Sequence alignment for CL0115

PF02544

Q19605_CAEEL/97-243------------------TKSP-------------------------------------------------------VAI
YN67_SCHPO/146-295------------------ATMP-------------------------------------------------------LRN
Q20344_CAEEL/97-243------------------TKSP-------------------------------------------------------LLI
S5A1_RAT/110-259------------------KPTL-------------------------------------------------------LVT
S5A2_HUMAN/105-254------------------RPYP-------------------------------------------------------AIL
PORED_CAEEL/189-309------------------DDIS-------------------------------------------------------LTQ
Q23431_CAEEL/103-253------------------NQSP-------------------------------------------------------VKI
DET2_ARATH/111-262------------------NGFP-------------------------------------------------------ITI
TECR_YEAST/154-310------------------ATMP-------------------------------------------------------IFN
S5A1_HUMAN/110-259------------------KPMP-------------------------------------------------------LLA

PF06966

YJD4_SCHPO/67-320--------LWGVSVWTKNTSQV-------------------------------------------------------DRL
Q10E47_ORYSJ/24-252--------FFIITALLRFDKVT-------------------------------------------------------DFA
Q8PAZ9_XANCP/20-250--------GWLWQRRSGNAGPV-------------------------------------------------------DVL
Q9A3U2_CAUCR/70-299--------LWAVSLRTKDVSFI-------------------------------------------------------DAW
Q9VSM5_DROME/25-264--------FFLINSVLQMDKLT-------------------------------------------------------DFA
Q9CHY6_LACLA/17-245--------WFLIATSKKNYGLI-------------------------------------------------------DIA
Q7CY59_AGRFC/19-248--------AWALQRATGSSGWI-------------------------------------------------------DTV
O81042_ARATH/64-303--------FWVIGLLQSSHWMI-------------------------------------------------------DVY
O53731_MYCTU/17-243--------AFAIGRRIGRYNVV-------------------------------------------------------DVV
Q8Y9D9_LISMO/16-244--------WFIISKIKGKYSLV-------------------------------------------------------DIA
Q984A1_RHILO/21-257--------AWLVAIRTGSSGWV-------------------------------------------------------DAI
B9DFE9_ARATH/24-252--------FFVITALFKFDQVT-------------------------------------------------------DFA

PF01222

LBR_CHICK/175-609EEIYAEKKIFEAIKTPEKPSSK....TKELEFGGRFGTFMLMFFLPATVLYLVLMCKQDDPSLMNFPPLPALESLWETKV
ERG24_NEUCR/17-490RQQHYEFGG.PIGAFGITFGLPILVHVFNLFCNDISGCPAPSLLHPKSLDLAQLKREIGWPDNGVFGL.....FSWSATL
STS1_SCHPO/7-453KSAPREFGG.AKGALAIMTGFP....CLMYYLWACSKFNDSQFIKPESFTIAGFQNFFRTLGHYIYVG...AY..PTRYA
ERG4_YEAST/34-473NEIEYEFGG.TTGVIGMLIGFP....LLMYYMWICAEFYHGKVALPKAG..ESWMHFIKHLYQLVLEN...GI..PEKYD
ERG24_YEAST/8-438RTTEFEFGG.LIGALGISIGLP....VFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKP..LRYYLG........NREL

PF04140

Q9EWQ7_STRCO/75-167--------------------------------------------------------------------------------
Q99YI2_STRP1/81-173--------------------------------------------------------------------------------
P91402_CAEEL/171-267--------------------------------------------------------------------------------
Q9KF68_BACHD/72-166--------------------------------------------------------------------------------
MAM4_SCHPO/121-215--------------------------------------------------------------------------------
Q9CM58_PASMU/75-167--------------------------------------------------------------------------------
ICMT_HUMAN/161-257--------------------------------------------------------------------------------
STE14_YEAST/123-219--------------------------------------------------------------------------------
Q9RTL5_DEIRA/91-184--------------------------------------------------------------------------------
B6IT05_RHOCS/73-163--------------------------------------------------------------------------------
F7EBZ7_XENTR/175-268--------------------------------------------------------------------------------
Q2G1E3_STAA8/100-189--------------------------------------------------------------------------------

PF04191

A4HJV7_LEIBR/438-543-----------------------------------------------------------------------------FVM
PEMT_HUMAN/89-192-----------------------------------------------------------------------------AYS
CHO2_ASPCL/504-608-----------------------------------------------------------------------------LRH
A1CQK4_ASPCL/70-170-----------------------------------------------------------------------------L..
A3LQ40_PICST/106-209-----------------------------------------------------------------------------VKA
CHO2_PICST/449-558-----------------------------------------------------------------------------LRV
A4HJL2_LEIBR/106-210-----------------------------------------------------------------------------MRG
CHO2_MAGO7/497-601-----------------------------------------------------------------------------LKH
CHO2_PICGU/462-570-----------------------------------------------------------------------------LRS
CHO2_LODEL/480-589-----------------------------------------------------------------------------LRI
A5UZK8_ROSS1/43-144-----------------------------------------------------------------------------GAL
A7TIE1_VANPO/140-243-----------------------------------------------------------------------------VKM
CHO22_VANPO/452-560-----------------------------------------------------------------------------TQI
CHO21_VANPO/439-547-----------------------------------------------------------------------------SHV
A8NIW8_COPC7/92-195-----------------------------------------------------------------------------ASK
CHO2_MALGO/537-642-----------------------------------------------------------------------------LRY
A8PVU2_MALGO/102-205-----------------------------------------------------------------------------VRV
A9B4Y9_HERA2/33-137-----------------------------------------------------------------------------PFN
A9V3D6_MONBE/125-229-----------------------------------------------------------------------------IFF
CHO2_LACBS/492-596-----------------------------------------------------------------------------LRH
B1MLL6_MYCA9/108-208-----------------------------------------------------------------------------WLV
B1WZT5_CYAA5/96-194-----------------------------------------------------------------------------FRL
B2AR50_PODAN/95-198-----------------------------------------------------------------------------VTY
CHO2_PODAN/496-600-----------------------------------------------------------------------------LKH
B2JAT8_NOSP7/42-145-----------------------------------------------------------------------------VAL
B2VTC6_PYRTR/87-190-----------------------------------------------------------------------------IKY
CHO2_PYRTR/425-530-----------------------------------------------------------------------------FRH
B3RI13_TRIAD/89-192-----------------------------------------------------------------------------FKF
CHO2_SCHJY/478-583-----------------------------------------------------------------------------FRH
B6QQY2_PENMQ/89-189-----------------------------------------------------------------------------I..
B8LBH8_THAPS/30-132-----------------------------------------------------------------------------ITT
B8PB22_POSPM/91-194-----------------------------------------------------------------------------DTL
CHO2_PICPG/450-564-----------------------------------------------------------------------------LRF
C4R5S7_PICPG/98-201-----------------------------------------------------------------------------FRY
CHO2_CLAL4/444-555-----------------------------------------------------------------------------LRI
C5DC91_LACTC/106-209-----------------------------------------------------------------------------VRK
CHO2_LACTC/450-558-----------------------------------------------------------------------------TQI
C5DZ83_ZYGRC/102-205-----------------------------------------------------------------------------IAV
CHO2_ZYGRC/430-538-----------------------------------------------------------------------------TQF
C5G0L0_ARTOC/115-215-----------------------------------------------------------------------------L..
C6WWJ2_METML/43-146-----------------------------------------------------------------------------VCR
C7YM51_NECH7/94-197-----------------------------------------------------------------------------VQA
CHO2_NECH7/505-609-----------------------------------------------------------------------------LKH
CHO2_SORMK/496-600-----------------------------------------------------------------------------LKH
E3I110_RHOVT/77-175-----------------------------------------------------------------------------WRF
D2U841_XANAP/75-178-----------------------------------------------------------------------------PAR
D2V512_NAEGR/65-168-----------------------------------------------------------------------------IMY
D2VYZ6_NAEGR/455-563-----------------------------------------------------------------------------TQL
D3AX06_POLPA/89-193-----------------------------------------------------------------------------ATL
D3BED6_POLPA/557-662-----------------------------------------------------------------------------WRQ
D3BN57_POLPA/99-202-----------------------------------------------------------------------------LQT
CHO2_SCHPO/491-596-----------------------------------------------------------------------------LRH
CHO1_SCHPO/110-213-----------------------------------------------------------------------------VQG
Q0AM70_MARMM/72-173-----------------------------------------------------------------------------ISL
Q0AQW8_MARMM/72-173-----------------------------------------------------------------------------VSL
CHO2_PHANO/462-567-----------------------------------------------------------------------------LRH
Q0UN81_PHANO/69-173-----------------------------------------------------------------------------SSN
Q11IW9_CHESB/45-148-----------------------------------------------------------------------------ILF
Q1GIY9_RUEST/78-176-----------------------------------------------------------------------------LRY
A0A0D1CJ51_USTMA/99-202-----------------------------------------------------------------------------VKP
PEMTL_DICDI/82-186-----------------------------------------------------------------------------ANM
PEM2_DICDI/98-201-----------------------------------------------------------------------------VEV
Q6C649_YARLI/97-200-----------------------------------------------------------------------------VKP
CHO2_YARLI/531-635-----------------------------------------------------------------------------LKY
CHO2_KLULA/451-559-----------------------------------------------------------------------------NTI
Q6CV75_KLULA/106-209-----------------------------------------------------------------------------FTY
Q6FUV4_CANGA/106-209-----------------------------------------------------------------------------ITN
CHO2_CANGA/431-540-----------------------------------------------------------------------------SQI
Q752Z0_ASHGO/100-203-----------------------------------------------------------------------------VRY
Q7ZVZ2_DANRE/120-223-----------------------------------------------------------------------------VYY
Q86IF9_DICDI/521-626-----------------------------------------------------------------------------WRQ
Q8TN26_METAC/121-221-----------------------------------------------------------------------------YIV
Q98I61_RHILO/42-146-----------------------------------------------------------------------------GFV
E7QGU3_YEASZ/100-199-----------------------------------------------------------------------------...
F1SB04_PIG/61-160-----------------------------------------------------------------------------...
F7BHJ5_XENTR/62-163-----------------------------------------------------------------------------..Y
G1MZ29_MELGA/96-197-----------------------------------------------------------------------------..H
CHO2_YEAST/471-577-----------------------------------------------------------------------------.QL
CHO2_CANAL/468-576-----------------------------------------------------------------------------LRV
Q5KDE7_CRYNJ/618-724-----------------------------------------------------------------------------LRH
Q5KHK0_CRYNJ/121-221-----------------------------------------------------------------------------...
Q8DW48_STRMU/70-169-----------------------------------------------------------------------------..I
Q8PE74_XANCP/100-199-----------------------------------------------------------------------------...

PF07298

B2JUD7_BURP8/3-190------------------------------------------------------------------------------IL
A1VI53_POLNA/3-190------------------------------------------------------------------------------ML
Q12HL7_POLSJ/3-190------------------------------------------------------------------------------VL
A2SBS8_METPP/3-190------------------------------------------------------------------------------VL
Q223I4_RHOFT/3-190------------------------------------------------------------------------------YL
A1K5T7_AZOSB/6-191------------------------------------------------------------------------------VL
A1WT38_HALHL/3-190------------------------------------------------------------------------------IL
A6VV32_MARMS/3-191------------------------------------------------------------------------------IL
Q0AQE8_MARMM/3-183------------------------------------------------------------------------------VL
A1AZI2_PARDP/3-180------------------------------------------------------------------------------IL
Q28U80_JANSC/6-185------------------------------------------------------------------------------LL
Q5LXD7_RUEPO/5-179------------------------------------------------------------------------------LL
Q1GLH3_RUEST/3-179------------------------------------------------------------------------------LL
A8LJK3_DINSH/5-184------------------------------------------------------------------------------VL
Q169U5_ROSDO/3-182------------------------------------------------------------------------------LL
A0KG00_AERHH/3-186------------------------------------------------------------------------------LL
Q6N9Q3_RHOPA/31-253------------------------------------------------------------------------------EF
Q219Y9_RHOPB/14-236------------------------------------------------------------------------------EF
Q5LUC0_RUEPO/7-220------------------------------------------------------------------------------EF
Q0C1Y5_HYPNA/14-233------------------------------------------------------------------------------EF
Q169M4_ROSDO/6-220------------------------------------------------------------------------------TF
A8LNX8_DINSH/42-256------------------------------------------------------------------------------EF
A9CGK0_AGRFC/3-221------------------------------------------------------------------------------EL
Q2JYB9_RHIEC/5-223------------------------------------------------------------------------------EF
Q92Z13_RHIME/3-221------------------------------------------------------------------------------EF
B0U8Q9_METS4/2-221------------------------------------------------------------------------------EF
Q2VYZ8_MAGSA/17-229------------------------------------------------------------------------------HL
Q60BH7_METCA/3-224------------------------------------------------------------------------------NL
A7HZ42_PARL1/3-227------------------------------------------------------------------------------QL
Q1GUJ7_SPHAL/6-226------------------------------------------------------------------------------LL
Q2GC12_NOVAD/7-219------------------------------------------------------------------------------PL
Q8DMH0_THEEB/15-236------------------------------------------------------------------------------IM
Q113R6_TRIEI/12-233------------------------------------------------------------------------------II
Q8YQ81_NOSS1/13-234------------------------------------------------------------------------------VM
Q9ALA6_SYNE7/12-229------------------------------------------------------------------------------IM
Q7V3C9_PROMP/9-231------------------------------------------------------------------------------LI
A9CI20_AGRFC/3-191------------------------------------------------------------------------------FL
Q92UK4_RHIME/3-191------------------------------------------------------------------------------IL
Q89MZ5_BRADU/5-191------------------------------------------------------------------------------VM
A7IF98_XANP2/3-187------------------------------------------------------------------------------MM
B0UL45_METS4/3-192------------------------------------------------------------------------------VL
Q0C445_HYPNA/3-190------------------------------------------------------------------------------YL
Q3JDP5_NITOC/3-187------------------------------------------------------------------------------QF
Q9AAA0_CAUCR/3-186------------------------------------------------------------------------------IL
Q11KH3_CHESB/3-188------------------------------------------------------------------------------VL
B4EFU3_BURCJ/3-190------------------------------------------------------------------------------VL
C5B332_METEA/3-195------------------------------------------------------------------------------VM
Q2JMU2_SYNJB/23-239------------------------------------------------------------------------------..
Q2K5L0_RHIEC/3-191------------------------------------------------------------------------------LL
Q3SR07_NITWN/1-185------------------------------------------------------------------------------.M
Q46HM6_PROMT/12-228------------------------------------------------------------------------------VM
Q63MK0_BURPS/3-190------------------------------------------------------------------------------VL

PF02544

Q19605_CAEEL/97-243VAAATF.FCAYNGFL-----------------------------------------------------------------
YN67_SCHPO/146-295IFKNCAHYHLLSGLF-----------------------------------------------------------------
Q20344_CAEEL/97-243VAAAVA.FCTYNGTL-----------------------------------------------------------------
S5A1_RAT/110-259FVLAFL.FCTFNGYV-----------------------------------------------------------------
S5A2_HUMAN/105-254ILRGTA.FCTGNGVL-----------------------------------------------------------------
PORED_CAEEL/189-309WAGAVL.FWICN...-----------------------------------------------------------------
Q23431_CAEEL/103-253VIMAFG.FSVLNGFI-----------------------------------------------------------------
DET2_ARATH/111-262AALAFT.FNLLNGYI-----------------------------------------------------------------
TECR_YEAST/154-310LFKNCFHYWVLSGLI-----------------------------------------------------------------
S5A1_HUMAN/110-259CTMAIM.FCTCNGYL-----------------------------------------------------------------

PF06966

YJD4_SCHPO/67-320WPILPTAFSLHFLFYG....LGYNIASRR---------------------------------------------------
Q10E47_ORYSJ/24-252GSTNFIILAILTLAL......KGA.WHFR---------------------------------------------------
Q8PAZ9_XANCP/20-250WAGCLAVAAPYCAWM......SEG.ALLP---------------------------------------------------
Q9A3U2_CAUCR/70-299WGPSMALLAWSTLL.......QGA.HTPH---------------------------------------------------
Q9VSM5_DROME/25-264GGVNFIIISLLTFFLGQIDRPSKA.YDSR---------------------------------------------------
Q9CHY6_LACLA/17-245WGGGFVLTAVVSYLF......SPR.ITIQ---------------------------------------------------
Q7CY59_AGRFC/19-248WSASVGLGGVLAVLF......AEG.DGWR---------------------------------------------------
O81042_ARATH/64-303WTVIPVMLVHYFASH.....PLSQYNKLR---------------------------------------------------
O53731_MYCTU/17-243WGLGFVAVAVAAATL......GHG.DPVR---------------------------------------------------
Q8Y9D9_LISMO/16-244WGGGFVVVAWTGFLT......TFS.VTTQ---------------------------------------------------
Q984A1_RHILO/21-257WSFAVGIIGAFLALVP....FVEGDNDHR---------------------------------------------------
B9DFE9_ARATH/24-252GSTNFVILAVLTLVL......KAS.WHFR---------------------------------------------------

PF01222

LBR_CHICK/175-609FGVFLLWFFFQALFYLLPIGKVVEGLPLS..NPRKLQYRINGFYA...FLLTAAAIGTLLYFQ.FELHYLYDHFVQFAVS
ERG24_NEUCR/17-490WTLG..YYALSLVQYRFLPGHHVEGTELS..TGGRLKYKLNAFNSAMCTLAILAAGTIAQGAEFPVWTFISDNFAQIISA
STS1_SCHPO/7-453FLVFWSFCIVQAVMYLTLPGVRTQGLPLKHRNNERLPYLCNAIWS...FYTTIVILAVLHVTHVFPITTFIDMFGPLMSV
ERG4_YEAST/34-473WTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWT...LYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTC
ERG24_YEAST/8-438WTVYCLWYGILAVLDVILPGRVMKGVQLR..DGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCII

PF04140

Q9EWQ7_STRCO/75-167MLAL..ALS-----------------------------------------------------------------------
Q99YI2_STRP1/81-173LLLM...LL-----------------------------------------------------------------------
P91402_CAEEL/171-267WIGTLGCII-----------------------------------------------------------------------
Q9KF68_BACHD/72-166AIPFAWFLF-----------------------------------------------------------------------
MAM4_SCHPO/121-215ALGF.L.CL-----------------------------------------------------------------------
Q9CM58_PASMU/75-167LAIL...VF-----------------------------------------------------------------------
ICMT_HUMAN/161-257VTGLLMVVF-----------------------------------------------------------------------
STE14_YEAST/123-219VLGCLLVIL-----------------------------------------------------------------------
Q9RTL5_DEIRA/91-184ALLL..FLA-----------------------------------------------------------------------
B6IT05_RHOCS/73-163.LAL..FVL-----------------------------------------------------------------------
F7EBZ7_XENTR/175-268.LIM..VLF-----------------------------------------------------------------------
Q2G1E3_STAA8/100-189.V.I..LIF-----------------------------------------------------------------------

PF04191

A4HJV7_LEIBR/438-543MVGMLLVGI-----------------------------------------------------------------------
PEMT_HUMAN/89-192L.GLALLGL-----------------------------------------------------------------------
CHO2_ASPCL/504-608VLGAGLISL-----------------------------------------------------------------------
A1CQK4_ASPCL/70-170..GAVLFGI-----------------------------------------------------------------------
A3LQ40_PICST/106-209A.AVATFGL-----------------------------------------------------------------------
CHO2_PICST/449-558FVGLLLIFT-----------------------------------------------------------------------
A4HJL2_LEIBR/106-210T.GTALLLS-----------------------------------------------------------------------
CHO2_MAGO7/497-601VTGTGLVAL-----------------------------------------------------------------------
CHO2_PICGU/462-570FLGALLILT-----------------------------------------------------------------------
CHO2_LODEL/480-589FIGTLLIFT-----------------------------------------------------------------------
A5UZK8_ROSS1/43-144IVGVVLCGC-----------------------------------------------------------------------
A7TIE1_VANPO/140-243V.GVTLFGF-----------------------------------------------------------------------
CHO22_VANPO/452-560IFGGILCAI-----------------------------------------------------------------------
CHO21_VANPO/439-547IFGLLLCAI-----------------------------------------------------------------------
A8NIW8_COPC7/92-195I.AVVLFGL-----------------------------------------------------------------------
CHO2_MALGO/537-642VLGVLLILV-----------------------------------------------------------------------
A8PVU2_MALGO/102-205L.AVVLIAS-----------------------------------------------------------------------
A9B4Y9_HERA2/33-137WLGLVIGIA-----------------------------------------------------------------------
A9V3D6_MONBE/125-229AVGAATVLV-----------------------------------------------------------------------
CHO2_LACBS/492-596TLGALLVGL-----------------------------------------------------------------------
B1MLL6_MYCA9/108-208IVGEVLTIG-----------------------------------------------------------------------
B1WZT5_CYAA5/96-194IIGGILLIS-----------------------------------------------------------------------
B2AR50_PODAN/95-198A.AYALLAL-----------------------------------------------------------------------
CHO2_PODAN/496-600VIGVSLIAL-----------------------------------------------------------------------
B2JAT8_NOSP7/42-145ALGVLAIIC-----------------------------------------------------------------------
B2VTC6_PYRTR/87-190S.AIPLFLM-----------------------------------------------------------------------
CHO2_PYRTR/425-530VLGAGMIAL-----------------------------------------------------------------------
B3RI13_TRIAD/89-192I.GTALMVV-----------------------------------------------------------------------
CHO2_SCHJY/478-583VLGLTFIAL-----------------------------------------------------------------------
B6QQY2_PENMQ/89-189..AYGLFAT-----------------------------------------------------------------------
B8LBH8_THAPS/30-132FLGPSMILL-----------------------------------------------------------------------
B8PB22_POSPM/91-194V.PAALFAI-----------------------------------------------------------------------
CHO2_PICPG/450-564ILAALMILG-----------------------------------------------------------------------
C4R5S7_PICPG/98-201L.GIASFLF-----------------------------------------------------------------------
CHO2_CLAL4/444-555FLGLLLIIT-----------------------------------------------------------------------
C5DC91_LACTC/106-209A.GMVLSAF-----------------------------------------------------------------------
CHO2_LACTC/450-558IFGFLLCWL-----------------------------------------------------------------------
C5DZ83_ZYGRC/102-205A.GRFLAII-----------------------------------------------------------------------
CHO2_ZYGRC/430-538IFGLLLCAV-----------------------------------------------------------------------
C5G0L0_ARTOC/115-215..AYGLFAT-----------------------------------------------------------------------
C6WWJ2_METML/43-146EVGVLLFVL-----------------------------------------------------------------------
C7YM51_NECH7/94-197A.ALTLFAV-----------------------------------------------------------------------
CHO2_NECH7/505-609VLGAGLVAL-----------------------------------------------------------------------
CHO2_SORMK/496-600VVGLGLIAL-----------------------------------------------------------------------
E3I110_RHOVT/77-175LAGMICVVI-----------------------------------------------------------------------
D2U841_XANAP/75-178WLGCALLIG-----------------------------------------------------------------------
D2V512_NAEGR/65-168G.GYALQVI-----------------------------------------------------------------------
D2VYZ6_NAEGR/455-563VAGIILILL-----------------------------------------------------------------------
D3AX06_POLPA/89-193L.GNSCFIF-----------------------------------------------------------------------
D3BED6_POLPA/557-662IIGILLILL-----------------------------------------------------------------------
D3BN57_POLPA/99-202V.SYALYAI-----------------------------------------------------------------------
CHO2_SCHPO/491-596ALGFGLIAL-----------------------------------------------------------------------
CHO1_SCHPO/110-213I.AKLIFCF-----------------------------------------------------------------------
Q0AM70_MARMM/72-173ALGGGLFLG-----------------------------------------------------------------------
Q0AQW8_MARMM/72-173AAGGLLLVA-----------------------------------------------------------------------
CHO2_PHANO/462-567VLGAGLLLL-----------------------------------------------------------------------
Q0UN81_PHANO/69-173TLPIPLFLT-----------------------------------------------------------------------
Q11IW9_CHESB/45-148AAGWLIGLA-----------------------------------------------------------------------
Q1GIY9_RUEST/78-176AVGLPLMVM-----------------------------------------------------------------------
A0A0D1CJ51_USTMA/99-202V.AALLFAS-----------------------------------------------------------------------
PEMTL_DICDI/82-186I.GDSCFIF-----------------------------------------------------------------------
PEM2_DICDI/98-201L.SYILYGF-----------------------------------------------------------------------
Q6C649_YARLI/97-200L.AIVLFAV-----------------------------------------------------------------------
CHO2_YARLI/531-635ILGALLIAL-----------------------------------------------------------------------
CHO2_KLULA/451-559TFGLLLLAI-----------------------------------------------------------------------
Q6CV75_KLULA/106-209V.GIAYIAF-----------------------------------------------------------------------
Q6FUV4_CANGA/106-209I.GYAFLIV-----------------------------------------------------------------------
CHO2_CANGA/431-540IFGLICCAL-----------------------------------------------------------------------
Q752Z0_ASHGO/100-203A.GAGLFVF-----------------------------------------------------------------------
Q7ZVZ2_DANRE/120-223A.GAALMAV-----------------------------------------------------------------------
Q86IF9_DICDI/521-626ILGLMLILI-----------------------------------------------------------------------
Q8TN26_METAC/121-221IAGDMLVVL-----------------------------------------------------------------------
Q98I61_RHILO/42-146PVGGVLIVA-----------------------------------------------------------------------
E7QGU3_YEASZ/100-199.LGVALFGL-----------------------------------------------------------------------
F1SB04_PIG/61-160.LGLALLGV-----------------------------------------------------------------------
F7BHJ5_XENTR/62-163YLSWMLIGA-----------------------------------------------------------------------
G1MZ29_MELGA/96-197YSGLAIMAV-----------------------------------------------------------------------
CHO2_YEAST/471-577IFGLILVAL-----------------------------------------------------------------------
CHO2_CANAL/468-576FLGLLLIYT-----------------------------------------------------------------------
Q5KDE7_CRYNJ/618-724VLGLSLIAL-----------------------------------------------------------------------
Q5KHK0_CRYNJ/121-221AAAIALFAS-----------------------------------------------------------------------
Q8DW48_STRMU/70-169YLGILLMIL-----------------------------------------------------------------------
Q8PE74_XANCP/100-199.GACALIAG-----------------------------------------------------------------------

PF07298

B2JUD7_BURP8/3-190ILGLLIFLGGHSVRI-----------------------------------------------------------------
A1VI53_POLNA/3-190ILGLVLFLGVHSTRI-----------------------------------------------------------------
Q12HL7_POLSJ/3-190ILGLILFLGVHSTRI-----------------------------------------------------------------
A2SBS8_METPP/3-190ILGLVLFLGTHSVRI-----------------------------------------------------------------
Q223I4_RHOFT/3-190ILGLIVFLGVHSVRI-----------------------------------------------------------------
A1K5T7_AZOSB/6-191VLGLLLFLGPHSLRI-----------------------------------------------------------------
A1WT38_HALHL/3-190LLGLILFLGTHSVRV-----------------------------------------------------------------
A6VV32_MARMS/3-191VMGLVIFFFVHSVRL-----------------------------------------------------------------
Q0AQE8_MARMM/3-183TAGLVLFLGVHCLRL-----------------------------------------------------------------
A1AZI2_PARDP/3-180ILGLALWWGAHLFKR-----------------------------------------------------------------
Q28U80_JANSC/6-185IAGLALWVAAHAWKR-----------------------------------------------------------------
Q5LXD7_RUEPO/5-179ILGIAVWWAAHLFKR-----------------------------------------------------------------
Q1GLH3_RUEST/3-179ILGIILWWGAHLFKR-----------------------------------------------------------------
A8LJK3_DINSH/5-184IAGLALWAGAHYFKR-----------------------------------------------------------------
Q169U5_ROSDO/3-182IAGLILWIAAHYFKR-----------------------------------------------------------------
A0KG00_AERHH/3-186TLGVLLFTLIHLYPC-----------------------------------------------------------------
Q6N9Q3_RHOPA/31-253VAAFAVFLLSHAIPA-----------------------------------------------------------------
Q219Y9_RHOPB/14-236IAAFAVFLASHAVPS-----------------------------------------------------------------
Q5LUC0_RUEPO/7-220VAALAVFLLSHVIPV-----------------------------------------------------------------
Q0C1Y5_HYPNA/14-233LGAALVFLVSHALPA-----------------------------------------------------------------
Q169M4_ROSDO/6-220AGVFALFFATHSIPV-----------------------------------------------------------------
A8LNX8_DINSH/42-256ILAFTVFFLSHGVPV-----------------------------------------------------------------
A9CGK0_AGRFC/3-221VAALSLFVALHSVPA-----------------------------------------------------------------
Q2JYB9_RHIEC/5-223LAAFALFVALHSIPA-----------------------------------------------------------------
Q92Z13_RHIME/3-221LLALFVFLTLHSIPA-----------------------------------------------------------------
B0U8Q9_METS4/2-221AAALATFLVAHSVPA-----------------------------------------------------------------
Q2VYZ8_MAGSA/17-229VLSVAAFLGAHSLSN-----------------------------------------------------------------
Q60BH7_METCA/3-224ALAMLFFVGIHFLIS-----------------------------------------------------------------
A7HZ42_PARL1/3-227WAAAAFFLGIHLVIA-----------------------------------------------------------------
Q1GUJ7_SPHAL/6-226ITTCVLFVGTHLLM.-----------------------------------------------------------------
Q2GC12_NOVAD/7-219AAATSCFVGSHFLL.-----------------------------------------------------------------
Q8DMH0_THEEB/15-236VGLLLLFAIAHSG..-----------------------------------------------------------------
Q113R6_TRIEI/12-233LGLLLSFAIAHSG..-----------------------------------------------------------------
Q8YQ81_NOSS1/13-234LGLQLTFAIAHSG..-----------------------------------------------------------------
Q9ALA6_SYNE7/12-229LALLLLFAIAHSG..-----------------------------------------------------------------
Q7V3C9_PROMP/9-231LGLILIFAVIHSG..-----------------------------------------------------------------
A9CI20_AGRFC/3-191VLCLALFLLTHLLKV-----------------------------------------------------------------
Q92UK4_RHIME/3-191VLGIIIFLGMHLVRV-----------------------------------------------------------------
Q89MZ5_BRADU/5-191ILGLVLFFAAHVFTT-----------------------------------------------------------------
A7IF98_XANP2/3-187LFGLLVFLGIHVVGS-----------------------------------------------------------------
B0UL45_METS4/3-192LLGLALFLGTHAFTM-----------------------------------------------------------------
Q0C445_HYPNA/3-190ILGLIIFFGAHLFSA-----------------------------------------------------------------
Q3JDP5_NITOC/3-187LLGLALFFGMHSISI-----------------------------------------------------------------
Q9AAA0_CAUCR/3-186VLGLVLFLGIHSVRI-----------------------------------------------------------------
Q11KH3_CHESB/3-188VLGLVLFLGVHSVRI-----------------------------------------------------------------
B4EFU3_BURCJ/3-190ILGLAIFLGVHSVRI-----------------------------------------------------------------
C5B332_METEA/3-195ILGLVLFLGTHAFSM-----------------------------------------------------------------
Q2JMU2_SYNJB/23-239LALILGFACAHSG..-----------------------------------------------------------------
Q2K5L0_RHIEC/3-191IVGIILFLGVHLVRV-----------------------------------------------------------------
Q3SR07_NITWN/1-185IAGLVLSLGVHLVVT-----------------------------------------------------------------
Q46HM6_PROMT/12-228ILLLFCFAVIHSG..-----------------------------------------------------------------
Q63MK0_BURPS/3-190ILGLVIFLGTHSIRL-----------------------------------------------------------------

PF02544

Q19605_CAEEL/97-243-----------------QGY--------------------------WNAFYQP.....-----...EEPWTT--------
YN67_SCHPO/146-295-----------------LA.--------------------------.YFIYGPWH...-----...ANDYIK--------
Q20344_CAEEL/97-243-----------------QGV--------------------------WNSYYQL.....-----...EEELTY--------
S5A1_RAT/110-259-----------------QSR--------------------------YLSQFAVY....-----...AEDWVT--------
S5A2_HUMAN/105-254-----------------QGY--------------------------YLIYCAEY....-----...PDGWYT--------
PORED_CAEEL/189-309-----------------...--------------------------.WKQHQL.....-----...AEQIAN--------
Q23431_CAEEL/103-253-----------------QGT--------------------------WNAFYQPE....-----...FDTLHP--------
DET2_ARATH/111-262-----------------QAR--------------------------WVSHYKD..DYE-----...DGNWFW--------
TECR_YEAST/154-310-----------------SFG--------------------------YFGYGFPFGNAK-----LFKYYSYLK--------
S5A1_HUMAN/110-259-----------------QSR--------------------------YLSHCAVY....-----...ADDWVT--------

PF06966

YJD4_SCHPO/67-320----LMIMAFLQTLWSARLT--------------------------YNYYRKGGYNRG-----.AEDYRWVRVRQIMPKW
Q10E47_ORYSJ/24-252----QVVLTVLVVIWGLRLG--------------------------LFLLMR.ILQWG-----..EDKRFDEMRDNLG..
Q8PAZ9_XANCP/20-250----RVLVAVLGGVWGARLA--------------------------WHLGVR.VFGDP-----.HEDGRYRALREHWNGD
Q9A3U2_CAUCR/70-299----GLLLTGLCTLWAARLG--------------------------LYLLWR.WRKHG-----..ADRRYVAIFAHYEKT
Q9VSM5_DROME/25-264----QLMVTLFVCLWGARLS--------------------------GYLLYR.IVKLG-----..RDKQFEDTRRNI...
Q9CHY6_LACLA/17-245----NSLILVLVILWGVRLA--------------------------IHLGRR.NWNKP-----..EDYRYTNMRKRWGNN
Q7CY59_AGRFC/19-248----RAVVFFLVVVWSLRLA--------------------------GHIGMR.TRGGG-----..EDPRYAKLIEEWGSA
O81042_ARATH/64-303----SMIVITLTWIWSIRLT--------------------------HNYFRRENWEWG-----AREDWRFNDLRKQYGKH
O53731_MYCTU/17-243----RWLLLALVSTWGLRLS--------------------------WHMYRK.TAGQG-----..EDPRYADLLR..GAT
Q8Y9D9_LISMO/16-244----SITILILVTLWGVRLF--------------------------WHLARR.NWNKP-----..EDYRYVNMRKRWGTT
Q984A1_RHILO/21-257----RWLVALLALVWSLRLG--------------------------VHIAGR.TIGDS-----.RDDPRYRQLKQQWGAS
B9DFE9_ARATH/24-252----QIVLTLLVVVWGLRLG--------------------------IFLLMR.ILQWG-----..EDRRFDEQRGNIV..

PF01222

LBR_CHICK/175-609AAAFSMALSIYLYIRSLKAPE..........EDLAPGGNSGYLVYDFFTGHELNPRIG.....SFDLKYFCELRPGLIGW
ERG24_NEUCR/17-490NILFAFALAIFVYVRSFDVKPGNKD.....MRQLAAGGVTGSLIYDFYIGRELNPRITLPLIGQVDIKEFMEMRPGLLGW
STS1_SCHPO/7-453AIITAFVCTFVLYTGTLLFGDRLFD.........KPHRLSGNPIYDAFMGACLNPRLG....KLLDFKMFFEVRIPWFIL
ERG4_YEAST/34-473AIISGFAFSIILYLWTLFISH.............DYHRMTGNHLYDFFMGAPLNPRWG.....ILDLKMFFEVRLPWFTL
ERG24_YEAST/8-438SILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLG.....PLDIKMFSELRPGMLLW

PF04140

Q9EWQ7_STRCO/75-167-------------------------------------------------------------------AQALRW-------
Q99YI2_STRP1/81-173-------------------------------------------------------------------SVAVLY-------
P91402_CAEEL/171-267-------------------------------------------------------------------GEIFRK-------
Q9KF68_BACHD/72-166-------------------------------------------------------------------AQILRL-------
MAM4_SCHPO/121-215-------------------------------------------------------------------GQYLRS-------
Q9CM58_PASMU/75-167-------------------------------------------------------------------AIAMLF-------
ICMT_HUMAN/161-257-------------------------------------------------------------------GECLRK-------
STE14_YEAST/123-219-------------------------------------------------------------------GQYTRT-------
Q9RTL5_DEIRA/91-184-------------------------------------------------------------------LQPLRY-------
B6IT05_RHOCS/73-163-------------------------------------------------------------------LQAGRV-------
F7EBZ7_XENTR/175-268-------------------------------------------------------------------GELLRK-------
Q2G1E3_STAA8/100-189-------------------------------------------------------------------AYIMLF-------

PF04191

A4HJV7_LEIBR/438-543-------------------------------------------------------------------NGYVSW-------
PEMT_HUMAN/89-192-------------------------------------------------------------------GVVLVL-------
CHO2_ASPCL/504-608-------------------------------------------------------------------QIWTSV-------
A1CQK4_ASPCL/70-170-------------------------------------------------------------------GSILVL-------
A3LQ40_PICST/106-209-------------------------------------------------------------------GNIFVL-------
CHO2_PICST/449-558-------------------------------------------------------------------QSWINS-------
A4HJL2_LEIBR/106-210-------------------------------------------------------------------GTTLVV-------
CHO2_MAGO7/497-601-------------------------------------------------------------------QIWTAV-------
CHO2_PICGU/462-570-------------------------------------------------------------------QVWINS-------
CHO2_LODEL/480-589-------------------------------------------------------------------QTWINA-------
A5UZK8_ROSS1/43-144-------------------------------------------------------------------GAMLAG-------
A7TIE1_VANPO/140-243-------------------------------------------------------------------GQLLVL-------
CHO22_VANPO/452-560-------------------------------------------------------------------QMWCNS-------
CHO21_VANPO/439-547-------------------------------------------------------------------QIWCNV-------
A8NIW8_COPC7/92-195-------------------------------------------------------------------GQLFVI-------
CHO2_MALGO/537-642-------------------------------------------------------------------HMWSAR-------
A8PVU2_MALGO/102-205-------------------------------------------------------------------GTVFVL-------
A9B4Y9_HERA2/33-137-------------------------------------------------------------------GLAVAI-------
A9V3D6_MONBE/125-229-------------------------------------------------------------------GTVLTS-------
CHO2_LACBS/492-596-------------------------------------------------------------------HVWASM-------
B1MLL6_MYCA9/108-208-------------------------------------------------------------------GLGMAT-------
B1WZT5_CYAA5/96-194-------------------------------------------------------------------GFFLAF-------
B2AR50_PODAN/95-198-------------------------------------------------------------------GNILVI-------
CHO2_PODAN/496-600-------------------------------------------------------------------QLWTSS-------
B2JAT8_NOSP7/42-145-------------------------------------------------------------------AGLIVT-------
B2VTC6_PYRTR/87-190-------------------------------------------------------------------GNTLVL-------
CHO2_PYRTR/425-530-------------------------------------------------------------------QVWTAM-------
B3RI13_TRIAD/89-192-------------------------------------------------------------------GTILVL-------
CHO2_SCHJY/478-583-------------------------------------------------------------------HIYTSV-------
B6QQY2_PENMQ/89-189-------------------------------------------------------------------GNVLVL-------
B8LBH8_THAPS/30-132-------------------------------------------------------------------GLFIVY-------
B8PB22_POSPM/91-194-------------------------------------------------------------------GQVFVV-------
CHO2_PICPG/450-564-------------------------------------------------------------------QFLTVH-------
C4R5S7_PICPG/98-201-------------------------------------------------------------------GNVLVL-------
CHO2_CLAL4/444-555-------------------------------------------------------------------QVMINT-------
C5DC91_LACTC/106-209-------------------------------------------------------------------GQVLVA-------
CHO2_LACTC/450-558-------------------------------------------------------------------QKWCDD-------
C5DZ83_ZYGRC/102-205-------------------------------------------------------------------GQVLVA-------
CHO2_ZYGRC/430-538-------------------------------------------------------------------QTWCNA-------
C5G0L0_ARTOC/115-215-------------------------------------------------------------------GNVLVL-------
C6WWJ2_METML/43-146-------------------------------------------------------------------SSFLAR-------
C7YM51_NECH7/94-197-------------------------------------------------------------------GNVLVV-------
CHO2_NECH7/505-609-------------------------------------------------------------------QLWTAF-------
CHO2_SORMK/496-600-------------------------------------------------------------------QVWTAT-------
E3I110_RHOVT/77-175-------------------------------------------------------------------GFGFTI-------
D2U841_XANAP/75-178-------------------------------------------------------------------GLALRL-------
D2V512_NAEGR/65-168-------------------------------------------------------------------GSLLVM-------
D2VYZ6_NAEGR/455-563-------------------------------------------------------------------NIYQST-------
D3AX06_POLPA/89-193-------------------------------------------------------------------GILLNI-------
D3BED6_POLPA/557-662-------------------------------------------------------------------NVWSSV-------
D3BN57_POLPA/99-202-------------------------------------------------------------------GGILVG-------
CHO2_SCHPO/491-596-------------------------------------------------------------------HIYTSV-------
CHO1_SCHPO/110-213-------------------------------------------------------------------GSVLVL-------
Q0AM70_MARMM/72-173-------------------------------------------------------------------GAYVIF-------
Q0AQW8_MARMM/72-173-------------------------------------------------------------------GAGVIA-------
CHO2_PHANO/462-567-------------------------------------------------------------------QLWTST-------
Q0UN81_PHANO/69-173-------------------------------------------------------------------GNTLVL-------
Q11IW9_CHESB/45-148-------------------------------------------------------------------GLSINI-------
Q1GIY9_RUEST/78-176-------------------------------------------------------------------AFGITL-------
A0A0D1CJ51_USTMA/99-202-------------------------------------------------------------------GNIFVL-------
PEMTL_DICDI/82-186-------------------------------------------------------------------GILLNI-------
PEM2_DICDI/98-201-------------------------------------------------------------------GGILVL-------
Q6C649_YARLI/97-200-------------------------------------------------------------------GNVLVL-------
CHO2_YARLI/531-635-------------------------------------------------------------------HGWTSK-------
CHO2_KLULA/451-559-------------------------------------------------------------------QIWCNT-------
Q6CV75_KLULA/106-209-------------------------------------------------------------------GQLLVL-------
Q6FUV4_CANGA/106-209-------------------------------------------------------------------GQILVI-------
CHO2_CANGA/431-540-------------------------------------------------------------------QIWCNT-------
Q752Z0_ASHGO/100-203-------------------------------------------------------------------GQVLVL-------
Q7ZVZ2_DANRE/120-223-------------------------------------------------------------------GSLLVI-------
Q86IF9_DICDI/521-626-------------------------------------------------------------------NLWSSL-------
Q8TN26_METAC/121-221-------------------------------------------------------------------GYFLIF-------
Q98I61_RHILO/42-146-------------------------------------------------------------------AAAVLL-------
E7QGU3_YEASZ/100-199-------------------------------------------------------------------GQVLVL-------
F1SB04_PIG/61-160-------------------------------------------------------------------GSVFVL-------
F7BHJ5_XENTR/62-163-------------------------------------------------------------------GGVLVV-------
G1MZ29_MELGA/96-197-------------------------------------------------------------------GTLFVI-------
CHO2_YEAST/471-577-------------------------------------------------------------------QTWCDK-------
CHO2_CANAL/468-576-------------------------------------------------------------------QFWINF-------
Q5KDE7_CRYNJ/618-724-------------------------------------------------------------------HIWSAV-------
Q5KHK0_CRYNJ/121-221-------------------------------------------------------------------GQTFVI-------
Q8DW48_STRMU/70-169-------------------------------------------------------------------GIIFRV-------
Q8PE74_XANCP/100-199-------------------------------------------------------------------GLGLRV-------

PF07298

B2JUD7_BURP8/3-190----------------------------------------------FAEGWRKATI.E-----RMGAKNWKAA-------
A1VI53_POLNA/3-190----------------------------------------------VADGWRTAMI.G-----RLGEKRWKGL-------
Q12HL7_POLSJ/3-190----------------------------------------------VADGWRTQMI.A-----KVGEKPWKGV-------
A2SBS8_METPP/3-190----------------------------------------------FAEPWRTRTL.A-----RVGEARWKAA-------
Q223I4_RHOFT/3-190----------------------------------------------VADDWRTQTR.A-----RIGPLAWKGL-------
A1K5T7_AZOSB/6-191----------------------------------------------FADDWRHRRV.A-----ALGEKRWKGI-------
A1WT38_HALHL/3-190----------------------------------------------VADDWRSNQI.A-----AYGEIPWKTA-------
A6VV32_MARMS/3-191----------------------------------------------VAPNWREKSM.A-----IHGEMRWKMR-------
Q0AQE8_MARMM/3-183----------------------------------------------.VPGLRDTLQ.A-----RLGATPYKLT-------
A1AZI2_PARDP/3-180----------------------------------------------LAPQRR.....A-----VMGDRG.KGV-------
Q28U80_JANSC/6-185----------------------------------------------VAPAHR.....A-----SFGDKG.KGI-------
Q5LXD7_RUEPO/5-179----------------------------------------------AMPARR.....A-----AMGDRG.KGM-------
Q1GLH3_RUEST/3-179----------------------------------------------VAPAQR.....A-----SLGDKG.RGL-------
A8LJK3_DINSH/5-184----------------------------------------------LMPAQR.....A-----AMGDKG.KAV-------
Q169U5_ROSDO/3-182----------------------------------------------LMPQQR.....A-----AMGNAG.KGG-------
A0KG00_AERHH/3-186----------------------------------------------FAGAHRARLR.E-----RLGENRYKGL-------
Q6N9Q3_RHOPA/31-253----------------------------------------------.RPAVRARLV.G-----ALGERGFLIA-------
Q219Y9_RHOPB/14-236----------------------------------------------.RPAVRAAMV.A-----RLGERGFLAL-------
Q5LUC0_RUEPO/7-220----------------------------------------------.RPPVRPWLV.A-----RLGARGFGIA-------
Q0C1Y5_HYPNA/14-233----------------------------------------------.RPGIRIRLV.S-----LLGRWAYLAL-------
Q169M4_ROSDO/6-220----------------------------------------------.RPPVKKRLV.R-----HLGAKGFTTA-------
A8LNX8_DINSH/42-256----------------------------------------------.RPPMRPWLE.A-----RLGARGFTLA-------
A9CGK0_AGRFC/3-221----------------------------------------------.VPAVRGRLI.A-----AVGRPAYLGA-------
Q2JYB9_RHIEC/5-223----------------------------------------------.VPTIRAEII.R-----RVGRPVYFVG-------
Q92Z13_RHIME/3-221----------------------------------------------.IPAIRERLL.F-----LLGRAGYFSL-------
B0U8Q9_METS4/2-221----------------------------------------------.VPRLRGRLV.A-----RLGRRAYLVA-------
Q2VYZ8_MAGSA/17-229----------------------------------------------.WKPLRGPIE.A-----RYGKAGFYAG-------
Q60BH7_METCA/3-224----------------------------------------------.GTSLRDRLV.A-----YRGEQAFRAA-------
A7HZ42_PARL1/3-227----------------------------------------------.GSGARGRIV.A-----TIGERAWLAL-------
Q1GUJ7_SPHAL/6-226----------------------------------------------.SHPLRAGLA.S-----RLGERGFQIV-------
Q2GC12_NOVAD/7-219----------------------------------------------.SGPLRRVIA.K-----SLGRPTYLTI-------
Q8DMH0_THEEB/15-236----------------------------------------------.LASLRPWAE.K-----RLGARLYRIF-------
Q113R6_TRIEI/12-233----------------------------------------------.LAALRSWAE.N-----KIGPRLYRIL-------
Q8YQ81_NOSS1/13-234----------------------------------------------.GAALRPWAE.K-----YTGPRLYRIF-------
Q9ALA6_SYNE7/12-229----------------------------------------------.LAALRPWGE.T-----KIGARGYRIL-------
Q7V3C9_PROMP/9-231----------------------------------------------.GAALRSRAE.A-----FMGARLWRLL-------
A9CI20_AGRFC/3-191----------------------------------------------VAPQFRARMI.A-----AMGEGPFKGV-------
Q92UK4_RHIME/3-191----------------------------------------------VAPGFRAGII.D-----SRGKGTWMGL-------
Q89MZ5_BRADU/5-191----------------------------------------------.KREARAQAI.A-----RLGEGTYKIL-------
A7IF98_XANP2/3-187----------------------------------------------.LRGLRAKLI.A-----QVGEAAYKGF-------
B0UL45_METS4/3-192----------------------------------------------.LRGPRAALI.A-----RVGEGPYKLG-------
Q0C445_HYPNA/3-190----------------------------------------------FRSRAPGRDIRE-----KLGYGPYMGL-------
Q3JDP5_NITOC/3-187----------------------------------------------VALPLRDQL..A-----AKSEIGWKIL-------
Q9AAA0_CAUCR/3-186----------------------------------------------LAAPLRDAQV.A-----A.NPKRWRGL-------
Q11KH3_CHESB/3-188----------------------------------------------AAPQFRDRVV.G-----SRGLGAWKGI-------
B4EFU3_BURCJ/3-190----------------------------------------------VADGWRSATI.D-----RIGEKGWKGG-------
C5B332_METEA/3-195----------------------------------------------.ARAKRGEVI.G-----RIGEGRFKLG-------
Q2JMU2_SYNJB/23-239----------------------------------------------.LAYLRPWGE.S-----RLGSRLYRIF-------
Q2K5L0_RHIEC/3-191----------------------------------------------VAPDLRRSMI.A-----SLGEKGWRAG-------
Q3SR07_NITWN/1-185----------------------------------------------.RREFRARLI.S-----SYGEGPYKIG-------
Q46HM6_PROMT/12-228----------------------------------------------.GAALRVKAE.S-----VIGARAWRLI-------
Q63MK0_BURPS/3-190----------------------------------------------VAGDWRAAQI.A-----TLGEPRWKGI-------

PF02544

Q19605_CAEEL/97-243--------------------------------------------------..RKLVGS----------------------
YN67_SCHPO/146-295--------------------------------------------------PNHLLFLI----------------------
Q20344_CAEEL/97-243--------------------------------------------------..RHLIGS----------------------
S5A1_RAT/110-259--------------------------------------------------HPCFLTGF----------------------
S5A2_HUMAN/105-254--------------------------------------------------DIRFSLGV----------------------
PORED_CAEEL/189-309--------------------------------------------------........----------------------
Q23431_CAEEL/103-253--------------------------------------------------KFFVFLGA----------------------
DET2_ARATH/111-262--------------------------------------------------.WRFVIGM----------------------
TECR_YEAST/154-310--------------------------------------------------LDDLSTLI----------------------
S5A1_HUMAN/110-259--------------------------------------------------DPRFLIGF----------------------

PF06966

YJD4_SCHPO/67-320.....IYPLFHYFYIHIFQVLHLYLLAS--PTYIAMLAGNER.....AF.GAWDWIAL----------------------
Q10E47_ORYSJ/24-252.........KLAV.FWIFQAVWVWTVSL--PVTIVNASDSDP.....SI.EARDIIGW----------------------
Q8PAZ9_XANCP/20-250.......QRKFLG.FFLAQAMVVVLFSV--PFLAA.ASNPNP.....AW.SVWSSLAI----------------------
Q9A3U2_CAUCR/70-299KRWNFAT.TSLII.VFGLQAVLSYFVAL--PVQLGQGP........GVL.GGLAYAGA----------------------
Q9VSM5_DROME/25-264........IRYAV.FWTFQAVWVYIVSL--PVIIINSPRHSQPRAPKTM.TTLDSTGT----------------------
Q9CHY6_LACLA/17-245....FPKLKAFLT.VFMVQYLLLIIISL--PIIQVN.SNVNS.....QF.YWWQILGI----------------------
Q7CY59_AGRFC/19-248......ASLRLFI.FLQIQAIAAFILVL--AVYLATG..NGQ.....VFPRVIDVFAT----------------------
O81042_ARATH/64-303....WWWL.SFFS.VYVSQQIFLIGICL--PLYVIHS.....I..DEPL.NIWDFISS----------------------
O53731_MYCTU/17-243.....PVQ.ALRK.VFGLQGLLTLFVSF--PLQLSAVTGPTP....KPL.LAVGGVGL----------------------
Q8Y9D9_LISMO/16-244....LVNLKAFLN.VFVLQGVLLFIIAL--PITHSFA.NETA.....TF.AWWQILGI----------------------
Q984A1_RHILO/21-257.......SSSRLFWFLQVQAAAAFLLAM--SI.MAAAHKPAP.....EL.GPGDWIGV----------------------
B9DFE9_ARATH/24-252.........RLII.FWTLQAVWVWTVSL--PLTLVNASDGGG.....SL.KPADVIGW----------------------

PF01222

LBR_CHICK/175-609VVINLAMLLAEMKIHNQSMPSLSMILVNSFQLLYVVDALWNEEAVLTTMDITHDGFGFMLAFGDLVWVPFVYSLQAFYLV
ERG24_NEUCR/17-490IILNCAFIAKQYRLYGYVTDSILFITAI..QAFYVFDGIYMEPAVLTTMDITTDGFGFMLSFGDVVWVPFMYSTQTRYLS
STS1_SCHPO/7-453FFISVGAAVRQYETYGTVSPQVLFVCLG..HYLYANACSKGEQLIVPTWDMAYEKFGFMLIFWNMAGVPFTYSHCTLYLF
ERG4_YEAST/34-473YFITLGACLKQWETYGYVTPQLGVVMLA..HWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLY
ERG24_YEAST/8-438LLINLSCLHHHYLKTGKINDALVLVNFL..QGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLS

PF04140

Q9EWQ7_STRCO/75-167--------------------------------------------------WCIATLGP----------------------
Q99YI2_STRP1/81-173--------------------------------------------------EVTRILGD----------------------
P91402_CAEEL/171-267--------------------------------------------------VGMVHAGL----------------------
Q9KF68_BACHD/72-166--------------------------------------------------WALSSLGR----------------------
MAM4_SCHPO/121-215--------------------------------------------------SAMVQAGQ----------------------
Q9CM58_PASMU/75-167--------------------------------------------------YVIYELKE----------------------
ICMT_HUMAN/161-257--------------------------------------------------AAMFTAGS----------------------
STE14_YEAST/123-219--------------------------------------------------IAMHTAGH----------------------
Q9RTL5_DEIRA/91-184--------------------------------------------------WVMHTLGR----------------------
B6IT05_RHOCS/73-163--------------------------------------------------WVVASLGP----------------------
F7EBZ7_XENTR/175-268--------------------------------------------------CAMLTAGS----------------------
Q2G1E3_STAA8/100-189--------------------------------------------------MVIKTLGG----------------------

PF04191

A4HJV7_LEIBR/438-543--------------------------------------------------SIYKAIGD----------------------
PEMT_HUMAN/89-192--------------------------------------------------SSFFALGF----------------------
CHO2_ASPCL/504-608--------------------------------------------------SIYESLGE----------------------
A1CQK4_ASPCL/70-170--------------------------------------------------TSMYALGV----------------------
A3LQ40_PICST/106-209--------------------------------------------------TSMYALGV----------------------
CHO2_PICST/449-558--------------------------------------------------SIIDSIGY----------------------
A4HJL2_LEIBR/106-210--------------------------------------------------SSFLRLGV----------------------
CHO2_MAGO7/497-601--------------------------------------------------SIYDELGE----------------------
CHO2_PICGU/462-570--------------------------------------------------SIIDSIGY----------------------
CHO2_LODEL/480-589--------------------------------------------------SIIDLIGY----------------------
A5UZK8_ROSS1/43-144--------------------------------------------------AGLLHLGA----------------------
A7TIE1_VANPO/140-243--------------------------------------------------TSMYQLGI----------------------
CHO22_VANPO/452-560--------------------------------------------------EIRAAISD----------------------
CHO21_VANPO/439-547--------------------------------------------------ETRDAISD----------------------
A8NIW8_COPC7/92-195--------------------------------------------------TSTWQLGI----------------------
CHO2_MALGO/537-642--------------------------------------------------SSYRVLGP----------------------
A8PVU2_MALGO/102-205--------------------------------------------------SSMWMLGI----------------------
A9B4Y9_HERA2/33-137--------------------------------------------------SSARHFRQ----------------------
A9V3D6_MONBE/125-229--------------------------------------------------ASFIRLGI----------------------
CHO2_LACBS/492-596--------------------------------------------------ESFEVLGV----------------------
B1MLL6_MYCA9/108-208--------------------------------------------------LVVAQNNY----------------------
B1WZT5_CYAA5/96-194--------------------------------------------------WAVKAISI----------------------
B2AR50_PODAN/95-198--------------------------------------------------SSTWQLGI----------------------
CHO2_PODAN/496-600--------------------------------------------------SIYESLGE----------------------
B2JAT8_NOSP7/42-145--------------------------------------------------SAFRTMNR----------------------
B2VTC6_PYRTR/87-190--------------------------------------------------TSMWALGV----------------------
CHO2_PYRTR/425-530--------------------------------------------------SIYESLGE----------------------
B3RI13_TRIAD/89-192--------------------------------------------------TSYWRLGF----------------------
CHO2_SCHJY/478-583--------------------------------------------------SIFDDLGN----------------------
B6QQY2_PENMQ/89-189--------------------------------------------------SSMWALGV----------------------
B8LBH8_THAPS/30-132--------------------------------------------------KSASDLKN----------------------
B8PB22_POSPM/91-194--------------------------------------------------TSTWALGV----------------------
CHO2_PICPG/450-564--------------------------------------------------QMIDSIGL----------------------
C4R5S7_PICPG/98-201--------------------------------------------------SSMWKLGI----------------------
CHO2_CLAL4/444-555--------------------------------------------------SIVDSIGY----------------------
C5DC91_LACTC/106-209--------------------------------------------------TSMYQLGV----------------------
CHO2_LACTC/450-558--------------------------------------------------EILTAISE----------------------
C5DZ83_ZYGRC/102-205--------------------------------------------------TSMWKLRI----------------------
CHO2_ZYGRC/430-538--------------------------------------------------EIRSAISD----------------------
C5G0L0_ARTOC/115-215--------------------------------------------------SSMWALGI----------------------
C6WWJ2_METML/43-146--------------------------------------------------WSFITMRK----------------------
C7YM51_NECH7/94-197--------------------------------------------------TSTWRLGI----------------------
CHO2_NECH7/505-609--------------------------------------------------SVYDSLGE----------------------
CHO2_SORMK/496-600--------------------------------------------------SIYESLGE----------------------
E3I110_RHOVT/77-175--------------------------------------------------YGYFDLGI----------------------
D2U841_XANAP/75-178--------------------------------------------------WAIRVLAR----------------------
D2V512_NAEGR/65-168--------------------------------------------------GAYYQLGI----------------------
D2VYZ6_NAEGR/455-563--------------------------------------------------STHEVLGD----------------------
D3AX06_POLPA/89-193--------------------------------------------------WTLYCLGI----------------------
D3BED6_POLPA/557-662--------------------------------------------------STLEVLGE----------------------
D3BN57_POLPA/99-202--------------------------------------------------ATYYRLGI----------------------
CHO2_SCHPO/491-596--------------------------------------------------SIYEDLGQ----------------------
CHO1_SCHPO/110-213--------------------------------------------------SSMYKLGL----------------------
Q0AM70_MARMM/72-173--------------------------------------------------LGRYAYGS----------------------
Q0AQW8_MARMM/72-173--------------------------------------------------AGRIAYGS----------------------
CHO2_PHANO/462-567--------------------------------------------------SIYDSLGE----------------------
Q0UN81_PHANO/69-173--------------------------------------------------TSMYALGV----------------------
Q11IW9_CHESB/45-148--------------------------------------------------AALRRLRL----------------------
Q1GIY9_RUEST/78-176--------------------------------------------------WGYRFLGL----------------------
A0A0D1CJ51_USTMA/99-202--------------------------------------------------SSMWALGV----------------------
PEMTL_DICDI/82-186--------------------------------------------------WTLKALGI----------------------
PEM2_DICDI/98-201--------------------------------------------------AAYLKLGI----------------------
Q6C649_YARLI/97-200--------------------------------------------------TSMYALGV----------------------
CHO2_YARLI/531-635--------------------------------------------------SIHDSLGH----------------------
CHO2_KLULA/451-559--------------------------------------------------EIFHSIKE----------------------
Q6CV75_KLULA/106-209--------------------------------------------------SSMYQLGI----------------------
Q6FUV4_CANGA/106-209--------------------------------------------------SSMYQLGI----------------------
CHO2_CANGA/431-540--------------------------------------------------EIRSAISD----------------------
Q752Z0_ASHGO/100-203--------------------------------------------------SSMWRLGV----------------------
Q7ZVZ2_DANRE/120-223--------------------------------------------------SSFLALGV----------------------
Q86IF9_DICDI/521-626--------------------------------------------------STFEVLGE----------------------
Q8TN26_METAC/121-221--------------------------------------------------LVFRENPF----------------------
Q98I61_RHILO/42-146--------------------------------------------------HAFARFAL----------------------
E7QGU3_YEASZ/100-199--------------------------------------------------SSMYKLGI----------------------
F1SB04_PIG/61-160--------------------------------------------------SSFLALGF----------------------
F7BHJ5_XENTR/62-163--------------------------------------------------SSFLALGF----------------------
G1MZ29_MELGA/96-197--------------------------------------------------SSFLALGF----------------------
CHO2_YEAST/471-577--------------------------------------------------ETRLAISD----------------------
CHO2_CANAL/468-576--------------------------------------------------SIIDSIGY----------------------
Q5KDE7_CRYNJ/618-724--------------------------------------------------SSYEVLGD----------------------
Q5KHK0_CRYNJ/121-221--------------------------------------------------TSMWALGV----------------------
Q8DW48_STRMU/70-169--------------------------------------------------YAINYLGK----------------------
Q8PE74_XANCP/100-199--------------------------------------------------WAIQVLAR----------------------

PF07298

B2JUD7_BURP8/3-190--------------------------------------------------YSVVSLVG----------------------
A1VI53_POLNA/3-190--------------------------------------------------YALVSLVG----------------------
Q12HL7_POLSJ/3-190--------------------------------------------------YALLSIAG----------------------
A2SBS8_METPP/3-190--------------------------------------------------YAVVSLIG----------------------
Q223I4_RHOFT/3-190--------------------------------------------------YSVLSLLG----------------------
A1K5T7_AZOSB/6-191--------------------------------------------------YAAVAAVG----------------------
A1WT38_HALHL/3-190--------------------------------------------------YSALSLVG----------------------
A6VV32_MARMS/3-191--------------------------------------------------FGMITLIA----------------------
Q0AQE8_MARMM/3-183--------------------------------------------------YTVISLIG----------------------
A1AZI2_PARDP/3-180--------------------------------------------------VAGLLALS----------------------
Q28U80_JANSC/6-185--------------------------------------------------VAGLVVLS----------------------
Q5LXD7_RUEPO/5-179--------------------------------------------------VALALLGS----------------------
Q1GLH3_RUEST/3-179--------------------------------------------------VALVLLVS----------------------
A8LJK3_DINSH/5-184--------------------------------------------------VAVAIVAS----------------------
Q169U5_ROSDO/3-182--------------------------------------------------VAVAIIAS----------------------
A0KG00_AERHH/3-186--------------------------------------------------FSLLVFIA----------------------
Q6N9Q3_RHOPA/31-253--------------------------------------------------YSIESLLV----------------------
Q219Y9_RHOPB/14-236--------------------------------------------------YSGVSLLV----------------------
Q5LUC0_RUEPO/7-220--------------------------------------------------YSLFSIAV----------------------
Q0C1Y5_HYPNA/14-233--------------------------------------------------YSAVSLAL----------------------
Q169M4_ROSDO/6-220--------------------------------------------------YSALSLCI----------------------
A8LNX8_DINSH/42-256--------------------------------------------------YSALSLGV----------------------
A9CGK0_AGRFC/3-221--------------------------------------------------YSVVSLLT----------------------
Q2JYB9_RHIEC/5-223--------------------------------------------------YSAASTLA----------------------
Q92Z13_RHIME/3-221--------------------------------------------------YSFASILA----------------------
B0U8Q9_METS4/2-221--------------------------------------------------YSALSLAL----------------------
Q2VYZ8_MAGSA/17-229--------------------------------------------------YSVVSTIL----------------------
Q60BH7_METCA/3-224--------------------------------------------------FSVLSLLA----------------------
A7HZ42_PARL1/3-227--------------------------------------------------FSLASIAG----------------------
Q1GUJ7_SPHAL/6-226--------------------------------------------------YSIVAIAT----------------------
Q2GC12_NOVAD/7-219--------------------------------------------------YSLVAIAT----------------------
Q8DMH0_THEEB/15-236--------------------------------------------------FASVSLPL----------------------
Q113R6_TRIEI/12-233--------------------------------------------------FALVSLPL----------------------
Q8YQ81_NOSS1/13-234--------------------------------------------------FALVSLPL----------------------
Q9ALA6_SYNE7/12-229--------------------------------------------------FALVSLPL----------------------
Q7V3C9_PROMP/9-231--------------------------------------------------FVSLSLPS----------------------
A9CI20_AGRFC/3-191--------------------------------------------------YSLVSLIT----------------------
Q92UK4_RHIME/3-191--------------------------------------------------YTIVSLVG----------------------
Q89MZ5_BRADU/5-191--------------------------------------------------YALVSLAG----------------------
A7IF98_XANP2/3-187--------------------------------------------------FSLLAISG----------------------
B0UL45_METS4/3-192--------------------------------------------------YSVLALVG----------------------
Q0C445_HYPNA/3-190--------------------------------------------------YTLVSAVG----------------------
Q3JDP5_NITOC/3-187--------------------------------------------------YGSVSLIG----------------------
Q9AAA0_CAUCR/3-186--------------------------------------------------YSLVAAAG----------------------
Q11KH3_CHESB/3-188--------------------------------------------------YSLAAFLG----------------------
B4EFU3_BURCJ/3-190--------------------------------------------------YAIASIVG----------------------
C5B332_METEA/3-195--------------------------------------------------YTLLSVLG----------------------
Q2JMU2_SYNJB/23-239--------------------------------------------------FALVSLSL----------------------
Q2K5L0_RHIEC/3-191--------------------------------------------------YSIASILT----------------------
Q3SR07_NITWN/1-185--------------------------------------------------FSLISAVG----------------------
Q46HM6_PROMT/12-228--------------------------------------------------FAFASIPS----------------------
Q63MK0_BURPS/3-190--------------------------------------------------YALASVIG----------------------

PF02544

Q19605_CAEEL/97-243------------------LMYCTGMYINHKSDTILR..--------------..--------ELRADGGTGYKIPT.GF-
YN67_SCHPO/146-295------------------VGWAFAVLSNFRTHIILR..--------------..--------DLRPAGSKKRVIPT.GY-
Q20344_CAEEL/97-243------------------ILYFSGMFINHKSDNILM..--------------..--------TLRKPGETGYKIPT.GF-
S5A1_RAT/110-259------------------ALWLVGMVINIHSDHILR..--------------..--------NLRKPGETGYKIPR.GG-
S5A2_HUMAN/105-254------------------FLFILGMGINIHSDYILR..--------------..--------QLRKPGEISYRIPQ.GG-
PORED_CAEEL/189-309------------------.........TRKGPRGLI..--------------..--------.....RNYAYGICF.GG-
Q23431_CAEEL/103-253------------------WLFVIGFITHCVSDLHLI..--------------..--------TLRNDYLNSYSIPR.GH-
DET2_ARATH/111-262------------------VVFITGMYINITSDRTLV..--------------..--------RLKKENRGGYVIPR.GG-
TECR_YEAST/154-310------------------GLFVLSELWNFYCHIKLRLW--------------GD--------YQKKHGNAKIRVPLNQG-
S5A1_HUMAN/110-259------------------GLWLTGMLINIHSDHILR..--------------..--------NLRKPGDTGYKIPR.GG-

PF06966

YJD4_SCHPO/67-320------------------ELFMFMFVLEMLADQQQWDYYEARNHYNVDKTVPPR--------FKYDLLSLGRGFNA-TG-
Q10E47_ORYSJ/24-252------------------IMWLIGAGMEAIADQQKLTF................--------.KNSPSNRGR.WCN-VG-
Q8PAZ9_XANCP/20-250------------------VVWLIAVGGEALADRQLSAH................--------.KANPANRGK.TCR-TG-
Q9A3U2_CAUCR/70-299------------------ALTIVGILFETIGDAQLTAF................--------.KANPDNAGK.VMD-KG-
Q9VSM5_DROME/25-264------------------GMFIVGLLAETYADLQKFSF................--------.RQDPANQGK.FCN-DG-
Q9CHY6_LACLA/17-245------------------IIWIFGFIFEVFGDRQLEVF................--------.KKLPQNKGK.LLT-SG-
Q7CY59_AGRFC/19-248------------------VVALTALAGEALSDAQLSKF................--------.RRTPEAKTG.VCE-TG-
O81042_ARATH/64-303------------------AICLTGIVMAYFADTQLHEFVTGN........QKLK--------EQGKPK...IPNLD-SG-
O53731_MYCTU/17-243------------------AVWLVGITFEAVGDWQLWVF................--------.KSDPANRGV.IMD-RG-
Q8Y9D9_LISMO/16-244------------------VIWIIGFIFEVGGDLQLENF................--------.KKNPANKGK.LLT-SG-
Q984A1_RHILO/21-257------------------AIWVVAIGGEALADRQLNAF................--------.RGDPRNKGK.VCD-VG-
B9DFE9_ARATH/24-252------------------TMWVFGFLIEAAADQQKLSF................--------.KNSPENRGK.WCD-VG-

PF01222

LBR_CHICK/175-609GH.PIAISWP..VAAAITILNCIGYYIFRSANSQKNNFR...........RNPADPKLSY..LKVIPTATGKGLLV-TG-
ERG24_NEUCR/17-490VH.PQQLGAFG..LIAVGAVLAAGYSIFRLSNSQKNNFR...........TNPEDPSVKH..LTYLQTKTGSRLIT-SG-
STS1_SCHPO/7-453SHDPSVYNWSTQYTTGIYVLLLCCYYIFDTCNGQKNHFRNQIYGTEVHRKTFPQLPWLIIKNPTFIRCANGGTLLT-SG-
ERG4_YEAST/34-473YHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLI-DG-
ERG24_YEAST/8-438VS.PVELGWV..KVVGILAIMFLGFHIFHSANKQKSEFR...............QGKLEN..LKSIQTKRGTKLLC-DG-

PF04140

Q9EWQ7_STRCO/75-167------------------YWNTRVIV..VPGT------------------------------R----------PVG-AG-
Q99YI2_STRP1/81-173------------------IWTVKLML..AKDH------------------------------K----------YVD-HW-
P91402_CAEEL/171-267------------------AFTHRLAMTKRSDH------------------------------R----------LVK-DG-
Q9KF68_BACHD/72-166------------------FWNTRIMI..LPDA------------------------------N----------VIA-SG-
MAM4_SCHPO/121-215------------------SFSHIVASKRNKDH------------------------------L----------LVT-DG-
Q9CM58_PASMU/75-167------------------IWTVKLYI..LPEH------------------------------H----------INR-SF-
ICMT_HUMAN/161-257------------------NFNHVVQNEKSDTH------------------------------T----------LVT-SG-
STE14_YEAST/123-219------------------SFSHIVKTKKESDH------------------------------V----------LVK-TG-
Q9RTL5_DEIRA/91-184------------------YWNTRILI..VPGG------------------------------Q----------RVT-SG-
B6IT05_RHOCS/73-163------------------YWTTRIIT..LPGA------------------------------P----------LIR-RG-
F7EBZ7_XENTR/175-268------------------NFNHIVQNEKSDSH------------------------------T----------LVT-SG-
Q2G1E3_STAA8/100-189------------------IWTLKLFI..LPNH------------------------------P----------IIK-SG-

PF04191

A4HJV7_LEIBR/438-543------------------YGYFYGDFFI.DKV------------------------------P..A......KLNY-SG-
PEMT_HUMAN/89-192------------------AGTFLGDYFG.ILK------------------------------E..A.......RVT-VF-
CHO2_ASPCL/504-608------------------FGWFYGDFFF.D.A------------------------------S...P.....KLTY-NG-
A1CQK4_ASPCL/70-170------------------TGTYLGDYFG.ILM------------------------------D..A.......PVT-GF-
A3LQ40_PICST/106-209------------------TGTYLGDYFG.ILM------------------------------N..E.......RVT-GF-
CHO2_PICST/449-558------------------FGWFYGDFFI.PKS------------------------------Y..SSM...QHLTK-AG-
A4HJL2_LEIBR/106-210------------------TGTYLGDYFD.ILM------------------------------D..E.......RVT-AF-
CHO2_MAGO7/497-601------------------FGWFFGDFFF.N.N------------------------------R...T.....KLTY-RS-
CHO2_PICGU/462-570------------------FGWFYGDFFL.P.T------------------------------S..PQR...SHLTK-AG-
CHO2_LODEL/480-589------------------FGWFYGDFFI.PKS------------------------------Q..SFA...NHLTK-AG-
A5UZK8_ROSS1/43-144------------------NLTPFPRP...RDD------------------------------G..R.......LVQ-HG-
A7TIE1_VANPO/140-243------------------TGTYLGDYFG.ILM------------------------------D..E.......RVT-AF-
CHO22_VANPO/452-560------------------FGWFYGDFFL....------------------------------...INYISERRLTS-QG-
CHO21_VANPO/439-547------------------FGWFYGDFFL....------------------------------...TNYITTRKLTS-QG-
A8NIW8_COPC7/92-195------------------TGTFLGDYFG.ILM------------------------------D..H.......RVE-GF-
CHO2_MALGO/537-642------------------FGWLYGDFFI.DAY------------------------------P...K.....RLSY-TG-
A8PVU2_MALGO/102-205------------------TGTYLGDYFG.ILM------------------------------D..H.......MVT-GF-
A9B4Y9_HERA2/33-137------------------MGTNIMTF...GQP------------------------------D..R.......LVI-SG-
A9V3D6_MONBE/125-229------------------FGTYMGEFFG.VML------------------------------S..E.......KIT-TF-
CHO2_LACBS/492-596------------------FGWFFGDFFM.EEF------------------------------P...T.....HLEY-TG-
B1MLL6_MYCA9/108-208------------------AAASITV....ESG------------------------------Q..T.......VTA-TG-
B1WZT5_CYAA5/96-194------------------HDSL.......GLE------------------------------G..E.......LIT-KG-
B2AR50_PODAN/95-198------------------TGTFLGDYFG.ILM------------------------------D..K.......MVT-GF-
CHO2_PODAN/496-600------------------FGWFYGDFFF.E.S------------------------------P...R.....PPTY-NS-
B2JAT8_NOSP7/42-145------------------AQTEVNPS...RPT------------------------------T..A.......IVS-DG-
B2VTC6_PYRTR/87-190------------------TGTYLGDYFG.ILM------------------------------D..E.......PVT-TF-
CHO2_PYRTR/425-530------------------FGWFCGDFFF.DPP------------------------------S...K.....SLTY-NG-
B3RI13_TRIAD/89-192------------------TGTFLGDYFG.ILL------------------------------E..E.......RVT-TF-
CHO2_SCHJY/478-583------------------FGWFYGDFFL.PVQ------------------------------S...P.....KLSY-RG-
B6QQY2_PENMQ/89-189------------------TGTYLGDYFG.ILM------------------------------D..A.......PVT-GF-
B8LBH8_THAPS/30-132------------------NLSPYPVP...SEK------------------------------G..A.......LID-SG-
B8PB22_POSPM/91-194------------------TGTFLGDYFG.ILM------------------------------D..H.......RVE-GF-
CHO2_PICPG/450-564------------------FGWYYGDFFI.GVL------------------------------S..SHKSEVTTLSR-SG-
C4R5S7_PICPG/98-201------------------TGTYLGDYFG.ILM------------------------------E..D.......RVT-SF-
CHO2_CLAL4/444-555------------------FGWFYGDFFI.PKA------------------------------SVLPQR...AHLSK-GG-
C5DC91_LACTC/106-209------------------TGTYLGDYFG.ILM------------------------------D..N.......IVT-AF-
CHO2_LACTC/450-558------------------FGWFYGDFFL....------------------------------...TNYISSRKLNS-RG-
C5DZ83_ZYGRC/102-205------------------TGTYLGDYFG.ILM------------------------------D..E.......IVT-DF-
CHO2_ZYGRC/430-538------------------FGWFYGDFFL....------------------------------...SNYIPTKSLTS-HG-
C5G0L0_ARTOC/115-215------------------TGTYLGDYFG.ILM------------------------------D..A.......PVT-GF-
C6WWJ2_METML/43-146------------------IGTSGNPR...ETS------------------------------T..A.......LAI-NG-
C7YM51_NECH7/94-197------------------TGTFLGDYFG.ILM------------------------------D..E.......MVT-GF-
CHO2_NECH7/505-609------------------FGWFCGDFFF.D.Q------------------------------Q...A.....KLTY-KS-
CHO2_SORMK/496-600------------------FGWFYGDFFF.D.S------------------------------K...R.....QLTY-TS-
E3I110_RHOVT/77-175------------------ENTY.......GAD------------------------------E..G.......LVT-GG-
D2U841_XANAP/75-178------------------WFTVDLTI...QHG------------------------------Q..R.......LVG-HG-
D2V512_NAEGR/65-168------------------TGTYLGDYFG.ILM------------------------------E..D.......RIT-SF-
D2VYZ6_NAEGR/455-563------------------HGWFYGDFFYTETN------------------------------Q...N....KQPSY-TG-
D3AX06_POLPA/89-193------------------KGMYNGDSFG.HIM------------------------------D..A.......PVT-GG-
D3BED6_POLPA/557-662------------------FGWFYGDFFI.DEV------------------------------P...T.....KLYY-TG-
D3BN57_POLPA/99-202------------------TGTYLGDYFG.ILM------------------------------K..E.......RVY-GF-
CHO2_SCHPO/491-596------------------YGWFYGDFFL.PSR------------------------------S...P.....KLVY-QG-
CHO1_SCHPO/110-213------------------VGTYLGDYFG.FLL------------------------------P..E.......RVS-GF-
Q0AM70_MARMM/72-173------------------QERVYG.....LLE------------------------------D..E.......LIQ-HG-
Q0AQW8_MARMM/72-173------------------QKRVYG.....LLE------------------------------D..R.......LIE-GG-
CHO2_PHANO/462-567------------------FGWFCGDFFF.DPP------------------------------S...S.....NLTY-SG-
Q0UN81_PHANO/69-173------------------TGTYLGDYFG.ILM------------------------------D..A.......PVT-TF-
Q11IW9_CHESB/45-148------------------AKTTVMPT...RSA------------------------------T..Q.......LVT-DG-
Q1GIY9_RUEST/78-176------------------DNTY.......CDT------------------------------G..G.......LVT-GG-
A0A0D1CJ51_USTMA/99-202------------------TGTYLGDYFG.ILM------------------------------D..S.......IVT-GF-
PEMTL_DICDI/82-186------------------KGMYNGDSFG.HIM------------------------------D..S.......PVT-GG-
PEM2_DICDI/98-201------------------TGTYLGDYFG.ILM------------------------------K..E.......RVT-GF-
Q6C649_YARLI/97-200------------------TGTYLGDYFG.ILM------------------------------N..E.......RVT-GF-
CHO2_YARLI/531-635------------------FGWFYGDFFL.D.R------------------------------K...Q.....NLTY-SG-
CHO2_KLULA/451-559------------------FGWFYGDFFL....------------------------------...PNLIDKRKLKN-DG-
Q6CV75_KLULA/106-209------------------TGTYLGDYFG.ILM------------------------------D..H.......RVT-SF-
Q6FUV4_CANGA/106-209------------------TGTYLGDYFG.ILM------------------------------N..D.......RVT-AF-
CHO2_CANGA/431-540------------------FGWFYGDFFL....------------------------------...INYIVDRKLTT-QG-
Q752Z0_ASHGO/100-203------------------TGTYLGDYFG.ILM------------------------------E..D.......RVT-SF-
Q7ZVZ2_DANRE/120-223------------------TGTFLGDYFG.ILM------------------------------D..Q.......KVT-GF-
Q86IF9_DICDI/521-626------------------FGWFYGDFFI.EDI------------------------------P...S.....NLYY-TG-
Q8TN26_METAC/121-221------------------AAATIQV....SSD------------------------------Q..Q.......VIT-TG-
Q98I61_RHILO/42-146------------------EGLGTPAPVA.PTE------------------------------R..........LVI-GG-
E7QGU3_YEASZ/100-199------------------TGTYLGDYFG.ILM------------------------------D..E.......RVT-GF-
F1SB04_PIG/61-160------------------TGTFLGDYFG.ILM------------------------------E..A.......RVT-RF-
F7BHJ5_XENTR/62-163------------------VGTYLGDYFG.ILM------------------------------E..K.......KVT-GF-
G1MZ29_MELGA/96-197------------------TGTFLGDYFG.ILM------------------------------E..A.......KVT-CF-
CHO2_YEAST/471-577------------------FGWFYGDFFL.SNY------------------------------I..ST....RKLTS-QG-
CHO2_CANAL/468-576------------------FGWFYGDFFI.PKS------------------------------Q..SSI...KNITT-AG-
Q5KDE7_CRYNJ/618-724------------------FGWLYSDFFL.IEQ------------------------------I..PS.....QLAY-TG-
Q5KHK0_CRYNJ/121-221------------------TGTYLGDYFG.ILM------------------------------S..H.......RVT-SF-
Q8DW48_STRMU/70-169------------------AFTLTVQA...TDN------------------------------Q..K.......LIS-SG-
Q8PE74_XANCP/100-199------------------WFTVDVTI...QAD------------------------------H..Q.......LVR-SG-

PF07298

B2JUD7_BURP8/3-190------------------LVLIIWGYGIARRE.PVVLWTSP..-------------------AWSPHLTGVLTLIA-FIL
A1VI53_POLNA/3-190------------------FGLVIWGFGLARQQ.PVQWWAPP..-------------------FATRHLAWLLTALA-FIL
Q12HL7_POLSJ/3-190------------------FVLLVWGYGLARQS.PVVLWTPP..-------------------VGMRHVAALLMLLA-FIL
A2SBS8_METPP/3-190------------------FVLLAWGYGLARQQ.PVLLWTPP..-------------------VAMRHIAALLTLVA-FVL
Q223I4_RHOFT/3-190------------------FALIVWGFGLARQQ.PVQLWSPP..-------------------VALRHLASLLTLLS-FVL
A1K5T7_AZOSB/6-191------------------LVLVVWGYGLTRDV.PVAIWSAP..-------------------VWTRHLAAVLTLPA-FVL
A1WT38_HALHL/3-190------------------LIIAIYGYGLTRVD.AVWVWMPP..-------------------NWTAHLMALVMIPA-FIL
A6VV32_MARMS/3-191------------------VGLIVMGYSQTRLE.PVWLWFPP..-------------------VWTRHLAGLLVLVA-LFF
Q0AQE8_MARMM/3-183------------------FGLIIYGKVIAHPT..PSIWTTP..-------------------GWGHQAALFAVPVG-IIL
A1AZI2_PARDP/3-180------------------VVLMVVGYRQADGP...YWWGAS..-------------------APLKGINNLLVLVA-FYF
Q28U80_JANSC/6-185------------------VILMVIGYRGAEGA...FYWGRS..-------------------PALVGINNILMVLA-FYI
Q5LXD7_RUEPO/5-179------------------VVLMVIGYRMTDYI...HVWAPP..-------------------SYLTHANNLLVLVA-IWM
Q1GLH3_RUEST/3-179------------------VVLMVLGYRGTEYI...HVWAPA..-------------------PFLVHVNNTLMLFA-LYF
A8LJK3_DINSH/5-184------------------IVLMVIGYRGAEFV...FLWSPP..-------------------AFMTHVNNTLMLFA-LWV
Q169U5_ROSDO/3-182------------------LVLMVMGYRAAEFI...PVWQPP..-------------------AFMMHVNNTLMLFA-LWV
A0KG00_AERHH/3-186------------------IACIIAGWRTASPL...PLYFLP..-------------------VWGPTLMMAVMPIA-LIL
Q6N9Q3_RHOPA/31-253------------------LTWLIVATERAPFV...ELWPFE..-------------------TWQMWVPNLALPLA-CQF
Q219Y9_RHOPB/14-236------------------LAWLIGAAGRAPLL...PLWPFE..-------------------PWQMLAPNLAMPFV-CLL
Q5LUC0_RUEPO/7-220------------------LGWLILAAARAPYV...EVIPPL..-------------------PALRWVPILIMLPV-CLL
Q0C1Y5_HYPNA/14-233------------------FAWLIIAAGRAPYV...WLWFWG..-------------------PHGLWLANGLMALA-LLL
Q169M4_ROSDO/6-220------------------LALLIWAAGQAPFV...LLWAEA..-------------------AWHRPAILVGMLAA-CLI
A8LNX8_DINSH/42-256------------------LAWLIGAAGRAPFV...PLWDWA..-------------------PWQAHLVLAAMLPV-CVI
A9CGK0_AGRFC/3-221------------------LSWVFHAALSVDYI...PLWDVA..-------------------PWQAHVTFLAAPIG-LFF
Q2JYB9_RHIEC/5-223------------------LIWVFSAALALDYI...PLWELT..-------------------PGNAAAAFVLAPFG-IFL
Q92Z13_RHIME/3-221------------------LAWVLYAALDVDHI...PLWQPS..-------------------AWQAWLTMIAAPVG-VFL
B0U8Q9_METS4/2-221------------------LAWLIVAARRAGTV...ALWEPA..-------------------RWQWAVPLALMPVA-LFL
Q2VYZ8_MAGSA/17-229------------------LVWVIAAALNSPTV...VVWEQQ..-------------------PWMRWVPPLVMPVA-CLF
Q60BH7_METCA/3-224------------------LGWVVFAYRQAPYV...ETWGQL..-------------------TGFKPIAAVLMLVS-FIF
A7HZ42_PARL1/3-227------------------ISWLAYSFNEAVAGPNHLYWVPP..-------------------LWALHLSPLVILVA-TFF
Q1GUJ7_SPHAL/6-226------------------FILVVQAWRGMPPE..PPLWPVG..-------------------DGLWALASLIVLFA-SIL
Q2GC12_NOVAD/7-219------------------LTWAIVAFDRAPAA..PALWDGT.N-------------------AVAWALASVLTIVS-LAF
Q8DMH0_THEEB/15-236------------------ATILILYFLAHRYD.GVQLWQLQEV-------------------PGMGALVWGLSALS-FLF
Q113R6_TRIEI/12-233------------------AVILIIYFFNHRYD.GLQLWQLQGV-------------------PIVKPIVWTFSAIS-FLF
Q8YQ81_NOSS1/13-234------------------AVILIIYFFNHRYD.GLQLWQVQNV-------------------PGVQAVVWVSSAIS-FLF
Q9ALA6_SYNE7/12-229------------------AVVTISYFILHRYD.GALLWQLQGI-------------------PWIAPLVWVLTAIS-FLL
Q7V3C9_PROMP/9-231------------------ALILISYFLAHRYD.GIRLWNFQGN-------------------HYVFLLVWILTAIS-FLF
A9CI20_AGRFC/3-191------------------LGLVIYAFGEARQE.TGMLWNPP..-------------------VFMSHIAVTLMLPA-MIC
Q92UK4_RHIME/3-191------------------LCLIIYGFSQARGE.TGMLYDPP..-------------------TFLRHIALLLMLVA-FIV
Q89MZ5_BRADU/5-191------------------LALIIWGFGHYRATGWIDVWYPP..-------------------KAMKHITLALMLPA-VIL
A7IF98_XANP2/3-187------------------LLLTAYGFALWRASGAPDLWDPP..-------------------LGMTHLTKLLMVFA-CIA
B0UL45_METS4/3-192------------------LIVLGIGYGRYRSEGYIDIWSPP..-------------------VWTRHLALLLVLVA-FVA
Q0C445_HYPNA/3-190------------------LGLFLWGFGAMRPA..PILYTPP..-------------------AGLAHLNLVLMLPA-LIL
Q3JDP5_NITOC/3-187------------------IILISRGYVDLRQA.PTLLYVSP..-------------------IWLHHVVTILLLPT-FIL
Q9AAA0_CAUCR/3-186------------------LGLIIWGWIVYRPA.APQLYDPP..-------------------AWGRHAAMLLVWLA-FIL
Q11KH3_CHESB/3-188------------------LVLIVWGYWLARQN.PVVLYTPA..-------------------TWMQHLTLLLMLPV-FPL
B4EFU3_BURCJ/3-190------------------FVLIIWGYGIARAG.ATLLWVSP..-------------------VGVRHLTGMLTAVA-FVL
C5B332_METEA/3-195------------------LILTIYGYGLYRQEGMIPVWSPP..-------------------LWTRHLAVLLTLFA-FIS
Q2JMU2_SYNJB/23-239------------------APLLLIYFFNHRYD.GVILWDLQAV-------------------PGIRTTVALLSALS-FFF
Q2K5L0_RHIEC/3-191------------------LILLIYGFGQARQV.TGMLYNPP..-------------------VWTAHIAITLMLIA-MIC
Q3SR07_NITWN/1-185------------------VALTLWGFLSYRATGVIDVWYPP..-------------------RVMKHIAEALILPS-IIL
Q46HM6_PROMT/12-228------------------AVILVGYFIAHRYD.GFRFWNLQGV-------------------SELIPLIWILSAIS-FLF
Q63MK0_BURPS/3-190------------------FALIVWGYGLARAD.TASLWFPP..-------------------LGIRHLTGLLTAIA-FVL

PF02544

Q19605_CAEEL/97-243---------------------------LYEYISCPNYAGEIMEWIGYSILA-----------------------------
YN67_SCHPO/146-295---------------------------GFNLVSFPNYFFESLGWLFFALLT-----------------------------
Q20344_CAEEL/97-243---------------------------LYEYISCPNYFGEIMEWIGYAILG-----------------------------
S5A1_RAT/110-259---------------------------LFEYVSAANYFGELVEWCGFALAS-----------------------------
S5A2_HUMAN/105-254---------------------------LFTYVSGANFLGEIIEWIGYALAT-----------------------------
PORED_CAEEL/189-309---------------------------WFNLVSCPHFLFEICIYLSLFLVI-----------------------------
Q23431_CAEEL/103-253---------------------------YFEYISCPNYFGECLQWIGYALAA-----------------------------
DET2_ARATH/111-262---------------------------WFELVSCPNYFGEAIEWLGWAVMT-----------------------------
TECR_YEAST/154-310---------------------------IFNLFVAPNYTFEVWSWIWFTFVF-----------------------------
S5A1_HUMAN/110-259---------------------------LFEYVTAANYFGEIMEWCGYALAS-----------------------------

PF06966

YJD4_SCHPO/67-320---------------------------LFRWSRHPNFLAEQLIWLSFYLFGAIA--------------------..SESL
Q10E47_ORYSJ/24-252---------------------------LWSYTRHPNYFGEIFLWWGIFVASTPV--------------------..LSGA
Q8PAZ9_XANCP/20-250---------------------------LWRYSRHPNYFFEFVHWFAYLALAVGA--------------------..GPWL
Q9A3U2_CAUCR/70-299---------------------------LWRYTRHPNYFGDACVWWGLYLIAAET--------------------..GLGA
Q9VSM5_DROME/25-264---------------------------LWSVSRHPNYFGEVVIWWGIFAISLNV--------------------..ISGH
Q9CHY6_LACLA/17-245---------------------------LWSLTRHPNYFGESMCWWGIFLISLTT--------------------..LSTL
Q7CY59_AGRFC/19-248---------------------------LWRYSRHPNYFFEWLFWCSFPLLAIQE--------------------...QVL
O81042_ARATH/64-303---------------------------LWRYSRHPNYLGEQLWWWGLVIFAWNL--------------------..GQG.
O53731_MYCTU/17-243---------------------------LWAWTRHPNYFGDACVWWGLWLITIND--------------------..WAPL
Q8Y9D9_LISMO/16-244---------------------------FWSVTRHPNYFGEALSWWGVFLVALTQ--------------------..LTDL
Q984A1_RHILO/21-257---------------------------LWRLSRHPNYFFEWLGWLAYMAIAIGS--------------------PWAYPW
B9DFE9_ARATH/24-252---------------------------VWKYSRHPNYFGEMLLWWGIFVAASPV--------------------..LEGA

PF01222

LBR_CHICK/175-609---------------------------WWGFVRHPNYLGDIIMALAWSLPCGFN..........................
ERG24_NEUCR/17-490---------------------------WWGIARHINYLGDWLQSWPYSLPTGIAGYQILSAGSNAPGAITMLDGREVVQG
STS1_SCHPO/7-453---------------------------WYRYARKIHYTADFFQSLSWALITGFQ..........................
ERG4_YEAST/34-473---------------------------WYTLARKIHYTADWTQSLVWALSCGFN..........................
ERG24_YEAST/8-438---------------------------WWAKSQHINYFGDWLISLSWCLATWFQ..........................

PF04140

Q9EWQ7_STRCO/75-167---------------------------PYRFLRHPNYLA.VVVEVAALPLVHSA--------------------------
Q99YI2_STRP1/81-173---------------------------LFKTIKHPNYFLNIAPELVGIALLCHA--------------------------
P91402_CAEEL/171-267---------------------------IYAYLRHPGYFGWFLWAVSTQIILCNP--------------------------
Q9KF68_BACHD/72-166---------------------------PYRYIKHPNYAV.VIIEIAMLPLFFKA--------------------------
MAM4_SCHPO/121-215---------------------------IYAYVRHPSYVGFFIWALGTQMLLGNF--------------------------
Q9CM58_PASMU/75-167---------------------------LFKYVRHPNYFLNIIPELIGLSLFCQA--------------------------
ICMT_HUMAN/161-257---------------------------VYAWFRHPSYVGWFYWSIGTQVMLCNP--------------------------
STE14_YEAST/123-219---------------------------VYSWSRHPSYLGFFWWAIGTQLLLLNP--------------------------
Q9RTL5_DEIRA/91-184---------------------------PFRFLGHPNYTV.VALELAAAPLAVGA--------------------------
B6IT05_RHOCS/73-163---------------------------PFRHVRHPNYLV.VTGEIAVLPLAFGA--------------------------
F7EBZ7_XENTR/175-268---------------------------VYSWFRHPSYVGWFYWSIGTQVLLCNP--------------------------
Q2G1E3_STAA8/100-189---------------------------LYKITKHPNYFLNIIPELIGVLLLTHA--------------------------

PF04191

A4HJV7_LEIBR/438-543---------------------------IYRYLNNPDSSLGMSAYYGIALL.SGS--------------------------
PEMT_HUMAN/89-192---------------------------PFNILDNPMYWGSTANYLGWAIM.HAS--------------------------
CHO2_ASPCL/504-608---------------------------IYRFLNNPERVLGLAGVWGAVLI.TSS--------------------------
A1CQK4_ASPCL/70-170---------------------------PFSATGSPMYWGSTLNFLGVALY.FGK--------------------------
A3LQ40_PICST/106-209---------------------------PFNVNDNPMYNGSTLCFLGTALW.YGK--------------------------
CHO2_PICST/449-558---------------------------VYRYLNNPEQIFGVCGVMGVFIM.VPS--------------------------
A4HJL2_LEIBR/106-210---------------------------PFSHFDNPMYLGATLNFLAASII.QNN--------------------------
CHO2_MAGO7/497-601---------------------------IYRFLNNPERVMGSLGLYGAALI.TWS--------------------------
CHO2_PICGU/462-570---------------------------VYRYLNNPEQLFGVCGVMGLTLI.APS--------------------------
CHO2_LODEL/480-589---------------------------VYRYLNNPEQIFGVCGVMGVFII.WPT--------------------------
A5UZK8_ROSS1/43-144---------------------------AYAIVRHPIYSGIIIGAFGWSLL.RGS--------------------------
A7TIE1_VANPO/140-243---------------------------PFNVSNNPMYQGSTLSFLGTALI.YGK--------------------------
CHO22_VANPO/452-560---------------------------IYRYLNNPEAILGTAGIWGTALM.TNF--------------------------
CHO21_VANPO/439-547---------------------------IYRYLNNPEAILGVAGIWGSVLM.TNF--------------------------
A8NIW8_COPC7/92-195---------------------------PFNILNDPMYVGSTMSFIATALW.TER--------------------------
CHO2_MALGO/537-642---------------------------IYRFLNNPERSMGSAAFFGMALL.SGS--------------------------
A8PVU2_MALGO/102-205---------------------------PFSVLNDPMYVGSTLNFVGVALW.YAR--------------------------
A9B4Y9_HERA2/33-137---------------------------WFRWSRNPMYLGFGLSLLGIALL.LGA--------------------------
A9V3D6_MONBE/125-229---------------------------PFDVVDNPMYFGSSLMHIGLAIM.EQS--------------------------
CHO2_LACBS/492-596---------------------------IYRYLNNPE.AMGGAAWFGLALI.SGS--------------------------
B1MLL6_MYCA9/108-208---------------------------LYGLVRHPMYTGSLVMMVGMPLA.LGS--------------------------
B1WZT5_CYAA5/96-194---------------------------VYNYSRNPEYIGDLILFLGYSLL.TNS--------------------------
B2AR50_PODAN/95-198---------------------------PFNITSAPMYYGSTMSFLGSALL.YGK--------------------------
CHO2_PODAN/496-600---------------------------IYRFLNNPERVLGAAGFWGLALI.TWS--------------------------
B2JAT8_NOSP7/42-145---------------------------VFRLSRNPIYLSLTLFYIGIALL.LGA--------------------------
B2VTC6_PYRTR/87-190---------------------------PFNVSSSPMYHGSTMSFLATAIW.FGK--------------------------
CHO2_PYRTR/425-530---------------------------IYRFLNNPERVLGLAGVWGIAII.TWS--------------------------
B3RI13_TRIAD/89-192---------------------------PFNIFDNPMYIGSTSNFLGLALR.SAS--------------------------
CHO2_SCHJY/478-583---------------------------IYRYLNNPERFFGSAAFWGMALI.SNS--------------------------
B6QQY2_PENMQ/89-189---------------------------PFNVTGSPMYWGSTLSFLGTSLY.YGK--------------------------
B8LBH8_THAPS/30-132---------------------------IYGLMRHPMYTGVLIGMAGLSLV.TDS--------------------------
B8PB22_POSPM/91-194---------------------------PFNVLRDPMYVGSTMSFVAVSLW.FER--------------------------
CHO2_PICPG/450-564---------------------------IYHFLNNPERVTSNLTVWALYLLFNNS--------------------------
C4R5S7_PICPG/98-201---------------------------PFNIDDNPMYNGSTLCFLGTGLY.YGK--------------------------
CHO2_CLAL4/444-555---------------------------VYRYLNNPEQIFGVCGVMGVTMI.VPT--------------------------
C5DC91_LACTC/106-209---------------------------PFNVSNNPMYHGSTLTFLGTSLY.YGK--------------------------
CHO2_LACTC/450-558---------------------------IYRYLSNPERFLGVAGCWGAVLI.THF--------------------------
C5DZ83_ZYGRC/102-205---------------------------PFNVSSNPMYQGSTLTFIGYTLM.EGK--------------------------
CHO2_ZYGRC/430-538---------------------------IYRYLNNPETILGVAGVWGTVLM.TDF--------------------------
C5G0L0_ARTOC/115-215---------------------------PFNITSAPMYWGSTMSFLAVALY.HGK--------------------------
C6WWJ2_METML/43-146---------------------------PFRISRNPIYLAMTGMYLGISFF.TNS--------------------------
C7YM51_NECH7/94-197---------------------------PFNVTSSPMYTGSTMSFLATALY.FGK--------------------------
CHO2_NECH7/505-609---------------------------IYRFLNNPDRFFGTAGVWGAALI.TWS--------------------------
CHO2_SORMK/496-600---------------------------IYRFLNNPERVFGTAGLWGAALI.TWS--------------------------
E3I110_RHOVT/77-175---------------------------LYRFSRNPQYVASILGFFGTGLA.NGS--------------------------
D2U841_XANAP/75-178---------------------------PYRYLRHPSYTGALLAFYGLAVG.MGN--------------------------
D2V512_NAEGR/65-168---------------------------PFNVTDNPMYNGSTLWFLGHSLV.KSS--------------------------
D2VYZ6_NAEGR/455-563---------------------------IYRYLNNPEIVLGYCAYFGLALI.SKS--------------------------
D3AX06_POLPA/89-193---------------------------VYQYFNDPQYVGTTISCLGYAIR.YQS--------------------------
D3BED6_POLPA/557-662---------------------------IYRFLNNPDSVLGFAGYYGLSLI.GGS--------------------------
D3BN57_POLPA/99-202---------------------------PFNVMSNPMYNGSTILFLAHALH.GKS--------------------------
CHO2_SCHPO/491-596---------------------------IYRYVNNPERFLGCSAYWGLALI.SSS--------------------------
CHO1_SCHPO/110-213---------------------------PFNVNDNPMYNGSTLCFLSTALR.YGK--------------------------
Q0AM70_MARMM/72-173---------------------------IYRRTRNPQYVGYSGMFLGAAIA.AGS--------------------------
Q0AQW8_MARMM/72-173---------------------------IYRFSRNPQYVGYAAMFFGAAAA.AGS--------------------------
CHO2_PHANO/462-567---------------------------IYRFLNNPERVLGLAGVWGLALI.TWN--------------------------
Q0UN81_PHANO/69-173---------------------------PFNVSEAPMYHGSTLSFLATALW.FGK--------------------------
Q11IW9_CHESB/45-148---------------------------PFSFSRNPIYLGGTLIVIAIGLI.VGN--------------------------
Q1GIY9_RUEST/78-176---------------------------MYEYSRNPQYVTSVLATVGLGIT.TGS--------------------------
A0A0D1CJ51_USTMA/99-202---------------------------PFNVMANPMYWGSSMSFTAVALW.FGK--------------------------
PEMTL_DICDI/82-186---------------------------PYQFFSDPQYVGTTIAALGVAIR.NQS--------------------------
PEM2_DICDI/98-201---------------------------PFNVMNNPMYNGSVMLFIAHALS.YKS--------------------------
Q6C649_YARLI/97-200---------------------------PFNVSNNPMYHGSTLCFLASALW.YAK--------------------------
CHO2_YARLI/531-635---------------------------IYRYLNNPERFFGIAGIWGLALM.TNS--------------------------
CHO2_KLULA/451-559---------------------------IYRYLNNPERVFGVAGIWGTVLI.NNF--------------------------
Q6CV75_KLULA/106-209---------------------------PFNYFDNPMYQGSTFTFLGYALY.NGK--------------------------
Q6FUV4_CANGA/106-209---------------------------PFNVSNNPMYQGSTFSFIGTSLI.AGK--------------------------
CHO2_CANGA/431-540---------------------------IYRYLNNPEAILGVAGVWGSVLM.TDF--------------------------
Q752Z0_ASHGO/100-203---------------------------PFNVSDNPMYQGSTLTFLGTSLY.YGK--------------------------
Q7ZVZ2_DANRE/120-223---------------------------PFNVMDNPMYWGSTANYLGLALM.NAS--------------------------
Q86IF9_DICDI/521-626---------------------------IYRFLNNPDSVTGFAGFYGLSLI.AGS--------------------------
Q8TN26_METAC/121-221---------------------------VYSIVRHPMYAAGLIIFSGTPLA.LGS--------------------------
Q98I61_RHILO/42-146---------------------------IYRHVRNPMYVAVLSIILGQALL.FSS--------------------------
E7QGU3_YEASZ/100-199---------------------------PFNVSNNPMYQGSTLSFLGIALY.KGK--------------------------
F1SB04_PIG/61-160---------------------------PFSVLDNPMYWGSTAVYLGWALM.HAS--------------------------
F7BHJ5_XENTR/62-163---------------------------PFNVMENPMYWGSTANYLGLALL.NAS--------------------------
G1MZ29_MELGA/96-197---------------------------PFSILDNPMYWGSTAVYLGWSLM.HAS--------------------------
CHO2_YEAST/471-577---------------------------IYRYLNHPEAVLGVVGVWGTVLM.TNF--------------------------
CHO2_CANAL/468-576---------------------------VYRYLNNPEQIFGVCGVMGIFLI.YPT--------------------------
Q5KDE7_CRYNJ/618-724---------------------------IYRFLNNPERSMGGAAFFGLWLI.SNS--------------------------
Q5KHK0_CRYNJ/121-221---------------------------PFNVLSDPMYVGSFLTHLGTALW.FQS--------------------------
Q8DW48_STRMU/70-169---------------------------PYSIVRNPAYTGTIISILGLAFI.TLN--------------------------
Q8PE74_XANCP/100-199---------------------------PYRWLRHPSYTGALLCFYGMALG.MGN--------------------------

PF07298

B2JUD7_BURP8/3-190FPAAHAPGNH.................FKSIVKHPMTAGVGLWALAHLFV-SAT--------------------------
A1VI53_POLNA/3-190LAAAYVPRNA.................IKARLHHPMVLGVMFWAVAHLLA-NGN--------------------------
Q12HL7_POLSJ/3-190LVATYVPRNA.................IKATLHHPMLLSVKVWALAHLLA-NGT--------------------------
A2SBS8_METPP/3-190LAAAYVPGNG.................LKAKLHHPMVLSVKVWAFAHLLA-NGT--------------------------
Q223I4_RHOFT/3-190LAAAYVPGNI.................IKERIHHPMVLGVKLWALAHLLA-NGN--------------------------
A1K5T7_AZOSB/6-191LVAAYLPGSH.................IKATLRHPMLAGTALWAFAHLLA-NGT--------------------------
A1WT38_HALHL/3-190LFSAYGPANR.................IRNAVGHPMLLAVALWALAHLMA-NGR--------------------------
A6VV32_MARMS/3-191VGSALVPHTT.................MKKKVGYPMLIAIKIWAFAHLIS-NGS--------------------------
Q0AQE8_MARMM/3-183LTSAYAPGH..................IRRWVRHPMLAGVVVWSGAHLLA-NAE--------------------------
A1AZI2_PARDP/3-180FAADGMKTR..................ITRHLRHPQLTGFALWAFAHLVP-NGD--------------------------
Q28U80_JANSC/6-185YAVGGPKGDRVW...............LGTKLRHPQLTGYSLWAIAHLLV-NGD--------------------------
Q5LXD7_RUEPO/5-179MSPAGTKGK..................LLHKMRHPMLAGFRAWAAAHLLV-NGD--------------------------
Q1GLH3_RUEST/3-179TSPGPNKGA..................LFHKMRHPMLTGFKIWAVAHLLV-NGD--------------------------
A8LJK3_DINSH/5-184YGSSAAKGAKAW...............PANKIRHPQLTGVKIWALAHLLV-NGD--------------------------
Q169U5_ROSDO/3-182YGSSAAKGAKAW...............PAYKLRHPQLVGFKIWALAHLLV-NGD--------------------------
A0KG00_AERHH/3-186FCSGQGPNH..................LRRWLVHPQLLGTLLWAGAHLAV-NSE--------------------------
Q6N9Q3_RHOPA/31-253AAFGIGAANPLSFGGDPRKPFDPQHPGVVGIVRHPLLWAIGLWAGAHVVP-NGD--------------------------
Q219Y9_RHOPB/14-236AAFGVGAANPLSFGGNPRLAFDPEQPGIVGAARHPLLWAIALWSGAHLVP-NGD--------------------------
Q5LUC0_RUEPO/7-220AVAGLRAVNPLSFGGLGRGVFDPTRPGILALSRHPLLLALALWSGAHLLA-NGS--------------------------
Q0C1Y5_HYPNA/14-233VIGGTAIANPFSLGGLAERAYNPARPGILAVTRHPLLWAMVLWSLAHLIA-NGD--------------------------
Q169M4_ROSDO/6-220LAASIGQPNPFSFGGRDNDAFDPTDCGIIGYMRHPLLSVLALWALLHVLA-NGD--------------------------
A8LNX8_DINSH/42-256IALTLGRPNPFSFGGARNDIFDPDRPGIVRVTRHPLLLALAIWAGAHLFP-NGD--------------------------
A9CGK0_AGRFC/3-221VLAGLLSVNPLSISVRQ....GQQPGAIVRITRHPVLVGFLFWSLGHVVP-NGD--------------------------
Q2JYB9_RHIEC/5-223VIAGLLSANPLSITLNR....SPNPGAITKITRHPVLWGFAAWASGHIAA-NGD--------------------------
Q92Z13_RHIME/3-221VLAGLFSVNPLSVSIRQ....GQKPGSIVSVTRHPVLWGFAIWALGHLVA-NGD--------------------------
B0U8Q9_METS4/2-221IAAGLFAANPLSVSLRA....GAEPGPVTAVTRHPLMWGFLIWALAHIPP-NGD--------------------------
Q2VYZ8_MAGSA/17-229WMLGLSQKNPFSIGPGGAG.YDPARPGIVRLTRHPIIWGLGLWSAAHILP-NGH--------------------------
Q60BH7_METCA/3-224VVAGLTTPNPTAVSGESVLNDAEAARGILRITRHPFLWGLSLWALVHVIA-NGD--------------------------
A7HZ42_PARL1/3-227VVVGITTPNPTAVGADALADKPDTVKGMLRITRHPFLWGAAIWALWHILV-NGD--------------------------
Q1GUJ7_SPHAL/6-226FVGSLV.GNPALAAPGAEKAAQAAPRGVFAITRHPMMWGFALWALAHVMV-MPT--------------------------
Q2GC12_NOVAD/7-219FIPSFA.GNPVLPGRKAAGLGTVVPTGVFTITRHPMMWAFALWALAHIIV-APT--------------------------
Q8DMH0_THEEB/15-236LYPATFNLLEIAAVQKPE..VHLYETGIIRITRHPQLWGQLIWCVAHTLW-LGT--------------------------
Q113R6_TRIEI/12-233LYPSTFNLLEIAAIQKPQ..VHLHETGIIRITRHPQMVGQVIWCIAHTLW-LGT--------------------------
Q8YQ81_NOSS1/13-234LYPATFNLLEIAAIQKPQ..VHLYETGIIRITRHPQMVGQVIWCIAHTLW-LGT--------------------------
Q9ALA6_SYNE7/12-229LYPATFNLLEIAAIAQPQ..VRLYETGITRITRHPQTFGQILWCLAHSLW-LGT--------------------------
Q7V3C9_PROMP/9-231LYPATYNLLEIPSVLKPQ..VRIYGTGIMRITRHPQAFGQIIWCLAHTLW-IGT--------------------------
A9CI20_AGRFC/3-191LIASLIPAGH.................IATKTKHPLILSVKIWALAHLLA-NGE--------------------------
Q92UK4_RHIME/3-191LAAGFLPAGR.................IAVALKHPQVLSIKIWALAHLLA-NGE--------------------------
Q89MZ5_BRADU/5-191VVASYLRGR..................IYATLKHPMLAGIKLWAAAHLLA-NGD--------------------------
A7IF98_XANP2/3-187LVASEVPSH..................IKAWLKHPMLVAVKIWALAHLLA-NGD--------------------------
B0UL45_METS4/3-192FAAAYLPGR..................IKGALKHPMLAGVKIWAAAHLLA-NGD--------------------------
Q0C445_HYPNA/3-190LAAAYTPTGR.................IRKAVKHPMLVAVKIWAFGHLLA-NGE--------------------------
Q3JDP5_NITOC/3-187FLAPYFPGR..................INNTVKHPQLVAVMIWAVAHLLV-NGT--------------------------
Q9AAA0_CAUCR/3-186LPTANAPAGR.................IKATLRHPMLLGVILWSAGHLLV-NGD--------------------------
Q11KH3_CHESB/3-188MAASHRPGR..................ISTAVGHPMLLGTVIWGLAHLLA-NGT--------------------------
B4EFU3_BURCJ/3-190IAASYVPRNR.................IKTLVGHPMLAGVMVWAVAHLLV-NGT--------------------------
C5B332_METEA/3-195LAAAYLPGH..................LRARLKHPMLLAVKIWATAHLLA-NGD--------------------------
Q2JMU2_SYNJB/23-239LYPATFNLLEIAAIRKPE..IHLFETGIIRITRHPQMVGQVIWCVAHTLW-IGS--------------------------
Q2K5L0_RHIEC/3-191LVASLLPAGH.................IATRTKHPMVLSVKIWALAHLLA-NGE--------------------------
Q3SR07_NITWN/1-185VVASYIRGR..................IYAKLKHPMLAGIKLWATAHLLA-NGD--------------------------
Q46HM6_PROMT/12-228LYPATYNLLEIPAVLKPK..VRIYATGIIRVTRHPQAIGQIIWCFAHLLW-IGT--------------------------
Q63MK0_BURPS/3-190LVAAYVPGTR.................IKALVGHPMLAGVMVWAGAHLLA-NGT--------------------------

PF02544

Q19605_CAEEL/97-243--WNLPALAFAI...FTIANIGPRAV--------------------------------------------AHHKWYKETF
YN67_SCHPO/146-295--KSWASWIFLF...VGSAQMFVWAK--------------------------------------------KKHARYLKEF
Q20344_CAEEL/97-243--WNLPALAFAI...FTFANIGPRAI--------------------------------------------AHHNWYKEKF
S5A1_RAT/110-259--WSLQGVVFAL...FTLSTLLTRAK--------------------------------------------QHHQWYHEKF
S5A2_HUMAN/105-254--WSLPALAFAF...FSLCFLGLRAF--------------------------------------------HHHRFYLKMF
PORED_CAEEL/189-309--P..DAYVYRFIIMFVCINQTFAAL--------------------------------------------ITHSWYHKTF
Q23431_CAEEL/103-253--RSFPAIAFAF...FIVCNLAPRAM--------------------------------------------SHHKWYQKMF
DET2_ARATH/111-262--WSWAGIGFFL...YTCSNLFPRAR--------------------------------------------ASHKWYIAKF
TECR_YEAST/154-310--K......FNL...FAVLFLTVSTA--------------------------------------------QMYAWAQKKN
S5A1_HUMAN/110-259--WSVQGAAFAF...FTFCFLSGRAK--------------------------------------------EHHEWYLRKF

PF06966

YJD4_SCHPO/67-320LNWTIFA..WLGLVGVFQGSTRLTEK--------------------------------------------MSCEKY...-
Q10E47_ORYSJ/24-252EWLVILGPVFLTLLLLFVSGIPLLEA--------------------------------------------SADKRFGQN-
Q8PAZ9_XANCP/20-250LALCALGPVVMFVFLYRFTGIPYTEQ--------------------------------------------QALRSRG..-
Q9A3U2_CAUCR/70-299..WALPGPLLMTFLLTKWSGVPTTEG--------------------------------------------KMRK...SK-
Q9VSM5_DROME/25-264EWVAIASPIFTTMIILFLSGIPLRER--------------------------------------------SADEKYKDQ-
Q9CHY6_LACLA/17-245..WLVISPLLITSLLLFVSGVPILE.--------------------------------------------...KKYKNR-
Q7CY59_AGRFC/19-248SWASLAAPVMMYWLLVHVSGIPPLEE--------------------------------------------HMLKSRG..-
O81042_ARATH/64-303..WTLIGALVNTLCLVYVT.I.LVER--------------------------------------------RMVKQQYRA-
O53731_MYCTU/17-243..ATVGSPLLMTYLLVDVSGARLTE.--------------------------------------------...RYLKGR-
Q8Y9D9_LISMO/16-244..WLITSPIVITLLLLFVSGVPLLE.--------------------------------------------...KKYQDR-
Q984A1_RHILO/21-257GFAALAGPILMYWLLVHVSGIPPLEA--------------------------------------------HMLRSRG..-
B9DFE9_ARATH/24-252EYLVIFGPLFLTLLLLFVSGIPLLEA--------------------------------------------SADKKHGNS-

PF01222

LBR_CHICK/175-609......HILPYFYVIYFICLLVHREA--------------------------------------------RDEHHCKKKY
ERG24_NEUCR/17-490EARGWGIVFTYFYILYFAILLIHRDL--------------------------------------------RDDEKCSKKY
STS1_SCHPO/7-453......SPLPYFYPCFFFVVLVHRVS--------------------------------------------RDIKKCKAKY
ERG4_YEAST/34-473......SVFPWFFPVFFLVVLIHRAF--------------------------------------------RDQAKCKRKY
ERG24_YEAST/8-438......TPLTYYYSLYFATLLLHRQQ--------------------------------------------RDEHKCRLKY

PF04140

Q9EWQ7_STRCO/75-167--WLTAAVFTAANAMLLT.VRLRCEN------------------------------------------------------
Q99YI2_STRP1/81-173--KITAMLLFPCYIVVIY.LRIREEN------------------------------------------------------
P91402_CAEEL/171-267--..ICCVVYAYVTWHFFASRIYDEE------------------------------------------------------
Q9KF68_BACHD/72-166--YVTAFLFSLLNAIVLY.IRIHTEE------------------------------------------------------
MAM4_SCHPO/121-215--..VSTLLFSLVLWKFFSQRITTEE------------------------------------------------------
Q9CM58_PASMU/75-167--KYTALIGLPIYLLILG.VRIKQEE------------------------------------------------------
ICMT_HUMAN/161-257--..ICGVSYALTVWRFFRDRTEEEE------------------------------------------------------
STE14_YEAST/123-219--..LSLVIFIFVLWKFFSDRIRVEE------------------------------------------------------
Q9RTL5_DEIRA/91-184--WRTAVAFSLLNAALLLGVRIPAED------------------------------------------------------
B6IT05_RHOCS/73-163--WEIALVFSFLNAALLF.HRIRQEE------------------------------------------------------
F7EBZ7_XENTR/175-268--..LCLFGYTFASWRFFRERIEEEE------------------------------------------------------
Q2G1E3_STAA8/100-189--TYTTILLVP.YAYFLY.VRIKQEE------------------------------------------------------

PF04191

A4HJV7_LEIBR/438-543--PVV.LVVSVVSHAAAKMFEAIVEE------------------------------------------------------
PEMT_HUMAN/89-192--PTG.LLLTVLVALTYIVALL.YEE------------------------------------------------------
CHO2_ASPCL/504-608--GAI.TFLALLSHTLTLAFIQFVER------------------------------------------------------
A1CQK4_ASPCL/70-170--AAG.LLLTAEVFIVYWFALQ.WED------------------------------------------------------
A3LQ40_PICST/106-209--PAG.IAVAGFVFVMYKIALL.FEE------------------------------------------------------
CHO2_PICST/449-558--VEN.LVCCFLWVANNFVRINFIER------------------------------------------------------
A4HJL2_LEIBR/106-210--AVG.VLLTGLVALVYHVSTRYFES------------------------------------------------------
CHO2_MAGO7/497-601--RAI.FVLALISHLLTLAFISYVEK------------------------------------------------------
CHO2_PICGU/462-570--LEN.FVCCLLWVSNNFFRINFVEK------------------------------------------------------
CHO2_LODEL/480-589--FEN.LTCCVLWVLSNFIRINFIEK------------------------------------------------------
A5UZK8_ROSS1/43-144--II..ALVLSVALLVFFHLKSRREE------------------------------------------------------
A7TIE1_VANPO/140-243--SAG.LLVAFMVQTMYNLALK.LEE------------------------------------------------------
CHO22_VANPO/452-560--CYENIILAIIWTSTNFIFVKFIEK------------------------------------------------------
CHO21_VANPO/439-547--SKTNVTLAVLWTVTNLIFVKLIEE------------------------------------------------------
A8NIW8_COPC7/92-195--PAG.LFISAYVYIVYRIALL.FEG------------------------------------------------------
CHO2_MALGO/537-642--LTA.TVVAQLAHLSHWWFLGCVEG------------------------------------------------------
A8PVU2_MALGO/102-205--PSG.LLLSVLVWVTYRVALC.FES------------------------------------------------------
A9B4Y9_HERA2/33-137--AISNLVLVIAFVIIVDRWYIAFEE------------------------------------------------------
A9V3D6_MONBE/125-229--PVG.VVLGAVVFWWYYMAAL.YEE------------------------------------------------------
CHO2_LACBS/492-596--KLV.LSLAVIRHLANWWFLSSVEN------------------------------------------------------
B1MLL6_MYCA9/108-208--YW..GLLATVPAAAALVVRIIDEE------------------------------------------------------
B1WZT5_CYAA5/96-194--WM..VMITDTGLALWFFLAPFTEE------------------------------------------------------
B2AR50_PODAN/95-198--PAG.ILLTLHVLIVYIIAIQ.FEN------------------------------------------------------
CHO2_PODAN/496-600--KAV.FVMALVSQLLMLGFISFVEK------------------------------------------------------
B2JAT8_NOSP7/42-145--LWA.LLLLFPLLVIVQIGIVQREE------------------------------------------------------
B2VTC6_PYRTR/87-190--PAG.ILLTGLVAVAYSIACK.WED------------------------------------------------------
CHO2_PYRTR/425-530--PAV.FYVATTAHILNLAFLQFVEK------------------------------------------------------
B3RI13_TRIAD/89-192--PCG.IIMSGFVYLVYWIGLL.LEE------------------------------------------------------
CHO2_SCHJY/478-583--SWI.FFLALLAQVSTLGIIRFVEK------------------------------------------------------
B6QQY2_PENMQ/89-189--VAG.LLLTLEVFVLYWFALR.WED------------------------------------------------------
B8LBH8_THAPS/30-132--VL..RMLLTVVLYFVLDVKSDYEE------------------------------------------------------
B8PB22_POSPM/91-194--PAG.LLITFYVYAVYLIALR.FEG------------------------------------------------------
CHO2_PICPG/450-564--NKIFLVIALLFTMNNLIVLNFIEK------------------------------------------------------
C4R5S7_PICPG/98-201--PAG.VFASLVVYLMYQIALK.FEE------------------------------------------------------
CHO2_CLAL4/444-555--YDN.FMICLLWMLNNFFRINFVER------------------------------------------------------
C5DC91_LACTC/106-209--AAG.VFATVLVNLVYNIAQQ.FEE------------------------------------------------------
CHO2_LACTC/450-558--SPYNLILAALWTAANIALVKLVEE------------------------------------------------------
C5DZ83_ZYGRC/102-205--AAG.LLLSFMVYSMYYFALK.FEE------------------------------------------------------
CHO2_ZYGRC/430-538--SWENIALACLWSGCNFIIVKFIEQ------------------------------------------------------
C5G0L0_ARTOC/115-215--PAG.LLLTAEVFICYKIACL.WEE------------------------------------------------------
C6WWJ2_METML/43-146--LWS.LVLLVPLLSVMHWGVIFREE------------------------------------------------------
C7YM51_NECH7/94-197--PAG.ILLTVWVYIVYKIALL.YED------------------------------------------------------
CHO2_NECH7/505-609--RSI.FLMALVTQILTVFYISYIER------------------------------------------------------
CHO2_SORMK/496-600--RAI.FLMALAGHFLTLAFLAYVEK------------------------------------------------------
E3I110_RHOVT/77-175--AQ..SAVLCGLAILVYVVLPYTEE------------------------------------------------------
D2U841_XANAP/75-178--VLS.LLAIVLPVTWVFVHRIRIEE------------------------------------------------------
D2V512_NAEGR/65-168--PAG.ILMAICVFVMYKFACL.FEE------------------------------------------------------
D2VYZ6_NAEGR/455-563--YAV.LGLAILSQFATYLFVKFVEK------------------------------------------------------
D3AX06_POLPA/89-193--ING.FICTAAMGLVFYISVKFVEG------------------------------------------------------
D3BED6_POLPA/557-662--LPL.FAIAISSQVANFLFVKYVEH------------------------------------------------------
D3BN57_POLPA/99-202--VAG.IFLSLIVFITYRIALT.FEE------------------------------------------------------
CHO2_SCHPO/491-596--AWI.FLIAILAQLSNLAIIRLVEQ------------------------------------------------------
CHO1_SCHPO/110-213--VAG.LLLTLEVFFVYRIALK.FEE------------------------------------------------------
Q0AM70_MARMM/72-173--GLA.MLSALVFTAIIHVFITWVEE------------------------------------------------------
Q0AQW8_MARMM/72-173--ILA.LTSSALFALIIHVFITRVEE------------------------------------------------------
CHO2_PHANO/462-567--PPI.FYLAATAHILNLAFLQFVER------------------------------------------------------
Q0UN81_PHANO/69-173--PAG.VLLTGVVAVAYGVARR.WED------------------------------------------------------
Q11IW9_CHESB/45-148--AWF.LLFALLAAFATQKLAIEPEE------------------------------------------------------
Q1GIY9_RUEST/78-176--WT..TVALALVLFALYFLFVLNEE------------------------------------------------------
A0A0D1CJ51_USTMA/99-202--PAG.LLLSVLVVIVYALALR.FEE------------------------------------------------------
PEMTL_DICDI/82-186--IYG.FLCTILVGVVFYISATFVET------------------------------------------------------
PEM2_DICDI/98-201--VAG.LVLSFVVYVVYKFALI.FEE------------------------------------------------------
Q6C649_YARLI/97-200--PAG.LLITAFVSLMYSIALK.FEE------------------------------------------------------
CHO2_YARLI/531-635--PGV.GILAFLWTLEGMAFIKFVEQ------------------------------------------------------
CHO2_KLULA/451-559--SNWNLWLATTWTMFNWFTVKFIET------------------------------------------------------
Q6CV75_KLULA/106-209--PAG.LIATLVVHVMYNIALR.FEE------------------------------------------------------
Q6FUV4_CANGA/106-209--PAG.LILAFFVHAMYYMALK.FEE------------------------------------------------------
CHO2_CANGA/431-540--AWENIALGMLWTATNFVLVKFIET------------------------------------------------------
Q752Z0_ASHGO/100-203--AAG.VFAALLVNLMYTMALK.LEE------------------------------------------------------
Q7ZVZ2_DANRE/120-223--PIG.IVLTAVVALSYKVAIA.YEG------------------------------------------------------
Q86IF9_DICDI/521-626--FPL.FALSIFSQVANFLFIKFVEK------------------------------------------------------
Q8TN26_METAC/121-221--WW..GLLILVPIMLVIIWRLLEEE------------------------------------------------------
Q98I61_RHILO/42-146--WTL.VAYAVIGAVVMGSFVRFYEE------------------------------------------------------
E7QGU3_YEASZ/100-199--PAG.LVVSAVVYFMYKIALR.WEE------------------------------------------------------
F1SB04_PIG/61-160--PTG.LLLTLVVAAIYKLAIL.FEE------------------------------------------------------
F7BHJ5_XENTR/62-163--PAG.LLLTALVALCYKVAIL.YEG------------------------------------------------------
G1MZ29_MELGA/96-197--PAG.LLLTAVVAISYTIAVL.YEG------------------------------------------------------
CHO2_YEAST/471-577--AVTNIILAVLWTLTNFILVKFIET------------------------------------------------------
CHO2_CANAL/468-576--VEN.FVCVGLWVVNNFIRINFIEK------------------------------------------------------
Q5KDE7_CRYNJ/618-724--KLV.FALALASHLSHWWFLTFVER------------------------------------------------------
Q5KHK0_CRYNJ/121-221--PAG.IVLAAWVWIVYAVALK.FEG------------------------------------------------------
Q8DW48_STRMU/70-169--IFN.ILIVFIILSIGYAIRIRTEE------------------------------------------------------
Q8PE74_XANCP/100-199--ALS.LLVIVLPVTWVFLRRIRVEE------------------------------------------------------

PF07298

B2JUD7_BURP8/3-190--LHAVVLFGAFLVWAVFDYAAARRR.......DRA.EGVVYPGGTLSR..................DVMPVVAGVVLWV
A1VI53_POLNA/3-190--RAHVLLFGSFLVWAGLSFRAARAR.......DRA.ALAVYPAGTASG..................TLMAVLAGMAAWA
Q12HL7_POLSJ/3-190--LAGVVLFGSFLVWAVVCFKAARGR.......DRV.AQTVYPPGTATG..................TAITMAVGLVAWA
A2SBS8_METPP/3-190--LADVLLFGGFLVWAVLCFRAARGR.......DRA.TGVATPPGRAGA..................TAITVVVGAVAWA
Q223I4_RHOFT/3-190--LGHVVLFGSFLAWAIVDFTASRRR.......DRT.LGTRYPGGTAGA..................TGITVALGVGAWI
A1K5T7_AZOSB/6-191--LADLLLFGGFLAWSATDFVSARRR.......EPT.SRITRPALKV....................DATAVLLGIVAWA
A1WT38_HALHL/3-190--LGDLVFFGAFLAWASVTFVAARER.......DRR.QAASPTPAQRWG..................NAWAIGGGLIGYI
A6VV32_MARMS/3-191--LADVILFGSFLVWSIVSFAVYRRR.......DRK.AGVVRDQESGVQF.................DLAAFTFAMVTWF
Q0AQE8_MARMM/3-183--ASAVLLFGSFFVWSLVTFIAACLR............ETPPPVVKGWGG.................DLTAIVLGLIAAL
A1AZI2_PARDP/3-180--LPSFVLFGGLLVWALVEMVVINRA.......QPD.WTPPAGPFPARK..................EIMAVAGAVVVLL
Q28U80_JANSC/6-185--TPSFVLFGGLLVWALGSVVAINAA.......EGP.WT.PPNRAPKRK..................ELTYVIATVVIVV
Q5LXD7_RUEPO/5-179--LASIILFGGLFLWGIVEVAAINAA.......EPE.WT.PGEPGTLGK..................DAMFLVASVVLMA
Q1GLH3_RUEST/3-179--LASVILFGGLLAWAVVEVITINKS.......EPN.WQ.PNPKGSLAK..................DAMFFVASIVLLG
A8LJK3_DINSH/5-184--LASIVLFGGLLAWAVGEVILINKA.......EPD.WT.PPETAGMKT..................KIRLAVITVVLYL
Q169U5_ROSDO/3-182--LASIILFGGLLGWAVGSVILINKA.......EPE.WT.APERAGMAT..................RVRLAIITLVLYA
A0KG00_AERHH/3-186--ARSLVLFGGIGLWALVSIVWISVR.........D.WQRHPRPVANWYG.................TGLSVGAGLALTA
Q6N9Q3_RHOPA/31-253--LAHVLLFGFFAMIAVIGMLIIDRR.KRR.QLGAERWAELAARTSFWPFAALISGR..FRPQTWRISSLRLCIGLAAWL
Q219Y9_RHOPB/14-236--LAHALLFGFFALIALAGMVMIDRR.KQR.RLGYEAWHALARNTSFWPFAALLQGR..FRPRSYGVDAKRLAIALVAWL
Q5LUC0_RUEPO/7-220--LAHVILFGLFAGFAVMGMALIDRR.KRR.ELGAD.WARLAAGTARLSPRGL..........PALLAPRVLWPAALLYL
Q0C1Y5_HYPNA/14-233--LAHVLLFGSLGVFSVVGILAMETR.SRM.RGGAL.WSQMIRGTSLVPFAALLTG....NARWRELLQLRMLLLPVVWG
Q169M4_ROSDO/6-220--LAHVLLFGTLGLFAYVGPRIIDAR.NRR.DMGAEAWEALVGETRRQRRIRV..........PSPAMMLRLGAGVILYL
A8LNX8_DINSH/42-256--LAHVILFGTFAAFALLGGRLVDRR.ARR.TLGSQ.WSPLLQKSRQTPVFRAF.........PLGESLLRLGLGVVLYL
A9CGK0_AGRFC/3-221--LRSVILFGGFALFSLGGMAMTEKR.ARK.RLGNA.WNATAAGSATVPFAAILSGKT.RIAVDGPMLLAAALTGLTVWW
Q2JYB9_RHIEC/5-223--LRSLLLFGGFAVFALGAISMTDKR.AKR.RLGVS.WTRLAEHTSIWPFGACFKGEQ.PRLDVPMLLAGLASAVMVLWL
Q92Z13_RHIME/3-221--VRSLILFGGFALFALGTIPMIEKR.ARR.RLGDQ.WQRQSAKTSILPFAALFTGRTRLSGDTPIATATVATAVLTLWL
B0U8Q9_METS4/2-221--LVSVVLFGGMAAFSLAGFALLDAK.ARR.RLGAERWRALSRGTSVVPFAAILAGR..ARLGPVRPLLPAAAAALAAYA
Q2VYZ8_MAGSA/17-229--LAGLLLFVPLLLLCLVGPRILDAK.RRK.SLGDRHWREMAERAVFEPRALL...........AELGWARICGGLALYP
Q60BH7_METCA/3-224--VAALLLFGSLLALCLAGTRSIDAK.RRR.TYGDR.WERFAAATSNVPFMAIKEGR..NRLELGEIGWQRLGIAVALYL
A7HZ42_PARL1/3-227--KASIIFFGTFALLAILGTFSIDDK.KRK.RMGES.WTAFAARTSNLPFAAIFAGR..NQLKLGELGWWRILAALIVFG
Q1GUJ7_SPHAL/6-226--PGQIVLSATIAFLALAGSAGQDVK.KAR.LMGDA.WRGWAARTSFVPFARQVGGA..APWADAMPRAHALLGGIILWL
Q2GC12_NOVAD/7-219--GRSLIFMSGMIVLALLGSHFQDKR.KIA.GNNRE.FAPWQRRTSYWPRLDK...........LGAIGLIWLLAALVWV
Q8DMH0_THEEB/15-236--SFTLLTSLGLIAHHCFGVWHGDRR.WYA.RHGEA.FAALKNRTSIIPFKAIWEGK...QQLVWQEFLRPAYGGVVIFV
Q113R6_TRIEI/12-233--SFTFVTSVGLILHHLFGVWHGDRR.LQK.RFGES.YDQLKSRTSVIPFLAIIQGR...QTLHLQEFIRWAYLGIGLFV
Q8YQ81_NOSS1/13-234--SFTLVTSFGLILHHLFGVWHGDRR.MSK.RYGEA.FEIVKQRTSIIPFAAIIDGR...QSIKWEEFIRPAYLGVAIFV
Q9ALA6_SYNE7/12-229--SFMMVASAGLIAHHLFSIWHGDRR.LQK.RYGEA.FEALKSRTSIIPFLAIAQGK...QTLVWKEFLRPAYLGVAIAI
Q7V3C9_PROMP/9-231--SFTFITSIGLILHHLFAIWHGDKR.LEI.KFGEE.FYKYKESTSIIPFVAIFDGR...QQIKLKEFFKLSQIGILIAI
A9CI20_AGRFC/3-191--TSSILLFASFLAWGVVMRISLKRR.......ERA.GEKVVRDFVSSRY.................DLVAIVGGIVLWG
Q92UK4_RHIME/3-191--TSSVLLFGSFLAWAVILRISLKRR.......ERA.GEKVLPVFKSARN.................DVLAVVIGLVAFV
Q89MZ5_BRADU/5-191--LGSIILFGSFLGWAVFDRISLKHR.......TDA.GGPPIPVGGVSN..................DLIAVAVGVVAYL
A7IF98_XANP2/3-187--VASIVLFGSVLAWAVYDRIAVKRR.......GDP.LPVAPNNYAG....................DALVVGGGLVLYA
B0UL45_METS4/3-192--LGSILLFGSILAWAVAARISVKRR..DE.VKAHA..GPAAAPAGWRN..................DALAVGIGVVAWF
Q0C445_HYPNA/3-190--LNSVILFGSFLGYAVIDRIALKKR.......GDN.GPAPDAPVSAMG..................DIAAVGIGVAAYL
Q3JDP5_NITOC/3-187--LADLLLFGSFLLWAIVDRISMMNR.......ATR..SVPSVPQSKAN..................DIIVVVVGLAVYA
Q9AAA0_CAUCR/3-186--QASVLLFGAFLVWAVVDLFSAIGR.......KEP.APVVVKPRA.....................DLTAVLGGTVAYL
Q11KH3_CHESB/3-188--LADLLLFGGIAVWGTVDWVSSVQR.......PRE..PVAKGKPSPRN..................DVMAVVGGLVIYA
B4EFU3_BURCJ/3-190--VHAVVLFGAFFVWSIVDFVVSRAR.......DRS.DGVRYPAGGLAG..................DLATVAAGLVAWA
C5B332_METEA/3-195--LGSILLFGSFLAWAVVARISAKRRALTAGQVAQQ.HGGQAAPAGWRN..................DAIAVVVGVVAWF
Q2JMU2_SYNJB/23-239--SFMVVTSLGLIAYHLFAVWHGDHR.LER.KYGQA.FRDLKARTSVIPGLAILQKR...QQLRPQEFFRWAYLGVFSFV
Q2K5L0_RHIEC/3-191--TSSVLLFAAFLAWGVIVRISLKRR.......ERA.GEITLRPFVSAKY.................DLYALVIGIVVWA
Q3SR07_NITWN/1-185--LGSIILFGSILAWAVIDRISLKHR.......SDP.GGLPIPVGGVRN..................DVIAIVVGVVVYV
Q46HM6_PROMT/12-228--SFTLVTCLGLIAHHLFAIWHGDRR.LSL.KFGQE.FEDVKKRTSVVPFLAVLDGR...QKLQIKEFLRPSQMGILIAV
Q63MK0_BURPS/3-190--LHAELLFAAFFVWAFVDFIASRAR.......DRR.DGVRYPAGSLAR..................DGVAIAVGLLVWA

PF02544

Q19605_CAEEL/97-243.PGYPPNRR-----ILIPRIF
YN67_SCHPO/146-295.PNYPRSRK-----IMIPFFL
Q20344_CAEEL/97-243.PKYPPTRR-----ALIPYIY
S5A1_RAT/110-259.EDYPKSRK-----ILIPFVL
S5A2_HUMAN/105-254.EDYPKSRK-----ALIPFIF
PORED_CAEEL/189-309.PKYPKSRK-----ALIPYVL
Q23431_CAEEL/103-253GEQYPRDRH-----ALVPGVW
DET2_ARATH/111-262KEEYPKTRK-----AVIPFVY
TECR_YEAST/154-310.KKYHTRRA-----FLIPFVF
S5A1_HUMAN/110-259.EEYPKFRK-----IIIPFLF

PF06966

YJD4_SCHPO/67-320-PLYRVYQD-----KV-----
Q10E47_ORYSJ/24-252-EEYRTYKN-----TT-----
Q8PAZ9_XANCP/20-250-EDYAQYQR-----ST-----
Q9A3U2_CAUCR/70-299-PGYEEYVA-----RT-----
Q9VSM5_DROME/25-264-LEYRKYKA-----ST-----
Q9CHY6_LACLA/17-245-EDFKEYAK-----TT-----
Q7CY59_AGRFC/19-248-EKFRALQR-----RV-----
O81042_ARATH/64-303-EAYRAYQK-----TT-----
O53731_MYCTU/17-243-PGFAEYQR-----RT-----
Q8Y9D9_LISMO/16-244-ADFQAYAN-----KT-----
Q984A1_RHILO/21-257-VQFRRYQE-----RV-----
B9DFE9_ARATH/24-252-GAYRSYKK-----TT-----

PF01222

LBR_CHICK/175-609GLAWERYCQRVPYTHISLHLL
ERG24_NEUCR/17-490GDDWEKYKKLVKW.RIVPGIY
STS1_SCHPO/7-453GADFDEYCRICPY.LFIPYIF
ERG4_YEAST/34-473GKDWDEYCKHCPY.VFIPYVF
ERG24_YEAST/8-438GENWEEYERKVPY.KIIPYVY

PF04140

Q9EWQ7_STRCO/75-167-----TALA-----Q------
Q99YI2_STRP1/81-173-----KLLA-----E------
P91402_CAEEL/171-267-----KDLI-----S------
Q9KF68_BACHD/72-166-----EALQ-----A------
MAM4_SCHPO/121-215-----AYLV-----S------
Q9CM58_PASMU/75-167-----SAMA-----H------
ICMT_HUMAN/161-257-----ISLI-----H------
STE14_YEAST/123-219-----KYLI-----E------
Q9RTL5_DEIRA/91-184-----RALA-----E------
B6IT05_RHOCS/73-163-----RALA-----.------
F7EBZ7_XENTR/175-268-----FSLI-----H------
Q2G1E3_STAA8/100-189-----KLMN-----.------

PF04191

A4HJV7_LEIBR/438-543-----PHMR-----KHYGD.Q
PEMT_HUMAN/89-192-----PFTA-----EIYRQKA
CHO2_ASPCL/504-608-----PHMQ-----KLYGR.S
A1CQK4_ASPCL/70-170-----PFTA-----EIYAKRE
A3LQ40_PICST/106-209-----PFTA-----KIYAARD
CHO2_PICST/449-558-----WHMI-----KVYGEQE
A4HJL2_LEIBR/106-210-----PFTA-----MIYSKRG
CHO2_MAGO7/497-601-----PHMQ-----KIYGQ.S
CHO2_PICGU/462-570-----VHMI-----KVYGEKE
CHO2_LODEL/480-589-----WHMI-----RLYGEQE
A5UZK8_ROSS1/43-144-----RWLV-----ERY.PEY
A7TIE1_VANPO/140-243-----PFTA-----QIYAKRD
CHO22_VANPO/452-560-----PHVS-----KIYG.NE
CHO21_VANPO/439-547-----PHVS-----KVYG.NG
A8NIW8_COPC7/92-195-----PFTD-----MIYSNRA
CHO2_MALGO/537-642-----PHMR-----RLYGA.D
A8PVU2_MALGO/102-205-----PFTA-----NIYREAA
A9B4Y9_HERA2/33-137-----RAML-----AKFGEQY
A9V3D6_MONBE/125-229-----PLMV-----EMYKKDL
CHO2_LACBS/492-596-----PHMR-----KLYGD.S
B1MLL6_MYCA9/108-208-----KMLR-----HDL.QGY
B1WZT5_CYAA5/96-194-----PWLQ-----ERYGEEY
B2AR50_PODAN/95-198-----PFTS-----GIYAKRE
CHO2_PODAN/496-600-----PHMQ-----KIYGQ.N
B2JAT8_NOSP7/42-145-----NYLE-----RKFGDEY
B2VTC6_PYRTR/87-190-----PFTS-----MIYQKRE
CHO2_PYRTR/425-530-----PHVI-----KLYGE.N
B3RI13_TRIAD/89-192-----PYTE-----EIYRQKN
CHO2_SCHJY/478-583-----PHMQ-----RIYGS.G
B6QQY2_PENMQ/89-189-----PFTA-----EIYAKRE
B8LBH8_THAPS/30-132-----TLLV-----ESYGKEY
B8PB22_POSPM/91-194-----PFTD-----MIYSNRA
CHO2_PICPG/450-564-----PHMV-----KLYGEQN
C4R5S7_PICPG/98-201-----PFTA-----KIYAKRE
CHO2_CLAL4/444-555-----SHMI-----KIYGERE
C5DC91_LACTC/106-209-----PFTA-----QIYAKRD
CHO2_LACTC/450-558-----PHVS-----KVYG.TS
C5DZ83_ZYGRC/102-205-----PFTA-----MIYAKRD
CHO2_ZYGRC/430-538-----PHMA-----KLYG.DN
C5G0L0_ARTOC/115-215-----PFTV-----EIYSKRD
C6WWJ2_METML/43-146-----RYLA-----KQFGQAY
C7YM51_NECH7/94-197-----PFTS-----GIYAKRE
CHO2_NECH7/505-609-----PHMQ-----KIYGR.S
CHO2_SORMK/496-600-----PHMQ-----KVYGR.N
E3I110_RHOVT/77-175-----PWLE-----RAYGDVY
D2U841_XANAP/75-178-----TMLT-----EAFPLDY
D2V512_NAEGR/65-168-----PFTA-----MIYAKRD
D2VYZ6_NAEGR/455-563-----PHMD-----KIYGAKN
D3AX06_POLPA/89-193-----PHMN-----RIYENKN
D3BED6_POLPA/557-662-----PHMK-----KLYGT.K
D3BN57_POLPA/99-202-----PFTA-----HIYSKRT
CHO2_SCHPO/491-596-----PHMQ-----KVYGN.T
CHO1_SCHPO/110-213-----PFTA-----KIYAARD
Q0AM70_MARMM/72-173-----PHMR-----RTFGDAF
Q0AQW8_MARMM/72-173-----PHLD-----RVFAAAY
CHO2_PHANO/462-567-----PHMQ-----RLYGR.K
Q0UN81_PHANO/69-173-----PFTG-----EIYAKRE
Q11IW9_CHESB/45-148-----RHLA-----QHFGKRY
Q1GIY9_RUEST/78-176-----RWLL-----KGYGKAF
A0A0D1CJ51_USTMA/99-202-----PFTA-----NIYKQAE
PEMTL_DICDI/82-186-----PHLK-----NIYSNRS
PEM2_DICDI/98-201-----SFTN-----YIYSTAA
Q6C649_YARLI/97-200-----PFTG-----EIYAKRD
CHO2_YARLI/531-635-----PHMQ-----RIYGT.S
CHO2_KLULA/451-559-----PHLL-----KVYG.TK
Q6CV75_KLULA/106-209-----PFTA-----KIYAKRA
Q6FUV4_CANGA/106-209-----PFTA-----EIYAKRD
CHO2_CANGA/431-540-----PHVS-----KVYGPSA
Q752Z0_ASHGO/100-203-----PFTA-----MIYAKRD
Q7ZVZ2_DANRE/120-223-----PFTQ-----EIYRQRS
Q86IF9_DICDI/521-626-----PHMK-----RLYGS.K
Q8TN26_METAC/121-221-----KFLS-----ENL.PGY
Q98I61_RHILO/42-146-----PTLA-----RRYGADY
E7QGU3_YEASZ/100-199-----PFTA-----MIYANR.
F1SB04_PIG/61-160-----PFTA-----EIYRQR.
F7BHJ5_XENTR/62-163-----PFTE-----EIYRKK.
G1MZ29_MELGA/96-197-----PFTE-----EIYRQK.
CHO2_YEAST/471-577-----PHVN-----KIYGK..
CHO2_CANAL/468-576-----SHMV-----KLYGEQ.
Q5KDE7_CRYNJ/618-724-----PHMQ-----RLYGKR.
Q5KHK0_CRYNJ/121-221-----PFTD-----KIYSAK.
Q8DW48_STRMU/70-169-----EVLE-----QHFGR..
Q8PE74_XANCP/100-199-----AALR-----RAFPTRY

PF07298

B2JUD7_BURP8/3-190AFVFFLHGW-----L.IGVKP
A1VI53_POLNA/3-190VFAFWAHGL-----L.IGIRP
Q12HL7_POLSJ/3-190GFAFWAHGV-----L.IGVRP
A2SBS8_METPP/3-190VFAFWAHGA-----W.IGVRP
Q223I4_RHOFT/3-190AFALWLHGL-----L.IGVRP
A1K5T7_AZOSB/6-191IFARFLHGP-----L.IGVPP
A1WT38_HALHL/3-190VFALFLHIP-----I.TGVPA
A6VV32_MARMS/3-191AIAFYLHQA-----I.IGVSP
Q0AQE8_MARMM/3-183IILN.FHMY-----L.FGVAV
A1AZI2_PARDP/3-180VVGL.IHAW-----L..GYNP
Q28U80_JANSC/6-185VVML.IHWA-----L..GVQP
Q5LXD7_RUEPO/5-179VIGY.IHGL-----V..G..P
Q1GLH3_RUEST/3-179VIGY.IHGL-----V..GPSP
A8LJK3_DINSH/5-184VIGG.IHAW-----L..GVWP
Q169U5_ROSDO/3-182LISA.VHIW-----A..GVWP
A0KG00_AERHH/3-186LLIFWGHGM-----L.TGIPL
Q6N9Q3_RHOPA/31-253SLLL.LHPL-----V.IGVSP
Q219Y9_RHOPB/14-236TLLA.LHAP-----V.IGVSP
Q5LUC0_RUEPO/7-220ALLL.AHAP-----V.IGVSP
Q0C1Y5_HYPNA/14-233GLIL.LHRP-----V.VGVSP
Q169M4_ROSDO/6-220VLVF.LHPV-----V.IGVPV
A8LNX8_DINSH/42-256VLIG.VHPW-----L.FGVSP
A9CGK0_AGRFC/3-221LLAG.GHAM-----L.FGADP
Q2JYB9_RHIEC/5-223LFAG.GHSA-----M.FGADP
Q92Z13_RHIME/3-221LAG..GHAA-----L.FYADP
B0U8Q9_METS4/2-221WFLAQGHAL-----L.IGPDP
Q2VYZ8_MAGSA/17-229VLLW.LHPM-----V.IGLSP
Q60BH7_METCA/3-224AMLH.FHAK-----I.FGVSP
A7HZ42_PARL1/3-227ALFY.AHLW-----L.FGVSP
Q1GUJ7_SPHAL/6-226AASW.AHGA-----L.GYMVA
Q2GC12_NOVAD/7-219IITL.IHWE-----L.FGIPA
Q8DMH0_THEEB/15-236ALLWWLHPY-----F.YHVTP
Q113R6_TRIEI/12-233LLFWQAHPL-----L.IRATG
Q8YQ81_NOSS1/13-234ALLWWAHPL-----L.FVATS
Q9ALA6_SYNE7/12-229GLFWFAHRW-----I.....P
Q7V3C9_PROMP/9-231AIIWWSHKY-----INIAVTT
A9CI20_AGRFC/3-191AFILKLHEW-----L.IGVQP
Q92UK4_RHIME/3-191LFVWKLHEL-----L.IGVQP
Q89MZ5_BRADU/5-191ALAFAFHPV-----V.IGVPV
A7IF98_XANP2/3-187ALAYLFHPY-----V.IGVPV
B0UL45_METS4/3-192VFARVLHPW-----L.IGVAV
Q0C445_HYPNA/3-190FLLFWFHPI-----L.TGMPA
Q3JDP5_NITOC/3-187AIVFWLHET-----L.LGVKP
Q9AAA0_CAUCR/3-186IFVFVLHRL-----L.FGVSP
Q11KH3_CHESB/3-188IFVAGLHRL-----L.FGVSP
B4EFU3_BURCJ/3-190VFALFLHGP-----L.IGVRP
C5B332_METEA/3-195VFGKYLHPL-----L.IGVA.
Q2JMU2_SYNJB/23-239LILYAFHPQ-----M.VS...
Q2K5L0_RHIEC/3-191LIIWKLHEW-----L.IGVSP
Q3SR07_NITWN/1-185AIGALFHPF-----V.LGVP.
Q46HM6_PROMT/12-228FFFWWSHKF-----I......
Q63MK0_BURPS/3-190LFAFVLHGW-----L.IGVRP

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window