Sequence alignment for CL0115

PF04140

Q9EWQ7_STRCO/75-167--------------------------------------------------------------------------------
Q99YI2_STRP1/81-173--------------------------------------------------------------------------------
P91402_CAEEL/171-267--------------------------------------------------------------------------------
Q9KF68_BACHD/72-166--------------------------------------------------------------------------------
MAM4_SCHPO/121-215--------------------------------------------------------------------------------
Q9CM58_PASMU/75-167--------------------------------------------------------------------------------
ICMT_HUMAN/161-257--------------------------------------------------------------------------------
STE14_YEAST/123-219--------------------------------------------------------------------------------
Q9RTL5_DEIRA/91-184--------------------------------------------------------------------------------
B6IT05_RHOCS/73-163--------------------------------------------------------------------------------
F7EBZ7_XENTR/175-268--------------------------------------------------------------------------------
Q2G1E3_STAA8/100-189--------------------------------------------------------------------------------

PF04191

A4HJV7_LEIBR/438-543--------------------------------------------------------------------------------
PEMT_HUMAN/89-192--------------------------------------------------------------------------------
CHO2_ASPCL/504-608--------------------------------------------------------------------------------
A1CQK4_ASPCL/70-170--------------------------------------------------------------------------------
A3CKP0_STRSV/68-171--------------------------------------------------------------------------------
A3LQ40_PICST/106-209--------------------------------------------------------------------------------
CHO2_PICST/449-558--------------------------------------------------------------------------------
A4HJL2_LEIBR/106-210--------------------------------------------------------------------------------
CHO2_MAGO7/497-601--------------------------------------------------------------------------------
CHO2_PICGU/462-570--------------------------------------------------------------------------------
CHO2_LODEL/480-589--------------------------------------------------------------------------------
A5UZK8_ROSS1/43-144--------------------------------------------------------------------------------
A7TIE1_VANPO/140-243--------------------------------------------------------------------------------
CHO22_VANPO/452-560--------------------------------------------------------------------------------
CHO21_VANPO/439-547--------------------------------------------------------------------------------
A8NIW8_COPC7/92-195--------------------------------------------------------------------------------
CHO2_MALGO/537-642--------------------------------------------------------------------------------
A8PVU2_MALGO/102-205--------------------------------------------------------------------------------
A9B4Y9_HERA2/33-137--------------------------------------------------------------------------------
A9V3D6_MONBE/125-229--------------------------------------------------------------------------------
CHO2_LACBS/492-596--------------------------------------------------------------------------------
B1MLL6_MYCA9/108-208--------------------------------------------------------------------------------
B1WZT5_CYAA5/96-194--------------------------------------------------------------------------------
B2AR50_PODAN/95-198--------------------------------------------------------------------------------
CHO2_PODAN/496-600--------------------------------------------------------------------------------
B2JAT8_NOSP7/42-145--------------------------------------------------------------------------------
B2VTC6_PYRTR/87-190--------------------------------------------------------------------------------
CHO2_PYRTR/425-530--------------------------------------------------------------------------------
B3RI13_TRIAD/89-192--------------------------------------------------------------------------------
CHO2_SCHJY/478-583--------------------------------------------------------------------------------
B6QQY2_PENMQ/89-189--------------------------------------------------------------------------------
B8LBH8_THAPS/30-132--------------------------------------------------------------------------------
B8PB22_POSPM/91-194--------------------------------------------------------------------------------
CHO2_PICPG/450-564--------------------------------------------------------------------------------
C4R5S7_PICPG/98-201--------------------------------------------------------------------------------
CHO2_CLAL4/444-555--------------------------------------------------------------------------------
C5DC91_LACTC/106-209--------------------------------------------------------------------------------
CHO2_LACTC/450-558--------------------------------------------------------------------------------
C5DZ83_ZYGRC/102-205--------------------------------------------------------------------------------
CHO2_ZYGRC/430-538--------------------------------------------------------------------------------
C5G0L0_ARTOC/115-215--------------------------------------------------------------------------------
C6WWJ2_METML/43-146--------------------------------------------------------------------------------
C7YM51_NECH7/94-197--------------------------------------------------------------------------------
CHO2_NECH7/505-609--------------------------------------------------------------------------------
CHO2_SORMK/496-600--------------------------------------------------------------------------------
E3I110_RHOVT/77-175--------------------------------------------------------------------------------
D2U841_XANAP/75-178--------------------------------------------------------------------------------
D2V512_NAEGR/65-168--------------------------------------------------------------------------------
D2VYZ6_NAEGR/455-563--------------------------------------------------------------------------------
D3AX06_POLPA/89-193--------------------------------------------------------------------------------
D3BED6_POLPA/557-662--------------------------------------------------------------------------------
D3BN57_POLPA/99-202--------------------------------------------------------------------------------
CHO2_SCHPO/491-596--------------------------------------------------------------------------------
CHO1_SCHPO/110-213--------------------------------------------------------------------------------
Q01DA1_OSTTA/648-751--------------------------------------------------------------------------------
Q0AM70_MARMM/72-173--------------------------------------------------------------------------------
Q0AQW8_MARMM/72-173--------------------------------------------------------------------------------
CHO2_PHANO/462-567--------------------------------------------------------------------------------
Q0UN81_PHANO/69-173--------------------------------------------------------------------------------
Q11IW9_CHESB/45-148--------------------------------------------------------------------------------
Q1GIY9_RUEST/78-176--------------------------------------------------------------------------------
Q4P2D8_USTMA/99-202--------------------------------------------------------------------------------
Q4PA66_USTMA/318-424--------------------------------------------------------------------------------
PEMTL_DICDI/82-186--------------------------------------------------------------------------------
PEM2_DICDI/98-201--------------------------------------------------------------------------------
Q6C649_YARLI/97-200--------------------------------------------------------------------------------
CHO2_YARLI/531-635--------------------------------------------------------------------------------
CHO2_KLULA/451-559--------------------------------------------------------------------------------
Q6CV75_KLULA/106-209--------------------------------------------------------------------------------
Q6FUV4_CANGA/106-209--------------------------------------------------------------------------------
CHO2_CANGA/431-540--------------------------------------------------------------------------------
Q752Z0_ASHGO/100-203--------------------------------------------------------------------------------
Q7ZVZ2_DANRE/120-223--------------------------------------------------------------------------------
Q86IF9_DICDI/521-626--------------------------------------------------------------------------------
Q8TN26_METAC/121-221--------------------------------------------------------------------------------
Q98I61_RHILO/42-146--------------------------------------------------------------------------------
E7QGU3_YEASZ/100-199--------------------------------------------------------------------------------
F1SB04_PIG/61-160--------------------------------------------------------------------------------
F7BHJ5_XENTR/62-163--------------------------------------------------------------------------------
G1MZ29_MELGA/96-197--------------------------------------------------------------------------------
CHO2_YEAST/471-577--------------------------------------------------------------------------------
CHO2_CANAL/468-576--------------------------------------------------------------------------------
Q5KDE7_CRYNJ/618-724--------------------------------------------------------------------------------
Q5KHK0_CRYNJ/121-221--------------------------------------------------------------------------------
Q8DW48_STRMU/70-169--------------------------------------------------------------------------------
Q8PE74_XANCP/100-199--------------------------------------------------------------------------------

PF07298

B2JUD7_BURP8/3-190ILILGLLIFLGGHSVRIFAEGW---------------------------------------------RKATI.ERMGAKN
A1VI53_POLNA/3-190MLILGLVLFLGVHSTRIVADGW---------------------------------------------RTAMI.GRLGEKR
Q12HL7_POLSJ/3-190VLILGLILFLGVHSTRIVADGW---------------------------------------------RTQMI.AKVGEKP
A2SBS8_METPP/3-190VLILGLVLFLGTHSVRIFAEPW---------------------------------------------RTRTL.ARVGEAR
Q223I4_ALBFT/3-190YLILGLIVFLGVHSVRIVADDW---------------------------------------------RTQTR.ARIGPLA
A1K5T7_AZOSB/6-191VLVLGLLLFLGPHSLRIFADDW---------------------------------------------RHRRV.AALGEKR
A1WT38_HALHL/3-190ILLLGLILFLGTHSVRVVADDW---------------------------------------------RSNQI.AAYGEIP
A6VV32_MARMS/3-191ILVMGLVIFFFVHSVRLVAPNW---------------------------------------------REKSM.AIHGEMR
Q0AQE8_MARMM/3-183VLTAGLVLFLGVHCLRL.VPGL---------------------------------------------RDTLQ.ARLGATP
A1AZI2_PARDP/3-180ILILGLALWWGAHLFKRLAPQR---------------------------------------------R.....AVMGDRG
Q28U80_JANSC/6-185LLIAGLALWVAAHAWKRVAPAH---------------------------------------------R.....ASFGDKG
Q5LXD7_RUEPO/5-179LLILGIAVWWAAHLFKRAMPAR---------------------------------------------R.....AAMGDRG
Q1GLH3_RUEST/3-179LLILGIILWWGAHLFKRVAPAQ---------------------------------------------R.....ASLGDKG
A8LJK3_DINSH/5-184VLIAGLALWAGAHYFKRLMPAQ---------------------------------------------R.....AAMGDKG
Q169U5_ROSDO/3-182LLIAGLILWIAAHYFKRLMPQQ---------------------------------------------R.....AAMGNAG
A0KG00_AERHH/3-186LLTLGVLLFTLIHLYPCFAGAH---------------------------------------------RARLR.ERLGENR
Q6N9Q3_RHOPA/31-253EFVAAFAVFLLSHAIPA.RPAV---------------------------------------------RARLV.GALGERG
Q219Y9_RHOPB/14-236EFIAAFAVFLASHAVPS.RPAV---------------------------------------------RAAMV.ARLGERG
Q5LUC0_RUEPO/7-220EFVAALAVFLLSHVIPV.RPPV---------------------------------------------RPWLV.ARLGARG
Q0C1Y5_HYPNA/14-233EFLGAALVFLVSHALPA.RPGI---------------------------------------------RIRLV.SLLGRWA
Q169M4_ROSDO/6-220TFAGVFALFFATHSIPV.RPPV---------------------------------------------KKRLV.RHLGAKG
A8LNX8_DINSH/42-256EFILAFTVFFLSHGVPV.RPPM---------------------------------------------RPWLE.ARLGARG
A9CGK0_AGRT5/3-221ELVAALSLFVALHSVPA.VPAV---------------------------------------------RGRLI.AAVGRPA
Q2JYB9_RHIEC/5-223EFLAAFALFVALHSIPA.VPTI---------------------------------------------RAEII.RRVGRPV
Q92Z13_RHIME/3-221EFLLALFVFLTLHSIPA.IPAI---------------------------------------------RERLL.FLLGRAG
B0U8Q9_METS4/2-221EFAAALATFLVAHSVPA.VPRL---------------------------------------------RGRLV.ARLGRRA
Q2VYZ8_MAGSA/17-229HLVLSVAAFLGAHSLSN.WKPL---------------------------------------------RGPIE.ARYGKAG
Q60BH7_METCA/3-224NLALAMLFFVGIHFLIS.GTSL---------------------------------------------RDRLV.AYRGEQA
A7HZ42_PARL1/3-227QLWAAAAFFLGIHLVIA.GSGA---------------------------------------------RGRIV.ATIGERA
Q1GUJ7_SPHAL/6-226LLITTCVLFVGTHLLM..SHPL---------------------------------------------RAGLA.SRLGERG
Q2GC12_NOVAD/7-219PLAAATSCFVGSHFLL..SGPL---------------------------------------------RRVIA.KSLGRPT
Q8DMH0_THEEB/15-236IMVGLLLLFAIAHSG...LASL---------------------------------------------RPWAE.KRLGARL
Q113R6_TRIEI/12-233IILGLLLSFAIAHSG...LAAL---------------------------------------------RSWAE.NKIGPRL
Q8YQ81_NOSS1/13-234VMLGLQLTFAIAHSG...GAAL---------------------------------------------RPWAE.KYTGPRL
Q9ALA6_SYNE7/12-229IMLALLLLFAIAHSG...LAAL---------------------------------------------RPWGE.TKIGARG
Q7V3C9_PROMP/9-231LILGLILIFAVIHSG...GAAL---------------------------------------------RSRAE.AFMGARL
A9CI20_AGRT5/3-191FLVLCLALFLLTHLLKVVAPQF---------------------------------------------RARMI.AAMGEGP
Q92UK4_RHIME/3-191ILVLGIIIFLGMHLVRVVAPGF---------------------------------------------RAGII.DSRGKGT
Q89MZ5_BRADU/5-191VMILGLVLFFAAHVFTT.KREA---------------------------------------------RAQAI.ARLGEGT
A7IF98_XANP2/3-187MMLFGLLVFLGIHVVGS.LRGL---------------------------------------------RAKLI.AQVGEAA
B0UL45_METS4/3-192VLLLGLALFLGTHAFTM.LRGP---------------------------------------------RAALI.ARVGEGP
Q0C445_HYPNA/3-190YLILGLIIFFGAHLFSAFRSRA---------------------------------------------PGRDIREKLGYGP
Q3JDP5_NITOC/3-187QFLLGLALFFGMHSISIVALPL---------------------------------------------RDQL..AAKSEIG
Q9AAA0_CAUCR/3-186ILVLGLVLFLGIHSVRILAAPL---------------------------------------------RDAQV.AA.NPKR
Q11KH3_CHESB/3-188VLVLGLVLFLGVHSVRIAAPQF---------------------------------------------RDRVV.GSRGLGA
B4EFU3_BURCJ/3-190VLILGLAIFLGVHSVRIVADGW---------------------------------------------RSATI.DRIGEKG
C5B332_METEA/3-195VMILGLVLFLGTHAFSM.ARAK---------------------------------------------RGEVI.GRIGEGR
Q2JMU2_SYNJB/23-239..LALILGFACAHSG...LAYL---------------------------------------------RPWGE.SRLGSRL
Q2K5L0_RHIEC/3-191LLIVGIILFLGVHLVRVVAPDL---------------------------------------------RRSMI.ASLGEKG
Q3SR07_NITWN/1-185.MIAGLVLSLGVHLVVT.RREF---------------------------------------------RARLI.SSYGEGP
Q46HM6_PROMT/12-228VMILLLFCFAVIHSG...GAAL---------------------------------------------RVKAE.SVIGARA
Q63MK0_BURPS/3-190VLILGLVIFLGTHSIRLVAGDW---------------------------------------------RAAQI.ATLGEPR

PF02544

Q19605_CAEEL/97-243------------------TKSP-------------------------------------------------------VAI
YN67_SCHPO/146-295------------------ATMP-------------------------------------------------------LRN
Q20344_CAEEL/97-243------------------TKSP-------------------------------------------------------LLI
S5A1_RAT/110-259------------------KPTL-------------------------------------------------------LVT
S5A2_HUMAN/105-254------------------RPYP-------------------------------------------------------AIL
PORED_CAEEL/189-309------------------DDIS-------------------------------------------------------LTQ
Q23431_CAEEL/103-253------------------NQSP-------------------------------------------------------VKI
DET2_ARATH/111-262------------------NGFP-------------------------------------------------------ITI
TSC13_YEAST/154-310------------------ATMP-------------------------------------------------------IFN
S5A1_HUMAN/110-259------------------KPMP-------------------------------------------------------LLA

PF06966

YJD4_SCHPO/67-320--------LWGVSVWTKNTSQV-------------------------------------------------------DRL
Q10E47_ORYSJ/24-252--------FFIITALLRFDKVT-------------------------------------------------------DFA
Q8PAZ9_XANCP/20-250--------GWLWQRRSGNAGPV-------------------------------------------------------DVL
Q9A3U2_CAUCR/70-299--------LWAVSLRTKDVSFI-------------------------------------------------------DAW
Q9VSM5_DROME/25-264--------FFLINSVLQMDKLT-------------------------------------------------------DFA
Q9CHY6_LACLA/17-245--------WFLIATSKKNYGLI-------------------------------------------------------DIA
Q7CY59_AGRT5/19-248--------AWALQRATGSSGWI-------------------------------------------------------DTV
O81042_ARATH/64-303--------FWVIGLLQSSHWMI-------------------------------------------------------DVY
O53731_MYCTU/17-243--------AFAIGRRIGRYNVV-------------------------------------------------------DVV
Q8Y9D9_LISMO/16-244--------WFIISKIKGKYSLV-------------------------------------------------------DIA
Q984A1_RHILO/21-257--------AWLVAIRTGSSGWV-------------------------------------------------------DAI
B9DFE9_ARATH/24-252--------FFVITALFKFDQVT-------------------------------------------------------DFA

PF01222

LBR_CHICK/175-609EEIYAEKKIFEAIKTPEKPSSK....TKELEFGGRFGTFMLMFFLPATVLYLVLMCKQDDPSLMNFPPLPALESLWETKV
ERG24_NEUCR/17-490RQQHYEFGG.PIGAFGITFGLPILVHVFNLFCNDISGCPAPSLLHPKSLDLAQLKREIGWPDNGVFGL.....FSWSATL
STS1_SCHPO/7-453KSAPREFGG.AKGALAIMTGFP....CLMYYLWACSKFNDSQFIKPESFTIAGFQNFFRTLGHYIYVG...AY..PTRYA
ERG4_YEAST/34-473NEIEYEFGG.TTGVIGMLIGFP....LLMYYMWICAEFYHGKVALPKAG..ESWMHFIKHLYQLVLEN...GI..PEKYD
ERG24_YEAST/8-438RTTEFEFGG.LIGALGISIGLP....VFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKP..LRYYLG........NREL

PF04140

Q9EWQ7_STRCO/75-167---------MLAL..-----------------------------------------------------------------
Q99YI2_STRP1/81-173---------LLLM..-----------------------------------------------------------------
P91402_CAEEL/171-267---------WIGTLG-----------------------------------------------------------------
Q9KF68_BACHD/72-166---------AIPFAW-----------------------------------------------------------------
MAM4_SCHPO/121-215---------ALGF.L-----------------------------------------------------------------
Q9CM58_PASMU/75-167---------LAIL..-----------------------------------------------------------------
ICMT_HUMAN/161-257---------VTGLLM-----------------------------------------------------------------
STE14_YEAST/123-219---------VLGCLL-----------------------------------------------------------------
Q9RTL5_DEIRA/91-184---------ALLL..-----------------------------------------------------------------
B6IT05_RHOCS/73-163---------.LAL..-----------------------------------------------------------------
F7EBZ7_XENTR/175-268---------.LIM..-----------------------------------------------------------------
Q2G1E3_STAA8/100-189---------.V.I..-----------------------------------------------------------------

PF04191

A4HJV7_LEIBR/438-543------FVMMVGMLL-----------------------------------------------------------------
PEMT_HUMAN/89-192------AYSL.GLAL-----------------------------------------------------------------
CHO2_ASPCL/504-608------LRHVLGAGL-----------------------------------------------------------------
A1CQK4_ASPCL/70-170------L....GAVL-----------------------------------------------------------------
A3CKP0_STRSV/68-171------LTIYLGILI-----------------------------------------------------------------
A3LQ40_PICST/106-209------VKAA.AVAT-----------------------------------------------------------------
CHO2_PICST/449-558------LRVFVGLLL-----------------------------------------------------------------
A4HJL2_LEIBR/106-210------MRGT.GTAL-----------------------------------------------------------------
CHO2_MAGO7/497-601------LKHVTGTGL-----------------------------------------------------------------
CHO2_PICGU/462-570------LRSFLGALL-----------------------------------------------------------------
CHO2_LODEL/480-589------LRIFIGTLL-----------------------------------------------------------------
A5UZK8_ROSS1/43-144------GALIVGVVL-----------------------------------------------------------------
A7TIE1_VANPO/140-243------VKMV.GVTL-----------------------------------------------------------------
CHO22_VANPO/452-560------TQIIFGGIL-----------------------------------------------------------------
CHO21_VANPO/439-547------SHVIFGLLL-----------------------------------------------------------------
A8NIW8_COPC7/92-195------ASKI.AVVL-----------------------------------------------------------------
CHO2_MALGO/537-642------LRYVLGVLL-----------------------------------------------------------------
A8PVU2_MALGO/102-205------VRVL.AVVL-----------------------------------------------------------------
A9B4Y9_HERA2/33-137------PFNWLGLVI-----------------------------------------------------------------
A9V3D6_MONBE/125-229------IFFAVGAAT-----------------------------------------------------------------
CHO2_LACBS/492-596------LRHTLGALL-----------------------------------------------------------------
B1MLL6_MYCA9/108-208------WLVIVGEVL-----------------------------------------------------------------
B1WZT5_CYAA5/96-194------FRLIIGGIL-----------------------------------------------------------------
B2AR50_PODAN/95-198------VTYA.AYAL-----------------------------------------------------------------
CHO2_PODAN/496-600------LKHVIGVSL-----------------------------------------------------------------
B2JAT8_NOSP7/42-145------VALALGVLA-----------------------------------------------------------------
B2VTC6_PYRTR/87-190------IKYS.AIPL-----------------------------------------------------------------
CHO2_PYRTR/425-530------FRHVLGAGM-----------------------------------------------------------------
B3RI13_TRIAD/89-192------FKFI.GTAL-----------------------------------------------------------------
CHO2_SCHJY/478-583------FRHVLGLTF-----------------------------------------------------------------
B6QQY2_PENMQ/89-189------I....AYGL-----------------------------------------------------------------
B8LBH8_THAPS/30-132------ITTFLGPSM-----------------------------------------------------------------
B8PB22_POSPM/91-194------DTLV.PAAL-----------------------------------------------------------------
CHO2_PICPG/450-564------LRFILAALM-----------------------------------------------------------------
C4R5S7_PICPG/98-201------FRYL.GIAS-----------------------------------------------------------------
CHO2_CLAL4/444-555------LRIFLGLLL-----------------------------------------------------------------
C5DC91_LACTC/106-209------VRKA.GMVL-----------------------------------------------------------------
CHO2_LACTC/450-558------TQIIFGFLL-----------------------------------------------------------------
C5DZ83_ZYGRC/102-205------IAVA.GRFL-----------------------------------------------------------------
CHO2_ZYGRC/430-538------TQFIFGLLL-----------------------------------------------------------------
C5G0L0_ARTOC/115-215------L....AYGL-----------------------------------------------------------------
C6WWJ2_METML/43-146------VCREVGVLL-----------------------------------------------------------------
C7YM51_NECH7/94-197------VQAA.ALTL-----------------------------------------------------------------
CHO2_NECH7/505-609------LKHVLGAGL-----------------------------------------------------------------
CHO2_SORMK/496-600------LKHVVGLGL-----------------------------------------------------------------
E3I110_RHOVT/77-175------WRFLAGMIC-----------------------------------------------------------------
D2U841_XANAP/75-178------PARWLGCAL-----------------------------------------------------------------
D2V512_NAEGR/65-168------IMYG.GYAL-----------------------------------------------------------------
D2VYZ6_NAEGR/455-563------TQLVAGIIL-----------------------------------------------------------------
D3AX06_POLPA/89-193------ATLL.GNSC-----------------------------------------------------------------
D3BED6_POLPA/557-662------WRQIIGILL-----------------------------------------------------------------
D3BN57_POLPA/99-202------LQTV.SYAL-----------------------------------------------------------------
CHO2_SCHPO/491-596------LRHALGFGL-----------------------------------------------------------------
CHO1_SCHPO/110-213------VQGI.AKLI-----------------------------------------------------------------
Q01DA1_OSTTA/648-751------QFDPISIIM-----------------------------------------------------------------
Q0AM70_MARMM/72-173------ISLALGGGL-----------------------------------------------------------------
Q0AQW8_MARMM/72-173------VSLAAGGLL-----------------------------------------------------------------
CHO2_PHANO/462-567------LRHVLGAGL-----------------------------------------------------------------
Q0UN81_PHANO/69-173------SSNTLPIPL-----------------------------------------------------------------
Q11IW9_CHESB/45-148------ILFAAGWLI-----------------------------------------------------------------
Q1GIY9_RUEST/78-176------LRYAVGLPL-----------------------------------------------------------------
Q4P2D8_USTMA/99-202------VKPV.AALL-----------------------------------------------------------------
Q4PA66_USTMA/318-424------LRHTLGLLL-----------------------------------------------------------------
PEMTL_DICDI/82-186------ANMI.GDSC-----------------------------------------------------------------
PEM2_DICDI/98-201------VEVL.SYIL-----------------------------------------------------------------
Q6C649_YARLI/97-200------VKPL.AIVL-----------------------------------------------------------------
CHO2_YARLI/531-635------LKYILGALL-----------------------------------------------------------------
CHO2_KLULA/451-559------NTITFGLLL-----------------------------------------------------------------
Q6CV75_KLULA/106-209------FTYV.GIAY-----------------------------------------------------------------
Q6FUV4_CANGA/106-209------ITNI.GYAF-----------------------------------------------------------------
CHO2_CANGA/431-540------SQIIFGLIC-----------------------------------------------------------------
Q752Z0_ASHGO/100-203------VRYA.GAGL-----------------------------------------------------------------
Q7ZVZ2_DANRE/120-223------VYYA.GAAL-----------------------------------------------------------------
Q86IF9_DICDI/521-626------WRQILGLML-----------------------------------------------------------------
Q8TN26_METAC/121-221------YIVIAGDML-----------------------------------------------------------------
Q98I61_RHILO/42-146------GFVPVGGVL-----------------------------------------------------------------
E7QGU3_YEASZ/100-199------....LGVAL-----------------------------------------------------------------
F1SB04_PIG/61-160------....LGLAL-----------------------------------------------------------------
F7BHJ5_XENTR/62-163------..YYLSWML-----------------------------------------------------------------
G1MZ29_MELGA/96-197------..HYSGLAI-----------------------------------------------------------------
CHO2_YEAST/471-577------.QLIFGLIL-----------------------------------------------------------------
CHO2_CANAL/468-576------LRVFLGLLL-----------------------------------------------------------------
Q5KDE7_CRYNJ/618-724------LRHVLGLSL-----------------------------------------------------------------
Q5KHK0_CRYNJ/121-221------...AAAIAL-----------------------------------------------------------------
Q8DW48_STRMU/70-169------..IYLGILL-----------------------------------------------------------------
Q8PE74_XANCP/100-199------....GACAL-----------------------------------------------------------------

PF07298

B2JUD7_BURP8/3-190WKAAYSVVSLVGLVL-----------------------------------------------------------------
A1VI53_POLNA/3-190WKGLYALVSLVGFGL-----------------------------------------------------------------
Q12HL7_POLSJ/3-190WKGVYALLSIAGFVL-----------------------------------------------------------------
A2SBS8_METPP/3-190WKAAYAVVSLIGFVL-----------------------------------------------------------------
Q223I4_ALBFT/3-190WKGLYSVLSLLGFAL-----------------------------------------------------------------
A1K5T7_AZOSB/6-191WKGIYAAVAAVGLVL-----------------------------------------------------------------
A1WT38_HALHL/3-190WKTAYSALSLVGLII-----------------------------------------------------------------
A6VV32_MARMS/3-191WKMRFGMITLIAVGL-----------------------------------------------------------------
Q0AQE8_MARMM/3-183YKLTYTVISLIGFGL-----------------------------------------------------------------
A1AZI2_PARDP/3-180.KGVVAGLLALSVVL-----------------------------------------------------------------
Q28U80_JANSC/6-185.KGIVAGLVVLSVIL-----------------------------------------------------------------
Q5LXD7_RUEPO/5-179.KGMVALALLGSVVL-----------------------------------------------------------------
Q1GLH3_RUEST/3-179.RGLVALVLLVSVVL-----------------------------------------------------------------
A8LJK3_DINSH/5-184.KAVVAVAIVASIVL-----------------------------------------------------------------
Q169U5_ROSDO/3-182.KGGVAVAIIASLVL-----------------------------------------------------------------
A0KG00_AERHH/3-186YKGLFSLLVFIAIAC-----------------------------------------------------------------
Q6N9Q3_RHOPA/31-253FLIAYSIESLLVLTW-----------------------------------------------------------------
Q219Y9_RHOPB/14-236FLALYSGVSLLVLAW-----------------------------------------------------------------
Q5LUC0_RUEPO/7-220FGIAYSLFSIAVLGW-----------------------------------------------------------------
Q0C1Y5_HYPNA/14-233YLALYSAVSLALFAW-----------------------------------------------------------------
Q169M4_ROSDO/6-220FTTAYSALSLCILAL-----------------------------------------------------------------
A8LNX8_DINSH/42-256FTLAYSALSLGVLAW-----------------------------------------------------------------
A9CGK0_AGRT5/3-221YLGAYSVVSLLTLSW-----------------------------------------------------------------
Q2JYB9_RHIEC/5-223YFVGYSAASTLALIW-----------------------------------------------------------------
Q92Z13_RHIME/3-221YFSLYSFASILALAW-----------------------------------------------------------------
B0U8Q9_METS4/2-221YLVAYSALSLALLAW-----------------------------------------------------------------
Q2VYZ8_MAGSA/17-229FYAGYSVVSTILLVW-----------------------------------------------------------------
Q60BH7_METCA/3-224FRAAFSVLSLLALGW-----------------------------------------------------------------
A7HZ42_PARL1/3-227WLALFSLASIAGISW-----------------------------------------------------------------
Q1GUJ7_SPHAL/6-226FQIVYSIVAIATFIL-----------------------------------------------------------------
Q2GC12_NOVAD/7-219YLTIYSLVAIATLTW-----------------------------------------------------------------
Q8DMH0_THEEB/15-236YRIFFASVSLPLATI-----------------------------------------------------------------
Q113R6_TRIEI/12-233YRILFALVSLPLAVI-----------------------------------------------------------------
Q8YQ81_NOSS1/13-234YRIFFALVSLPLAVI-----------------------------------------------------------------
Q9ALA6_SYNE7/12-229YRILFALVSLPLAVV-----------------------------------------------------------------
Q7V3C9_PROMP/9-231WRLLFVSLSLPSALI-----------------------------------------------------------------
A9CI20_AGRT5/3-191FKGVYSLVSLITLGL-----------------------------------------------------------------
Q92UK4_RHIME/3-191WMGLYTIVSLVGLCL-----------------------------------------------------------------
Q89MZ5_BRADU/5-191YKILYALVSLAGLAL-----------------------------------------------------------------
A7IF98_XANP2/3-187YKGFFSLLAISGLLL-----------------------------------------------------------------
B0UL45_METS4/3-192YKLGYSVLALVGLIV-----------------------------------------------------------------
Q0C445_HYPNA/3-190YMGLYTLVSAVGLGL-----------------------------------------------------------------
Q3JDP5_NITOC/3-187WKILYGSVSLIGIIL-----------------------------------------------------------------
Q9AAA0_CAUCR/3-186WRGLYSLVAAAGLGL-----------------------------------------------------------------
Q11KH3_CHESB/3-188WKGIYSLAAFLGLVL-----------------------------------------------------------------
B4EFU3_BURCJ/3-190WKGGYAIASIVGFVL-----------------------------------------------------------------
C5B332_METEA/3-195FKLGYTLLSVLGLIL-----------------------------------------------------------------
Q2JMU2_SYNJB/23-239YRIFFALVSLSLAPL-----------------------------------------------------------------
Q2K5L0_RHIEC/3-191WRAGYSIASILTLIL-----------------------------------------------------------------
Q3SR07_NITWN/1-185YKIGFSLISAVGVAL-----------------------------------------------------------------
Q46HM6_PROMT/12-228WRLIFAFASIPSAVI-----------------------------------------------------------------
Q63MK0_BURPS/3-190WKGIYALASVIGFAL-----------------------------------------------------------------

PF02544

Q19605_CAEEL/97-243VAAATF.FCAYNGFL-----------------------------------------------------------------
YN67_SCHPO/146-295IFKNCAHYHLLSGLF-----------------------------------------------------------------
Q20344_CAEEL/97-243VAAAVA.FCTYNGTL-----------------------------------------------------------------
S5A1_RAT/110-259FVLAFL.FCTFNGYV-----------------------------------------------------------------
S5A2_HUMAN/105-254ILRGTA.FCTGNGVL-----------------------------------------------------------------
PORED_CAEEL/189-309WAGAVL.FWICN...-----------------------------------------------------------------
Q23431_CAEEL/103-253VIMAFG.FSVLNGFI-----------------------------------------------------------------
DET2_ARATH/111-262AALAFT.FNLLNGYI-----------------------------------------------------------------
TSC13_YEAST/154-310LFKNCFHYWVLSGLI-----------------------------------------------------------------
S5A1_HUMAN/110-259CTMAIM.FCTCNGYL-----------------------------------------------------------------

PF06966

YJD4_SCHPO/67-320WPILPTAFSLHFLFYG....LGYNIASRR---------------------------------------------------
Q10E47_ORYSJ/24-252GSTNFIILAILTLAL......KGA.WHFR---------------------------------------------------
Q8PAZ9_XANCP/20-250WAGCLAVAAPYCAWM......SEG.ALLP---------------------------------------------------
Q9A3U2_CAUCR/70-299WGPSMALLAWSTLL.......QGA.HTPH---------------------------------------------------
Q9VSM5_DROME/25-264GGVNFIIISLLTFFLGQIDRPSKA.YDSR---------------------------------------------------
Q9CHY6_LACLA/17-245WGGGFVLTAVVSYLF......SPR.ITIQ---------------------------------------------------
Q7CY59_AGRT5/19-248WSASVGLGGVLAVLF......AEG.DGWR---------------------------------------------------
O81042_ARATH/64-303WTVIPVMLVHYFASH.....PLSQYNKLR---------------------------------------------------
O53731_MYCTU/17-243WGLGFVAVAVAAATL......GHG.DPVR---------------------------------------------------
Q8Y9D9_LISMO/16-244WGGGFVVVAWTGFLT......TFS.VTTQ---------------------------------------------------
Q984A1_RHILO/21-257WSFAVGIIGAFLALVP....FVEGDNDHR---------------------------------------------------
B9DFE9_ARATH/24-252GSTNFVILAVLTLVL......KAS.WHFR---------------------------------------------------

PF01222

LBR_CHICK/175-609FGVFLLWFFFQALFYLLPIGKVVEGLPLS..NPRKLQYRINGFYA...FLLTAAAIGTLLYFQ.FELHYLYDHFVQFAVS
ERG24_NEUCR/17-490WTLG..YYALSLVQYRFLPGHHVEGTELS..TGGRLKYKLNAFNSAMCTLAILAAGTIAQGAEFPVWTFISDNFAQIISA
STS1_SCHPO/7-453FLVFWSFCIVQAVMYLTLPGVRTQGLPLKHRNNERLPYLCNAIWS...FYTTIVILAVLHVTHVFPITTFIDMFGPLMSV
ERG4_YEAST/34-473WTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWT...LYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTC
ERG24_YEAST/8-438WTVYCLWYGILAVLDVILPGRVMKGVQLR..DGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCII

PF04140

Q9EWQ7_STRCO/75-167------------ALSAQALR--------------------------WWC----IATLG----------------------
Q99YI2_STRP1/81-173------------.LLSVAVL--------------------------YEV----TRILG----------------------
P91402_CAEEL/171-267------------CIIGEIFR--------------------------KVG----MVHAG----------------------
Q9KF68_BACHD/72-166------------FLFAQILR--------------------------LWA----LSSLG----------------------
MAM4_SCHPO/121-215------------.CLGQYLR--------------------------SSA----MVQAG----------------------
Q9CM58_PASMU/75-167------------.VFAIAML--------------------------FYV----IYELK----------------------
ICMT_HUMAN/161-257------------VVFGECLR--------------------------KAA----MFTAG----------------------
STE14_YEAST/123-219------------VILGQYTR--------------------------TIA----MHTAG----------------------
Q9RTL5_DEIRA/91-184------------FLALQPLR--------------------------YWV----MHTLG----------------------
B6IT05_RHOCS/73-163------------FVLLQAGR--------------------------VWV----VASLG----------------------
F7EBZ7_XENTR/175-268------------VLFGELLR--------------------------KCA----MLTAG----------------------
Q2G1E3_STAA8/100-189------------LIFAYIML--------------------------FMV----IKTLG----------------------

PF04191

A4HJV7_LEIBR/438-543------------VGINGYVS--------------------------WSI----YKAIG----------------------
PEMT_HUMAN/89-192------------LGLGVVLV--------------------------LSS----FFALG----------------------
CHO2_ASPCL/504-608------------ISLQIWTS--------------------------VSI----YESLG----------------------
A1CQK4_ASPCL/70-170------------FGIGSILV--------------------------LTS----MYALG----------------------
A3CKP0_STRSV/68-171------------SLAGFALR--------------------------VYA----VNYLG----------------------
A3LQ40_PICST/106-209------------FGLGNIFV--------------------------LTS----MYALG----------------------
CHO2_PICST/449-558------------IFTQSWIN--------------------------SSI----IDSIG----------------------
A4HJL2_LEIBR/106-210------------LLSGTTLV--------------------------VSS----FLRLG----------------------
CHO2_MAGO7/497-601------------VALQIWTA--------------------------VSI----YDELG----------------------
CHO2_PICGU/462-570------------ILTQVWIN--------------------------SSI----IDSIG----------------------
CHO2_LODEL/480-589------------IFTQTWIN--------------------------ASI----IDLIG----------------------
A5UZK8_ROSS1/43-144------------CGCGAMLA--------------------------GAG----LLHLG----------------------
A7TIE1_VANPO/140-243------------FGFGQLLV--------------------------LTS----MYQLG----------------------
CHO22_VANPO/452-560------------CAIQMWCN--------------------------SEI----RAAIS----------------------
CHO21_VANPO/439-547------------CAIQIWCN--------------------------VET----RDAIS----------------------
A8NIW8_COPC7/92-195------------FGLGQLFV--------------------------ITS----TWQLG----------------------
CHO2_MALGO/537-642------------ILVHMWSA--------------------------RSS----YRVLG----------------------
A8PVU2_MALGO/102-205------------IASGTVFV--------------------------LSS----MWMLG----------------------
A9B4Y9_HERA2/33-137------------GIAGLAVA--------------------------ISS----ARHFR----------------------
A9V3D6_MONBE/125-229------------VLVGTVLT--------------------------SAS----FIRLG----------------------
CHO2_LACBS/492-596------------VGLHVWAS--------------------------MES----FEVLG----------------------
B1MLL6_MYCA9/108-208------------TIGGLGMA--------------------------TLV----VAQNN----------------------
B1WZT5_CYAA5/96-194------------LISGFFLA--------------------------FWA----VKAIS----------------------
B2AR50_PODAN/95-198------------LALGNILV--------------------------ISS----TWQLG----------------------
CHO2_PODAN/496-600------------IALQLWTS--------------------------SSI----YESLG----------------------
B2JAT8_NOSP7/42-145------------IICAGLIV--------------------------TSA----FRTMN----------------------
B2VTC6_PYRTR/87-190------------FLMGNTLV--------------------------LTS----MWALG----------------------
CHO2_PYRTR/425-530------------IALQVWTA--------------------------MSI----YESLG----------------------
B3RI13_TRIAD/89-192------------MVVGTILV--------------------------LTS----YWRLG----------------------
CHO2_SCHJY/478-583------------IALHIYTS--------------------------VSI----FDDLG----------------------
B6QQY2_PENMQ/89-189------------FATGNVLV--------------------------LSS----MWALG----------------------
B8LBH8_THAPS/30-132------------ILLGLFIV--------------------------YKS----ASDLK----------------------
B8PB22_POSPM/91-194------------FAIGQVFV--------------------------VTS----TWALG----------------------
CHO2_PICPG/450-564------------ILGQFLTV--------------------------HQM----IDSIG----------------------
C4R5S7_PICPG/98-201------------FLFGNVLV--------------------------LSS----MWKLG----------------------
CHO2_CLAL4/444-555------------IITQVMIN--------------------------TSI----VDSIG----------------------
C5DC91_LACTC/106-209------------SAFGQVLV--------------------------ATS----MYQLG----------------------
CHO2_LACTC/450-558------------CWLQKWCD--------------------------DEI----LTAIS----------------------
C5DZ83_ZYGRC/102-205------------AIIGQVLV--------------------------ATS----MWKLR----------------------
CHO2_ZYGRC/430-538------------CAVQTWCN--------------------------AEI----RSAIS----------------------
C5G0L0_ARTOC/115-215------------FATGNVLV--------------------------LSS----MWALG----------------------
C6WWJ2_METML/43-146------------FVLSSFLA--------------------------RWS----FITMR----------------------
C7YM51_NECH7/94-197------------FAVGNVLV--------------------------VTS----TWRLG----------------------
CHO2_NECH7/505-609------------VALQLWTA--------------------------FSV----YDSLG----------------------
CHO2_SORMK/496-600------------IALQVWTA--------------------------TSI----YESLG----------------------
E3I110_RHOVT/77-175------------VVIGFGFT--------------------------IYG----YFDLG----------------------
D2U841_XANAP/75-178------------LIGGLALR--------------------------LWA----IRVLA----------------------
D2V512_NAEGR/65-168------------QVIGSLLV--------------------------MGA----YYQLG----------------------
D2VYZ6_NAEGR/455-563------------ILLNIYQS--------------------------TST----HEVLG----------------------
D3AX06_POLPA/89-193------------FIFGILLN--------------------------IWT----LYCLG----------------------
D3BED6_POLPA/557-662------------ILLNVWSS--------------------------VST----LEVLG----------------------
D3BN57_POLPA/99-202------------YAIGGILV--------------------------GAT----YYRLG----------------------
CHO2_SCHPO/491-596------------IALHIYTS--------------------------VSI----YEDLG----------------------
CHO1_SCHPO/110-213------------FCFGSVLV--------------------------LSS----MYKLG----------------------
Q01DA1_OSTTA/648-751------------IVCGYGLS--------------------------TSA----AVALG----------------------
Q0AM70_MARMM/72-173------------FLGGAYVI--------------------------FLG----RYAYG----------------------
Q0AQW8_MARMM/72-173------------LVAGAGVI--------------------------AAG----RIAYG----------------------
CHO2_PHANO/462-567------------LLLQLWTS--------------------------TSI----YDSLG----------------------
Q0UN81_PHANO/69-173------------FLTGNTLV--------------------------LTS----MYALG----------------------
Q11IW9_CHESB/45-148------------GLAGLSIN--------------------------IAA----LRRLR----------------------
Q1GIY9_RUEST/78-176------------MVMAFGIT--------------------------LWG----YRFLG----------------------
Q4P2D8_USTMA/99-202------------FASGNIFV--------------------------LSS----MWALG----------------------
Q4PA66_USTMA/318-424------------VALHVWTA--------------------------NSS----YEVLG----------------------
PEMTL_DICDI/82-186------------FIFGILLN--------------------------IWT----LKALG----------------------
PEM2_DICDI/98-201------------YGFGGILV--------------------------LAA----YLKLG----------------------
Q6C649_YARLI/97-200------------FAVGNVLV--------------------------LTS----MYALG----------------------
CHO2_YARLI/531-635------------IALHGWTS--------------------------KSI----HDSLG----------------------
CHO2_KLULA/451-559------------LAIQIWCN--------------------------TEI----FHSIK----------------------
Q6CV75_KLULA/106-209------------IAFGQLLV--------------------------LSS----MYQLG----------------------
Q6FUV4_CANGA/106-209------------LIVGQILV--------------------------ISS----MYQLG----------------------
CHO2_CANGA/431-540------------CALQIWCN--------------------------TEI----RSAIS----------------------
Q752Z0_ASHGO/100-203------------FVFGQVLV--------------------------LSS----MWRLG----------------------
Q7ZVZ2_DANRE/120-223------------MAVGSLLV--------------------------ISS----FLALG----------------------
Q86IF9_DICDI/521-626------------ILINLWSS--------------------------LST----FEVLG----------------------
Q8TN26_METAC/121-221------------VVLGYFLI--------------------------FLV----FRENP----------------------
Q98I61_RHILO/42-146------------IVAAAAVL--------------------------LHA----FARFA----------------------
E7QGU3_YEASZ/100-199------------FGLGQVLV--------------------------LSS----MYKLG----------------------
F1SB04_PIG/61-160------------LGVGSVFV--------------------------LSS----FLALG----------------------
F7BHJ5_XENTR/62-163------------IGAGGVLV--------------------------VSS----FLALG----------------------
G1MZ29_MELGA/96-197------------MAVGTLFV--------------------------ISS----FLALG----------------------
CHO2_YEAST/471-577------------VALQTWCD--------------------------KET----RLAIS----------------------
CHO2_CANAL/468-576------------IYTQFWIN--------------------------FSI----IDSIG----------------------
Q5KDE7_CRYNJ/618-724------------IALHIWSA--------------------------VSS----YEVLG----------------------
Q5KHK0_CRYNJ/121-221------------FASGQTFV--------------------------ITS----MWALG----------------------
Q8DW48_STRMU/70-169------------MILGIIFR--------------------------VYA----INYLG----------------------
Q8PE74_XANCP/100-199------------IAGGLGLR--------------------------VWA----IQVLA----------------------

PF07298

B2JUD7_BURP8/3-190------------IIWGYGIA--------------------------RRE.PVVLWTSP----------------------
A1VI53_POLNA/3-190------------VIWGFGLA--------------------------RQQ.PVQWWAPP----------------------
Q12HL7_POLSJ/3-190------------LVWGYGLA--------------------------RQS.PVVLWTPP----------------------
A2SBS8_METPP/3-190------------LAWGYGLA--------------------------RQQ.PVLLWTPP----------------------
Q223I4_ALBFT/3-190------------IVWGFGLA--------------------------RQQ.PVQLWSPP----------------------
A1K5T7_AZOSB/6-191------------VVWGYGLT--------------------------RDV.PVAIWSAP----------------------
A1WT38_HALHL/3-190------------AIYGYGLT--------------------------RVD.AVWVWMPP----------------------
A6VV32_MARMS/3-191------------IVMGYSQT--------------------------RLE.PVWLWFPP----------------------
Q0AQE8_MARMM/3-183------------IIYGKVIA--------------------------HPT..PSIWTTP----------------------
A1AZI2_PARDP/3-180------------MVVGYRQA--------------------------DGP...YWWGAS----------------------
Q28U80_JANSC/6-185------------MVIGYRGA--------------------------EGA...FYWGRS----------------------
Q5LXD7_RUEPO/5-179------------MVIGYRMT--------------------------DYI...HVWAPP----------------------
Q1GLH3_RUEST/3-179------------MVLGYRGT--------------------------EYI...HVWAPA----------------------
A8LJK3_DINSH/5-184------------MVIGYRGA--------------------------EFV...FLWSPP----------------------
Q169U5_ROSDO/3-182------------MVMGYRAA--------------------------EFI...PVWQPP----------------------
A0KG00_AERHH/3-186------------IIAGWRTA--------------------------SPL...PLYFLP----------------------
Q6N9Q3_RHOPA/31-253------------LIVATERA--------------------------PFV...ELWPFE----------------------
Q219Y9_RHOPB/14-236------------LIGAAGRA--------------------------PLL...PLWPFE----------------------
Q5LUC0_RUEPO/7-220------------LILAAARA--------------------------PYV...EVIPPL----------------------
Q0C1Y5_HYPNA/14-233------------LIIAAGRA--------------------------PYV...WLWFWG----------------------
Q169M4_ROSDO/6-220------------LIWAAGQA--------------------------PFV...LLWAEA----------------------
A8LNX8_DINSH/42-256------------LIGAAGRA--------------------------PFV...PLWDWA----------------------
A9CGK0_AGRT5/3-221------------VFHAALSV--------------------------DYI...PLWDVA----------------------
Q2JYB9_RHIEC/5-223------------VFSAALAL--------------------------DYI...PLWELT----------------------
Q92Z13_RHIME/3-221------------VLYAALDV--------------------------DHI...PLWQPS----------------------
B0U8Q9_METS4/2-221------------LIVAARRA--------------------------GTV...ALWEPA----------------------
Q2VYZ8_MAGSA/17-229------------VIAAALNS--------------------------PTV...VVWEQQ----------------------
Q60BH7_METCA/3-224------------VVFAYRQA--------------------------PYV...ETWGQL----------------------
A7HZ42_PARL1/3-227------------LAYSFNEA--------------------------VAGPNHLYWVPP----------------------
Q1GUJ7_SPHAL/6-226------------VVQAWRGM--------------------------PPE..PPLWPVG----------------------
Q2GC12_NOVAD/7-219------------AIVAFDRA--------------------------PAA..PALWDGT----------------------
Q8DMH0_THEEB/15-236------------LILYFLAH--------------------------RYD.GVQLWQLQ----------------------
Q113R6_TRIEI/12-233------------LIIYFFNH--------------------------RYD.GLQLWQLQ----------------------
Q8YQ81_NOSS1/13-234------------LIIYFFNH--------------------------RYD.GLQLWQVQ----------------------
Q9ALA6_SYNE7/12-229------------TISYFILH--------------------------RYD.GALLWQLQ----------------------
Q7V3C9_PROMP/9-231------------LISYFLAH--------------------------RYD.GIRLWNFQ----------------------
A9CI20_AGRT5/3-191------------VIYAFGEA--------------------------RQE.TGMLWNPP----------------------
Q92UK4_RHIME/3-191------------IIYGFSQA--------------------------RGE.TGMLYDPP----------------------
Q89MZ5_BRADU/5-191------------IIWGFGHY--------------------------RATGWIDVWYPP----------------------
A7IF98_XANP2/3-187------------TAYGFALW--------------------------RASGAPDLWDPP----------------------
B0UL45_METS4/3-192------------LGIGYGRY--------------------------RSEGYIDIWSPP----------------------
Q0C445_HYPNA/3-190------------FLWGFGAM--------------------------RPA..PILYTPP----------------------
Q3JDP5_NITOC/3-187------------ISRGYVDL--------------------------RQA.PTLLYVSP----------------------
Q9AAA0_CAUCR/3-186------------IIWGWIVY--------------------------RPA.APQLYDPP----------------------
Q11KH3_CHESB/3-188------------IVWGYWLA--------------------------RQN.PVVLYTPA----------------------
B4EFU3_BURCJ/3-190------------IIWGYGIA--------------------------RAG.ATLLWVSP----------------------
C5B332_METEA/3-195------------TIYGYGLY--------------------------RQEGMIPVWSPP----------------------
Q2JMU2_SYNJB/23-239------------LLIYFFNH--------------------------RYD.GVILWDLQ----------------------
Q2K5L0_RHIEC/3-191------------LIYGFGQA--------------------------RQV.TGMLYNPP----------------------
Q3SR07_NITWN/1-185------------TLWGFLSY--------------------------RATGVIDVWYPP----------------------
Q46HM6_PROMT/12-228------------LVGYFIAH--------------------------RYD.GFRFWNLQ----------------------
Q63MK0_BURPS/3-190------------IVWGYGLA--------------------------RAD.TASLWFPP----------------------

PF02544

Q19605_CAEEL/97-243-----------------QGY--------------------------WNAFYQP.....-----...EEPWTT--------
YN67_SCHPO/146-295-----------------LA.--------------------------.YFIYGPWH...-----...ANDYIK--------
Q20344_CAEEL/97-243-----------------QGV--------------------------WNSYYQL.....-----...EEELTY--------
S5A1_RAT/110-259-----------------QSR--------------------------YLSQFAVY....-----...AEDWVT--------
S5A2_HUMAN/105-254-----------------QGY--------------------------YLIYCAEY....-----...PDGWYT--------
PORED_CAEEL/189-309-----------------...--------------------------.WKQHQL.....-----...AEQIAN--------
Q23431_CAEEL/103-253-----------------QGT--------------------------WNAFYQPE....-----...FDTLHP--------
DET2_ARATH/111-262-----------------QAR--------------------------WVSHYKD..DYE-----...DGNWFW--------
TSC13_YEAST/154-310-----------------SFG--------------------------YFGYGFPFGNAK-----LFKYYSYLK--------
S5A1_HUMAN/110-259-----------------QSR--------------------------YLSHCAVY....-----...ADDWVT--------

PF06966

YJD4_SCHPO/67-320----LMIMAFLQTLWSARLT--------------------------YNYYRKGGYNRG-----.AEDYRWVRVRQIMPKW
Q10E47_ORYSJ/24-252----QVVLTVLVVIWGLRLG--------------------------LFLLMR.ILQWG-----..EDKRFDEMRDNLG..
Q8PAZ9_XANCP/20-250----RVLVAVLGGVWGARLA--------------------------WHLGVR.VFGDP-----.HEDGRYRALREHWNGD
Q9A3U2_CAUCR/70-299----GLLLTGLCTLWAARLG--------------------------LYLLWR.WRKHG-----..ADRRYVAIFAHYEKT
Q9VSM5_DROME/25-264----QLMVTLFVCLWGARLS--------------------------GYLLYR.IVKLG-----..RDKQFEDTRRNI...
Q9CHY6_LACLA/17-245----NSLILVLVILWGVRLA--------------------------IHLGRR.NWNKP-----..EDYRYTNMRKRWGNN
Q7CY59_AGRT5/19-248----RAVVFFLVVVWSLRLA--------------------------GHIGMR.TRGGG-----..EDPRYAKLIEEWGSA
O81042_ARATH/64-303----SMIVITLTWIWSIRLT--------------------------HNYFRRENWEWG-----AREDWRFNDLRKQYGKH
O53731_MYCTU/17-243----RWLLLALVSTWGLRLS--------------------------WHMYRK.TAGQG-----..EDPRYADLLR..GAT
Q8Y9D9_LISMO/16-244----SITILILVTLWGVRLF--------------------------WHLARR.NWNKP-----..EDYRYVNMRKRWGTT
Q984A1_RHILO/21-257----RWLVALLALVWSLRLG--------------------------VHIAGR.TIGDS-----.RDDPRYRQLKQQWGAS
B9DFE9_ARATH/24-252----QIVLTLLVVVWGLRLG--------------------------IFLLMR.ILQWG-----..EDRRFDEQRGNIV..

PF01222

LBR_CHICK/175-609AAAFSMALSIYLYIRSLKAPE..........EDLAPGGNSGYLVYDFFTGHELNPRIG.....SFDLKYFCELRPGLIGW
ERG24_NEUCR/17-490NILFAFALAIFVYVRSFDVKPGNKD.....MRQLAAGGVTGSLIYDFYIGRELNPRITLPLIGQVDIKEFMEMRPGLLGW
STS1_SCHPO/7-453AIITAFVCTFVLYTGTLLFGDRLFD.........KPHRLSGNPIYDAFMGACLNPRLG....KLLDFKMFFEVRIPWFIL
ERG4_YEAST/34-473AIISGFAFSIILYLWTLFISH.............DYHRMTGNHLYDFFMGAPLNPRWG.....ILDLKMFFEVRLPWFTL
ERG24_YEAST/8-438SILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLG.....PLDIKMFSELRPGMLLW

PF04140

Q9EWQ7_STRCO/75-167--------------------------------------------------PYWNTRVI----------------------
Q99YI2_STRP1/81-173--------------------------------------------------DIWTVKLM----------------------
P91402_CAEEL/171-267--------------------------------------------------LAFTHRLA----------------------
Q9KF68_BACHD/72-166--------------------------------------------------RFWNTRIM----------------------
MAM4_SCHPO/121-215--------------------------------------------------QSFSHIVA----------------------
Q9CM58_PASMU/75-167--------------------------------------------------EIWTVKLY----------------------
ICMT_HUMAN/161-257--------------------------------------------------SNFNHVVQ----------------------
STE14_YEAST/123-219--------------------------------------------------HSFSHIVK----------------------
Q9RTL5_DEIRA/91-184--------------------------------------------------RYWNTRIL----------------------
B6IT05_RHOCS/73-163--------------------------------------------------PYWTTRII----------------------
F7EBZ7_XENTR/175-268--------------------------------------------------SNFNHIVQ----------------------
Q2G1E3_STAA8/100-189--------------------------------------------------GIWTLKLF----------------------

PF04191

A4HJV7_LEIBR/438-543--------------------------------------------------DYGYFYGD----------------------
PEMT_HUMAN/89-192--------------------------------------------------FAGTFLGD----------------------
CHO2_ASPCL/504-608--------------------------------------------------EFGWFYGD----------------------
A1CQK4_ASPCL/70-170--------------------------------------------------VTGTYLGD----------------------
A3CKP0_STRSV/68-171--------------------------------------------------KNFTLAVQ----------------------
A3LQ40_PICST/106-209--------------------------------------------------VTGTYLGD----------------------
CHO2_PICST/449-558--------------------------------------------------YFGWFYGD----------------------
A4HJL2_LEIBR/106-210--------------------------------------------------VTGTYLGD----------------------
CHO2_MAGO7/497-601--------------------------------------------------EFGWFFGD----------------------
CHO2_PICGU/462-570--------------------------------------------------YFGWFYGD----------------------
CHO2_LODEL/480-589--------------------------------------------------YFGWFYGD----------------------
A5UZK8_ROSS1/43-144--------------------------------------------------ANLTPFPR----------------------
A7TIE1_VANPO/140-243--------------------------------------------------ITGTYLGD----------------------
CHO22_VANPO/452-560--------------------------------------------------DFGWFYGD----------------------
CHO21_VANPO/439-547--------------------------------------------------DFGWFYGD----------------------
A8NIW8_COPC7/92-195--------------------------------------------------ITGTFLGD----------------------
CHO2_MALGO/537-642--------------------------------------------------PFGWLYGD----------------------
A8PVU2_MALGO/102-205--------------------------------------------------ITGTYLGD----------------------
A9B4Y9_HERA2/33-137--------------------------------------------------QMGTNIMT----------------------
A9V3D6_MONBE/125-229--------------------------------------------------IFGTYMGE----------------------
CHO2_LACBS/492-596--------------------------------------------------VFGWFFGD----------------------
B1MLL6_MYCA9/108-208--------------------------------------------------YAAASITV----------------------
B1WZT5_CYAA5/96-194--------------------------------------------------IHDSL...----------------------
B2AR50_PODAN/95-198--------------------------------------------------ITGTFLGD----------------------
CHO2_PODAN/496-600--------------------------------------------------EFGWFYGD----------------------
B2JAT8_NOSP7/42-145--------------------------------------------------RAQTEVNP----------------------
B2VTC6_PYRTR/87-190--------------------------------------------------VTGTYLGD----------------------
CHO2_PYRTR/425-530--------------------------------------------------EFGWFCGD----------------------
B3RI13_TRIAD/89-192--------------------------------------------------FTGTFLGD----------------------
CHO2_SCHJY/478-583--------------------------------------------------NFGWFYGD----------------------
B6QQY2_PENMQ/89-189--------------------------------------------------VTGTYLGD----------------------
B8LBH8_THAPS/30-132--------------------------------------------------NNLSPYPV----------------------
B8PB22_POSPM/91-194--------------------------------------------------VTGTFLGD----------------------
CHO2_PICPG/450-564--------------------------------------------------LFGWYYGD----------------------
C4R5S7_PICPG/98-201--------------------------------------------------ITGTYLGD----------------------
CHO2_CLAL4/444-555--------------------------------------------------YFGWFYGD----------------------
C5DC91_LACTC/106-209--------------------------------------------------VTGTYLGD----------------------
CHO2_LACTC/450-558--------------------------------------------------EFGWFYGD----------------------
C5DZ83_ZYGRC/102-205--------------------------------------------------ITGTYLGD----------------------
CHO2_ZYGRC/430-538--------------------------------------------------DFGWFYGD----------------------
C5G0L0_ARTOC/115-215--------------------------------------------------ITGTYLGD----------------------
C6WWJ2_METML/43-146--------------------------------------------------KIGTSGNP----------------------
C7YM51_NECH7/94-197--------------------------------------------------ITGTFLGD----------------------
CHO2_NECH7/505-609--------------------------------------------------EFGWFCGD----------------------
CHO2_SORMK/496-600--------------------------------------------------EFGWFYGD----------------------
E3I110_RHOVT/77-175--------------------------------------------------IENTY...----------------------
D2U841_XANAP/75-178--------------------------------------------------RWFTVDLT----------------------
D2V512_NAEGR/65-168--------------------------------------------------ITGTYLGD----------------------
D2VYZ6_NAEGR/455-563--------------------------------------------------DHGWFYGD----------------------
D3AX06_POLPA/89-193--------------------------------------------------IKGMYNGD----------------------
D3BED6_POLPA/557-662--------------------------------------------------EFGWFYGD----------------------
D3BN57_POLPA/99-202--------------------------------------------------ITGTYLGD----------------------
CHO2_SCHPO/491-596--------------------------------------------------QYGWFYGD----------------------
CHO1_SCHPO/110-213--------------------------------------------------LVGTYLGD----------------------
Q01DA1_OSTTA/648-751--------------------------------------------------MDQTYFGV----------------------
Q0AM70_MARMM/72-173--------------------------------------------------SQERVYG.----------------------
Q0AQW8_MARMM/72-173--------------------------------------------------SQKRVYG.----------------------
CHO2_PHANO/462-567--------------------------------------------------EFGWFCGD----------------------
Q0UN81_PHANO/69-173--------------------------------------------------VTGTYLGD----------------------
Q11IW9_CHESB/45-148--------------------------------------------------LAKTTVMP----------------------
Q1GIY9_RUEST/78-176--------------------------------------------------LDNTY...----------------------
Q4P2D8_USTMA/99-202--------------------------------------------------VTGTYLGD----------------------
Q4PA66_USTMA/318-424--------------------------------------------------PFGWLYGD----------------------
PEMTL_DICDI/82-186--------------------------------------------------IKGMYNGD----------------------
PEM2_DICDI/98-201--------------------------------------------------ITGTYLGD----------------------
Q6C649_YARLI/97-200--------------------------------------------------VTGTYLGD----------------------
CHO2_YARLI/531-635--------------------------------------------------HFGWFYGD----------------------
CHO2_KLULA/451-559--------------------------------------------------EFGWFYGD----------------------
Q6CV75_KLULA/106-209--------------------------------------------------ITGTYLGD----------------------
Q6FUV4_CANGA/106-209--------------------------------------------------ITGTYLGD----------------------
CHO2_CANGA/431-540--------------------------------------------------DFGWFYGD----------------------
Q752Z0_ASHGO/100-203--------------------------------------------------VTGTYLGD----------------------
Q7ZVZ2_DANRE/120-223--------------------------------------------------VTGTFLGD----------------------
Q86IF9_DICDI/521-626--------------------------------------------------EFGWFYGD----------------------
Q8TN26_METAC/121-221--------------------------------------------------FAAATIQV----------------------
Q98I61_RHILO/42-146--------------------------------------------------LEGLGTPA----------------------
E7QGU3_YEASZ/100-199--------------------------------------------------ITGTYLGD----------------------
F1SB04_PIG/61-160--------------------------------------------------FTGTFLGD----------------------
F7BHJ5_XENTR/62-163--------------------------------------------------FVGTYLGD----------------------
G1MZ29_MELGA/96-197--------------------------------------------------FTGTFLGD----------------------
CHO2_YEAST/471-577--------------------------------------------------DFGWFYGD----------------------
CHO2_CANAL/468-576--------------------------------------------------YFGWFYGD----------------------
Q5KDE7_CRYNJ/618-724--------------------------------------------------DFGWLYSD----------------------
Q5KHK0_CRYNJ/121-221--------------------------------------------------VTGTYLGD----------------------
Q8DW48_STRMU/70-169--------------------------------------------------KAFTLTVQ----------------------
Q8PE74_XANCP/100-199--------------------------------------------------RWFTVDVT----------------------

PF07298

B2JUD7_BURP8/3-190------------------------------------------------..AWSPHLTG----------------------
A1VI53_POLNA/3-190------------------------------------------------..FATRHLAW----------------------
Q12HL7_POLSJ/3-190------------------------------------------------..VGMRHVAA----------------------
A2SBS8_METPP/3-190------------------------------------------------..VAMRHIAA----------------------
Q223I4_ALBFT/3-190------------------------------------------------..VALRHLAS----------------------
A1K5T7_AZOSB/6-191------------------------------------------------..VWTRHLAA----------------------
A1WT38_HALHL/3-190------------------------------------------------..NWTAHLMA----------------------
A6VV32_MARMS/3-191------------------------------------------------..VWTRHLAG----------------------
Q0AQE8_MARMM/3-183------------------------------------------------..GWGHQAAL----------------------
A1AZI2_PARDP/3-180------------------------------------------------..APLKGINN----------------------
Q28U80_JANSC/6-185------------------------------------------------..PALVGINN----------------------
Q5LXD7_RUEPO/5-179------------------------------------------------..SYLTHANN----------------------
Q1GLH3_RUEST/3-179------------------------------------------------..PFLVHVNN----------------------
A8LJK3_DINSH/5-184------------------------------------------------..AFMTHVNN----------------------
Q169U5_ROSDO/3-182------------------------------------------------..AFMMHVNN----------------------
A0KG00_AERHH/3-186------------------------------------------------..VWGPTLMM----------------------
Q6N9Q3_RHOPA/31-253------------------------------------------------..TWQMWVPN----------------------
Q219Y9_RHOPB/14-236------------------------------------------------..PWQMLAPN----------------------
Q5LUC0_RUEPO/7-220------------------------------------------------..PALRWVPI----------------------
Q0C1Y5_HYPNA/14-233------------------------------------------------..PHGLWLAN----------------------
Q169M4_ROSDO/6-220------------------------------------------------..AWHRPAIL----------------------
A8LNX8_DINSH/42-256------------------------------------------------..PWQAHLVL----------------------
A9CGK0_AGRT5/3-221------------------------------------------------..PWQAHVTF----------------------
Q2JYB9_RHIEC/5-223------------------------------------------------..PGNAAAAF----------------------
Q92Z13_RHIME/3-221------------------------------------------------..AWQAWLTM----------------------
B0U8Q9_METS4/2-221------------------------------------------------..RWQWAVPL----------------------
Q2VYZ8_MAGSA/17-229------------------------------------------------..PWMRWVPP----------------------
Q60BH7_METCA/3-224------------------------------------------------..TGFKPIAA----------------------
A7HZ42_PARL1/3-227------------------------------------------------..LWALHLSP----------------------
Q1GUJ7_SPHAL/6-226------------------------------------------------..DGLWALAS----------------------
Q2GC12_NOVAD/7-219------------------------------------------------.NAVAWALAS----------------------
Q8DMH0_THEEB/15-236------------------------------------------------EVPGMGALVW----------------------
Q113R6_TRIEI/12-233------------------------------------------------GVPIVKPIVW----------------------
Q8YQ81_NOSS1/13-234------------------------------------------------NVPGVQAVVW----------------------
Q9ALA6_SYNE7/12-229------------------------------------------------GIPWIAPLVW----------------------
Q7V3C9_PROMP/9-231------------------------------------------------GNHYVFLLVW----------------------
A9CI20_AGRT5/3-191------------------------------------------------..VFMSHIAV----------------------
Q92UK4_RHIME/3-191------------------------------------------------..TFLRHIAL----------------------
Q89MZ5_BRADU/5-191------------------------------------------------..KAMKHITL----------------------
A7IF98_XANP2/3-187------------------------------------------------..LGMTHLTK----------------------
B0UL45_METS4/3-192------------------------------------------------..VWTRHLAL----------------------
Q0C445_HYPNA/3-190------------------------------------------------..AGLAHLNL----------------------
Q3JDP5_NITOC/3-187------------------------------------------------..IWLHHVVT----------------------
Q9AAA0_CAUCR/3-186------------------------------------------------..AWGRHAAM----------------------
Q11KH3_CHESB/3-188------------------------------------------------..TWMQHLTL----------------------
B4EFU3_BURCJ/3-190------------------------------------------------..VGVRHLTG----------------------
C5B332_METEA/3-195------------------------------------------------..LWTRHLAV----------------------
Q2JMU2_SYNJB/23-239------------------------------------------------AVPGIRTTVA----------------------
Q2K5L0_RHIEC/3-191------------------------------------------------..VWTAHIAI----------------------
Q3SR07_NITWN/1-185------------------------------------------------..RVMKHIAE----------------------
Q46HM6_PROMT/12-228------------------------------------------------GVSELIPLIW----------------------
Q63MK0_BURPS/3-190------------------------------------------------..LGIRHLTG----------------------

PF02544

Q19605_CAEEL/97-243--------------------------------------------------..RKLVGS----------------------
YN67_SCHPO/146-295--------------------------------------------------PNHLLFLI----------------------
Q20344_CAEEL/97-243--------------------------------------------------..RHLIGS----------------------
S5A1_RAT/110-259--------------------------------------------------HPCFLTGF----------------------
S5A2_HUMAN/105-254--------------------------------------------------DIRFSLGV----------------------
PORED_CAEEL/189-309--------------------------------------------------........----------------------
Q23431_CAEEL/103-253--------------------------------------------------KFFVFLGA----------------------
DET2_ARATH/111-262--------------------------------------------------.WRFVIGM----------------------
TSC13_YEAST/154-310--------------------------------------------------LDDLSTLI----------------------
S5A1_HUMAN/110-259--------------------------------------------------DPRFLIGF----------------------

PF06966

YJD4_SCHPO/67-320.....IYPLFHYFYIHIFQVLHLYLLAS--PTYIAMLAGNER.....AF.GAWDWIAL----------------------
Q10E47_ORYSJ/24-252.........KLAV.FWIFQAVWVWTVSL--PVTIVNASDSDP.....SI.EARDIIGW----------------------
Q8PAZ9_XANCP/20-250.......QRKFLG.FFLAQAMVVVLFSV--PFLAA.ASNPNP.....AW.SVWSSLAI----------------------
Q9A3U2_CAUCR/70-299KRWNFAT.TSLII.VFGLQAVLSYFVAL--PVQLGQGP........GVL.GGLAYAGA----------------------
Q9VSM5_DROME/25-264........IRYAV.FWTFQAVWVYIVSL--PVIIINSPRHSQPRAPKTM.TTLDSTGT----------------------
Q9CHY6_LACLA/17-245....FPKLKAFLT.VFMVQYLLLIIISL--PIIQVN.SNVNS.....QF.YWWQILGI----------------------
Q7CY59_AGRT5/19-248......ASLRLFI.FLQIQAIAAFILVL--AVYLATG..NGQ.....VFPRVIDVFAT----------------------
O81042_ARATH/64-303....WWWL.SFFS.VYVSQQIFLIGICL--PLYVIHS.....I..DEPL.NIWDFISS----------------------
O53731_MYCTU/17-243.....PVQ.ALRK.VFGLQGLLTLFVSF--PLQLSAVTGPTP....KPL.LAVGGVGL----------------------
Q8Y9D9_LISMO/16-244....LVNLKAFLN.VFVLQGVLLFIIAL--PITHSFA.NETA.....TF.AWWQILGI----------------------
Q984A1_RHILO/21-257.......SSSRLFWFLQVQAAAAFLLAM--SI.MAAAHKPAP.....EL.GPGDWIGV----------------------
B9DFE9_ARATH/24-252.........RLII.FWTLQAVWVWTVSL--PLTLVNASDGGG.....SL.KPADVIGW----------------------

PF01222

LBR_CHICK/175-609VVINLAMLLAEMKIHNQSMPSLSMILVNSFQLLYVVDALWNEEAVLTTMDITHDGFGFMLAFGDLVWVPFVYSLQAFYLV
ERG24_NEUCR/17-490IILNCAFIAKQYRLYGYVTDSILFITAI..QAFYVFDGIYMEPAVLTTMDITTDGFGFMLSFGDVVWVPFMYSTQTRYLS
STS1_SCHPO/7-453FFISVGAAVRQYETYGTVSPQVLFVCLG..HYLYANACSKGEQLIVPTWDMAYEKFGFMLIFWNMAGVPFTYSHCTLYLF
ERG4_YEAST/34-473YFITLGACLKQWETYGYVTPQLGVVMLA..HWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLY
ERG24_YEAST/8-438LLINLSCLHHHYLKTGKINDALVLVNFL..QGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLS

PF04140

Q9EWQ7_STRCO/75-167------------------V..VPGTR----------PVGAG---------------------------------------
Q99YI2_STRP1/81-173------------------L..AKDHK----------YVDHW---------------------------------------
P91402_CAEEL/171-267------------------MTKRSDHR----------LVKDG---------------------------------------
Q9KF68_BACHD/72-166------------------I..LPDAN----------VIASG---------------------------------------
MAM4_SCHPO/121-215------------------SKRNKDHL----------LVTDG---------------------------------------
Q9CM58_PASMU/75-167------------------I..LPEHH----------INRSF---------------------------------------
ICMT_HUMAN/161-257------------------NEKSDTHT----------LVTSG---------------------------------------
STE14_YEAST/123-219------------------TKKESDHV----------LVKTG---------------------------------------
Q9RTL5_DEIRA/91-184------------------I..VPGGQ----------RVTSG---------------------------------------
B6IT05_RHOCS/73-163------------------T..LPGAP----------LIRRG---------------------------------------
F7EBZ7_XENTR/175-268------------------NEKSDSHT----------LVTSG---------------------------------------
Q2G1E3_STAA8/100-189------------------I..LPNHP----------IIKSG---------------------------------------

PF04191

A4HJV7_LEIBR/438-543------------------FFI.DKVP..A......KLNYSG---------------------------------------
PEMT_HUMAN/89-192------------------YFG.ILKE..A.......RVTVF---------------------------------------
CHO2_ASPCL/504-608------------------FFF.D.AS...P.....KLTYNG---------------------------------------
A1CQK4_ASPCL/70-170------------------YFG.ILMD..A.......PVTGF---------------------------------------
A3CKP0_STRSV/68-171------------------T...TDSQ..Q.......LVDHG---------------------------------------
A3LQ40_PICST/106-209------------------YFG.ILMN..E.......RVTGF---------------------------------------
CHO2_PICST/449-558------------------FFI.PKSY..SSM...QHLTKAG---------------------------------------
A4HJL2_LEIBR/106-210------------------YFD.ILMD..E.......RVTAF---------------------------------------
CHO2_MAGO7/497-601------------------FFF.N.NR...T.....KLTYRS---------------------------------------
CHO2_PICGU/462-570------------------FFL.P.TS..PQR...SHLTKAG---------------------------------------
CHO2_LODEL/480-589------------------FFI.PKSQ..SFA...NHLTKAG---------------------------------------
A5UZK8_ROSS1/43-144------------------P...RDDG..R.......LVQHG---------------------------------------
A7TIE1_VANPO/140-243------------------YFG.ILMD..E.......RVTAF---------------------------------------
CHO22_VANPO/452-560------------------FFL.......INYISERRLTSQG---------------------------------------
CHO21_VANPO/439-547------------------FFL.......TNYITTRKLTSQG---------------------------------------
A8NIW8_COPC7/92-195------------------YFG.ILMD..H.......RVEGF---------------------------------------
CHO2_MALGO/537-642------------------FFI.DAYP...K.....RLSYTG---------------------------------------
A8PVU2_MALGO/102-205------------------YFG.ILMD..H.......MVTGF---------------------------------------
A9B4Y9_HERA2/33-137------------------F...GQPD..R.......LVISG---------------------------------------
A9V3D6_MONBE/125-229------------------FFG.VMLS..E.......KITTF---------------------------------------
CHO2_LACBS/492-596------------------FFM.EEFP...T.....HLEYTG---------------------------------------
B1MLL6_MYCA9/108-208------------------....ESGQ..T.......VTATG---------------------------------------
B1WZT5_CYAA5/96-194------------------....GLEG..E.......LITKG---------------------------------------
B2AR50_PODAN/95-198------------------YFG.ILMD..K.......MVTGF---------------------------------------
CHO2_PODAN/496-600------------------FFF.E.SP...R.....PPTYNS---------------------------------------
B2JAT8_NOSP7/42-145------------------S...RPTT..A.......IVSDG---------------------------------------
B2VTC6_PYRTR/87-190------------------YFG.ILMD..E.......PVTTF---------------------------------------
CHO2_PYRTR/425-530------------------FFF.DPPS...K.....SLTYNG---------------------------------------
B3RI13_TRIAD/89-192------------------YFG.ILLE..E.......RVTTF---------------------------------------
CHO2_SCHJY/478-583------------------FFL.PVQS...P.....KLSYRG---------------------------------------
B6QQY2_PENMQ/89-189------------------YFG.ILMD..A.......PVTGF---------------------------------------
B8LBH8_THAPS/30-132------------------P...SEKG..A.......LIDSG---------------------------------------
B8PB22_POSPM/91-194------------------YFG.ILMD..H.......RVEGF---------------------------------------
CHO2_PICPG/450-564------------------FFI.GVLS..SHKSEVTTLSRSG---------------------------------------
C4R5S7_PICPG/98-201------------------YFG.ILME..D.......RVTSF---------------------------------------
CHO2_CLAL4/444-555------------------FFI.PKASVLPQR...AHLSKGG---------------------------------------
C5DC91_LACTC/106-209------------------YFG.ILMD..N.......IVTAF---------------------------------------
CHO2_LACTC/450-558------------------FFL.......TNYISSRKLNSRG---------------------------------------
C5DZ83_ZYGRC/102-205------------------YFG.ILMD..E.......IVTDF---------------------------------------
CHO2_ZYGRC/430-538------------------FFL.......SNYIPTKSLTSHG---------------------------------------
C5G0L0_ARTOC/115-215------------------YFG.ILMD..A.......PVTGF---------------------------------------
C6WWJ2_METML/43-146------------------R...ETST..A.......LAING---------------------------------------
C7YM51_NECH7/94-197------------------YFG.ILMD..E.......MVTGF---------------------------------------
CHO2_NECH7/505-609------------------FFF.D.QQ...A.....KLTYKS---------------------------------------
CHO2_SORMK/496-600------------------FFF.D.SK...R.....QLTYTS---------------------------------------
E3I110_RHOVT/77-175------------------....GADE..G.......LVTGG---------------------------------------
D2U841_XANAP/75-178------------------I...QHGQ..R.......LVGHG---------------------------------------
D2V512_NAEGR/65-168------------------YFG.ILME..D.......RITSF---------------------------------------
D2VYZ6_NAEGR/455-563------------------FFYTETNQ...N....KQPSYTG---------------------------------------
D3AX06_POLPA/89-193------------------SFG.HIMD..A.......PVTGG---------------------------------------
D3BED6_POLPA/557-662------------------FFI.DEVP...T.....KLYYTG---------------------------------------
D3BN57_POLPA/99-202------------------YFG.ILMK..E.......RVYGF---------------------------------------
CHO2_SCHPO/491-596------------------FFL.PSRS...P.....KLVYQG---------------------------------------
CHO1_SCHPO/110-213------------------YFG.FLLP..E.......RVSGF---------------------------------------
Q01DA1_OSTTA/648-751------------------ELG.EVKP..N.......FVSGF---------------------------------------
Q0AM70_MARMM/72-173------------------....LLED..E.......LIQHG---------------------------------------
Q0AQW8_MARMM/72-173------------------....LLED..R.......LIEGG---------------------------------------
CHO2_PHANO/462-567------------------FFF.DPPS...S.....NLTYSG---------------------------------------
Q0UN81_PHANO/69-173------------------YFG.ILMD..A.......PVTTF---------------------------------------
Q11IW9_CHESB/45-148------------------T...RSAT..Q.......LVTDG---------------------------------------
Q1GIY9_RUEST/78-176------------------....CDTG..G.......LVTGG---------------------------------------
Q4P2D8_USTMA/99-202------------------YFG.ILMD..S.......IVTGF---------------------------------------
Q4PA66_USTMA/318-424------------------FFV.DEYP...H.....QLYYTG---------------------------------------
PEMTL_DICDI/82-186------------------SFG.HIMD..S.......PVTGG---------------------------------------
PEM2_DICDI/98-201------------------YFG.ILMK..E.......RVTGF---------------------------------------
Q6C649_YARLI/97-200------------------YFG.ILMN..E.......RVTGF---------------------------------------
CHO2_YARLI/531-635------------------FFL.D.RK...Q.....NLTYSG---------------------------------------
CHO2_KLULA/451-559------------------FFL.......PNLIDKRKLKNDG---------------------------------------
Q6CV75_KLULA/106-209------------------YFG.ILMD..H.......RVTSF---------------------------------------
Q6FUV4_CANGA/106-209------------------YFG.ILMN..D.......RVTAF---------------------------------------
CHO2_CANGA/431-540------------------FFL.......INYIVDRKLTTQG---------------------------------------
Q752Z0_ASHGO/100-203------------------YFG.ILME..D.......RVTSF---------------------------------------
Q7ZVZ2_DANRE/120-223------------------YFG.ILMD..Q.......KVTGF---------------------------------------
Q86IF9_DICDI/521-626------------------FFI.EDIP...S.....NLYYTG---------------------------------------
Q8TN26_METAC/121-221------------------....SSDQ..Q.......VITTG---------------------------------------
Q98I61_RHILO/42-146------------------PVA.PTER..........LVIGG---------------------------------------
E7QGU3_YEASZ/100-199------------------YFG.ILMD..E.......RVTGF---------------------------------------
F1SB04_PIG/61-160------------------YFG.ILME..A.......RVTRF---------------------------------------
F7BHJ5_XENTR/62-163------------------YFG.ILME..K.......KVTGF---------------------------------------
G1MZ29_MELGA/96-197------------------YFG.ILME..A.......KVTCF---------------------------------------
CHO2_YEAST/471-577------------------FFL.SNYI..ST....RKLTSQG---------------------------------------
CHO2_CANAL/468-576------------------FFI.PKSQ..SSI...KNITTAG---------------------------------------
Q5KDE7_CRYNJ/618-724------------------FFL.IEQI..PS.....QLAYTG---------------------------------------
Q5KHK0_CRYNJ/121-221------------------YFG.ILMS..H.......RVTSF---------------------------------------
Q8DW48_STRMU/70-169------------------A...TDNQ..K.......LISSG---------------------------------------
Q8PE74_XANCP/100-199------------------I...QADH..Q.......LVRSG---------------------------------------

PF07298

B2JUD7_BURP8/3-190------------------VLTLIAFI----------LFPAAHAPGNH.------------------------........
A1VI53_POLNA/3-190------------------LLTALAFI----------LLAAAYVPRNA.------------------------........
Q12HL7_POLSJ/3-190------------------LLMLLAFI----------LLVATYVPRNA.------------------------........
A2SBS8_METPP/3-190------------------LLTLVAFV----------LLAAAYVPGNG.------------------------........
Q223I4_ALBFT/3-190------------------LLTLLSFV----------LLAAAYVPGNI.------------------------........
A1K5T7_AZOSB/6-191------------------VLTLPAFV----------LLVAAYLPGSH.------------------------........
A1WT38_HALHL/3-190------------------LVMIPAFI----------LLFSAYGPANR.------------------------........
A6VV32_MARMS/3-191------------------LLVLVALF----------FVGSALVPHTT.------------------------........
Q0AQE8_MARMM/3-183------------------FAVPVGII----------LLTSAYAPGH..------------------------........
A1AZI2_PARDP/3-180------------------LLVLVAFY----------FFAADGMKTR..------------------------........
Q28U80_JANSC/6-185------------------ILMVLAFY----------IYAVGGPKGDRV------------------------W.......
Q5LXD7_RUEPO/5-179------------------LLVLVAIW----------MMSPAGTKGK..------------------------........
Q1GLH3_RUEST/3-179------------------TLMLFALY----------FTSPGPNKGA..------------------------........
A8LJK3_DINSH/5-184------------------TLMLFALW----------VYGSSAAKGAKA------------------------W.......
Q169U5_ROSDO/3-182------------------TLMLFALW----------VYGSSAAKGAKA------------------------W.......
A0KG00_AERHH/3-186------------------AVMPIALI----------LFCSGQGPNH..------------------------........
Q6N9Q3_RHOPA/31-253------------------LALPLACQ----------FAAFGIGAANPL------------------------SFGGDPRK
Q219Y9_RHOPB/14-236------------------LAMPFVCL----------LAAFGVGAANPL------------------------SFGGNPRL
Q5LUC0_RUEPO/7-220------------------LIMLPVCL----------LAVAGLRAVNPL------------------------SFGGLGRG
Q0C1Y5_HYPNA/14-233------------------GLMALALL----------LVIGGTAIANPF------------------------SLGGLAER
Q169M4_ROSDO/6-220------------------VGMLAACL----------ILAASIGQPNPF------------------------SFGGRDND
A8LNX8_DINSH/42-256------------------AAMLPVCV----------IIALTLGRPNPF------------------------SFGGARND
A9CGK0_AGRT5/3-221------------------LAAPIGLF----------FVLAGLLSVNPL------------------------SISVRQ..
Q2JYB9_RHIEC/5-223------------------VLAPFGIF----------LVIAGLLSANPL------------------------SITLNR..
Q92Z13_RHIME/3-221------------------IAAPVGVF----------LVLAGLFSVNPL------------------------SVSIRQ..
B0U8Q9_METS4/2-221------------------ALMPVALF----------LIAAGLFAANPL------------------------SVSLRA..
Q2VYZ8_MAGSA/17-229------------------LVMPVACL----------FWMLGLSQKNPF------------------------SIGPGGAG
Q60BH7_METCA/3-224------------------VLMLVSFI----------FVVAGLTTPNPT------------------------AVSGESVL
A7HZ42_PARL1/3-227------------------LVILVATF----------FVVVGITTPNPT------------------------AVGADALA
Q1GUJ7_SPHAL/6-226------------------LIVLFASI----------LFVGSLV.GNPA------------------------LAAPGAEK
Q2GC12_NOVAD/7-219------------------VLTIVSLA----------FFIPSFA.GNPV------------------------LPGRKAAG
Q8DMH0_THEEB/15-236------------------GLSALSFL----------FLYPATFNLLEI------------------------AAVQKPE.
Q113R6_TRIEI/12-233------------------TFSAISFL----------FLYPSTFNLLEI------------------------AAIQKPQ.
Q8YQ81_NOSS1/13-234------------------VSSAISFL----------FLYPATFNLLEI------------------------AAIQKPQ.
Q9ALA6_SYNE7/12-229------------------VLTAISFL----------LLYPATFNLLEI------------------------AAIAQPQ.
Q7V3C9_PROMP/9-231------------------ILTAISFL----------FLYPATYNLLEI------------------------PSVLKPQ.
A9CI20_AGRT5/3-191------------------TLMLPAMI----------CLIASLIPAGH.------------------------........
Q92UK4_RHIME/3-191------------------LLMLVAFI----------VLAAGFLPAGR.------------------------........
Q89MZ5_BRADU/5-191------------------ALMLPAVI----------LVVASYLRGR..------------------------........
A7IF98_XANP2/3-187------------------LLMVFACI----------ALVASEVPSH..------------------------........
B0UL45_METS4/3-192------------------LLVLVAFV----------AFAAAYLPGR..------------------------........
Q0C445_HYPNA/3-190------------------VLMLPALI----------LLAAAYTPTGR.------------------------........
Q3JDP5_NITOC/3-187------------------ILLLPTFI----------LFLAPYFPGR..------------------------........
Q9AAA0_CAUCR/3-186------------------LLVWLAFI----------LLPTANAPAGR.------------------------........
Q11KH3_CHESB/3-188------------------LLMLPVFP----------LMAASHRPGR..------------------------........
B4EFU3_BURCJ/3-190------------------MLTAVAFV----------LIAASYVPRNR.------------------------........
C5B332_METEA/3-195------------------LLTLFAFI----------SLAAAYLPGH..------------------------........
Q2JMU2_SYNJB/23-239------------------LLSALSFF----------FLYPATFNLLEI------------------------AAIRKPE.
Q2K5L0_RHIEC/3-191------------------TLMLIAMI----------CLVASLLPAGH.------------------------........
Q3SR07_NITWN/1-185------------------ALILPSII----------LVVASYIRGR..------------------------........
Q46HM6_PROMT/12-228------------------ILSAISFL----------FLYPATYNLLEI------------------------PAVLKPK.
Q63MK0_BURPS/3-190------------------LLTAIAFV----------LLVAAYVPGTR.------------------------........

PF02544

Q19605_CAEEL/97-243------------------LMYCTGMY----------INHKSDTILR..--------------..--------ELRADGGT
YN67_SCHPO/146-295------------------VGWAFAVL----------SNFRTHIILR..--------------..--------DLRPAGSK
Q20344_CAEEL/97-243------------------ILYFSGMF----------INHKSDNILM..--------------..--------TLRKPGET
S5A1_RAT/110-259------------------ALWLVGMV----------INIHSDHILR..--------------..--------NLRKPGET
S5A2_HUMAN/105-254------------------FLFILGMG----------INIHSDYILR..--------------..--------QLRKPGEI
PORED_CAEEL/189-309------------------........----------.TRKGPRGLI..--------------..--------.....RNY
Q23431_CAEEL/103-253------------------WLFVIGFI----------THCVSDLHLI..--------------..--------TLRNDYLN
DET2_ARATH/111-262------------------VVFITGMY----------INITSDRTLV..--------------..--------RLKKENRG
TSC13_YEAST/154-310------------------GLFVLSEL----------WNFYCHIKLRLW--------------GD--------YQKKHGNA
S5A1_HUMAN/110-259------------------GLWLTGML----------INIHSDHILR..--------------..--------NLRKPGDT

PF06966

YJD4_SCHPO/67-320------------------ELFMFMFV----------LEMLADQQQWDYYEARNHYNVDKTVPPR--------FKYDLLSL
Q10E47_ORYSJ/24-252------------------IMWLIGAG----------MEAIADQQKLTF................--------.KNSPSNR
Q8PAZ9_XANCP/20-250------------------VVWLIAVG----------GEALADRQLSAH................--------.KANPANR
Q9A3U2_CAUCR/70-299------------------ALTIVGIL----------FETIGDAQLTAF................--------.KANPDNA
Q9VSM5_DROME/25-264------------------GMFIVGLL----------AETYADLQKFSF................--------.RQDPANQ
Q9CHY6_LACLA/17-245------------------IIWIFGFI----------FEVFGDRQLEVF................--------.KKLPQNK
Q7CY59_AGRT5/19-248------------------VVALTALA----------GEALSDAQLSKF................--------.RRTPEAK
O81042_ARATH/64-303------------------AICLTGIV----------MAYFADTQLHEFVTGN........QKLK--------EQGKPK..
O53731_MYCTU/17-243------------------AVWLVGIT----------FEAVGDWQLWVF................--------.KSDPANR
Q8Y9D9_LISMO/16-244------------------VIWIIGFI----------FEVGGDLQLENF................--------.KKNPANK
Q984A1_RHILO/21-257------------------AIWVVAIG----------GEALADRQLNAF................--------.RGDPRNK
B9DFE9_ARATH/24-252------------------TMWVFGFL----------IEAAADQQKLSF................--------.KNSPENR

PF01222

LBR_CHICK/175-609GH.PIAISWP..VAAAITILNCIGYY----------IFRSANSQKNNFR...........RNPADPKLSY..LKVIPTAT
ERG24_NEUCR/17-490VH.PQQLGAFG..LIAVGAVLAAGYS----------IFRLSNSQKNNFR...........TNPEDPSVKH..LTYLQTKT
STS1_SCHPO/7-453SHDPSVYNWSTQYTTGIYVLLLCCYY----------IFDTCNGQKNHFRNQIYGTEVHRKTFPQLPWLIIKNPTFIRCAN
ERG4_YEAST/34-473YHDPSEYHWSTLYNVSLYVVLLCAYY----------FFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSN
ERG24_YEAST/8-438VS.PVELGWV..KVVGILAIMFLGFH----------IFHSANKQKSEFR...............QGKLEN..LKSIQTKR

PF04140

Q9EWQ7_STRCO/75-167---------PYRFLRHPNYLA.VVVEVAALPLVHSA----------------------------WLTAAVFTAANAMLLT
Q99YI2_STRP1/81-173---------LFKTIKHPNYFLNIAPELVGIALLCHA----------------------------KITAMLLFPCYIVVIY
P91402_CAEEL/171-267---------IYAYLRHPGYFGWFLWAVSTQIILCNP----------------------------..ICCVVYAYVTWHFF
Q9KF68_BACHD/72-166---------PYRYIKHPNYAV.VIIEIAMLPLFFKA----------------------------YVTAFLFSLLNAIVLY
MAM4_SCHPO/121-215---------IYAYVRHPSYVGFFIWALGTQMLLGNF----------------------------..VSTLLFSLVLWKFF
Q9CM58_PASMU/75-167---------LFKYVRHPNYFLNIIPELIGLSLFCQA----------------------------KYTALIGLPIYLLILG
ICMT_HUMAN/161-257---------VYAWFRHPSYVGWFYWSIGTQVMLCNP----------------------------..ICGVSYALTVWRFF
STE14_YEAST/123-219---------VYSWSRHPSYLGFFWWAIGTQLLLLNP----------------------------..LSLVIFIFVLWKFF
Q9RTL5_DEIRA/91-184---------PFRFLGHPNYTV.VALELAAAPLAVGA----------------------------WRTAVAFSLLNAALLL
B6IT05_RHOCS/73-163---------PFRHVRHPNYLV.VTGEIAVLPLAFGA----------------------------WEIALVFSFLNAALLF
F7EBZ7_XENTR/175-268---------VYSWFRHPSYVGWFYWSIGTQVLLCNP----------------------------..LCLFGYTFASWRFF
Q2G1E3_STAA8/100-189---------LYKITKHPNYFLNIIPELIGVLLLTHA----------------------------TYTTILLVP.YAYFLY

PF04191

A4HJV7_LEIBR/438-543---------IYRYLNNPDSSLGMSAYYGIALL.SGS----------------------------PVV.LVVSVVSHAAAK
PEMT_HUMAN/89-192---------PFNILDNPMYWGSTANYLGWAIM.HAS----------------------------PTG.LLLTVLVALTYI
CHO2_ASPCL/504-608---------IYRFLNNPERVLGLAGVWGAVLI.TSS----------------------------GAI.TFLALLSHTLTL
A1CQK4_ASPCL/70-170---------PFSATGSPMYWGSTLNFLGVALY.FGK----------------------------AAG.LLLTAEVFIVYW
A3CKP0_STRSV/68-171---------PYSIVRNPAYTGSILSILGLSIT.SLN----------------------------PLT.IIISLILLVLGY
A3LQ40_PICST/106-209---------PFNVNDNPMYNGSTLCFLGTALW.YGK----------------------------PAG.IAVAGFVFVMYK
CHO2_PICST/449-558---------VYRYLNNPEQIFGVCGVMGVFIM.VPS----------------------------VEN.LVCCFLWVANNF
A4HJL2_LEIBR/106-210---------PFSHFDNPMYLGATLNFLAASII.QNN----------------------------AVG.VLLTGLVALVYH
CHO2_MAGO7/497-601---------IYRFLNNPERVMGSLGLYGAALI.TWS----------------------------RAI.FVLALISHLLTL
CHO2_PICGU/462-570---------VYRYLNNPEQLFGVCGVMGLTLI.APS----------------------------LEN.FVCCLLWVSNNF
CHO2_LODEL/480-589---------VYRYLNNPEQIFGVCGVMGVFII.WPT----------------------------FEN.LTCCVLWVLSNF
A5UZK8_ROSS1/43-144---------AYAIVRHPIYSGIIIGAFGWSLL.RGS----------------------------II..ALVLSVALLVFF
A7TIE1_VANPO/140-243---------PFNVSNNPMYQGSTLSFLGTALI.YGK----------------------------SAG.LLVAFMVQTMYN
CHO22_VANPO/452-560---------IYRYLNNPEAILGTAGIWGTALM.TNF----------------------------CYENIILAIIWTSTNF
CHO21_VANPO/439-547---------IYRYLNNPEAILGVAGIWGSVLM.TNF----------------------------SKTNVTLAVLWTVTNL
A8NIW8_COPC7/92-195---------PFNILNDPMYVGSTMSFIATALW.TER----------------------------PAG.LFISAYVYIVYR
CHO2_MALGO/537-642---------IYRFLNNPERSMGSAAFFGMALL.SGS----------------------------LTA.TVVAQLAHLSHW
A8PVU2_MALGO/102-205---------PFSVLNDPMYVGSTLNFVGVALW.YAR----------------------------PSG.LLLSVLVWVTYR
A9B4Y9_HERA2/33-137---------WFRWSRNPMYLGFGLSLLGIALL.LGA----------------------------AISNLVLVIAFVIIVD
A9V3D6_MONBE/125-229---------PFDVVDNPMYFGSSLMHIGLAIM.EQS----------------------------PVG.VVLGAVVFWWYY
CHO2_LACBS/492-596---------IYRYLNNPE.AMGGAAWFGLALI.SGS----------------------------KLV.LSLAVIRHLANW
B1MLL6_MYCA9/108-208---------LYGLVRHPMYTGSLVMMVGMPLA.LGS----------------------------YW..GLLATVPAAAAL
B1WZT5_CYAA5/96-194---------VYNYSRNPEYIGDLILFLGYSLL.TNS----------------------------WM..VMITDTGLALWF
B2AR50_PODAN/95-198---------PFNITSAPMYYGSTMSFLGSALL.YGK----------------------------PAG.ILLTLHVLIVYI
CHO2_PODAN/496-600---------IYRFLNNPERVLGAAGFWGLALI.TWS----------------------------KAV.FVMALVSQLLML
B2JAT8_NOSP7/42-145---------VFRLSRNPIYLSLTLFYIGIALL.LGA----------------------------LWA.LLLLFPLLVIVQ
B2VTC6_PYRTR/87-190---------PFNVSSSPMYHGSTMSFLATAIW.FGK----------------------------PAG.ILLTGLVAVAYS
CHO2_PYRTR/425-530---------IYRFLNNPERVLGLAGVWGIAII.TWS----------------------------PAV.FYVATTAHILNL
B3RI13_TRIAD/89-192---------PFNIFDNPMYIGSTSNFLGLALR.SAS----------------------------PCG.IIMSGFVYLVYW
CHO2_SCHJY/478-583---------IYRYLNNPERFFGSAAFWGMALI.SNS----------------------------SWI.FFLALLAQVSTL
B6QQY2_PENMQ/89-189---------PFNVTGSPMYWGSTLSFLGTSLY.YGK----------------------------VAG.LLLTLEVFVLYW
B8LBH8_THAPS/30-132---------IYGLMRHPMYTGVLIGMAGLSLV.TDS----------------------------VL..RMLLTVVLYFVL
B8PB22_POSPM/91-194---------PFNVLRDPMYVGSTMSFVAVSLW.FER----------------------------PAG.LLITFYVYAVYL
CHO2_PICPG/450-564---------IYHFLNNPERVTSNLTVWALYLLFNNS----------------------------NKIFLVIALLFTMNNL
C4R5S7_PICPG/98-201---------PFNIDDNPMYNGSTLCFLGTGLY.YGK----------------------------PAG.VFASLVVYLMYQ
CHO2_CLAL4/444-555---------VYRYLNNPEQIFGVCGVMGVTMI.VPT----------------------------YDN.FMICLLWMLNNF
C5DC91_LACTC/106-209---------PFNVSNNPMYHGSTLTFLGTSLY.YGK----------------------------AAG.VFATVLVNLVYN
CHO2_LACTC/450-558---------IYRYLSNPERFLGVAGCWGAVLI.THF----------------------------SPYNLILAALWTAANI
C5DZ83_ZYGRC/102-205---------PFNVSSNPMYQGSTLTFIGYTLM.EGK----------------------------AAG.LLLSFMVYSMYY
CHO2_ZYGRC/430-538---------IYRYLNNPETILGVAGVWGTVLM.TDF----------------------------SWENIALACLWSGCNF
C5G0L0_ARTOC/115-215---------PFNITSAPMYWGSTMSFLAVALY.HGK----------------------------PAG.LLLTAEVFICYK
C6WWJ2_METML/43-146---------PFRISRNPIYLAMTGMYLGISFF.TNS----------------------------LWS.LVLLVPLLSVMH
C7YM51_NECH7/94-197---------PFNVTSSPMYTGSTMSFLATALY.FGK----------------------------PAG.ILLTVWVYIVYK
CHO2_NECH7/505-609---------IYRFLNNPDRFFGTAGVWGAALI.TWS----------------------------RSI.FLMALVTQILTV
CHO2_SORMK/496-600---------IYRFLNNPERVFGTAGLWGAALI.TWS----------------------------RAI.FLMALAGHFLTL
E3I110_RHOVT/77-175---------LYRFSRNPQYVASILGFFGTGLA.NGS----------------------------AQ..SAVLCGLAILVY
D2U841_XANAP/75-178---------PYRYLRHPSYTGALLAFYGLAVG.MGN----------------------------VLS.LLAIVLPVTWVF
D2V512_NAEGR/65-168---------PFNVTDNPMYNGSTLWFLGHSLV.KSS----------------------------PAG.ILMAICVFVMYK
D2VYZ6_NAEGR/455-563---------IYRYLNNPEIVLGYCAYFGLALI.SKS----------------------------YAV.LGLAILSQFATY
D3AX06_POLPA/89-193---------VYQYFNDPQYVGTTISCLGYAIR.YQS----------------------------ING.FICTAAMGLVFY
D3BED6_POLPA/557-662---------IYRFLNNPDSVLGFAGYYGLSLI.GGS----------------------------LPL.FAIAISSQVANF
D3BN57_POLPA/99-202---------PFNVMSNPMYNGSTILFLAHALH.GKS----------------------------VAG.IFLSLIVFITYR
CHO2_SCHPO/491-596---------IYRYVNNPERFLGCSAYWGLALI.SSS----------------------------AWI.FLIAILAQLSNL
CHO1_SCHPO/110-213---------PFNVNDNPMYNGSTLCFLSTALR.YGK----------------------------VAG.LLLTLEVFFVYR
Q01DA1_OSTTA/648-751---------PYNVVPHPMIVGSMLGLLGIHKM.DGL----------------------------REA.LPYAVPMHCFMY
Q0AM70_MARMM/72-173---------IYRRTRNPQYVGYSGMFLGAAIA.AGS----------------------------GLA.MLSALVFTAIIH
Q0AQW8_MARMM/72-173---------IYRFSRNPQYVGYAAMFFGAAAA.AGS----------------------------ILA.LTSSALFALIIH
CHO2_PHANO/462-567---------IYRFLNNPERVLGLAGVWGLALI.TWN----------------------------PPI.FYLAATAHILNL
Q0UN81_PHANO/69-173---------PFNVSEAPMYHGSTLSFLATALW.FGK----------------------------PAG.VLLTGVVAVAYG
Q11IW9_CHESB/45-148---------PFSFSRNPIYLGGTLIVIAIGLI.VGN----------------------------AWF.LLFALLAAFATQ
Q1GIY9_RUEST/78-176---------MYEYSRNPQYVTSVLATVGLGIT.TGS----------------------------WT..TVALALVLFALY
Q4P2D8_USTMA/99-202---------PFNVMANPMYWGSSMSFTAVALW.FGK----------------------------PAG.LLLSVLVVIVYA
Q4PA66_USTMA/318-424---------IYRFLNNPERSMGGAAFFGLALV.SGS----------------------------KLT.LLMAIVSYIAHW
PEMTL_DICDI/82-186---------PYQFFSDPQYVGTTIAALGVAIR.NQS----------------------------IYG.FLCTILVGVVFY
PEM2_DICDI/98-201---------PFNVMNNPMYNGSVMLFIAHALS.YKS----------------------------VAG.LVLSFVVYVVYK
Q6C649_YARLI/97-200---------PFNVSNNPMYHGSTLCFLASALW.YAK----------------------------PAG.LLITAFVSLMYS
CHO2_YARLI/531-635---------IYRYLNNPERFFGIAGIWGLALM.TNS----------------------------PGV.GILAFLWTLEGM
CHO2_KLULA/451-559---------IYRYLNNPERVFGVAGIWGTVLI.NNF----------------------------SNWNLWLATTWTMFNW
Q6CV75_KLULA/106-209---------PFNYFDNPMYQGSTFTFLGYALY.NGK----------------------------PAG.LIATLVVHVMYN
Q6FUV4_CANGA/106-209---------PFNVSNNPMYQGSTFSFIGTSLI.AGK----------------------------PAG.LILAFFVHAMYY
CHO2_CANGA/431-540---------IYRYLNNPEAILGVAGVWGSVLM.TDF----------------------------AWENIALGMLWTATNF
Q752Z0_ASHGO/100-203---------PFNVSDNPMYQGSTLTFLGTSLY.YGK----------------------------AAG.VFAALLVNLMYT
Q7ZVZ2_DANRE/120-223---------PFNVMDNPMYWGSTANYLGLALM.NAS----------------------------PIG.IVLTAVVALSYK
Q86IF9_DICDI/521-626---------IYRFLNNPDSVTGFAGFYGLSLI.AGS----------------------------FPL.FALSIFSQVANF
Q8TN26_METAC/121-221---------VYSIVRHPMYAAGLIIFSGTPLA.LGS----------------------------WW..GLLILVPIMLVI
Q98I61_RHILO/42-146---------IYRHVRNPMYVAVLSIILGQALL.FSS----------------------------WTL.VAYAVIGAVVMG
E7QGU3_YEASZ/100-199---------PFNVSNNPMYQGSTLSFLGIALY.KGK----------------------------PAG.LVVSAVVYFMYK
F1SB04_PIG/61-160---------PFSVLDNPMYWGSTAVYLGWALM.HAS----------------------------PTG.LLLTLVVAAIYK
F7BHJ5_XENTR/62-163---------PFNVMENPMYWGSTANYLGLALL.NAS----------------------------PAG.LLLTALVALCYK
G1MZ29_MELGA/96-197---------PFSILDNPMYWGSTAVYLGWSLM.HAS----------------------------PAG.LLLTAVVAISYT
CHO2_YEAST/471-577---------IYRYLNHPEAVLGVVGVWGTVLM.TNF----------------------------AVTNIILAVLWTLTNF
CHO2_CANAL/468-576---------VYRYLNNPEQIFGVCGVMGIFLI.YPT----------------------------VEN.FVCVGLWVVNNF
Q5KDE7_CRYNJ/618-724---------IYRFLNNPERSMGGAAFFGLWLI.SNS----------------------------KLV.FALALASHLSHW
Q5KHK0_CRYNJ/121-221---------PFNVLSDPMYVGSFLTHLGTALW.FQS----------------------------PAG.IVLAAWVWIVYA
Q8DW48_STRMU/70-169---------PYSIVRNPAYTGTIISILGLAFI.TLN----------------------------IFN.ILIVFIILSIGY
Q8PE74_XANCP/100-199---------PYRWLRHPSYTGALLCFYGMALG.MGN----------------------------ALS.LLVIVLPVTWVF

PF07298

B2JUD7_BURP8/3-190......-..FKSIVKHPMTAGVGLWALAHLFV-SAT----------------------------LHAVVLFGAFLVWAVF
A1VI53_POLNA/3-190......-..IKARLHHPMVLGVMFWAVAHLLA-NGN----------------------------RAHVLLFGSFLVWAGL
Q12HL7_POLSJ/3-190......-..IKATLHHPMLLSVKVWALAHLLA-NGT----------------------------LAGVVLFGSFLVWAVV
A2SBS8_METPP/3-190......-..LKAKLHHPMVLSVKVWAFAHLLA-NGT----------------------------LADVLLFGGFLVWAVL
Q223I4_ALBFT/3-190......-..IKERIHHPMVLGVKLWALAHLLA-NGN----------------------------LGHVVLFGSFLAWAIV
A1K5T7_AZOSB/6-191......-..IKATLRHPMLAGTALWAFAHLLA-NGT----------------------------LADLLLFGGFLAWSAT
A1WT38_HALHL/3-190......-..IRNAVGHPMLLAVALWALAHLMA-NGR----------------------------LGDLVFFGAFLAWASV
A6VV32_MARMS/3-191......-..MKKKVGYPMLIAIKIWAFAHLIS-NGS----------------------------LADVILFGSFLVWSIV
Q0AQE8_MARMM/3-183......-..IRRWVRHPMLAGVVVWSGAHLLA-NAE----------------------------ASAVLLFGSFFVWSLV
A1AZI2_PARDP/3-180......-..ITRHLRHPQLTGFALWAFAHLVP-NGD----------------------------LPSFVLFGGLLVWALV
Q28U80_JANSC/6-185......-..LGTKLRHPQLTGYSLWAIAHLLV-NGD----------------------------TPSFVLFGGLLVWALG
Q5LXD7_RUEPO/5-179......-..LLHKMRHPMLAGFRAWAAAHLLV-NGD----------------------------LASIILFGGLFLWGIV
Q1GLH3_RUEST/3-179......-..LFHKMRHPMLTGFKIWAVAHLLV-NGD----------------------------LASVILFGGLLAWAVV
A8LJK3_DINSH/5-184......-..PANKIRHPQLTGVKIWALAHLLV-NGD----------------------------LASIVLFGGLLAWAVG
Q169U5_ROSDO/3-182......-..PAYKLRHPQLVGFKIWALAHLLV-NGD----------------------------LASIILFGGLLGWAVG
A0KG00_AERHH/3-186......-..LRRWLVHPQLLGTLLWAGAHLAV-NSE----------------------------ARSLVLFGGIGLWALV
Q6N9Q3_RHOPA/31-253PFDPQH-PGVVGIVRHPLLWAIGLWAGAHVVP-NGD----------------------------LAHVLLFGFFAMIAVI
Q219Y9_RHOPB/14-236AFDPEQ-PGIVGAARHPLLWAIALWSGAHLVP-NGD----------------------------LAHALLFGFFALIALA
Q5LUC0_RUEPO/7-220VFDPTR-PGILALSRHPLLLALALWSGAHLLA-NGS----------------------------LAHVILFGLFAGFAVM
Q0C1Y5_HYPNA/14-233AYNPAR-PGILAVTRHPLLWAMVLWSLAHLIA-NGD----------------------------LAHVLLFGSLGVFSVV
Q169M4_ROSDO/6-220AFDPTD-CGIIGYMRHPLLSVLALWALLHVLA-NGD----------------------------LAHVLLFGTLGLFAYV
A8LNX8_DINSH/42-256IFDPDR-PGIVRVTRHPLLLALAIWAGAHLFP-NGD----------------------------LAHVILFGTFAAFALL
A9CGK0_AGRT5/3-221..GQQP-GAIVRITRHPVLVGFLFWSLGHVVP-NGD----------------------------LRSVILFGGFALFSLG
Q2JYB9_RHIEC/5-223..SPNP-GAITKITRHPVLWGFAAWASGHIAA-NGD----------------------------LRSLLLFGGFAVFALG
Q92Z13_RHIME/3-221..GQKP-GSIVSVTRHPVLWGFAIWALGHLVA-NGD----------------------------VRSLILFGGFALFALG
B0U8Q9_METS4/2-221..GAEP-GPVTAVTRHPLMWGFLIWALAHIPP-NGD----------------------------LVSVVLFGGMAAFSLA
Q2VYZ8_MAGSA/17-229.YDPAR-PGIVRLTRHPIIWGLGLWSAAHILP-NGH----------------------------LAGLLLFVPLLLLCLV
Q60BH7_METCA/3-224NDAEAA-RGILRITRHPFLWGLSLWALVHVIA-NGD----------------------------VAALLLFGSLLALCLA
A7HZ42_PARL1/3-227DKPDTV-KGMLRITRHPFLWGAAIWALWHILV-NGD----------------------------KASIIFFGTFALLAIL
Q1GUJ7_SPHAL/6-226AAQAAP-RGVFAITRHPMMWGFALWALAHVMV-MPT----------------------------PGQIVLSATIAFLALA
Q2GC12_NOVAD/7-219LGTVVP-TGVFTITRHPMMWAFALWALAHIIV-APT----------------------------GRSLIFMSGMIVLALL
Q8DMH0_THEEB/15-236.VHLYE-TGIIRITRHPQLWGQLIWCVAHTLW-LGT----------------------------SFTLLTSLGLIAHHCF
Q113R6_TRIEI/12-233.VHLHE-TGIIRITRHPQMVGQVIWCIAHTLW-LGT----------------------------SFTFVTSVGLILHHLF
Q8YQ81_NOSS1/13-234.VHLYE-TGIIRITRHPQMVGQVIWCIAHTLW-LGT----------------------------SFTLVTSFGLILHHLF
Q9ALA6_SYNE7/12-229.VRLYE-TGITRITRHPQTFGQILWCLAHSLW-LGT----------------------------SFMMVASAGLIAHHLF
Q7V3C9_PROMP/9-231.VRIYG-TGIMRITRHPQAFGQIIWCLAHTLW-IGT----------------------------SFTFITSIGLILHHLF
A9CI20_AGRT5/3-191......-..IATKTKHPLILSVKIWALAHLLA-NGE----------------------------TSSILLFASFLAWGVV
Q92UK4_RHIME/3-191......-..IAVALKHPQVLSIKIWALAHLLA-NGE----------------------------TSSVLLFGSFLAWAVI
Q89MZ5_BRADU/5-191......-..IYATLKHPMLAGIKLWAAAHLLA-NGD----------------------------LGSIILFGSFLGWAVF
A7IF98_XANP2/3-187......-..IKAWLKHPMLVAVKIWALAHLLA-NGD----------------------------VASIVLFGSVLAWAVY
B0UL45_METS4/3-192......-..IKGALKHPMLAGVKIWAAAHLLA-NGD----------------------------LGSILLFGSILAWAVA
Q0C445_HYPNA/3-190......-..IRKAVKHPMLVAVKIWAFGHLLA-NGE----------------------------LNSVILFGSFLGYAVI
Q3JDP5_NITOC/3-187......-..INNTVKHPQLVAVMIWAVAHLLV-NGT----------------------------LADLLLFGSFLLWAIV
Q9AAA0_CAUCR/3-186......-..IKATLRHPMLLGVILWSAGHLLV-NGD----------------------------QASVLLFGAFLVWAVV
Q11KH3_CHESB/3-188......-..ISTAVGHPMLLGTVIWGLAHLLA-NGT----------------------------LADLLLFGGIAVWGTV
B4EFU3_BURCJ/3-190......-..IKTLVGHPMLAGVMVWAVAHLLV-NGT----------------------------VHAVVLFGAFFVWSIV
C5B332_METEA/3-195......-..LRARLKHPMLLAVKIWATAHLLA-NGD----------------------------LGSILLFGSFLAWAVV
Q2JMU2_SYNJB/23-239.IHLFE-TGIIRITRHPQMVGQVIWCVAHTLW-IGS----------------------------SFMVVTSLGLIAYHLF
Q2K5L0_RHIEC/3-191......-..IATRTKHPMVLSVKIWALAHLLA-NGE----------------------------TSSVLLFAAFLAWGVI
Q3SR07_NITWN/1-185......-..IYAKLKHPMLAGIKLWATAHLLA-NGD----------------------------LGSIILFGSILAWAVI
Q46HM6_PROMT/12-228.VRIYA-TGIIRVTRHPQAIGQIIWCFAHLLW-IGT----------------------------SFTLVTCLGLIAHHLF
Q63MK0_BURPS/3-190......-..IKALVGHPMLAGVMVWAGAHLLA-NGT----------------------------LHAELLFAAFFVWAFV

PF02544

Q19605_CAEEL/97-243GYKIPT.GFLYEYISCPNYAGEIMEWIGYSILA-------------------------------WNLPALAFAI...FTI
YN67_SCHPO/146-295KRVIPT.GYGFNLVSFPNYFFESLGWLFFALLT-------------------------------KSWASWIFLF...VGS
Q20344_CAEEL/97-243GYKIPT.GFLYEYISCPNYFGEIMEWIGYAILG-------------------------------WNLPALAFAI...FTF
S5A1_RAT/110-259GYKIPR.GGLFEYVSAANYFGELVEWCGFALAS-------------------------------WSLQGVVFAL...FTL
S5A2_HUMAN/105-254SYRIPQ.GGLFTYVSGANFLGEIIEWIGYALAT-------------------------------WSLPALAFAF...FSL
PORED_CAEEL/189-309AYGICF.GGWFNLVSCPHFLFEICIYLSLFLVI-------------------------------P..DAYVYRFIIMFVC
Q23431_CAEEL/103-253SYSIPR.GHYFEYISCPNYFGECLQWIGYALAA-------------------------------RSFPAIAFAF...FIV
DET2_ARATH/111-262GYVIPR.GGWFELVSCPNYFGEAIEWLGWAVMT-------------------------------WSWAGIGFFL...YTC
TSC13_YEAST/154-310KIRVPLNQGIFNLFVAPNYTFEVWSWIWFTFVF-------------------------------K......FNL...FAV
S5A1_HUMAN/110-259GYKIPR.GGLFEYVTAANYFGEIMEWCGYALAS-------------------------------WSVQGAAFAF...FTF

PF06966

YJD4_SCHPO/67-320GRGFNA-TGLFRWSRHPNFLAEQLIWLSFYLFGAIA--------------------..SESLLNWTIFA..WLGLVGVFQ
Q10E47_ORYSJ/24-252GR.WCN-VGLWSYTRHPNYFGEIFLWWGIFVASTPV--------------------..LSGAEWLVILGPVFLTLLLLFV
Q8PAZ9_XANCP/20-250GK.TCR-TGLWRYSRHPNYFFEFVHWFAYLALAVGA--------------------..GPWLLALCALGPVVMFVFLYRF
Q9A3U2_CAUCR/70-299GK.VMD-KGLWRYTRHPNYFGDACVWWGLYLIAAET--------------------..GLGA..WALPGPLLMTFLLTKW
Q9VSM5_DROME/25-264GK.FCN-DGLWSVSRHPNYFGEVVIWWGIFAISLNV--------------------..ISGHEWVAIASPIFTTMIILFL
Q9CHY6_LACLA/17-245GK.LLT-SGLWSLTRHPNYFGESMCWWGIFLISLTT--------------------..LSTL..WLVISPLLITSLLLFV
Q7CY59_AGRT5/19-248TG.VCE-TGLWRYSRHPNYFFEWLFWCSFPLLAIQE--------------------...QVLSWASLAAPVMMYWLLVHV
O81042_ARATH/64-303.IPNLD-SGLWRYSRHPNYLGEQLWWWGLVIFAWNL--------------------..GQG...WTLIGALVNTLCLVYV
O53731_MYCTU/17-243GV.IMD-RGLWAWTRHPNYFGDACVWWGLWLITIND--------------------..WAPL..ATVGSPLLMTYLLVDV
Q8Y9D9_LISMO/16-244GK.LLT-SGFWSVTRHPNYFGEALSWWGVFLVALTQ--------------------..LTDL..WLITSPIVITLLLLFV
Q984A1_RHILO/21-257GK.VCD-VGLWRLSRHPNYFFEWLGWLAYMAIAIGS--------------------PWAYPWGFAALAGPILMYWLLVHV
B9DFE9_ARATH/24-252GK.WCD-VGVWKYSRHPNYFGEMLLWWGIFVAASPV--------------------..LEGAEYLVIFGPLFLTLLLLFV

PF01222

LBR_CHICK/175-609GKGLLV-TGWWGFVRHPNYLGDIIMALAWSLPCGFN................................HILPYFYVIYFI
ERG24_NEUCR/17-490GSRLIT-SGWWGIARHINYLGDWLQSWPYSLPTGIAGYQILSAGSNAPGAITMLDGREVVQGEARGWGIVFTYFYILYFA
STS1_SCHPO/7-453GGTLLT-SGWYRYARKIHYTADFFQSLSWALITGFQ................................SPLPYFYPCFFF
ERG4_YEAST/34-473GSYLLI-DGWYTLARKIHYTADWTQSLVWALSCGFN................................SVFPWFFPVFFL
ERG24_YEAST/8-438GTKLLC-DGWWAKSQHINYFGDWLISLSWCLATWFQ................................TPLTYYYSLYFA

PF04140

Q9EWQ7_STRCO/75-167.VRLRCEN-----------------------------------------------------------TALA-----Q---
Q99YI2_STRP1/81-173.LRIREEN-----------------------------------------------------------KLLA-----E---
P91402_CAEEL/171-267ASRIYDEE-----------------------------------------------------------KDLI-----S---
Q9KF68_BACHD/72-166.IRIHTEE-----------------------------------------------------------EALQ-----A---
MAM4_SCHPO/121-215SQRITTEE-----------------------------------------------------------AYLV-----S---
Q9CM58_PASMU/75-167.VRIKQEE-----------------------------------------------------------SAMA-----H---
ICMT_HUMAN/161-257RDRTEEEE-----------------------------------------------------------ISLI-----H---
STE14_YEAST/123-219SDRIRVEE-----------------------------------------------------------KYLI-----E---
Q9RTL5_DEIRA/91-184GVRIPAED-----------------------------------------------------------RALA-----E---
B6IT05_RHOCS/73-163.HRIRQEE-----------------------------------------------------------RALA-----.---
F7EBZ7_XENTR/175-268RERIEEEE-----------------------------------------------------------FSLI-----H---
Q2G1E3_STAA8/100-189.VRIKQEE-----------------------------------------------------------KLMN-----.---

PF04191

A4HJV7_LEIBR/438-543MFEAIVEE-----------------------------------------------------------PHMR-----KHYG
PEMT_HUMAN/89-192VALL.YEE-----------------------------------------------------------PFTA-----EIYR
CHO2_ASPCL/504-608AFIQFVER-----------------------------------------------------------PHMQ-----KLYG
A1CQK4_ASPCL/70-170FALQ.WED-----------------------------------------------------------PFTA-----EIYA
A3CKP0_STRSV/68-171SIRLRVEE-----------------------------------------------------------KALG-----NHFG
A3LQ40_PICST/106-209IALL.FEE-----------------------------------------------------------PFTA-----KIYA
CHO2_PICST/449-558VRINFIER-----------------------------------------------------------WHMI-----KVYG
A4HJL2_LEIBR/106-210VSTRYFES-----------------------------------------------------------PFTA-----MIYS
CHO2_MAGO7/497-601AFISYVEK-----------------------------------------------------------PHMQ-----KIYG
CHO2_PICGU/462-570FRINFVEK-----------------------------------------------------------VHMI-----KVYG
CHO2_LODEL/480-589IRINFIEK-----------------------------------------------------------WHMI-----RLYG
A5UZK8_ROSS1/43-144HLKSRREE-----------------------------------------------------------RWLV-----ERY.
A7TIE1_VANPO/140-243LALK.LEE-----------------------------------------------------------PFTA-----QIYA
CHO22_VANPO/452-560IFVKFIEK-----------------------------------------------------------PHVS-----KIYG
CHO21_VANPO/439-547IFVKLIEE-----------------------------------------------------------PHVS-----KVYG
A8NIW8_COPC7/92-195IALL.FEG-----------------------------------------------------------PFTD-----MIYS
CHO2_MALGO/537-642WFLGCVEG-----------------------------------------------------------PHMR-----RLYG
A8PVU2_MALGO/102-205VALC.FES-----------------------------------------------------------PFTA-----NIYR
A9B4Y9_HERA2/33-137RWYIAFEE-----------------------------------------------------------RAML-----AKFG
A9V3D6_MONBE/125-229MAAL.YEE-----------------------------------------------------------PLMV-----EMYK
CHO2_LACBS/492-596WFLSSVEN-----------------------------------------------------------PHMR-----KLYG
B1MLL6_MYCA9/108-208VVRIIDEE-----------------------------------------------------------KMLR-----HDL.
B1WZT5_CYAA5/96-194FLAPFTEE-----------------------------------------------------------PWLQ-----ERYG
B2AR50_PODAN/95-198IAIQ.FEN-----------------------------------------------------------PFTS-----GIYA
CHO2_PODAN/496-600GFISFVEK-----------------------------------------------------------PHMQ-----KIYG
B2JAT8_NOSP7/42-145IGIVQREE-----------------------------------------------------------NYLE-----RKFG
B2VTC6_PYRTR/87-190IACK.WED-----------------------------------------------------------PFTS-----MIYQ
CHO2_PYRTR/425-530AFLQFVEK-----------------------------------------------------------PHVI-----KLYG
B3RI13_TRIAD/89-192IGLL.LEE-----------------------------------------------------------PYTE-----EIYR
CHO2_SCHJY/478-583GIIRFVEK-----------------------------------------------------------PHMQ-----RIYG
B6QQY2_PENMQ/89-189FALR.WED-----------------------------------------------------------PFTA-----EIYA
B8LBH8_THAPS/30-132DVKSDYEE-----------------------------------------------------------TLLV-----ESYG
B8PB22_POSPM/91-194IALR.FEG-----------------------------------------------------------PFTD-----MIYS
CHO2_PICPG/450-564IVLNFIEK-----------------------------------------------------------PHMV-----KLYG
C4R5S7_PICPG/98-201IALK.FEE-----------------------------------------------------------PFTA-----KIYA
CHO2_CLAL4/444-555FRINFVER-----------------------------------------------------------SHMI-----KIYG
C5DC91_LACTC/106-209IAQQ.FEE-----------------------------------------------------------PFTA-----QIYA
CHO2_LACTC/450-558ALVKLVEE-----------------------------------------------------------PHVS-----KVYG
C5DZ83_ZYGRC/102-205FALK.FEE-----------------------------------------------------------PFTA-----MIYA
CHO2_ZYGRC/430-538IIVKFIEQ-----------------------------------------------------------PHMA-----KLYG
C5G0L0_ARTOC/115-215IACL.WEE-----------------------------------------------------------PFTV-----EIYS
C6WWJ2_METML/43-146WGVIFREE-----------------------------------------------------------RYLA-----KQFG
C7YM51_NECH7/94-197IALL.YED-----------------------------------------------------------PFTS-----GIYA
CHO2_NECH7/505-609FYISYIER-----------------------------------------------------------PHMQ-----KIYG
CHO2_SORMK/496-600AFLAYVEK-----------------------------------------------------------PHMQ-----KVYG
E3I110_RHOVT/77-175VVLPYTEE-----------------------------------------------------------PWLE-----RAYG
D2U841_XANAP/75-178VHRIRIEE-----------------------------------------------------------TMLT-----EAFP
D2V512_NAEGR/65-168FACL.FEE-----------------------------------------------------------PFTA-----MIYA
D2VYZ6_NAEGR/455-563LFVKFVEK-----------------------------------------------------------PHMD-----KIYG
D3AX06_POLPA/89-193ISVKFVEG-----------------------------------------------------------PHMN-----RIYE
D3BED6_POLPA/557-662LFVKYVEH-----------------------------------------------------------PHMK-----KLYG
D3BN57_POLPA/99-202IALT.FEE-----------------------------------------------------------PFTA-----HIYS
CHO2_SCHPO/491-596AIIRLVEQ-----------------------------------------------------------PHMQ-----KVYG
CHO1_SCHPO/110-213IALK.FEE-----------------------------------------------------------PFTA-----KIYA
Q01DA1_OSTTA/648-751LLHMIQEQ-----------------------------------------------------------..VN-----DIYS
Q0AM70_MARMM/72-173VFITWVEE-----------------------------------------------------------PHMR-----RTFG
Q0AQW8_MARMM/72-173VFITRVEE-----------------------------------------------------------PHLD-----RVFA
CHO2_PHANO/462-567AFLQFVER-----------------------------------------------------------PHMQ-----RLYG
Q0UN81_PHANO/69-173VARR.WED-----------------------------------------------------------PFTG-----EIYA
Q11IW9_CHESB/45-148KLAIEPEE-----------------------------------------------------------RHLA-----QHFG
Q1GIY9_RUEST/78-176FLFVLNEE-----------------------------------------------------------RWLL-----KGYG
Q4P2D8_USTMA/99-202LALR.FEE-----------------------------------------------------------PFTA-----NIYK
Q4PA66_USTMA/318-424GFLSYVEG-----------------------------------------------------------PHMR-----KLYG
PEMTL_DICDI/82-186ISATFVET-----------------------------------------------------------PHLK-----NIYS
PEM2_DICDI/98-201FALI.FEE-----------------------------------------------------------SFTN-----YIYS
Q6C649_YARLI/97-200IALK.FEE-----------------------------------------------------------PFTG-----EIYA
CHO2_YARLI/531-635AFIKFVEQ-----------------------------------------------------------PHMQ-----RIYG
CHO2_KLULA/451-559FTVKFIET-----------------------------------------------------------PHLL-----KVYG
Q6CV75_KLULA/106-209IALR.FEE-----------------------------------------------------------PFTA-----KIYA
Q6FUV4_CANGA/106-209MALK.FEE-----------------------------------------------------------PFTA-----EIYA
CHO2_CANGA/431-540VLVKFIET-----------------------------------------------------------PHVS-----KVYG
Q752Z0_ASHGO/100-203MALK.LEE-----------------------------------------------------------PFTA-----MIYA
Q7ZVZ2_DANRE/120-223VAIA.YEG-----------------------------------------------------------PFTQ-----EIYR
Q86IF9_DICDI/521-626LFIKFVEK-----------------------------------------------------------PHMK-----RLYG
Q8TN26_METAC/121-221IWRLLEEE-----------------------------------------------------------KFLS-----ENL.
Q98I61_RHILO/42-146SFVRFYEE-----------------------------------------------------------PTLA-----RRYG
E7QGU3_YEASZ/100-199IALR.WEE-----------------------------------------------------------PFTA-----MIYA
F1SB04_PIG/61-160LAIL.FEE-----------------------------------------------------------PFTA-----EIYR
F7BHJ5_XENTR/62-163VAIL.YEG-----------------------------------------------------------PFTE-----EIYR
G1MZ29_MELGA/96-197IAVL.YEG-----------------------------------------------------------PFTE-----EIYR
CHO2_YEAST/471-577ILVKFIET-----------------------------------------------------------PHVN-----KIYG
CHO2_CANAL/468-576IRINFIEK-----------------------------------------------------------SHMV-----KLYG
Q5KDE7_CRYNJ/618-724WFLTFVER-----------------------------------------------------------PHMQ-----RLYG
Q5KHK0_CRYNJ/121-221VALK.FEG-----------------------------------------------------------PFTD-----KIYS
Q8DW48_STRMU/70-169AIRIRTEE-----------------------------------------------------------EVLE-----QHFG
Q8PE74_XANCP/100-199LRRIRVEE-----------------------------------------------------------AALR-----RAFP

PF07298

B2JUD7_BURP8/3-190DYAAARRR.......DRA.EGVVYPGGTLSR..................DVMPVVAGVVLWVAFVFFLHGW-----L.IG
A1VI53_POLNA/3-190SFRAARAR.......DRA.ALAVYPAGTASG..................TLMAVLAGMAAWAVFAFWAHGL-----L.IG
Q12HL7_POLSJ/3-190CFKAARGR.......DRV.AQTVYPPGTATG..................TAITMAVGLVAWAGFAFWAHGV-----L.IG
A2SBS8_METPP/3-190CFRAARGR.......DRA.TGVATPPGRAGA..................TAITVVVGAVAWAVFAFWAHGA-----W.IG
Q223I4_ALBFT/3-190DFTASRRR.......DRT.LGTRYPGGTAGA..................TGITVALGVGAWIAFALWLHGL-----L.IG
A1K5T7_AZOSB/6-191DFVSARRR.......EPT.SRITRPALKV....................DATAVLLGIVAWAIFARFLHGP-----L.IG
A1WT38_HALHL/3-190TFVAARER.......DRR.QAASPTPAQRWG..................NAWAIGGGLIGYIVFALFLHIP-----I.TG
A6VV32_MARMS/3-191SFAVYRRR.......DRK.AGVVRDQESGVQF.................DLAAFTFAMVTWFAIAFYLHQA-----I.IG
Q0AQE8_MARMM/3-183TFIAACLR............ETPPPVVKGWGG.................DLTAIVLGLIAALIILN.FHMY-----L.FG
A1AZI2_PARDP/3-180EMVVINRA.......QPD.WTPPAGPFPARK..................EIMAVAGAVVVLLVVGL.IHAW-----L..G
Q28U80_JANSC/6-185SVVAINAA.......EGP.WT.PPNRAPKRK..................ELTYVIATVVIVVVVML.IHWA-----L..G
Q5LXD7_RUEPO/5-179EVAAINAA.......EPE.WT.PGEPGTLGK..................DAMFLVASVVLMAVIGY.IHGL-----V..G
Q1GLH3_RUEST/3-179EVITINKS.......EPN.WQ.PNPKGSLAK..................DAMFFVASIVLLGVIGY.IHGL-----V..G
A8LJK3_DINSH/5-184EVILINKA.......EPD.WT.PPETAGMKT..................KIRLAVITVVLYLVIGG.IHAW-----L..G
Q169U5_ROSDO/3-182SVILINKA.......EPE.WT.APERAGMAT..................RVRLAIITLVLYALISA.VHIW-----A..G
A0KG00_AERHH/3-186SIVWISVR.........D.WQRHPRPVANWYG.................TGLSVGAGLALTALLIFWGHGM-----L.TG
Q6N9Q3_RHOPA/31-253GMLIIDRR.KRR.QLGAERWAELAARTSFWPFAALISGR..FRPQTWRISSLRLCIGLAAWLSLLL.LHPL-----V.IG
Q219Y9_RHOPB/14-236GMVMIDRR.KQR.RLGYEAWHALARNTSFWPFAALLQGR..FRPRSYGVDAKRLAIALVAWLTLLA.LHAP-----V.IG
Q5LUC0_RUEPO/7-220GMALIDRR.KRR.ELGAD.WARLAAGTARLSPRGL..........PALLAPRVLWPAALLYLALLL.AHAP-----V.IG
Q0C1Y5_HYPNA/14-233GILAMETR.SRM.RGGAL.WSQMIRGTSLVPFAALLTG....NARWRELLQLRMLLLPVVWGGLIL.LHRP-----V.VG
Q169M4_ROSDO/6-220GPRIIDAR.NRR.DMGAEAWEALVGETRRQRRIRV..........PSPAMMLRLGAGVILYLVLVF.LHPV-----V.IG
A8LNX8_DINSH/42-256GGRLVDRR.ARR.TLGSQ.WSPLLQKSRQTPVFRAF.........PLGESLLRLGLGVVLYLVLIG.VHPW-----L.FG
A9CGK0_AGRT5/3-221GMAMTEKR.ARK.RLGNA.WNATAAGSATVPFAAILSGKT.RIAVDGPMLLAAALTGLTVWWLLAG.GHAM-----L.FG
Q2JYB9_RHIEC/5-223AISMTDKR.AKR.RLGVS.WTRLAEHTSIWPFGACFKGEQ.PRLDVPMLLAGLASAVMVLWLLFAG.GHSA-----M.FG
Q92Z13_RHIME/3-221TIPMIEKR.ARR.RLGDQ.WQRQSAKTSILPFAALFTGRTRLSGDTPIATATVATAVLTLWLLAG..GHAA-----L.FY
B0U8Q9_METS4/2-221GFALLDAK.ARR.RLGAERWRALSRGTSVVPFAAILAGR..ARLGPVRPLLPAAAAALAAYAWFLAQGHAL-----L.IG
Q2VYZ8_MAGSA/17-229GPRILDAK.RRK.SLGDRHWREMAERAVFEPRALL...........AELGWARICGGLALYPVLLW.LHPM-----V.IG
Q60BH7_METCA/3-224GTRSIDAK.RRR.TYGDR.WERFAAATSNVPFMAIKEGR..NRLELGEIGWQRLGIAVALYLAMLH.FHAK-----I.FG
A7HZ42_PARL1/3-227GTFSIDDK.KRK.RMGES.WTAFAARTSNLPFAAIFAGR..NQLKLGELGWWRILAALIVFGALFY.AHLW-----L.FG
Q1GUJ7_SPHAL/6-226GSAGQDVK.KAR.LMGDA.WRGWAARTSFVPFARQVGGA..APWADAMPRAHALLGGIILWLAASW.AHGA-----L.GY
Q2GC12_NOVAD/7-219GSHFQDKR.KIA.GNNRE.FAPWQRRTSYWPRLDK...........LGAIGLIWLLAALVWVIITL.IHWE-----L.FG
Q8DMH0_THEEB/15-236GVWHGDRR.WYA.RHGEA.FAALKNRTSIIPFKAIWEGK...QQLVWQEFLRPAYGGVVIFVALLWWLHPY-----F.YH
Q113R6_TRIEI/12-233GVWHGDRR.LQK.RFGES.YDQLKSRTSVIPFLAIIQGR...QTLHLQEFIRWAYLGIGLFVLLFWQAHPL-----L.IR
Q8YQ81_NOSS1/13-234GVWHGDRR.MSK.RYGEA.FEIVKQRTSIIPFAAIIDGR...QSIKWEEFIRPAYLGVAIFVALLWWAHPL-----L.FV
Q9ALA6_SYNE7/12-229SIWHGDRR.LQK.RYGEA.FEALKSRTSIIPFLAIAQGK...QTLVWKEFLRPAYLGVAIAIGLFWFAHRW-----I...
Q7V3C9_PROMP/9-231AIWHGDKR.LEI.KFGEE.FYKYKESTSIIPFVAIFDGR...QQIKLKEFFKLSQIGILIAIAIIWWSHKY-----INIA
A9CI20_AGRT5/3-191MRISLKRR.......ERA.GEKVVRDFVSSRY.................DLVAIVGGIVLWGAFILKLHEW-----L.IG
Q92UK4_RHIME/3-191LRISLKRR.......ERA.GEKVLPVFKSARN.................DVLAVVIGLVAFVLFVWKLHEL-----L.IG
Q89MZ5_BRADU/5-191DRISLKHR.......TDA.GGPPIPVGGVSN..................DLIAVAVGVVAYLALAFAFHPV-----V.IG
A7IF98_XANP2/3-187DRIAVKRR.......GDP.LPVAPNNYAG....................DALVVGGGLVLYAALAYLFHPY-----V.IG
B0UL45_METS4/3-192ARISVKRR..DE.VKAHA..GPAAAPAGWRN..................DALAVGIGVVAWFVFARVLHPW-----L.IG
Q0C445_HYPNA/3-190DRIALKKR.......GDN.GPAPDAPVSAMG..................DIAAVGIGVAAYLFLLFWFHPI-----L.TG
Q3JDP5_NITOC/3-187DRISMMNR.......ATR..SVPSVPQSKAN..................DIIVVVVGLAVYAAIVFWLHET-----L.LG
Q9AAA0_CAUCR/3-186DLFSAIGR.......KEP.APVVVKPRA.....................DLTAVLGGTVAYLIFVFVLHRL-----L.FG
Q11KH3_CHESB/3-188DWVSSVQR.......PRE..PVAKGKPSPRN..................DVMAVVGGLVIYAIFVAGLHRL-----L.FG
B4EFU3_BURCJ/3-190DFVVSRAR.......DRS.DGVRYPAGGLAG..................DLATVAAGLVAWAVFALFLHGP-----L.IG
C5B332_METEA/3-195ARISAKRRALTAGQVAQQ.HGGQAAPAGWRN..................DAIAVVVGVVAWFVFGKYLHPL-----L.IG
Q2JMU2_SYNJB/23-239AVWHGDHR.LER.KYGQA.FRDLKARTSVIPGLAILQKR...QQLRPQEFFRWAYLGVFSFVLILYAFHPQ-----M.VS
Q2K5L0_RHIEC/3-191VRISLKRR.......ERA.GEITLRPFVSAKY.................DLYALVIGIVVWALIIWKLHEW-----L.IG
Q3SR07_NITWN/1-185DRISLKHR.......SDP.GGLPIPVGGVRN..................DVIAIVVGVVVYVAIGALFHPF-----V.LG
Q46HM6_PROMT/12-228AIWHGDRR.LSL.KFGQE.FEDVKKRTSVVPFLAVLDGR...QKLQIKEFLRPSQMGILIAVFFFWWSHKF-----I...
Q63MK0_BURPS/3-190DFIASRAR.......DRR.DGVRYPAGSLAR..................DGVAIAVGLLVWALFAFVLHGW-----L.IG

PF02544

Q19605_CAEEL/97-243ANIGPRAV--------------------------------------------AHHKWYKETF.PGYPPNRR-----ILIP
YN67_SCHPO/146-295AQMFVWAK--------------------------------------------KKHARYLKEF.PNYPRSRK-----IMIP
Q20344_CAEEL/97-243ANIGPRAI--------------------------------------------AHHNWYKEKF.PKYPPTRR-----ALIP
S5A1_RAT/110-259STLLTRAK--------------------------------------------QHHQWYHEKF.EDYPKSRK-----ILIP
S5A2_HUMAN/105-254CFLGLRAF--------------------------------------------HHHRFYLKMF.EDYPKSRK-----ALIP
PORED_CAEEL/189-309INQTFAAL--------------------------------------------ITHSWYHKTF.PKYPKSRK-----ALIP
Q23431_CAEEL/103-253CNLAPRAM--------------------------------------------SHHKWYQKMFGEQYPRDRH-----ALVP
DET2_ARATH/111-262SNLFPRAR--------------------------------------------ASHKWYIAKFKEEYPKTRK-----AVIP
TSC13_YEAST/154-310LFLTVSTA--------------------------------------------QMYAWAQKKN.KKYHTRRA-----FLIP
S5A1_HUMAN/110-259CFLSGRAK--------------------------------------------EHHEWYLRKF.EEYPKFRK-----IIIP

PF06966

YJD4_SCHPO/67-320GSTRLTEK--------------------------------------------MSCEKY...--PLYRVYQD-----KV--
Q10E47_ORYSJ/24-252SGIPLLEA--------------------------------------------SADKRFGQN--EEYRTYKN-----TT--
Q8PAZ9_XANCP/20-250TGIPYTEQ--------------------------------------------QALRSRG..--EDYAQYQR-----ST--
Q9A3U2_CAUCR/70-299SGVPTTEG--------------------------------------------KMRK...SK--PGYEEYVA-----RT--
Q9VSM5_DROME/25-264SGIPLRER--------------------------------------------SADEKYKDQ--LEYRKYKA-----ST--
Q9CHY6_LACLA/17-245SGVPILE.--------------------------------------------...KKYKNR--EDFKEYAK-----TT--
Q7CY59_AGRT5/19-248SGIPPLEE--------------------------------------------HMLKSRG..--EKFRALQR-----RV--
O81042_ARATH/64-303T.I.LVER--------------------------------------------RMVKQQYRA--EAYRAYQK-----TT--
O53731_MYCTU/17-243SGARLTE.--------------------------------------------...RYLKGR--PGFAEYQR-----RT--
Q8Y9D9_LISMO/16-244SGVPLLE.--------------------------------------------...KKYQDR--ADFQAYAN-----KT--
Q984A1_RHILO/21-257SGIPPLEA--------------------------------------------HMLRSRG..--VQFRRYQE-----RV--
B9DFE9_ARATH/24-252SGIPLLEA--------------------------------------------SADKKHGNS--GAYRSYKK-----TT--

PF01222

LBR_CHICK/175-609CLLVHREA--------------------------------------------RDEHHCKKKYGLAWERYCQRVPYTHISL
ERG24_NEUCR/17-490ILLIHRDL--------------------------------------------RDDEKCSKKYGDDWEKYKKLVKW.RIVP
STS1_SCHPO/7-453VVLVHRVS--------------------------------------------RDIKKCKAKYGADFDEYCRICPY.LFIP
ERG4_YEAST/34-473VVLIHRAF--------------------------------------------RDQAKCKRKYGKDWDEYCKHCPY.VFIP
ERG24_YEAST/8-438TLLLHRQQ--------------------------------------------RDEHKCRLKYGENWEEYERKVPY.KIIP

PF04140

Q9EWQ7_STRCO/75-167---
Q99YI2_STRP1/81-173---
P91402_CAEEL/171-267---
Q9KF68_BACHD/72-166---
MAM4_SCHPO/121-215---
Q9CM58_PASMU/75-167---
ICMT_HUMAN/161-257---
STE14_YEAST/123-219---
Q9RTL5_DEIRA/91-184---
B6IT05_RHOCS/73-163---
F7EBZ7_XENTR/175-268---
Q2G1E3_STAA8/100-189---

PF04191

A4HJV7_LEIBR/438-543D.Q
PEMT_HUMAN/89-192QKA
CHO2_ASPCL/504-608R.S
A1CQK4_ASPCL/70-170KRE
A3CKP0_STRSV/68-171KNY
A3LQ40_PICST/106-209ARD
CHO2_PICST/449-558EQE
A4HJL2_LEIBR/106-210KRG
CHO2_MAGO7/497-601Q.S
CHO2_PICGU/462-570EKE
CHO2_LODEL/480-589EQE
A5UZK8_ROSS1/43-144PEY
A7TIE1_VANPO/140-243KRD
CHO22_VANPO/452-560.NE
CHO21_VANPO/439-547.NG
A8NIW8_COPC7/92-195NRA
CHO2_MALGO/537-642A.D
A8PVU2_MALGO/102-205EAA
A9B4Y9_HERA2/33-137EQY
A9V3D6_MONBE/125-229KDL
CHO2_LACBS/492-596D.S
B1MLL6_MYCA9/108-208QGY
B1WZT5_CYAA5/96-194EEY
B2AR50_PODAN/95-198KRE
CHO2_PODAN/496-600Q.N
B2JAT8_NOSP7/42-145DEY
B2VTC6_PYRTR/87-190KRE
CHO2_PYRTR/425-530E.N
B3RI13_TRIAD/89-192QKN
CHO2_SCHJY/478-583S.G
B6QQY2_PENMQ/89-189KRE
B8LBH8_THAPS/30-132KEY
B8PB22_POSPM/91-194NRA
CHO2_PICPG/450-564EQN
C4R5S7_PICPG/98-201KRE
CHO2_CLAL4/444-555ERE
C5DC91_LACTC/106-209KRD
CHO2_LACTC/450-558.TS
C5DZ83_ZYGRC/102-205KRD
CHO2_ZYGRC/430-538.DN
C5G0L0_ARTOC/115-215KRD
C6WWJ2_METML/43-146QAY
C7YM51_NECH7/94-197KRE
CHO2_NECH7/505-609R.S
CHO2_SORMK/496-600R.N
E3I110_RHOVT/77-175DVY
D2U841_XANAP/75-178LDY
D2V512_NAEGR/65-168KRD
D2VYZ6_NAEGR/455-563AKN
D3AX06_POLPA/89-193NKN
D3BED6_POLPA/557-662T.K
D3BN57_POLPA/99-202KRT
CHO2_SCHPO/491-596N.T
CHO1_SCHPO/110-213ARD
Q01DA1_OSTTA/648-751DSW
Q0AM70_MARMM/72-173DAF
Q0AQW8_MARMM/72-173AAY
CHO2_PHANO/462-567R.K
Q0UN81_PHANO/69-173KRE
Q11IW9_CHESB/45-148KRY
Q1GIY9_RUEST/78-176KAF
Q4P2D8_USTMA/99-202QAE
Q4PA66_USTMA/318-424EAA
PEMTL_DICDI/82-186NRS
PEM2_DICDI/98-201TAA
Q6C649_YARLI/97-200KRD
CHO2_YARLI/531-635T.S
CHO2_KLULA/451-559.TK
Q6CV75_KLULA/106-209KRA
Q6FUV4_CANGA/106-209KRD
CHO2_CANGA/431-540PSA
Q752Z0_ASHGO/100-203KRD
Q7ZVZ2_DANRE/120-223QRS
Q86IF9_DICDI/521-626S.K
Q8TN26_METAC/121-221PGY
Q98I61_RHILO/42-146ADY
E7QGU3_YEASZ/100-199NR.
F1SB04_PIG/61-160QR.
F7BHJ5_XENTR/62-163KK.
G1MZ29_MELGA/96-197QK.
CHO2_YEAST/471-577K..
CHO2_CANAL/468-576EQ.
Q5KDE7_CRYNJ/618-724KR.
Q5KHK0_CRYNJ/121-221AK.
Q8DW48_STRMU/70-169R..
Q8PE74_XANCP/100-199TRY

PF07298

B2JUD7_BURP8/3-190VKP
A1VI53_POLNA/3-190IRP
Q12HL7_POLSJ/3-190VRP
A2SBS8_METPP/3-190VRP
Q223I4_ALBFT/3-190VRP
A1K5T7_AZOSB/6-191VPP
A1WT38_HALHL/3-190VPA
A6VV32_MARMS/3-191VSP
Q0AQE8_MARMM/3-183VAV
A1AZI2_PARDP/3-180YNP
Q28U80_JANSC/6-185VQP
Q5LXD7_RUEPO/5-179..P
Q1GLH3_RUEST/3-179PSP
A8LJK3_DINSH/5-184VWP
Q169U5_ROSDO/3-182VWP
A0KG00_AERHH/3-186IPL
Q6N9Q3_RHOPA/31-253VSP
Q219Y9_RHOPB/14-236VSP
Q5LUC0_RUEPO/7-220VSP
Q0C1Y5_HYPNA/14-233VSP
Q169M4_ROSDO/6-220VPV
A8LNX8_DINSH/42-256VSP
A9CGK0_AGRT5/3-221ADP
Q2JYB9_RHIEC/5-223ADP
Q92Z13_RHIME/3-221ADP
B0U8Q9_METS4/2-221PDP
Q2VYZ8_MAGSA/17-229LSP
Q60BH7_METCA/3-224VSP
A7HZ42_PARL1/3-227VSP
Q1GUJ7_SPHAL/6-226MVA
Q2GC12_NOVAD/7-219IPA
Q8DMH0_THEEB/15-236VTP
Q113R6_TRIEI/12-233ATG
Q8YQ81_NOSS1/13-234ATS
Q9ALA6_SYNE7/12-229..P
Q7V3C9_PROMP/9-231VTT
A9CI20_AGRT5/3-191VQP
Q92UK4_RHIME/3-191VQP
Q89MZ5_BRADU/5-191VPV
A7IF98_XANP2/3-187VPV
B0UL45_METS4/3-192VAV
Q0C445_HYPNA/3-190MPA
Q3JDP5_NITOC/3-187VKP
Q9AAA0_CAUCR/3-186VSP
Q11KH3_CHESB/3-188VSP
B4EFU3_BURCJ/3-190VRP
C5B332_METEA/3-195VA.
Q2JMU2_SYNJB/23-239...
Q2K5L0_RHIEC/3-191VSP
Q3SR07_NITWN/1-185VP.
Q46HM6_PROMT/12-228...
Q63MK0_BURPS/3-190VRP

PF02544

Q19605_CAEEL/97-243RIF
YN67_SCHPO/146-295FFL
Q20344_CAEEL/97-243YIY
S5A1_RAT/110-259FVL
S5A2_HUMAN/105-254FIF
PORED_CAEEL/189-309YVL
Q23431_CAEEL/103-253GVW
DET2_ARATH/111-262FVY
TSC13_YEAST/154-310FVF
S5A1_HUMAN/110-259FLF

PF06966

YJD4_SCHPO/67-320---
Q10E47_ORYSJ/24-252---
Q8PAZ9_XANCP/20-250---
Q9A3U2_CAUCR/70-299---
Q9VSM5_DROME/25-264---
Q9CHY6_LACLA/17-245---
Q7CY59_AGRT5/19-248---
O81042_ARATH/64-303---
O53731_MYCTU/17-243---
Q8Y9D9_LISMO/16-244---
Q984A1_RHILO/21-257---
B9DFE9_ARATH/24-252---

PF01222

LBR_CHICK/175-609HLL
ERG24_NEUCR/17-490GIY
STS1_SCHPO/7-453YIF
ERG4_YEAST/34-473YVF
ERG24_YEAST/8-438YVY

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window