGR/65-168---------------------------------------------------------------ME..D.......RITSF
D2VYZ6_NAEGR/455-563---------------------------------------------------------------NQ...N....KQPSYTG
D3AX06_POLPA/89-193---------------------------------------------------------------MD..A.......PVTGG
D3BED6_POLPA/557-662---------------------------------------------------------------VP...T.....KLYYTG
D3BN57_POLPA/99-202---------------------------------------------------------------MK..E.......RVYGF
CHO2_SCHPO/491-596---------------------------------------------------------------RS...P.....KLVYQG
CHO1_SCHPO/110-213---------------------------------------------------------------LP..E.......RVSGF
Q01DA1_OSTTA/648-751---------------------------------------------------------------KP..N.......FVSGF
Q0AM70_MARMM/72-173---------------------------------------------------------------ED..E.......LIQHG
Q0AQW8_MARMM/72-173---------------------------------------------------------------ED..R.......LIEGG
CHO2_PHANO/462-567---------------------------------------------------------------PS...S.....NLTYSG
Q0UN81_PHANO/69-173---------------------------------------------------------------MD..A.......PVTTF
Q11IW9_MESSB/45-148---------------------------------------------------------------AT..Q.......LVTDG
Q1GIY9_SILST/78-176---------------------------------------------------------------TG..G.......LVTGG
Q4P2D8_USTMA/99-202---------------------------------------------------------------MD..S.......IVTGF
Q4PA66_USTMA/318-424---------------------------------------------------------------YP...H.....QLYYTG
Q4V0H0_XANC8/96-199---------------------------------------------------------------DH..Q.......LVRSG
PEMTL_DICDI/82-186---------------------------------------------------------------MD..S.......PVTGG
PEM2_DICDI/98-201---------------------------------------------------------------MK..E.......RVTGF
Q55Q20_CRYNB/618-724---------------------------------------------------------------IP...S.....QLAYTG
Q55UT8_CRYNB/146-249---------------------------------------------------------------MS..H.......RVTSF
Q5ZJB1_CHICK/134-237---------------------------------------------------------------ME..A.......KVTCF
Q64EH3_9ARCH/57-160---------------------------------------------------------------PT..S.......LEISG
Q66KT1_XENLA/89-192---------------------------------------------------------------ME..K.......KVTGF
Q6C649_YARLI/97-200---------------------------------------------------------------MN..E.......RVTGF
CHO2_YARLI/531-635---------------------------------------------------------------RK...Q.....NLTYSG
CHO2_KLULA/451-559---------------------------------------------------------------....PNLIDKRKLKNDG
Q6CV75_KLULA/106-209---------------------------------------------------------------MD..H.......RVTSF
Q6FUV4_CANGA/106-209---------------------------------------------------------------MN..D.......RVTAF
CHO2_CANGA/431-540---------------------------------------------------------------....INYIVDRKLTTQG
Q752Z0_ASHGO/100-203---------------------------------------------------------------ME..D.......RVTSF
Q7MUP1_PORGI/82-176---------------------------------------------------------------....K.......TIKGG
Q7YRH5_PIG/89-192---------------------------------------------------------------ME..A.......RVTRF
Q7ZVZ2_DANRE/120-223---------------------------------------------------------------MD..Q.......KVTGF
Q86IF9_DICDI/521-626---------------------------------------------------------------IP...S.....NLYYTG
Q8TN26_METAC/121-221---------------------------------------------------------------DQ..Q.......VITTG
Q98I61_RHILO/42-146---------------------------------------------------------------ER..........LVIGG

PF06966

Q10E47_ORYSJ/24-252--------------------------------------------------.............KN--SPSNRGR.WCNVG
Q8PAZ9_XANCP/20-250--------------------------------------------------.............KA--NPANRGK.TCRTG
Q9A3U2_CAUCR/70-299--------------------------------------------------.............KA--NPDNAGK.VMDKG
Q9VSM5_DROME/25-264--------------------------------------------------.............RQ--DPANQGK.FCNDG
Q9CHY6_LACLA/17-245--------------------------------------------------.............KK--LPQNKGK.LLTSG
Q7CY59_AGRT5/19-248--------------------------------------------------.............RR--TPEAKTG.VCETG
O81042_ARATH/64-303--------------------------------------------------........QKLKEQG--KPK...IPNLDSG
Q8LEY8_ARATH/24-252--------------------------------------------------.............KN--SPENRGK.WCDVG
O53731_MYCTU/17-243--------------------------------------------------.............KS--DPANRGV.IMDRG
YJD4_SCHPO/61-314--------------------------------------------------NHYNVDKTVPPRFKY--DLLSLGRGFNATG
Q8Y9D9_LISMO/16-244--------------------------------------------------.............KK--NPANKGK.LLTSG
Q984A1_RHILO/21-257--------------------------------------------------.............RG--DPRNKGK.VCDVG

PF02544

Q19605_CAEEL/97-243---------------------------------------------------------------RA--DGGTGYKIPT.GF
YN67_SCHPO/146-295---------------------------------------------------------------RP--AGSKKRVIPT.GY
Q20344_CAEEL/97-243---------------------------------------------------------------RK--PGETGYKIPT.GF
S5A1_RAT/110-259---------------------------------------------------------------RK--PGETGYKIPR.GG
S5A2_HUMAN/105-254---------------------------------------------------------------RK--PGEISYRIPQ.GG
PORED_CAEEL/189-309---------------------------------------------------------------..--.RNYAYGICF.GG
Q23431_CAEEL/103-253---------------------------------------------------------------RN--DYLNSYSIPR.GH
DET2_ARATH/111-262---------------------------------------------------------------KK--ENRGGYVIPR.GG
TSC13_YEAST/154-310---------------------------------------------------------------KK--HGNAKIRVPLNQG
S5A1_HUMAN/110-259---------------------------------------------------------------RK--PGDTGYKIPR.GG

PF01222

LBR_CHICK/175-609GH.PIAISWP..VAAAITILNCIGYYIFRSANSQKNNFR...........RNPADPKLSY..LKV--IPTATGKGLLVTG
ERG24_NEUCR/17-490VH.PQQLGAFG..LIAVGAVLAAGYSIFRLSNSQKNNFR...........TNPEDPSVKH..LTY--LQTKTGSRLITSG
STS1_SCHPO/7-453SHDPSVYNWSTQYTTGIYVLLLCCYYIFDTCNGQKNHFRNQIYGTEVHRKTFPQLPWLIIKNPTF--IRCANGGTLLTSG
ERG4_YEAST/34-473YHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKY--MVTSNGSYLLIDG
ERG24_YEAST/8-438VS.PVELGWV..KVVGILAIMFLGFHIFHSANKQKSEFR...............QGKLEN..LKS--IQTKRGTKLLCDG

PF07298

C5N9K5_BURML/5-192---------------------------------------------------------------..--.............
A9ANX9_BURM1/3-190---------------------------------------------------------------..--.............
Q1BPV3_BURCA/3-190---------------------------------------------------------------..--.............
A4JQ26_BURVG/3-190---------------------------------------------------------------..--.............
B2JUD7_BURP8/3-190---------------------------------------------------------------..--.............
A1VI53_POLNA/3-190---------------------------------------------------------------..--.............
Q12HL7_POLSJ/3-190---------------------------------------------------------------..--.............
A2SBS8_METPP/3-190---------------------------------------------------------------..--.............
Q223I4_RHOFD/3-190---------------------------------------------------------------..--.............
A1K5T7_AZOSB/6-191---------------------------------------------------------------..--.............
A1WT38_HALHL/3-190---------------------------------------------------------------..--.............
A6VV32_MARMS/3-191---------------------------------------------------------------..--.............
A6GLJ7_9BURK/5-192---------------------------------------------------------------..--.............
A3UJ56_9RHOB/3-182---------------------------------------------------------------..--.............
Q0AQE8_MARMM/3-183---------------------------------------------------------------..--.............
A3JNN0_9RHOB/3-184---------------------------------------------------------------..--.............
Q2CI37_9RHOB/3-180---------------------------------------------------------------..--.............
A1AZI2_PARDP/3-180---------------------------------------------------------------..--.............
A3V560_9RHOB/3-179---------------------------------------------------------------..--.............
A3VBW4_9RHOB/3-178---------------------------------------------------------------..--.............
A4EI42_9RHOB/3-182---------------------------------------------------------------..--.............
Q28U80_JANSC/6-185---------------------------------------------------------------..--.............
A4EZ57_9RHOB/3-179---------------------------------------------------------------..--.............
A3TV37_9RHOB/3-178---------------------------------------------------------------..--.............
A3K3K6_9RHOB/3-179---------------------------------------------------------------..--.............
Q0FNF9_9RHOB/3-178---------------------------------------------------------------..--.............
Q5LXD7_SILPO/5-179---------------------------------------------------------------..--.............
Q1GLH3_SILST/3-179---------------------------------------------------------------..--.............
A4WNN0_RHOS5/3-178---------------------------------------------------------------..--.............
A6DVY9_9RHOB/3-178---------------------------------------------------------------..--.............
A6FLU6_9RHOB/3-178---------------------------------------------------------------..--.............
A3SVP9_9RHOB/4-183---------------------------------------------------------------..--.............
A8LJK3_DINSH/5-184---------------------------------------------------------------..--.............
Q169U5_ROSDO/3-182---------------------------------------------------------------..--.............
A0Z9H8_9GAMM/3-179---------------------------------------------------------------..--.............
B1KG57_SHEWM/3-185---------------------------------------------------------------..--.............
Q1KL82_9BACT/3-184---------------------------------------------------------------..--.............
A4A3P3_9GAMM/3-185---------------------------------------------------------------..--.............
A4SIT4_AERS4/3-186---------------------------------------------------------------..--.............
A0KG00_AERHH/3-186---------------------------------------------------------------..--.............
Q6N9Q3_RHOPA/31-253---------------------------------------------------------------FG--GDPRKPFDPQHPG
Q07S45_RHOP5/22-244---------------------------------------------------------------FG--GNPNRPFDPARPG
Q219Y9_RHOPB/14-236---------------------------------------------------------------FG--GNPRLAFDPEQPG
Q5LUC0_SILPO/7-220---------------------------------------------------------------FG--GLGRGVFDPTRPG
A1B4I1_PARDP/5-167---------------------------------------------------------------..--.............
A3PL51_RHOS1/6-228---------------------------------------------------------------LG--GRRSAAFDPDRPG
A4WR63_RHOS5/6-228---------------------------------------------------------------LG--GQRAARFDPDRPG
A3VCT1_9RHOB/6-228---------------------------------------------------------------LG--GRRQAVFDPADPG
A4EUV2_9RHOB/5-226---------------------------------------------------------------LG--GKSTAEFDPKHPG
Q0C1Y5_HYPNA/14-233---------------------------------------------------------------LG--GLAERAYNPARPG
Q169M4_ROSDO/6-220---------------------------------------------------------------FG--GRDNDAFDPTDCG
A3VZT2_9RHOB/6-219---------------------------------------------------------------FG--GATNARFDPARPG
A6DZE5_9RHOB/5-218---------------------------------------------------------------FG--GANNARFDPERPG
A8LNX8_DINSH/42-256---------------------------------------------------------------FG--GARNDIFDPDRPG
A0NZJ4_9RHOB/28-242---------------------------------------------------------------FG--GRHNNRFDPERPG
A9CGK0_AGRT5/3-221---------------------------------------------------------------IS--VRQ....GQQPGA
Q2JYB9_RHIEC/5-223---------------------------------------------------------------IT--LNR....SPNPGA
Q92Z13_RHIME/3-221---------------------------------------------------------------VS--IRQ....GQKPGS
Q9Z3V3_9RHIZ/48-266---------------------------------------------------------------IT--FRH....DGRPGA
B0U8Q9_METS4/2-221---------------------------------------------------------------VS--LRA....GAEPGP
Q2VYZ8_MAGSA/17-229---------------------------------------------------------------IG--PGGAG.YDPARPG
Q60BH7_METCA/3-224---------------------------------------------------------------VS--GESVLNDAEAARG
A7HZ42_PARL1/3-227---------------------------------------------------------------VG--ADALADKPDTVKG
B2T4H1_BURPP/6-224---------------------------------------------------------------PT--GGRPGAFPDTARG
Q1NFY6_9SPHN/3-221---------------------------------------------------------------PD--PDGAVRVPAQAKG
A3WFN8_9SPHN/7-218---------------------------------------------------------------PT--PQAKEQARAAPKG
A5P993_9SPHN/6-220---------------------------------------------------------------PD--PRAAQHAAAGPHG
Q1GUJ7_SPHAL/6-226---------------------------------------------------------------AA--PGAEKAAQAAPRG
Q2GC12_NOVAD/7-219---------------------------------------------------------------PG--RKAAGLGTVVPTG
Q8DMH0_THEEB/15-236---------------------------------------------------------------AV--QKPE..VHLYETG
A0YMQ9_LYNSP/24-245---------------------------------------------------------------AI--EKPQ..VHLYETG
Q113R6_TRIEI/12-233---------------------------------------------------------------AI--QKPQ..VHLHETG
Q8YQ81_NOSS1/13-234---------------------------------------------------------------AI--QKPQ..VHLYETG
A0ZJY3_NODSP/15-236---------------------------------------------------------------AI--QKPQ..VYLFESG
Q9ALA6_SYNE7/12-229---------------------------------------------------------------AI--AQPQ..VRLYETG
Q2JR62_SYNJA/13-234---------------------------------------------------------------AI--HKPE..IHLFETG
Q7V3C9_PROMP/9-231---------------------------------------------------------------SV--LKPQ..VRIYGTG
Q31D33_PROM9/9-231---------------------------------------------------------------SV--LKPK..VRIYGTG
A3Z341_9SYNE/15-237---------------------------------------------------------------AV--LKPQ..VRLYATG
A9BD06_PROM4/12-234---------------------------------------------------------------AL--AKPQ..MRLYEQG
A2BZX4_PROM1/12-234---------------------------------------------------------------AV--LKPK..VRIYASG
Q1N166_9GAMM/3-185---------------------------------------------------------------..--.............
A4BAE5_9GAMM/3-182---------------------------------------------------------------..--.............
A0YFY7_9GAMM/3-183---------------------------------------------------------------..--.............
A8FT27_SHESH/3-183---------------------------------------------------------------..--.............
Q1MDD4_RHIL3/3-191---------------------------------------------------------------..--.............
A9CI20_AGRT5/3-191---------------------------------------------------------------..--.............
Q92UK4_RHIME/3-191---------------------------------------------------------------..--.............
A0NMT3_9RHOB/3-193---------------------------------------------------------------..--.............
A3WZG1_9BRAD/2-188---------------------------------------------------------------..--.............
Q89MZ5_BRAJA/5-191---------------------------------------------------------------..--.............
Q2IXB1_RHOP2/5-191---------------------------------------------------------------..--.............
Q07LA3_RHOP5/5-191---------------------------------------------------------------..--.............
A7IF98_XANP2/3-187---------------------------------------------------------------..--.............
A9W8R2_METEP/3-196---------------------------------------------------------------..--.............
B0UL45_METS4/3-192---------------------------------------------------------------..--.............
Q0C445_HYPNA/3-190---------------------------------------------------------------..--.............
Q3JDP5_NITOC/3-187---------------------------------------------------------------..--.............
A6FBV0_9GAMM/3-187---------------------------------------------------------------..--.............
Q9AAA0_CAUCR/3-186---------------------------------------------------------------..--.............
Q11KH3_MESSB/3-188---------------------------------------------------------------..--.............
Q1YKP8_MOBAS/14-200---------------------------------------------------------------..--.............

PF04140

Q9EWQ7_STRCO/75-167PYRFLRHPNYLA.VVVEVAALPLVHSA--------W--------------------------------LTAAVFTAANAM
Q99YI2_STRP1/81-173LFKTIKHPNYFLNIAPELVGIALLCHA--------K--------------------------------ITAMLLFPCYIV
P91402_CAEEL/171-267IYAYLRHPGYFGWFLWAVSTQIILCNP--------.--------------------------------.ICCVVYAYVTW
Q9KF68_BACHD/72-166PYRYIKHPNYAV.VIIEIAMLPLFFKA--------Y--------------------------------VTAFLFSLLNAI
MAM4_SCHPO/121-215IYAYVRHPSYVGFFIWALGTQMLLGNF--------.--------------------------------.VSTLLFSLVLW
Q9CM58_PASMU/75-167LFKYVRHPNYFLNIIPELIGLSLFCQA--------K--------------------------------YTALIGLPIYLL
Q9XCY1_RHOCE/72-164PFRHVRHPNYLV.VTGEIAVLPLAFGA--------W--------------------------------EIALVFSFLNAA
ICMT_HUMAN/161-257VYAWFRHPSYVGWFYWSIGTQVMLCNP--------.--------------------------------.ICGVSYALTVW
STE14_YEAST/123-219VYSWSRHPSYLGFFWWAIGTQLLLLNP--------.--------------------------------.LSLVIFIFVLW
Q99X02_STAAM/73-164LYKITKHPNYFLNIIPELIGVLLLTHA--------T--------------------------------YTTILLVP.YAY
ICMT_XENLA/165-261VYSWFRHPSYVGWFYWSIGTQVLLCNP--------.--------------------------------.LCLVGYTLASW
Q9RTL5_DEIRA/91-184PFRFLGHPNYTV.VALELAAAPLAVGA--------W--------------------------------RTAVAFSLLNAA

PF04191

A4HJV7_LEIBR/438-543IYRYLNNPDSSLGMSAYYGIALL.SGS--------P--------------------------------VV.LVVSVVSHA
PEMT_HUMAN/89-192PFNILDNPMYWGSTANYLGWAIM.HAS--------P--------------------------------TG.LLLTVLVAL
CHO2_ASPCL/504-608IYRFLNNPERVLGLAGVWGAVLI.TSS--------G--------------------------------AI.TFLALLSHT
A1CQK4_ASPCL/70-170PFSATGSPMYWGSTLNFLGVALY.FGK--------A--------------------------------AG.LLLTAEVFI
A1UQ07_MYCSK/81-184PFGWVRNPIFTAVLTAFLGLALM.VPN--------L--------------------------------IA.LIGWVLALS
A3CKP0_STRSV/68-171PYSIVRNPAYTGSILSILGLSIT.SLN--------P--------------------------------LT.IIISLILLV
A3LQ40_PICST/106-209PFNVNDNPMYNGSTLCFLGTALW.YGK--------P--------------------------------AG.IAVAGFVFV
CHO2_PICST/449-558VYRYLNNPEQIFGVCGVMGVFIM.VPS--------V--------------------------------EN.LVCCFLWVA
A4AA40_9GAMM/36-141VYKITRNPMYLGMLLVLIAWGLY.LGS--------G--------------------------------LS.LLVALGFLT
A4GJI8_9BACT/30-133PFRISRNPTYLGMLLILLGTALS.LQS--------L--------------------------------SS.LMVAAVFFL
A4GK25_9BACT/30-133PFRVSRNPIYLGMLFILLGTAIS.LQS--------L--------------------------------SA.LLIAFIFFL
A4HJL2_LEIBR/106-210PFSHFDNPMYLGATLNFLAASII.QNN--------A--------------------------------VG.VLLTGLVAL
CHO2_MAGO7/497-601IYRFLNNPERVMGSLGLYGAALI.TWS--------R--------------------------------AI.FVLALISHL
CHO2_PICGU/462-570VYRYLNNPEQLFGVCGVMGLTLI.APS--------L--------------------------------EN.FVCCLLWVS
CHO2_LODEL/480-589VYRYLNNPEQIFGVCGVMGVFII.WPT--------F--------------------------------EN.LTCCVLWVL
A5UZK8_ROSS1/43-144AYAIVRHPIYSGIIIGAFGWSLL.RGS--------I--------------------------------I..ALVLSVALL
A6FZ22_9DELT/133-240AFAHSSNAMYTFVLLGLWGIALL.TRS--------P--------------------------------AA.LAAALFQHA
A6S8E2_BOTFB/75-178PFNVSSAPMYYGSTMSFLGTALL.WGK--------P--------------------------------AG.ILLTVEVLV
A6U6D6_SINMW/33-136LFAYSRNPMYLSMLLLVLGAALI.AGH--------W--------------------------------AG.LLMPLVFFI
A6ZQ31_YEAS7/97-200PFNVSNNPMYQGSTLSFLGIALY.KGK--------P--------------------------------AG.LVVSAVVYF
CHO2_YEAS7/470-578IYRYLNHPEAVLGVVGVWGTVLM.TNF--------A--------------------------------VTNIILAVLWTL
A7TIE1_VANPO/140-243PFNVSNNPMYQGSTLSFLGTALI.YGK--------S--------------------------------AG.LLVAFMVQT
CHO22_VANPO/452-560IYRYLNNPEAILGTAGIWGTALM.TNF--------C--------------------------------YENIILAIIWTS
CHO21_VANPO/439-547IYRYLNNPEAILGVAGIWGSVLM.TNF--------S--------------------------------KTNVTLAVLWTV
A8MZ66_HUMAN/126-222PFNILDNPMYWGSTANYLGWAII..PA--------P--------------------------------AG.AVGS.....
A8NIW8_COPC7/92-195PFNILNDPMYVGSTMSFIATALW.TER--------P--------------------------------AG.LFISAYVYI
CHO2_MALGO/537-642IYRFLNNPERSMGSAAFFGMALL.SGS--------L--------------------------------TA.TVVAQLAHL
A8PVU2_MALGO/102-205PFSVLNDPMYVGSTLNFVGVALW.YAR--------P--------------------------------SG.LLLSVLVWV
A9B4Y9_HERA2/33-137WFRWSRNPMYLGFGLSLLGIALL.LGA--------A--------------------------------ISNLVLVIAFVI
A9V3D6_MONBE/125-229PFDVVDNPMYFGSSLMHIGLAIM.EQS--------P--------------------------------VG.VVLGAVVFW
CHO2_LACBS/492-596IYRYLNNPE.AMGGAAWFGLALI.SGS--------K--------------------------------LV.LSLAVIRHL
B0EDH3_ENTDS/91-196PFGFVPHPMYFGGALLFISSALY.YYS--------S--------------------------------TG.LILSIWSIV
B1MLL6_MYCA9/108-208LYGLVRHPMYTGSLVMMVGMPLA.LGS--------Y--------------------------------W..GLLATVPAA
B1WZT5_CYAA5/96-194VYNYSRNPEYIGDLILFLGYSLL.TNS--------W--------------------------------M..VMITDTGLA
B2AR50_PODAN/95-198PFNITSAPMYYGSTMSFLGSALL.YGK--------P--------------------------------AG.ILLTLHVLI
CHO2_PODAN/496-600IYRFLNNPERVLGAAGFWGLALI.TWS--------K--------------------------------AV.FVMALVSQL
B2JAT8_NOSP7/42-145VFRLSRNPIYLSLTLFYIGIALL.LGA--------L--------------------------------WA.LLLLFPLLV
B2VTC6_PYRTR/87-190PFNVSSSPMYHGSTMSFLATAIW.FGK--------P--------------------------------AG.ILLTGLVAV
CHO2_PYRTR/425-530IYRFLNNPERVLGLAGVWGIAII.TWS--------P--------------------------------AV.FYVATTAHI
B3RI13_TRIAD/89-192PFNIFDNPMYIGSTSNFLGLALR.SAS--------P--------------------------------CG.IIMSGFVYL
B5J185_9RHOB/16-119IFTVTRNPMYVGMVAMLIGTALL.LND--------L--------------------------------WP.WFVIALFWL
B5XDB0_SALSA/119-222PFNVTENPMYWGSTANYLGLAFM.NAS--------P--------------------------------VG.LVLTAVVAI
CHO2_SCHJY/478-583IYRYLNNPERFFGSAAFWGMALI.SNS--------S--------------------------------WI.FFLALLAQV
B6QQY2_PENMQ/89-189PFNVTGSPMYWGSTLSFLGTSLY.YGK--------V--------------------------------AG.LLLTLEVFV
B8KMW4_9GAMM/36-141VYRWTRNPMYLGMFLVLFAWGLY.LGS--------G--------------------------------LS.FLVLIVFVA
B8LBH8_THAPS/30-132IYGLMRHPMYTGVLIGMAGLSLV.TDS--------V--------------------------------L..RMLLTVVLY
B8PB22_POSPM/91-194PFNVLRDPMYVGSTMSFVAVSLW.FER--------P--------------------------------AG.LLITFYVYA
CHO2_CANDC/471-580VYRYLNNPEQIFGVCGVMGIFMI.YPT--------V--------------------------------EN.FICVGLWVV
C0C2L6_9CLOT/84-187LYKYIRHPAYTGSILSLLGISLA.FKN--------I--------------------------------YA.TIFVFISCM
C4G5P4_ABIDE/68-162IYKFSRNPMYVAYFVCFLGMSLL.TQS--------L--------------------------------I..MLIVVLIFQ
CHO2_PICPG/450-564IYHFLNNPERVTSNLTVWALYLLFNNS--------N--------------------------------KIFLVIALLFTM
C4R5S7_PICPG/98-201PFNIDDNPMYNGSTLCFLGTGLY.YGK--------P--------------------------------AG.VFASLVVYL
CHO2_CLAL4/444-555VYRYLNNPEQIFGVCGVMGVTMI.VPT--------Y--------------------------------DN.FMICLLWML
C5DC91_LACTC/106-209PFNVSNNPMYHGSTLTFLGTSLY.YGK--------A--------------------------------AG.VFATVLVNL
CHO2_LACTC/450-558IYRYLSNPERFLGVAGCWGAVLI.THF--------S--------------------------------PYNLILAALWTA
C5DZ83_ZYGRC/102-205PFNVSSNPMYQGSTLTFIGYTLM.EGK--------A--------------------------------AG.LLLSFMVYS
CHO2_ZYGRC/430-538IYRYLNNPETILGVAGVWGTVLM.TDF--------S--------------------------------WENIALACLWSG
C5G0L0_ARTOC/115-215PFNITSAPMYWGSTMSFLAVALY.HGK--------P--------------------------------AG.LLLTAEVFI
D7VS98_9SPHI/49-154IYSVVRNPLYLGNFFMWLGLALL.TEN--------V--------------------------------WF.VISFILLYW
C6SSR2_STRMN/68-171PYSIVRNPAYTGTIISILGLAFI.TLN--------I--------------------------------FN.ILIVFIILS
C6WWJ2_METML/43-146PFRISRNPIYLAMTGMYLGISFF.TNS--------L--------------------------------WS.LVLLVPLLS
C7GC66_9FIRM/86-188MYKFVRHPAYTGSILSLLGVSIA.LKN--------I--------------------------------PA.ILIVAICSF
C7YM51_NECH7/94-197PFNVTSSPMYTGSTMSFLATALY.FGK--------P--------------------------------AG.ILLTVWVYI
CHO2_NECH7/505-609IYRFLNNPDRFFGTAGVWGAALI.TWS--------R--------------------------------SI.FLMALVTQI
C8PGT3_9PROT/79-173IYRLSRNPMYFFYFLGMAGVCVA.SAS--------P--------------------------------W..LLIVIVPFA
CHO2_SORMK/496-600IYRFLNNPERVFGTAGLWGAALI.TWS--------R--------------------------------AI.FLMALAGHF
E3I110_RHOVT/77-175LYRFSRNPQYVASILGFFGTGLA.NGS--------A--------------------------------Q..SAVLCGLAI
D2U841_XANAP/75-178PYRYLRHPSYTGALLAFYGLAVG.MGN--------V--------------------------------LS.LLAIVLPVT
D2V512_NAEGR/65-168PFNVTDNPMYNGSTLWFLGHSLV.KSS--------P--------------------------------AG.ILMAICVFV
D2VYZ6_NAEGR/455-563IYRYLNNPEIVLGYCAYFGLALI.SKS--------Y--------------------------------AV.LGLAILSQF
D3AX06_POLPA/89-193VYQYFNDPQYVGTTISCLGYAIR.YQS--------I--------------------------------NG.FICTAAMGL
D3BED6_POLPA/557-662IYRFLNNPDSVLGFAGYYGLSLI.GGS--------L--------------------------------PL.FAIAISSQV
D3BN57_POLPA/99-202PFNVMSNPMYNGSTILFLAHALH.GKS--------V--------------------------------AG.IFLSLIVFI
CHO2_SCHPO/491-596IYRYVNNPERFLGCSAYWGLALI.SSS--------A--------------------------------WI.FLIAILAQL
CHO1_SCHPO/110-213PFNVNDNPMYNGSTLCFLSTALR.YGK--------V--------------------------------AG.LLLTLEVFF
Q01DA1_OSTTA/648-751PYNVVPHPMIVGSMLGLLGIHKM.DGL--------R--------------------------------EA.LPYAVPMHC
Q0AM70_MARMM/72-173IYRRTRNPQYVGYSGMFLGAAIA.AGS--------G--------------------------------LA.MLSALVFTA
Q0AQW8_MARMM/72-173IYRFSRNPQYVGYAAMFFGAAAA.AGS--------I--------------------------------LA.LTSSALFAL
CHO2_PHANO/462-567IYRFLNNPERVLGLAGVWGLALI.TWN--------P--------------------------------PI.FYLAATAHI
Q0UN81_PHANO/69-173PFNVSEAPMYHGSTLSFLATALW.FGK--------P--------------------------------AG.VLLTGVVAV
Q11IW9_MESSB/45-148PFSFSRNPIYLGGTLIVIAIGLI.VGN--------A--------------------------------WF.LLFALLAAF
Q1GIY9_SILST/78-176MYEYSRNPQYVTSVLATVGLGIT.TGS--------W--------------------------------T..TVALALVLF
Q4P2D8_USTMA/99-202PFNVMANPMYWGSSMSFTAVALW.FGK--------P--------------------------------AG.LLLSVLVVI
Q4PA66_USTMA/318-424IYRFLNNPERSMGGAAFFGLALV.SGS--------K--------------------------------LT.LLMAIVSYI
Q4V0H0_XANC8/96-199PYRWLRHPSYTGALLCFYGMALG.MGN--------A--------------------------------LS.LLVIVLPVT
PEMTL_DICDI/82-186PYQFFSDPQYVGTTIAALGVAIR.NQS--------I--------------------------------YG.FLCTILVGV
PEM2_DICDI/98-201PFNVMNNPMYNGSVMLFIAHALS.YKS--------V--------------------------------AG.LVLSFVVYV
Q55Q20_CRYNB/618-724IYRFLNNPERSMGGAAFFGLWLI.SNS--------K--------------------------------LV.FALALASHL
Q55UT8_CRYNB/146-249PFNVLSDPMYVGSFLTHLGTALW.FQS--------P--------------------------------AG.IVLAAWVWI
Q5ZJB1_CHICK/134-237PFSILDNPMYWGSTAVYLGWSLM.HAS--------P--------------------------------AG.LLLTAVVAI
Q64EH3_9ARCH/57-160PFRISRHPMYLGMAAILLGVAIV.SGS--------L--------------------------------LS.FLFPIVFVL
Q66KT1_XENLA/89-192PFNIMENPMYWGSTANYLGLALL.NSS--------P--------------------------------AG.LVLTAVVAL
Q6C649_YARLI/97-200PFNVSNNPMYHGSTLCFLASALW.YAK--------P--------------------------------AG.LLITAFVSL
CHO2_YARLI/531-635IYRYLNNPERFFGIAGIWGLALM.TNS--------P--------------------------------GV.GILAFLWTL
CHO2_KLULA/451-559IYRYLNNPERVFGVAGIWGTVLI.NNF--------S--------------------------------NWNLWLATTWTM
Q6CV75_KLULA/106-209PFNYFDNPMYQGSTFTFLGYALY.NGK--------P--------------------------------AG.LIATLVVHV
Q6FUV4_CANGA/106-209PFNVSNNPMYQGSTFSFIGTSLI.AGK--------P--------------------------------AG.LILAFFVHA
CHO2_CANGA/431-540IYRYLNNPEAILGVAGVWGSVLM.TDF--------A--------------------------------WENIALGMLWTA
Q752Z0_ASHGO/100-203PFNVSDNPMYQGSTLTFLGTSLY.YGK--------A--------------------------------AG.VFAALLVNL
Q7MUP1_PORGI/82-176VYRWSRNPMYFFFFTGMFGVCIA.SAS--------L--------------------------------W..MLLVMIPFI
Q7YRH5_PIG/89-192PFSVLDNPMYWGSTAVYLGWALM.HAS--------P--------------------------------TG.LLLTLVVAA
Q7ZVZ2_DANRE/120-223PFNVMDNPMYWGSTANYLGLALM.NAS--------P--------------------------------IG.IVLTAVVAL
Q86IF9_DICDI/521-626IYRFLNNPDSVTGFAGFYGLSLI.AGS--------F--------------------------------PL.FALSIFSQV
Q8TN26_METAC/121-221VYSIVRHPMYAAGLIIFSGTPLA.LGS--------W--------------------------------W..GLLILVPIM
Q98I61_RHILO/42-146IYRHVRNPMYVAVLSIILGQALL.FSS--------W--------------------------------TL.VAYAVIGAV

PF06966

Q10E47_ORYSJ/24-252LWSYTRHPNYFGEIFLWWGIFVASTPV..LSGAEWL--------------------------------VILGPVFLTLLL
Q8PAZ9_XANCP/20-250LWRYSRHPNYFFEFVHWFAYLALAVGA..GPWLLAL--------------------------------CALGPVVMFVFL
Q9A3U2_CAUCR/70-299LWRYTRHPNYFGDACVWWGLYLIAAET..GLGA..W--------------------------------ALPGPLLMTFLL
Q9VSM5_DROME/25-264LWSVSRHPNYFGEVVIWWGIFAISLNV..ISGHEWV--------------------------------AIASPIFTTMII
Q9CHY6_LACLA/17-245LWSLTRHPNYFGESMCWWGIFLISLTT..LSTL..W--------------------------------LVISPLLITSLL
Q7CY59_AGRT5/19-248LWRYSRHPNYFFEWLFWCSFPLLAIQE...QVLSWA--------------------------------SLAAPVMMYWLL
O81042_ARATH/64-303LWRYSRHPNYLGEQLWWWGLVIFAWNL..GQG...W--------------------------------TLIGALVNTLCL
Q8LEY8_ARATH/24-252VWKYSRHPNYFGEMLLWWRIFVAASPV..LEGAEYL--------------------------------VIFGPLFLTLLL
O53731_MYCTU/17-243LWAWTRHPNYFGDACVWWGLWLITIND..WAPL..A--------------------------------TVGSPLLMTYLL
YJD4_SCHPO/61-314LFRWSRHPNFLAEQLIWLSFYLFGAIA..SESLLNW--------------------------------TIFA..WLGLVG
Q8Y9D9_LISMO/16-244FWSVTRHPNYFGEALSWWGVFLVALTQ..LTDL..W--------------------------------LITSPIVITLLL
Q984A1_RHILO/21-257LWRLSRHPNYFFEWLGWLAYMAIAIGSPWAYPWGFA--------------------------------ALAGPILMYWLL

PF02544

Q19605_CAEEL/97-243LYEYISCPNYAGEIMEWIGYSILAWNL--------P--------------------------------ALAFAI...FTI
YN67_SCHPO/146-295GFNLVSFPNYFFESLGWLFFALLTKSW--------A--------------------------------SWIFLF...VGS
Q20344_CAEEL/97-243LYEYISCPNYFGEIMEWIGYAILGWNL--------P--------------------------------ALAFAI...FTF
S5A1_RAT/110-259LFEYVSAANYFGELVEWCGFALASWSL--------Q--------------------------------GVVFAL...FTL
S5A2_HUMAN/105-254LFTYVSGANFLGEIIEWIGYALATWSL--------P--------------------------------ALAFAF...FSL
PORED_CAEEL/189-309WFNLVSCPHFLFEICIYLSLFLVIP..--------D--------------------------------AYVYRFIIMFVC
Q23431_CAEEL/103-253YFEYISCPNYFGECLQWIGYALAARSF--------P--------------------------------AIAFAF...FIV
DET2_ARATH/111-262WFELVSCPNYFGEAIEWLGWAVMTWSW--------A--------------------------------GIGFFL...YTC
TSC13_YEAST/154-310IFNLFVAPNYTFEVWSWIWFTFVFK..--------.--------------------------------...FNL...FAV
S5A1_HUMAN/110-259LFEYVTAANYFGEIMEWCGYALASWSV--------Q--------------------------------GAAFAF...FTF

PF01222

LBR_CHICK/175-609WWGFVRHPNYLGDIIMALAWSLP-CGF--------N................................HILPYFYVIYFI
ERG24_NEUCR/17-490WWGIARHINYLGDWLQSWPYSLP-TGI--------AGYQILSAGSNAPGAITMLDGREVVQGEARGWGIVFTYFYILYFA
STS1_SCHPO/7-453WYRYARKIHYTADFFQSLSWALI-TGF--------Q................................SPLPYFYPCFFF
ERG4_YEAST/34-473WYTLARKIHYTADWTQSLVWALS-CGF--------N................................SVFPWFFPVFFL
ERG24_YEAST/8-438WWAKSQHINYFGDWLISLSWCLA-TWF--------Q................................TPLTYYYSLYFA

PF07298

C5N9K5_BURML/5-192IKALVGHPMLAGVMVWAGAHLLA-NGT-----------------------------------------LHAELLFAAFFV
A9ANX9_BURM1/3-190IKTLVGHPMAAGVMVWAIAHLLA-NGT-----------------------------------------LHAVVLFGAFFV
Q1BPV3_BURCA/3-190IKTLVGHPMLAGTMVWAVAHLLV-NGT-----------------------------------------VHAVVLFGAFFV
A4JQ26_BURVG/3-190IKTLAGHPMVAGVMVWAVAHLLV-NGT-----------------------------------------LRAAVLFGAFFV
B2JUD7_BURP8/3-190FKSIVKHPMTAGVGLWALAHLFV-SAT-----------------------------------------LHAVVLFGAFLV
A1VI53_POLNA/3-190IKARLHHPMVLGVMFWAVAHLLA-NGN-----------------------------------------RAHVLLFGSFLV
Q12HL7_POLSJ/3-190IKATLHHPMLLSVKVWALAHLLA-NGT-----------------------------------------LAGVVLFGSFLV
A2SBS8_METPP/3-190LKAKLHHPMVLSVKVWAFAHLLA-NGT-----------------------------------------LADVLLFGGFLV
Q223I4_RHOFD/3-190IKERIHHPMVLGVKLWALAHLLA-NGN-----------------------------------------LGHVVLFGSFLA
A1K5T7_AZOSB/6-191IKATLRHPMLAGTALWAFAHLLA-NGT-----------------------------------------LADLLLFGGFLA
A1WT38_HALHL/3-190IRNAVGHPMLLAVALWALAHLMA-NGR-----------------------------------------LGDLVFFGAFLA
A6VV32_MARMS/3-191MKKKVGYPMLIAIKIWAFAHLIS-NGS-----------------------------------------LADVILFGSFLV
A6GLJ7_9BURK/5-192IKAKLQHPMTLSVKVWALAHLIA-NGT-----------------------------------------LADIILFGSFLV
A3UJ56_9RHOB/3-182IRSLTRHPMTLGVFLWSGSHLLA-NGE-----------------------------------------LASILLFGAFAA
Q0AQE8_MARMM/3-183IRRWVRHPMLAGVVVWSGAHLLA-NAE-----------------------------------------ASAVLLFGSFFV
A3JNN0_9RHOB/3-184FYSKTRHPLLMATSLWSLAHLLS-NGD-----------------------------------------LASALLFGTLGF
Q2CI37_9RHOB/3-180ITRHLRHPQLTAFGLWAGAHLLV-NGD-----------------------------------------TESLVLFGGLLA
A1AZI2_PARDP/3-180ITRHLRHPQLTGFALWAFAHLVP-NGD-----------------------------------------LPSFVLFGGLLV
A3V560_9RHOB/3-179ITRTIRHPQLTAVKVWALAHILV-NGD-----------------------------------------VPSFVLFGGLLA
A3VBW4_9RHOB/3-178ITSKIRHPQLTGVKTWAIAHLLV-NGD-----------------------------------------MPSFVLFGGLLA
A4EI42_9RHOB/3-182LGTKVRHPQLTGFSIWAVAHLLV-NGD-----------------------------------------TPSFILFGGLLV
Q28U80_JANSC/6-185LGTKLRHPQLTGYSLWAIAHLLV-NGD-----------------------------------------TPSFVLFGGLLV
A4EZ57_9RHOB/3-179LFYRMRHPMLFGFSLWAIAHLLV-NWD-----------------------------------------PASFVLFGSMLA
A3TV37_9RHOB/3-178LFYRMRHPMLTGFLLWTLAHLLV-NGD-----------------------------------------VPSFVLFGGLGL
A3K3K6_9RHOB/3-179LFYKLRHPMLLGFLLWTLAHLLV-NGD-----------------------------------------VPSFVLFGGLGL
Q0FNF9_9RHOB/3-178VLYKMRHPMLTGFMLWAVAHLLV-NGD-----------------------------------------VPSFVLFGGLGL
Q5LXD7_SILPO/5-179LLHKMRHPMLAGFRAWAAAHLLV-NGD-----------------------------------------LASIILFGGLFL
Q1GLH3_SILST/3-179LFHKMRHPMLTGFKIWAVAHLLV-NGD-----------------------------------------LASVILFGGLLA
A4WNN0_RHOS5/3-178LWTKIRHPMLYGFALWAFAHLLV-NGD-----------------------------------------VASLILFGGLGA
A6DVY9_9RHOB/3-178LRGAMRHPQLTAVKVWAVAHLLV-NGD-----------------------------------------LASLILFGGLLL
A6FLU6_9RHOB/3-178LRGKMRHPQLVAVKIWAVAHLLV-NGD-----------------------------------------LASVILFGGMLV
A3SVP9_9RHOB/4-183PAYKTRHPQLMAVKIWAVAHLLV-NGD-----------------------------------------LASILLFGSMLA
A8LJK3_DINSH/5-184PANKIRHPQLTGVKIWALAHLLV-NGD-----------------------------------------LASIVLFGGLLA
Q169U5_ROSDO/3-182PAYKLRHPQLVGFKIWALAHLLV-NGD-----------------------------------------LASIILFGGLLG
A0Z9H8_9GAMM/3-179ITASIRHPQLTAIKSWSIGHLVV-NGD-----------------------------------------SASMVLFGGLLA
B1KG57_SHEWM/3-185IKRVIRHPQLTSVLVWSIAHLIL-NGD-----------------------------------------SRSLILFGGMCL
Q1KL82_9BACT/3-184IKRFLRHPQLTSIIVWSAAHLLA-NGD-----------------------------------------TRSLALFGSLGV
A4A3P3_9GAMM/3-185VKGIVRHPQLTAVLLWAVAHLLL-NGD-----------------------------------------SRSLVLFGGLAL
A4SIT4_AERS4/3-186LRRWLVHPQLLGTLLWAGTHLAV-NSE-----------------------------------------ARSLVLFGGIGL
A0KG00_AERHH/3-186LRRWLVHPQLLGTLLWAGAHLAV-NSE-----------------------------------------ARSLVLFGGIGL
Q6N9Q3_RHOPA/31-253VVGIVRHPLLWAIGLWAGAHVVP-NGD-----------------------------------------LAHVLLFGFFAM
Q07S45_RHOP5/22-244IVGVVRHPLLWAIGLWAGAHLLP-NGD-----------------------------------------LAHVVLFGFFVI
Q219Y9_RHOPB/14-236IVGAARHPLLWAIALWSGAHLVP-NGD-----------------------------------------LAHALLFGFFAL
Q5LUC0_SILPO/7-220ILALSRHPLLLALALWSGAHLLA-NGS-----------------------------------------LAHVILFGLFAG
A1B4I1_PARDP/5-167........LMAGFTLWGAAHLVA-NGD-----------------------------------------LAHVVLFGLLLL
A3PL51_RHOS1/6-228FAAITRHPLLIALMLWSAAHLFP-NGD-----------------------------------------LAHVILFGTFFG
A4WR63_RHOS5/6-228FAAVTRHPLLIALMLWSFAHLFP-NGD-----------------------------------------LAHVILFGSFFG
A3VCT1_9RHOB/6-228FAAISRHPLFLALALWSLAHLVP-NGD-----------------------------------------LAHVILFGLFAA
A4EUV2_9RHOB/5-226IAAVSRHPLLLALLIWALVHLLA-NGD-----------------------------------------LAHALLFGSFAA
Q0C1Y5_HYPNA/14-233ILAVTRHPLLWAMVLWSLAHLIA-NGD-----------------------------------------LAHVLLFGSLGV
Q169M4_ROSDO/6-220IIGYMRHPLLSVLALWALLHVLA-NGD-----------------------------------------LAHVLLFGTLGL
A3VZT2_9RHOB/6-219IVRVTRHPMLLALALWALGHMVP-NGD-----------------------------------------LAHVILFGCFAG
A6DZE5_9RHOB/5-218IVRVTRHPMLVALALWALGHLLA-NGD-----------------------------------------LAHVILFGSFAG
A8LNX8_DINSH/42-256IVRVTRHPLLLALAIWAGAHLFP-NGD-----------------------------------------LAHVILFGTFAA
A0NZJ4_9RHOB/28-242IVGLMRHPILVAAFLWSVAHVVP-NGD-----------------------------------------LAHVILFGTFAV
A9CGK0_AGRT5/3-221IVRITRHPVLVGFLFWSLGHVVP-NGD-----------------------------------------LRSVILFGGFAL
Q2JYB9_RHIEC/5-223ITKITRHPVLWGFAAWASGHIAA-NGD-----------------------------------------LRSLLLFGGFAV
Q92Z13_RHIME/3-221IVSVTRHPVLWGFAIWALGHLVA-NGD-----------------------------------------VRSLILFGGFAL
Q9Z3V3_9RHIZ/48-266IVAITRHPVLWGFLFWSGGHLIA-NGD-----------------------------------------LRSLILFGGLGL
B0U8Q9_METS4/2-221VTAVTRHPLMWGFLIWALAHIPP-NGD-----------------------------------------LVSVVLFGGMAA
Q2VYZ8_MAGSA/17-229IVRLTRHPIIWGLGLWSAAHILP-NGH-----------------------------------------LAGLLLFVPLLL
Q60BH7_METCA/3-224ILRITRHPFLWGLSLWALVHVIA-NGD-----------------------------------------VAALLLFGSLLA
A7HZ42_PARL1/3-227MLRITRHPFLWGAAIWALWHILV-NGD-----------------------------------------KASIIFFGTFAL
B2T4H1_BURPP/6-224VFAVTRHPMMWSIALWGLCHIAV-FPV-----------------------------------------AKNVILAAAMVI
Q1NFY6_9SPHN/3-221VFAVTRHPMLWAFALWGLSHILV-YPV-----------------------------------------AKNIIVALAILI
A3WFN8_9SPHN/7-218VFTITRHPMMWGFALWALSHIVL-FWS-----------------------------------------LRTTITALAMGI
A5P993_9SPHN/6-220VFHVTRHPMMWSFALWAGVHILL-SPT-----------------------------------------PRQLVLAGALGF
Q1GUJ7_SPHAL/6-226VFAITRHPMMWGFALWALAHVMV-MPT-----------------------------------------PGQIVLSATIAF
Q2GC12_NOVAD/7-219VFTITRHPMMWAFALWALAHIIV-APT-----------------------------------------GRSLIFMSGMIV
Q8DMH0_THEEB/15-236IIRITRHPQLWGQLIWCVAHTLW-LGT-----------------------------------------SFTLLTSLGLIA
A0YMQ9_LYNSP/24-245IIRITRHPQMVGQVIWCIAHTLW-LGT-----------------------------------------SFTLVTSIGLVA
Q113R6_TRIEI/12-233IIRITRHPQMVGQVIWCIAHTLW-LGT-----------------------------------------SFTFVTSVGLIL
Q8YQ81_NOSS1/13-234IIRITRHPQMVGQVIWCIAHTLW-LGT-----------------------------------------SFTLVTSFGLIL
A0ZJY3_NODSP/15-236IIRITRHPQMVGQIIWCFAHTLW-LGT-----------------------------------------SFTLVTSMGLIL
Q9ALA6_SYNE7/12-229ITRITRHPQTFGQILWCLAHSLW-LGT-----------------------------------------SFMMVASAGLIA
Q2JR62_SYNJA/13-234IIRITRHPQMVGQVIWCVAHSLW-IGS-----------------------------------------SFMLVTSLGLVA
Q7V3C9_PROMP/9-231IMRITRHPQAFGQIIWCLAHTLW-IGT-----------------------------------------SFTFITSIGLIL
Q31D33_PROM9/9-231IMRITRHPQAFGQIIWCLAHTLW-IGS-----------------------------------------SFTLITSIGLIL
A3Z341_9SYNE/15-237IIRISRHPQAVGQILWCFSHALW-IGS-----------------------------------------SFMLVTCAGLIG
A9BD06_PROM4/12-234IIRITRHPQAVGQIIWCFAHGLW-IGS-----------------------------------------SFMMCTCFGLIG
A2BZX4_PROM1/12-234IIRVTRHPQAIGQIIWCFAHLLW-IGT-----------------------------------------SFTLVTCVGLIA
Q1N166_9GAMM/3-185IKRYTRHPMLWGIAIWSGMHLWL-NGD-----------------------------------------HASILLFGSFLA
A4BAE5_9GAMM/3-182IKRFTRHPMLWGIILWSVAHLAV-NGD-----------------------------------------LASMLLFGSFAL
A0YFY7_9GAMM/3-183VKRLTPHPMMWGVFLWALAHLAA-NGD-----------------------------------------QASIILFAPLLA
A8FT27_SHESH/3-183IRAKLKHPMLIATCLWALVHLLA-NGD-----------------------------------------LASSVLFGGFFL
Q1MDD4_RHIL3/3-191IATKTKHPMVLSVKIWALAHLLA-NGE-----------------------------------------TSSVLLFTAFLA
A9CI20_AGRT5/3-191IATKTKHPLILSVKIWALAHLLA-NGE-----------------------------------------TSSILLFASFLA
Q92UK4_RHIME/3-191IAVALKHPQVLSIKIWALAHLLA-NGE-----------------------------------------TSSVLLFGSFLA
A0NMT3_9RHOB/3-193IKTSLKHPMLVAVKLWAFAHLLA-NGD-----------------------------------------LASVLLFGGFLA
A3WZG1_9BRAD/2-188IYAKLKHPMLAGIKLWATAHLLA-NGD-----------------------------------------LGSIILFGSILA
Q89MZ5_BRAJA/5-191IYATLKHPMLAGIKLWAAAHLLA-NGD-----------------------------------------LGSIILFGSFLG
Q2IXB1_RHOP2/5-191IYAAVKHPMITAVKLWAVGHLIA-NGD-----------------------------------------LGSIILFGSLLA
Q07LA3_RHOP5/5-191IYAVVKHPMVTGVKVWALAHLIA-NGD-----------------------------------------LGSIILFGSLLA
A7IF98_XANP2/3-187IKAWLKHPMLVAVKIWALAHLLA-NGD-----------------------------------------VASIVLFGSVLA
A9W8R2_METEP/3-196LRARLKHPMLLAVKIWATAHLLA-NGD-----------------------------------------LGSILLFGSFLA
B0UL45_METS4/3-192IKGALKHPMLAGVKIWAAAHLLA-NGD-----------------------------------------LGSILLFGSILA
Q0C445_HYPNA/3-190IRKAVKHPMLVAVKIWAFGHLLA-NGE-----------------------------------------LNSVILFGSFLG
Q3JDP5_NITOC/3-187INNTVKHPQLVAVMIWAVAHLLV-NGT-----------------------------------------LADLLLFGSFLL
A6FBV0_9GAMM/3-187IRAMTKHPQLIAVKLWAVSHLLV-NGM-----------------------------------------LADVILFGAFLV
Q9AAA0_CAUCR/3-186IKATLRHPMLLGVILWSAGHLLV-NGD-----------------------------------------QASVLLFGAFLV
Q11KH3_MESSB/3-188ISTAVGHPMLLGTVIWGLAHLLA-NGT-----------------------------------------LADLLLFGGIAV
Q1YKP8_MOBAS/14-200IKTAVRHPMVLGVGLWALGHLLA-NGM-----------------------------------------VADVVLFGSFLV

PF04140

Q9EWQ7_STRCO/75-167LLT.VRLRCENT-----------------------------------------------------ALA--------Q---
Q99YI2_STRP1/81-173VIY.LRIREENK-----------------------------------------------------LLA--------E---
P91402_CAEEL/171-267HFFASRIYDEEK-----------------------------------------------------DLI--------S---
Q9KF68_BACHD/72-166VLY.IRIHTEEE-----------------------------------------------------ALQ--------A---
MAM4_SCHPO/121-215KFFSQRITTEEA-----------------------------------------------------YLV--------S---
Q9CM58_PASMU/75-167ILG.VRIKQEES-----------------------------------------------------AMA--------H---
Q9XCY1_RHOCE/72-164LLF.HRIRQEER-----------------------------------------------------ALA--------P---
ICMT_HUMAN/161-257RFFRDRTEEEEI-----------------------------------------------------SLI--------H---
STE14_YEAST/123-219KFFSDRIRVEEK-----------------------------------------------------YLI--------E---
Q99X02_STAAM/73-164FLY.VRIKQEEK-----------------------------------------------------LMN--------I---
ICMT_XENLA/165-261RFFSERIEEEEF-----------------------------------------------------SLI--------H---
Q9RTL5_DEIRA/91-184LLLGVRIPAEDR-----------------------------------------------------ALA--------E---

PF04191

A4HJV7_LEIBR/438-543AAKMFEAIVEEP-----------------------------------------------------HMR--------KHYG
PEMT_HUMAN/89-192TYIVALL.YEEP-----------------------------------------------------FTA--------EIYR
CHO2_ASPCL/504-608LTLAFIQFVERP-----------------------------------------------------HMQ--------KLYG
A1CQK4_ASPCL/70-170VYWFALQ.WEDP-----------------------------------------------------FTA--------EIYA
A1UQ07_MYCSK/81-184GIQTQVRLVEEP-----------------------------------------------------HLK--------RVHG
A3CKP0_STRSV/68-171LGYSIRLRVEEK-----------------------------------------------------ALG--------NHFG
A3LQ40_PICST/106-209MYKIALL.FEEP-----------------------------------------------------FTA--------KIYA
CHO2_PICST/449-558NNFVRINFIERW-----------------------------------------------------HMI--------KVYG
A4AA40_9GAMM/36-141YMTRFQIVPEER-----------------------------------------------------FMA--------QRFG
A4GJI8_9BACT/30-133IINFTWIRHEEN-----------------------------------------------------KLS--------EIFK
A4GK25_9BACT/30-133IINFTWIKHEEE-----------------------------------------------------KLA--------STFN
A4HJL2_LEIBR/106-210VYHVSTRYFESP-----------------------------------------------------FTA--------MIYS
CHO2_MAGO7/497-601LTLAFISYVEKP-----------------------------------------------------HMQ--------KIYG
CHO2_PICGU/462-570NNFFRINFVEKV-----------------------------------------------------HMI--------KVYG
CHO2_LODEL/480-589SNFIRINFIEKW-----------------------------------------------------HMI--------RLYG
A5UZK8_ROSS1/43-144VFFHLKSRREER-----------------------------------------------------WLV--------ERY.
A6FZ22_9DELT/133-240YIWVHWYCIEQP-----------------------------------------------------DGV--------VLYG
A6S8E2_BOTFB/75-178VYLVALR.FEDP-----------------------------------------------------FTA--------GIYA
A6U6D6_SINMW/33-136AANWWYIPFEES-----------------------------------------------------AAE--------QAFG
A6ZQ31_YEAS7/97-200MYKIALR.WEEP-----------------------------------------------------FTA--------MIYA
CHO2_YEAS7/470-578TNFILVKFIETP-----------------------------------------------------HVN--------KIYG
A7TIE1_VANPO/140-243MYNLALK.LEEP-----------------------------------------------------FTA--------QIYA
CHO22_VANPO/452-560TNFIFVKFIEKP-----------------------------------------------------HVS--------KIYG
CHO21_VANPO/439-547TNLIFVKLIEEP-----------------------------------------------------HVS--------KVYG
A8MZ66_HUMAN/126-222.EARQPH.GPAP-----------------------------------------------------DGA--------GGPH
A8NIW8_COPC7/92-195VYRIALL.FEGP-----------------------------------------------------FTD--------MIYS
CHO2_MALGO/537-642SHWWFLGCVEGP-----------------------------------------------------HMR--------RLYG
A8PVU2_MALGO/102-205TYRVALC.FESP-----------------------------------------------------FTA--------NIYR
A9B4Y9_HERA2/33-137IVDRWYIAFEER-----------------------------------------------------AML--------AKFG
A9V3D6_MONBE/125-229WYYMAAL.YEEP-----------------------------------------------------LMV--------EMYK
CHO2_LACBS/492-596ANWWFLSSVENP-----------------------------------------------------HMR--------KLYG
B0EDH3_ENTDS/91-196VYCIFSYLVEQP-----------------------------------------------------LTI--------LIYS
B1MLL6_MYCA9/108-208AALVVRIIDEEK-----------------------------------------------------MLR--------HDL.
B1WZT5_CYAA5/96-194LWFFLAPFTEEP-----------------------------------------------------WLQ--------ERYG
B2AR50_PODAN/95-198VYIIAIQ.FENP-----------------------------------------------------FTS--------GIYA
CHO2_PODAN/496-600LMLGFISFVEKP-----------------------------------------------------HMQ--------KIYG
B2JAT8_NOSP7/42-145IVQIGIVQREEN-----------------------------------------------------YLE--------RKFG
B2VTC6_PYRTR/87-190AYSIACK.WEDP-----------------------------------------------------FTS--------MIYQ
CHO2_PYRTR/425-530LNLAFLQFVEKP-----------------------------------------------------HVI--------KLYG
B3RI13_TRIAD/89-192VYWIGLL.LEEP-----------------------------------------------------YTE--------EIYR
B5J185_9RHOB/16-119VIRIGFVRHEET-----------------------------------------------------LME--------QTFG
B5XDB0_SALSA/119-222SYQVAII.FEGP-----------------------------------------------------FTE--------DIYR
CHO2_SCHJY/478-583STLGIIRFVEKP-----------------------------------------------------HMQ--------RIYG
B6QQY2_PENMQ/89-189LYWFALR.WEDP-----------------------------------------------------FTA--------EIYA
B8KMW4_9GAMM/36-141YMTRFQIIPEER-----------------------------------------------------SML--------LSFG
B8LBH8_THAPS/30-132FVLDVKSDYEET-----------------------------------------------------LLV--------ESYG
B8PB22_POSPM/91-194VYLIALR.FEGP-----------------------------------------------------FTD--------MIYS
CHO2_CANDC/471-580NNFIRINFIEKS-----------------------------------------------------HMV--------KLYG
C0C2L6_9CLOT/84-187ICYHIRIRIEEK-----------------------------------------------------VLL--------NHFK
C4G5P4_ABIDE/68-162ISAHWIIVSEER-----------------------------------------------------WCL--------EKFG
CHO2_PICPG/450-564NNLIVLNFIEKP-----------------------------------------------------HMV--------KLYG
C4R5S7_PICPG/98-201MYQIALK.FEEP-----------------------------------------------------FTA--------KIYA
CHO2_CLAL4/444-555NNFFRINFVERS-----------------------------------------------------HMI--------KIYG
C5DC91_LACTC/106-209VYNIAQQ.FEEP-----------------------------------------------------FTA--------QIYA
CHO2_LACTC/450-558ANIALVKLVEEP-----------------------------------------------------HVS--------KVYG
C5DZ83_ZYGRC/102-205MYYFALK.FEEP-----------------------------------------------------FTA--------MIYA
CHO2_ZYGRC/430-538CNFIIVKFIEQP-----------------------------------------------------HMA--------KLYG
C5G0L0_ARTOC/115-215CYKIACL.WEEP-----------------------------------------------------FTV--------EIYS
D7VS98_9SPHI/49-154MYYERIIFAEEQ-----------------------------------------------------FLE--------RKFG
C6SSR2_STRMN/68-171IGYAIRIRTEEE-----------------------------------------------------VLE--------QHFG
C6WWJ2_METML/43-146VMHWGVIFREER-----------------------------------------------------YLA--------KQFG
C7GC66_9FIRM/86-188VCYQIRINVEEA-----------------------------------------------------VLQ--------KYF.
C7YM51_NECH7/94-197VYKIALL.YEDP-----------------------------------------------------FTS--------GIYA
CHO2_NECH7/505-609LTVFYISYIERP-----------------------------------------------------HMQ--------KIYG
C8PGT3_9PROT/79-173IYNHLVVLGEER-----------------------------------------------------YCE--------QAYG
CHO2_SORMK/496-600LTLAFLAYVEKP-----------------------------------------------------HMQ--------KVYG
E3I110_RHOVT/77-175LVYVVLPYTEEP-----------------------------------------------------WLE--------RAYG
D2U841_XANAP/75-178WVFVHRIRIEET-----------------------------------------------------MLT--------EAFP
D2V512_NAEGR/65-168MYKFACL.FEEP-----------------------------------------------------FTA--------MIYA
D2VYZ6_NAEGR/455-563ATYLFVKFVEKP-----------------------------------------------------HMD--------KIYG
D3AX06_POLPA/89-193VFYISVKFVEGP-----------------------------------------------------HMN--------RIYE
D3BED6_POLPA/557-662ANFLFVKYVEHP-----------------------------------------------------HMK--------KLYG
D3BN57_POLPA/99-202TYRIALT.FEEP-----------------------------------------------------FTA--------HIYS
CHO2_SCHPO/491-596SNLAIIRLVEQP-----------------------------------------------------HMQ--------KVYG
CHO1_SCHPO/110-213VYRIALK.FEEP-----------------------------------------------------FTA--------KIYA
Q01DA1_OSTTA/648-751FMYLLHMIQEQ.-----------------------------------------------------.VN--------DIYS
Q0AM70_MARMM/72-173IIHVFITWVEEP-----------------------------------------------------HMR--------RTFG
Q0AQW8_MARMM/72-173IIHVFITRVEEP-----------------------------------------------------HLD--------RVFA
CHO2_PHANO/462-567LNLAFLQFVERP-----------------------------------------------------HMQ--------RLYG
Q0UN81_PHANO/69-173AYGVARR.WEDP-----------------------------------------------------FTG--------EIYA
Q11IW9_MESSB/45-148ATQKLAIEPEER-----------------------------------------------------HLA--------QHFG
Q1GIY9_SILST/78-176ALYFLFVLNEER-----------------------------------------------------WLL--------KGYG
Q4P2D8_USTMA/99-202VYALALR.FEEP-----------------------------------------------------FTA--------NIYK
Q4PA66_USTMA/318-424AHWGFLSYVEGP-----------------------------------------------------HMR--------KLYG
Q4V0H0_XANC8/96-199WVFLRRIRVEEA-----------------------------------------------------ALR--------RAFP
PEMTL_DICDI/82-186VFYISATFVETP-----------------------------------------------------HLK--------NIYS
PEM2_DICDI/98-201VYKFALI.FEES-----------------------------------------------------FTN--------YIYS
Q55Q20_CRYNB/618-724SHWWFLTFVERP-----------------------------------------------------HMQ--------RLYG
Q55UT8_CRYNB/146-249VYAVALK.FEGP-----------------------------------------------------FTD--------KIYS
Q5ZJB1_CHICK/134-237SYTIAVL.YEGP-----------------------------------------------------FTE--------EIYR
Q64EH3_9ARCH/57-160LMELLFIPIEEK-----------------------------------------------------NLE--------QVFG
Q66KT1_XENLA/89-192CYKVAIL.YEGP-----------------------------------------------------FTV--------EIYR
Q6C649_YARLI/97-200MYSIALK.FEEP-----------------------------------------------------FTG--------EIYA
CHO2_YARLI/531-635EGMAFIKFVEQP-----------------------------------------------------HMQ--------RIYG
CHO2_KLULA/451-559FNWFTVKFIETP-----------------------------------------------------HLL--------KVYG
Q6CV75_KLULA/106-209MYNIALR.FEEP-----------------------------------------------------FTA--------KIYA
Q6FUV4_CANGA/106-209MYYMALK.FEEP-----------------------------------------------------FTA--------EIYA
CHO2_CANGA/431-540TNFVLVKFIETP-----------------------------------------------------HVS--------KVYG
Q752Z0_ASHGO/100-203MYTMALK.LEEP-----------------------------------------------------FTA--------MIYA
Q7MUP1_PORGI/82-176IATHFLILGEER-----------------------------------------------------YCE--------ETYG
Q7YRH5_PIG/89-192IYKLAIL.FEEP-----------------------------------------------------FTA--------EIYR
Q7ZVZ2_DANRE/120-223SYKVAIA.YEGP-----------------------------------------------------FTQ--------EIYR
Q86IF9_DICDI/521-626ANFLFIKFVEKP-----------------------------------------------------HMK--------RLYG
Q8TN26_METAC/121-221LVIIWRLLEEEK-----------------------------------------------------FLS--------ENL.
Q98I61_RHILO/42-146VMGSFVRFYEEP-----------------------------------------------------TLA--------RRYG

PF06966

Q10E47_ORYSJ/24-252LFVSGIPLLEAS-----------------------------------------------------ADKRFGQNEEYRTYK
Q8PAZ9_XANCP/20-250YRFTGIPYTEQQ-----------------------------------------------------ALRSRG..EDYAQYQ
Q9A3U2_CAUCR/70-299TKWSGVPTTEGK-----------------------------------------------------MRK...SKPGYEEYV
Q9VSM5_DROME/25-264LFLSGIPLRERS-----------------------------------------------------ADEKYKDQLEYRKYK
Q9CHY6_LACLA/17-245LFVSGVPILE..-----------------------------------------------------..KKYKNREDFKEYA
Q7CY59_AGRT5/19-248VHVSGIPPLEEH-----------------------------------------------------MLKSRG..EKFRALQ
O81042_ARATH/64-303VYVT.I.LVERR-----------------------------------------------------MVKQQYRAEAYRAYQ
Q8LEY8_ARATH/24-252LFVSGIPLLEAS-----------------------------------------------------ADKKHGNSGAYRSYK
O53731_MYCTU/17-243VDVSGARLTE..-----------------------------------------------------..RYLKGRPGFAEYQ
YJD4_SCHPO/61-314VFQGSTRLTEKM-----------------------------------------------------SCEKY...PLYRVYQ
Q8Y9D9_LISMO/16-244LFVSGVPLLE..-----------------------------------------------------..KKYQDRADFQAYA
Q984A1_RHILO/21-257VHVSGIPPLEAH-----------------------------------------------------MLRSRG..VQFRRYQ

PF02544

Q19605_CAEEL/97-243ANIGPRAVAHHK-----------------------------------------------------WYK--------ETF.
YN67_SCHPO/146-295AQMFVWAKKKHA-----------------------------------------------------RYL--------KEF.
Q20344_CAEEL/97-243ANIGPRAIAHHN-----------------------------------------------------WYK--------EKF.
S5A1_RAT/110-259STLLTRAKQHHQ-----------------------------------------------------WYH--------EKF.
S5A2_HUMAN/105-254CFLGLRAFHHHR-----------------------------------------------------FYL--------KMF.
PORED_CAEEL/189-309INQTFAALITHS-----------------------------------------------------WYH--------KTF.
Q23431_CAEEL/103-253CNLAPRAMSHHK-----------------------------------------------------WYQ--------KMFG
DET2_ARATH/111-262SNLFPRARASHK-----------------------------------------------------WYI--------AKFK
TSC13_YEAST/154-310LFLTVSTAQMYA-----------------------------------------------------WAQ--------KKN.
S5A1_HUMAN/110-259CFLSGRAKEHHE-----------------------------------------------------WYL--------RKF.

PF01222

LBR_CHICK/175-609CLLVHREARDEH-----------------------------------------------------HCK--------KKYG
ERG24_NEUCR/17-490ILLIHRDLRDDE-----------------------------------------------------KCS--------KKYG
STS1_SCHPO/7-453VVLVHRVSRDIK-----------------------------------------------------KCK--------AKYG
ERG4_YEAST/34-473VVLIHRAFRDQA-----------------------------------------------------KCK--------RKYG
ERG24_YEAST/8-438TLLLHRQQRDEH-----------------------------------------------------KCR--------LKYG

PF07298

C5N9K5_BURML/5-192WAFVDFIASRAR........DRR.DGVRYPAGSLAR..................DGVAIAVGLLVWALFAFVLHGWL.IG
A9ANX9_BURM1/3-190WSLVDFVVLRAR........DRR.DGVRYPAGGLAG..................DVGTVVAGLVAWAVFASFLHGWL.IG
Q1BPV3_BURCA/3-190WSIVDFVVSRAR........DRR.DGVRYPAGGLAG..................DVATVVAGLVAWAVFARFLHGPL.IG
A4JQ26_BURVG/3-190WSLILFIASRTR........DRR.DRVRYPAGRLSG..................DVSAIAAGVVAWAVFALFLHGPL.IG
B2JUD7_BURP8/3-190WAVFDYAAARRR........DRA.EGVVYPGGTLSR..................DVMPVVAGVVLWVAFVFFLHGWL.IG
A1VI53_POLNA/3-190WAGLSFRAARAR........DRA.ALAVYPAGTASG..................TLMAVLAGMAAWAVFAFWAHGLL.IG
Q12HL7_POLSJ/3-190WAVVCFKAARGR........DRV.AQTVYPPGTATG..................TAITMAVGLVAWAGFAFWAHGVL.IG
A2SBS8_METPP/3-190WAVLCFRAARGR........DRA.TGVATPPGRAGA..................TAITVVVGAVAWAVFAFWAHGAW.IG
Q223I4_RHOFD/3-190WAIVDFTASRRR........DRT.LGTRYPGGTAGA..................TGITVALGVGAWIAFALWLHGLL.IG
A1K5T7_AZOSB/6-191WSATDFVSARRR........EPT.SRITRPALKV....................DATAVLLGIVAWAIFARFLHGPL.IG
A1WT38_HALHL/3-190WASVTFVAARER........DRR.QAASPTPAQRWG..................NAWAIGGGLIGYIVFALFLHIPI.TG
A6VV32_MARMS/3-191WSIVSFAVYRRR........DRK.AGVVRDQESGVQF.................DLAAFTFAMVTWFAIAFYLHQAI.IG
A6GLJ7_9BURK/5-192WAVLLFKTARRR........AIP.MGFAGDGPTMVG..................TLMTVVVGVLAWLVFAAWLHVHL.IG
A3UJ56_9RHOB/3-182WSLILLVEGYWT........GGH.FARPGVLWA.....................DLTALLIGVLASAVIAY.FHMQL.FG
Q0AQE8_MARMM/3-183WSLVTFIAACLR.............ETPPPVVKGWGG.................DLTAIVLGLIAALIILN.FHMYL.FG
A3JNN0_9RHOB/3-184WALLQMSLIWLQ........DDV.WIKPAKSTPK....................QDLFLLLGVCLVYAAIFGLHYNL..G
Q2CI37_9RHOB/3-180WAVAEIVTLNRI........EGP.WTRPAHPLPVRK..................EITSAVAALVLFVVVAL.IHGWI..G
A1AZI2_PARDP/3-180WALVEMVVINRA........QPD.WTPPAGPFPARK..................EIMAVAGAVVVLLVVGL.IHAWL..G
A3V560_9RHOB/3-179WAVGEVIVINRA........NRD.WT.PPPVVPVKK..................EITAIIAAVAVYAIAAA.IHVWL..G
A3VBW4_9RHOB/3-178WAVIEVILINRQ........AKP.AK.NTGPFPVGK..................EIGAAVGAVVVFAAIAG.VHYWL..G
A4EI42_9RHOB/3-182WAIVEILLINAQ........EGP.WQ.TPDRAPVKK..................EIVAIVVTIVVTVVVMG.IHYAL..G
Q28U80_JANSC/6-185WALGSVVAINAA........EGP.WT.PPNRAPKRK..................ELTYVIATVVIVVVVML.IHWAL..G
A4EZ57_9RHOB/3-179WALLEMVVINRA........EPN.WT.APAKGSIAK..................DGMFLVASIILLAVIGY.VHGLV..G
A3TV37_9RHOB/3-178WAVVEMIVINRS........DPD.WS.PPAKGSIAK..................DGMFFAISVLLLLVIGW.IHTWL..G
A3K3K6_9RHOB/3-179WAVVEMIVINRA........EPG.WV.APSKGSIAK..................DAMFMAISLVLLVVIGY.VHGLI..G
Q0FNF9_9RHOB/3-178WAIVEMVVINRA........EPE.WT.PPQKGSIGK..................DAMFLAISVVLLFVIGF.IHTWL..G
Q5LXD7_SILPO/5-179WGIVEVAAINAA........EPE.WT.PGEPGTLGK..................DAMFLVASVVLMAVIGY.IHGLV..G
Q1GLH3_SILST/3-179WAVVEVITINKS........EPN.WQ.PNPKGSLAK..................DAMFFVASIVLLGVIGY.IHGLV..G
A4WNN0_RHOS5/3-178WAVAEVVLINKQ.........TD.WV.RPVSGGPKR..................DLALVGVVLVMYGLIAL.VHIWT..G
A6DVY9_9RHOB/3-178WAVLEVVVINKS........E.T.WN.RPKPGEAKR..................DIILVVITIVLFLVMTA.IHNWL..G
A6FLU6_9RHOB/3-178WAVVQVIVINRT........E.E.WV.RPEPGKASK..................DILLVVITLVLFGVMTG.IHSWL..G
A3SVP9_9RHOB/4-183WAVGSVILINRA........EPN.WT.PPAPAGKAT..................YIRLAVITLVMLVVVTA.IHTLL..G
A8LJK3_DINSH/5-184WAVGEVILINKA........EPD.WT.PPETAGMKT..................KIRLAVITVVLYLVIGG.IHAWL..G
Q169U5_ROSDO/3-182WAVGSVILINKA........EPE.WT.APERAGMAT..................RVRLAIITLVLYALISA.VHIWA..G
A0Z9H8_9GAMM/3-179WAVISVVVINKQ........DGK.PA.LSVKTSAGR..................EVMTALSAILAFGGIAF.IHIYM..G
B1KG57_SHEWM/3-185WSLWQIYFINKR........EGA.WS.KPEPVSWRN..................EIKVLLVGGVIFVILAL.IHPYL.SG
Q1KL82_9BACT/3-184WAILEILLINKR........EGA.RD.KPAPVPLTG..................DVITVIVGAVAFGVIVF.SHEYL.FG
A4A3P3_9GAMM/3-185WSVLEILVINRR........DGA.WE.KPAAAGVIA..................EVVTVAIAAIVVVVLVW.AHPWY.AG
A4SIT4_AERS4/3-186WALVSIIWISVR..........D.WQCHPRPAANWVG.................TGISVGAGLAVTAILIFWGHGWL.TG
A0KG00_AERHH/3-186WALVSIVWISVR..........D.WQRHPRPVANWYG.................TGLSVGAGLALTALLIFWGHGML.TG
Q6N9Q3_RHOPA/31-253IAVIGMLIIDRR...KRRQLGAERWAELAARTSFWPFAALISGR..FRPQTWRISSLRLCIGLAAWLSLLL.LHPLV.IG
Q07S45_RHOP5/22-244MALLGMVIIDRR...KQRQLGRARWAMLAASTSFVPFVALLSGR..WRPRALKIDLKRLAIGLSVWLALLL.AHAPV.IG
Q219Y9_RHOPB/14-236IALAGMVMIDRR...KQRRLGYEAWHALARNTSFWPFAALLQGR..FRPRSYGVDAKRLAIALVAWLTLLA.LHAPV.IG
Q5LUC0_SILPO/7-220FAVMGMALIDRR...KRRELGAD.WARLAAGTARLSPRGL..........PALLAPRVLWPAALLYLALLL.AHAPV.IG
A1B4I1_PARDP/5-167YAGFGLAISLRR..................GVALRP..................TWPRLAAAVLVWAALLH.LHLPV.IG
A3PL51_RHOS1/6-228LSLAAIPMFDAR...ARRALTPDEARAAFGATALFSLRPLVDAH..WLKQNEDHLFPRLLAVVALWAAALT.LHPIL.LG
A4WR63_RHOS5/6-228LSLAAIPMFDAR...ARRALPPCEAWDAFRATSIFSLRPLLNPE..WLKQNEDHLIPRLLAIVAFWAAALA.LHPIL.LG
A3VCT1_9RHOB/6-228LALAAIPIFDAR...AQAHFGPDTAPAFFRATGLFSLAPLANRS..WRKRNGGRLVKRTAIGIILWAALLL.GHTAV.IG
A4EUV2_9RHOB/5-226FPMLAMWGFDLK...AKR.LSETQENELLTKTSWFSLAPVFQKV..WWKQNFRTLSLRVALGLFFWVGALH.LHATI.IG
Q0C1Y5_HYPNA/14-233FSVVGILAMETR...SRMRGGAL.WSQMIRGTSLVPFAALLTG....NARWRELLQLRMLLLPVVWGGLIL.LHRPV.VG
Q169M4_ROSDO/6-220FAYVGPRIIDAR...NRRDMGAEAWEALVGETRRQRRIRV..........PSPAMMLRLGAGVILYLVLVF.LHPVV.IG
A3VZT2_9RHOB/6-219FAGMGGVLIDRR...KRRAMGAE.WVRLEHARRQAGSVPQ..........SWPAAVLRSALGCVLYALVLG.AHPYL.FG
A6DZE5_9RHOB/5-218FAILGAVLIDRR...KRRIMGAE.WLRLDHARRRAGMAPQ..........SGGVALVRGILGLFLYAALLA.AHPHL.VG
A8LNX8_DINSH/42-256FALLGGRLVDRR...ARRTLGSQ.WSPLLQKSRQTPVFRAF.........PLGESLLRLGLGVVLYLVLIG.VHPWL.FG
A0NZJ4_9RHOB/28-242FSLAGMKLIDRR...KQRDLGMA.WPALVADIKRSSRPAKV.........NWQPFLSRATAGLVLYVVLAV.AHPLF.TG
A9CGK0_AGRT5/3-221FSLGGMAMTEKR...ARKRLGNA.WNATAAGSATVPFAAILSGKT.RIAVDGPMLLAAALTGLTVWWLLAG.GHAML.FG
Q2JYB9_RHIEC/5-223FALGAISMTDKR...AKRRLGVS.WTRLAEHTSIWPFGACFKGEQ.PRLDVPMLLAGLASAVMVLWLLFAG.GHSAM.FG
Q92Z13_RHIME/3-221FALGTIPMIEKR...ARRRLGDQ.WQRQSAKTSILPFAALFTGRTRLSGDTPIATATVATAVLTLWLLAG..GHAAL.FY
Q9Z3V3_9RHIZ/48-266FSAAGFLMLDKR...AKRRMNDC.WPIFRDAHPLLPLAVIATRKNHLRIDAPMALAFALTAGLTLWLLFG..GHALL.FG
B0U8Q9_METS4/2-221FSLAGFALLDAK...ARRRLGAERWRALSRGTSVVPFAAILAGR..ARLGPVRPLLPAAAAALAAYAWFLAQGHALL.IG
Q2VYZ8_MAGSA/17-229LCLVGPRILDAK...RRKSLGDRHWREMAERAVFEPRALL...........AELGWARICGGLALYPVLLW.LHPMV.IG
Q60BH7_METCA/3-224LCLAGTRSIDAK...RRRTYGDR.WERFAAATSNVPFMAIKEGR..NRLELGEIGWQRLGIAVALYLAMLH.FHAKI.FG
A7HZ42_PARL1/3-227LAILGTFSIDDK...KRKRMGES.WTAFAARTSNLPFAAIFAGR..NQLKLGELGWWRILAALIVFGALFY.AHLWL.FG
B2T4H1_BURPP/6-224LALAGAALQDRK...KERLQPEL.WATWEAQTSYLPFAAIAAG....RARLGGFGMHALLGGLVVWLAATW.AHIPL.SG
Q1NFY6_9SPHN/3-221LSLVGAALQDRK...KERLQPAQ.WREWEAKTSYWPFAAIVAG....RARFGRFGAHALAGGVVVWLAATW.AHMPL.AG
A3WFN8_9SPHN/7-218LALVGAKLQDRK...KKALMGDA.WQQWESNTSFWPRVGG..........FAKAGPLPWTLGLIFFVFFSW.LHWPL.GG
A5P993_9SPHN/6-220LALVGARMQDRK...KEQLMGEA.WAGWEAQTSYWPRLGR..........IARSGTVAWIGGIVIWLAATY.GHIHA.NG
Q1GUJ7_SPHAL/6-226LALAGSAGQDVK...KARLMGDA.WRGWAARTSFVPFARQVGGA..APWADAMPRAHALLGGIILWLAASW.AHGAL.GY
Q2GC12_NOVAD/7-219LALLGSHFQDKR...KIAGNNRE.FAPWQRRTSYWPRLDK...........LGAIGLIWLLAALVWVIITL.IHWEL.FG
Q8DMH0_THEEB/15-236HHCFGVWHGDRR...WYARHGEA.FAALKNRTSIIPFKAIWEGK...QQLVWQEFLRPAYGGVVIFVALLWWLHPYF.YH
A0YMQ9_LYNSP/24-245HHLFAVWHGDKR...MRARYGEA.FDAVRDRTSVIPFLAILQGR...QTLQWQEFVRWSYLGVAIFIILLWQAHPLL.IG
Q113R6_TRIEI/12-233HHLFGVWHGDRR...LQKRFGES.YDQLKSRTSVIPFLAIIQGR...QTLHLQEFIRWAYLGIGLFVLLFWQAHPLL.IR
Q8YQ81_NOSS1/13-234HHLFGVWHGDRR...MSKRYGEA.FEIVKQRTSIIPFAAIIDGR...QSIKWEEFIRPAYLGVAIFVALLWWAHPLL.FV
A0ZJY3_NODSP/15-236HHLFGVWHGDRR...LAARYGQA.FEMAKERTSIIPFLAIIDGR...QSIKWQEFLRPAYLGVGIFIALLSWAHPLL.LV
Q9ALA6_SYNE7/12-229HHLFSIWHGDRR...LQKRYGEA.FEALKSRTSIIPFLAIAQGK...QTLVWKEFLRPAYLGVAIAIGLFWFAHRWI...
Q2JR62_SYNJA/13-234YHLFAVWHGDHR...LERKYGQA.FRDLKARTSVIPGLAILQRR...QHLQPREFLRWAYLGVFSFVVILYAFHPQM.VS
Q7V3C9_PROMP/9-231HHLFAIWHGDKR...LEIKFGEE.FYKYKESTSIIPFVAIFDGR...QQIKLKEFFKLSQIGILIAIAIIWWSHKYINIA
Q31D33_PROM9/9-231HHLFAIWHGDKR...LANRFGEE.FEKFKKNTSIIPFLAIIEGR...QEFKIKEFFRLSQLGILVAIGVLWWSHQYINIA
A3Z341_9SYNE/15-237HHLFAVWHGDRR...LKERFGTA.FDTLRDSTSVVPFVAVLDGR...QQLDWRELLRPAQLGIAIAVGVFWWSHRYIPIG
A9BD06_PROM4/12-234HHLFAVWHGDKR...LREKFGAD.FEELKRNTSVIPFLAVINGR...QTLEIKEFLRPSQFGICIAVATFWWGHRFISFG
A2BZX4_PROM1/12-234HHLFAIWHGDRR...LTLRFGKE.FDEIKKKTSVVPFLAVLDGR...QKLQIKEFLRPSQMGILIAIFFFWWSHKFISVG
Q1N166_9GAMM/3-185YSLFAMFIGNVR........GAK.KQTKKVPFKN....................DIIVVVAGGVAYIAVAF.SHQWI.AG
A4BAE5_9GAMM/3-182YSVYAMVSQTRR........GAA.LQTEPVAVKY....................DAMVVVAGTIVFVAIWQ.LHGVL.FG
A0YFY7_9GAMM/3-183FSVIHIVSANRR........GAT.VQTHKLPVAA....................DIKVAVIGVAAYVILLF.AHPLL.FK
A8FT27_SHESH/3-183YALADILLAKSR........DSI.VPKGEPKAKF....................DVIAVVVGLIVYALVLR.GHQTL.FG
Q1MDD4_RHIL3/3-191WGVILRISLKRR........QRA.GEITLRPFVSAKY.................DLYAIIIGIVVWALIIWKLHEWL.IG
A9CI20_AGRT5/3-191WGVVMRISLKRR........ERA.GEKVVRDFVSSRY.................DLVAIVGGIVLWGAFILKLHEWL.IG
Q92UK4_RHIME/3-191WAVILRISLKRR........ERA.GEKVLPVFKSARN.................DVLAVVIGLVAFVLFVWKLHELL.IG
A0NMT3_9RHOB/3-193WAVADRISVKRR....GPGAGQI.GALASAKPGKYS..................DLVVILLGLVLYGLFVWKLHALL.IG
A3WZG1_9BRAD/2-188WAVIDRISLKHR........SDP.GGPPIPVGGVRN..................DVIAVVIGVVVYIALGALFHPFV.LG
Q89MZ5_BRAJA/5-191WAVFDRISLKHR........TDA.GGPPIPVGGVSN..................DLIAVAVGVVAYLALAFAFHPVV.IG
Q2IXB1_RHOP2/5-191WAVYDRISLKRR........ADP.GGPRIPVGGPKN..................DAIAIGAGVVLYLALAFAFHPYV.VG
Q07LA3_RHOP5/5-191WAVLDRISLKRR........TDA.GGPPIPVGGPKN..................DLIAIAVGIVAYLALAFAFHPVV.IG
A7IF98_XANP2/3-187WAVYDRIAVKRR........GDP.LPVAPNNYAG....................DALVVGGGLVLYAALAYLFHPYV.IG
A9W8R2_METEP/3-196WAVVARISAKRRALTAGQVAQQH..GGQATPAGWRN..................DAIAVVVGVVAWFVFGKYLHPLL.IG
B0UL45_METS4/3-192WAVAARISVKRR....DEVKAHA..GPAAAPAGWRN..................DALAVGIGVVAWFVFARVLHPWL.IG
Q0C445_HYPNA/3-190YAVIDRIALKKR........GDN.GPAPDAPVSAMG..................DIAAVGIGVAAYLFLLFWFHPIL.TG
Q3JDP5_NITOC/3-187WAIVDRISMMNR........ATR..SVPSVPQSKAN..................DIIVVVVGLAVYAAIVFWLHETL.LG
A6FBV0_9GAMM/3-187WAVVDRISMKKR........TSR..QVHHLPRALMN..................DVIIVVLGLGFYGVFAMYLHQRL.IG
Q9AAA0_CAUCR/3-186WAVVDLFSAIGR........KEP.APVVVKPRA.....................DLTAVLGGTVAYLIFVFVLHRLL.FG
Q11KH3_MESSB/3-188WGTVDWVSSVQR........PRE..PVAKGKPSPRN..................DVMAVVGGLVIYAIFVAGLHRLL.FG
Q1YKP8_MOBAS/14-200WAVLDYASAVRR..........PIPASAGRAPSLRG..................DLLAVVVGLGLAAAFILWLHRWL.FG

PF04140

Q9EWQ7_STRCO/75-167--------------------
Q99YI2_STRP1/81-173--------------------
P91402_CAEEL/171-267--------------------
Q9KF68_BACHD/72-166--------------------
MAM4_SCHPO/121-215--------------------
Q9CM58_PASMU/75-167--------------------
Q9XCY1_RHOCE/72-164--------------------
ICMT_HUMAN/161-257--------------------
STE14_YEAST/123-219--------------------
Q99X02_STAAM/73-164--------------------
ICMT_XENLA/165-261--------------------
Q9RTL5_DEIRA/91-184--------------------

PF04191

A4HJV7_LEIBR/438-543D.Q-----------------
PEMT_HUMAN/89-192QKA-----------------
CHO2_ASPCL/504-608R.S-----------------
A1CQK4_ASPCL/70-170KRE-----------------
A1UQ07_MYCSK/81-184EPY-----------------
A3CKP0_STRSV/68-171KNY-----------------
A3LQ40_PICST/106-209ARD-----------------
CHO2_PICST/449-558EQE-----------------
A4AA40_9GAMM/36-141DDF-----------------
A4GJI8_9BACT/30-133EDW-----------------
A4GK25_9BACT/30-133EEW-----------------
A4HJL2_LEIBR/106-210KRG-----------------
CHO2_MAGO7/497-601Q.S-----------------
CHO2_PICGU/462-570EKE-----------------
CHO2_LODEL/480-589EQE-----------------
A5UZK8_ROSS1/43-144PEY-----------------
A6FZ22_9DELT/133-240RSP-----------------
A6S8E2_BOTFB/75-178KRE-----------------
A6U6D6_SINMW/33-136DPY-----------------
A6ZQ31_YEAS7/97-200NRD-----------------
CHO2_YEAS7/470-578.KT-----------------
A7TIE1_VANPO/140-243KRD-----------------
CHO22_VANPO/452-560.NE-----------------
CHO21_VANPO/439-547.NG-----------------
A8MZ66_HUMAN/126-222LHS-----------------
A8NIW8_COPC7/92-195NRA-----------------
CHO2_MALGO/537-642A.D-----------------
A8PVU2_MALGO/102-205EAA-----------------
A9B4Y9_HERA2/33-137EQY-----------------
A9V3D6_MONBE/125-229KDL-----------------
CHO2_LACBS/492-596D.S-----------------
B0EDH3_ENTDS/91-196NKK-----------------
B1MLL6_MYCA9/108-208QGY-----------------
B1WZT5_CYAA5/96-194EEY-----------------
B2AR50_PODAN/95-198KRE-----------------
CHO2_PODAN/496-600Q.N-----------------
B2JAT8_NOSP7/42-145DEY-----------------
B2VTC6_PYRTR/87-190KRE-----------------
CHO2_PYRTR/425-530E.N-----------------
B3RI13_TRIAD/89-192QKN-----------------
B5J185_9RHOB/16-119EQY-----------------
B5XDB0_SALSA/119-222QRA-----------------
CHO2_SCHJY/478-583S.G-----------------
B6QQY2_PENMQ/89-189KRE-----------------
B8KMW4_9GAMM/36-141EAY-----------------
B8LBH8_THAPS/30-132KEY-----------------
B8PB22_POSPM/91-194NRA-----------------
CHO2_CANDC/471-580EQE-----------------
C0C2L6_9CLOT/84-187EEY-----------------
C4G5P4_ABIDE/68-162KNY-----------------
CHO2_PICPG/450-564EQN-----------------
C4R5S7_PICPG/98-201KRE-----------------
CHO2_CLAL4/444-555ERE-----------------
C5DC91_LACTC/106-209KRD-----------------
CHO2_LACTC/450-558.TS-----------------
C5DZ83_ZYGRC/102-205KRD-----------------
CHO2_ZYGRC/430-538.DN-----------------
C5G0L0_ARTOC/115-215KRD-----------------
D7VS98_9SPHI/49-154DQY-----------------
C6SSR2_STRMN/68-171RIY-----------------
C6WWJ2_METML/43-146QAY-----------------
C7GC66_9FIRM/86-188KEY-----------------
C7YM51_NECH7/94-197KRE-----------------
CHO2_NECH7/505-609R.S-----------------
C8PGT3_9PROT/79-173REY-----------------
CHO2_SORMK/496-600R.N-----------------
E3I110_RHOVT/77-175DVY-----------------
D2U841_XANAP/75-178LDY-----------------
D2V512_NAEGR/65-168KRD-----------------
D2VYZ6_NAEGR/455-563AKN-----------------
D3AX06_POLPA/89-193NKN-----------------
D3BED6_POLPA/557-662T.K-----------------
D3BN57_POLPA/99-202KRT-----------------
CHO2_SCHPO/491-596N.T-----------------
CHO1_SCHPO/110-213ARD-----------------
Q01DA1_OSTTA/648-751DSW-----------------
Q0AM70_MARMM/72-173DAF-----------------
Q0AQW8_MARMM/72-173AAY-----------------
CHO2_PHANO/462-567R.K-----------------
Q0UN81_PHANO/69-173KRE-----------------
Q11IW9_MESSB/45-148KRY-----------------
Q1GIY9_SILST/78-176KAF-----------------
Q4P2D8_USTMA/99-202QAE-----------------
Q4PA66_USTMA/318-424EAA-----------------
Q4V0H0_XANC8/96-199TRY-----------------
PEMTL_DICDI/82-186NRS-----------------
PEM2_DICDI/98-201TAA-----------------
Q55Q20_CRYNB/618-724K.R-----------------
Q55UT8_CRYNB/146-249AKN-----------------
Q5ZJB1_CHICK/134-237QKQ-----------------
Q64EH3_9ARCH/57-160TEY-----------------
Q66KT1_XENLA/89-192KKD-----------------
Q6C649_YARLI/97-200KRD-----------------
CHO2_YARLI/531-635T.S-----------------
CHO2_KLULA/451-559.TK-----------------
Q6CV75_KLULA/106-209KRA-----------------
Q6FUV4_CANGA/106-209KRD-----------------
CHO2_CANGA/431-540PSA-----------------
Q752Z0_ASHGO/100-203KRD-----------------
Q7MUP1_PORGI/82-176EEY-----------------
Q7YRH5_PIG/89-192QRG-----------------
Q7ZVZ2_DANRE/120-223QRS-----------------
Q86IF9_DICDI/521-626S.K-----------------
Q8TN26_METAC/121-221PGY-----------------
Q98I61_RHILO/42-146ADY-----------------

PF06966

Q10E47_ORYSJ/24-252NTT-----------------
Q8PAZ9_XANCP/20-250RST-----------------
Q9A3U2_CAUCR/70-299ART-----------------
Q9VSM5_DROME/25-264AST-----------------
Q9CHY6_LACLA/17-245KTT-----------------
Q7CY59_AGRT5/19-248RRV-----------------
O81042_ARATH/64-303KTT-----------------
Q8LEY8_ARATH/24-252KTT-----------------
O53731_MYCTU/17-243RRT-----------------
YJD4_SCHPO/61-314DKV-----------------
Q8Y9D9_LISMO/16-244NKT-----------------
Q984A1_RHILO/21-257ERV-----------------

PF02544

Q19605_CAEEL/97-243PGYPPNRR-----ILIPRIF
YN67_SCHPO/146-295PNYPRSRK-----IMIPFFL
Q20344_CAEEL/97-243PKYPPTRR-----ALIPYIY
S5A1_RAT/110-259EDYPKSRK-----ILIPFVL
S5A2_HUMAN/105-254EDYPKSRK-----ALIPFIF
PORED_CAEEL/189-309PKYPKSRK-----ALIPYVL
Q23431_CAEEL/103-253EQYPRDRH-----ALVPGVW
DET2_ARATH/111-262EEYPKTRK-----AVIPFVY
TSC13_YEAST/154-310KKYHTRRA-----FLIPFVF
S5A1_HUMAN/110-259EEYPKFRK-----IIIPFLF

PF01222

LBR_CHICK/175-609LAWERYCQRVPYTHISLHLL
ERG24_NEUCR/17-490DDWEKYKKLVKW.RIVPGIY
STS1_SCHPO/7-453ADFDEYCRICPY.LFIPYIF
ERG4_YEAST/34-473KDWDEYCKHCPY.VFIPYVF
ERG24_YEAST/8-438ENWEEYERKVPY.KIIPYVY

PF07298

C5N9K5_BURML/5-192VRP-----------------
A9ANX9_BURM1/3-190VRP-----------------
Q1BPV3_BURCA/3-190VRP-----------------
A4JQ26_BURVG/3-190VRP-----------------
B2JUD7_BURP8/3-190VKP-----------------
A1VI53_POLNA/3-190IRP-----------------
Q12HL7_POLSJ/3-190VRP-----------------
A2SBS8_METPP/3-190VRP-----------------
Q223I4_RHOFD/3-190VRP-----------------
A1K5T7_AZOSB/6-191VPP-----------------
A1WT38_HALHL/3-190VPA-----------------
A6VV32_MARMS/3-191VSP-----------------
A6GLJ7_9BURK/5-192ISP-----------------
A3UJ56_9RHOB/3-182VAV-----------------
Q0AQE8_MARMM/3-183VAV-----------------
A3JNN0_9RHOB/3-184HSP-----------------
Q2CI37_9RHOB/3-180PRP-----------------
A1AZI2_PARDP/3-180YNP-----------------
A3V560_9RHOB/3-179YNP-----------------
A3VBW4_9RHOB/3-178Y.P-----------------
A4EI42_9RHOB/3-182VTP-----------------
Q28U80_JANSC/6-185VQP-----------------
A4EZ57_9RHOB/3-179PSP-----------------
A3TV37_9RHOB/3-178Y.P-----------------
A3K3K6_9RHOB/3-179PPA-----------------
Q0FNF9_9RHOB/3-178Y.P-----------------
Q5LXD7_SILPO/5-179..P-----------------
Q1GLH3_SILST/3-179PSP-----------------
A4WNN0_RHOS5/3-178HNP-----------------
A6DVY9_9RHOB/3-178VWP-----------------
A6FLU6_9RHOB/3-178VWP-----------------
A3SVP9_9RHOB/4-183VSP-----------------
A8LJK3_DINSH/5-184VWP-----------------
Q169U5_ROSDO/3-182VWP-----------------
A0Z9H8_9GAMM/3-179YPV-----------------
B1KG57_SHEWM/3-185VAI-----------------
Q1KL82_9BACT/3-184VSA-----------------
A4A3P3_9GAMM/3-185MPA-----------------
A4SIT4_AERS4/3-186IPL-----------------
A0KG00_AERHH/3-186IPL-----------------
Q6N9Q3_RHOPA/31-253VSP-----------------
Q07S45_RHOP5/22-244VSP-----------------
Q219Y9_RHOPB/14-236VSP-----------------
Q5LUC0_SILPO/7-220VSP-----------------
A1B4I1_PARDP/5-167VSP-----------------
A3PL51_RHOS1/6-228VSP-----------------
A4WR63_RHOS5/6-228VSP-----------------
A3VCT1_9RHOB/6-228VSP-----------------
A4EUV2_9RHOB/5-226AWP-----------------
Q0C1Y5_HYPNA/14-233VSP-----------------
Q169M4_ROSDO/6-220VPV-----------------
A3VZT2_9RHOB/6-219VSP-----------------
A6DZE5_9RHOB/5-218VSP-----------------
A8LNX8_DINSH/42-256VSP-----------------
A0NZJ4_9RHOB/28-242VDP-----------------
A9CGK0_AGRT5/3-221ADP-----------------
Q2JYB9_RHIEC/5-223ADP-----------------
Q92Z13_RHIME/3-221ADP-----------------
Q9Z3V3_9RHIZ/48-266ADP-----------------
B0U8Q9_METS4/2-221PDP-----------------
Q2VYZ8_MAGSA/17-229LSP-----------------
Q60BH7_METCA/3-224VSP-----------------
A7HZ42_PARL1/3-227VSP-----------------
B2T4H1_BURPP/6-224WAA-----------------
Q1NFY6_9SPHN/3-221WAA-----------------
A3WFN8_9SPHN/7-218IRA-----------------
A5P993_9SPHN/6-220VPA-----------------
Q1GUJ7_SPHAL/6-226MVA-----------------
Q2GC12_NOVAD/7-219IPA-----------------
Q8DMH0_THEEB/15-236VTP-----------------
A0YMQ9_LYNSP/24-245ATS-----------------
Q113R6_TRIEI/12-233ATG-----------------
Q8YQ81_NOSS1/13-234ATS-----------------
A0ZJY3_NODSP/15-236ATS-----------------
Q9ALA6_SYNE7/12-229..P-----------------
Q2JR62_SYNJA/13-234AAS-----------------
Q7V3C9_PROMP/9-231VTT-----------------
Q31D33_PROM9/9-231VKT-----------------
A3Z341_9SYNE/15-237GMV-----------------
A9BD06_PROM4/12-234SEV-----------------
A2BZX4_PROM1/12-234AQR-----------------
Q1N166_9GAMM/3-185VSI-----------------
A4BAE5_9GAMM/3-182LPL-----------------
A0YFY7_9GAMM/3-183VSA-----------------
A8FT27_SHESH/3-183VSV-----------------
Q1MDD4_RHIL3/3-191VSP-----------------
A9CI20_AGRT5/3-191VQP-----------------
Q92UK4_RHIME/3-191VQP-----------------
A0NMT3_9RHOB/3-193VPV-----------------
A3WZG1_9BRAD/2-188VPV-----------------
Q89MZ5_BRAJA/5-191VPV-----------------
Q2IXB1_RHOP2/5-191VPV-----------------
Q07LA3_RHOP5/5-191VPV-----------------
A7IF98_XANP2/3-187VPV-----------------
A9W8R2_METEP/3-196VAA-----------------
B0UL45_METS4/3-192VAV-----------------
Q0C445_HYPNA/3-190MPA-----------------
Q3JDP5_NITOC/3-187VKP-----------------
A6FBV0_9GAMM/3-187IAP-----------------
Q9AAA0_CAUCR/3-186VSP-----------------
Q11KH3_MESSB/3-188VSP-----------------
Q1YKP8_MOBAS/14-200VAP-----------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window