Sequence alignment for CL0115

PF04140

Q9EWQ7_STRCO/75-167--------------------------------------------------------------------------------
Q99YI2_STRP1/81-173--------------------------------------------------------------------------------
P91402_CAEEL/171-267--------------------------------------------------------------------------------
Q9KF68_BACHD/72-166--------------------------------------------------------------------------------
MAM4_SCHPO/121-215--------------------------------------------------------------------------------
Q9CM58_PASMU/75-167--------------------------------------------------------------------------------
ICMT_HUMAN/161-257--------------------------------------------------------------------------------
STE14_YEAST/123-219--------------------------------------------------------------------------------
Q9RTL5_DEIRA/91-184--------------------------------------------------------------------------------
B6IT05_RHOCS/73-163--------------------------------------------------------------------------------
F7EBZ7_XENTR/175-268--------------------------------------------------------------------------------
Q2G1E3_STAA8/100-189--------------------------------------------------------------------------------

PF04191

Q5KDE7_CRYNJ/603-709-----------------------------------------------------------------------------LRH
A4HJV7_LEIBR/438-543-----------------------------------------------------------------------------FVM
PEMT_HUMAN/89-192-----------------------------------------------------------------------------AYS
CHO2_ASPCL/504-608-----------------------------------------------------------------------------LRH
A1CQK4_ASPCL/70-170-----------------------------------------------------------------------------L..
A3LQ40_PICST/106-209-----------------------------------------------------------------------------VKA
CHO2_PICST/449-558-----------------------------------------------------------------------------LRV
A4HJL2_LEIBR/106-210-----------------------------------------------------------------------------MRG
CHO2_MAGO7/497-601-----------------------------------------------------------------------------LKH
CHO2_PICGU/462-570-----------------------------------------------------------------------------LRS
CHO2_LODEL/480-589-----------------------------------------------------------------------------LRI
A5UZK8_ROSS1/43-144-----------------------------------------------------------------------------GAL
A7TIE1_VANPO/140-243-----------------------------------------------------------------------------VKM
CHO22_VANPO/452-560-----------------------------------------------------------------------------TQI
CHO21_VANPO/439-547-----------------------------------------------------------------------------SHV
A8NIW8_COPC7/92-195-----------------------------------------------------------------------------ASK
CHO2_MALGO/537-642-----------------------------------------------------------------------------LRY
A8PVU2_MALGO/102-205-----------------------------------------------------------------------------VRV
A9B4Y9_HERA2/33-137-----------------------------------------------------------------------------PFN
A9V3D6_MONBE/125-229-----------------------------------------------------------------------------IFF
CHO2_LACBS/492-596-----------------------------------------------------------------------------LRH
B1MLL6_MYCA9/108-208-----------------------------------------------------------------------------WLV
B1WZT5_CYAA5/96-194-----------------------------------------------------------------------------FRL
B2AR50_PODAN/95-198-----------------------------------------------------------------------------VTY
CHO2_PODAN/496-600-----------------------------------------------------------------------------LKH
B2JAT8_NOSP7/42-145-----------------------------------------------------------------------------VAL
B2VTC6_PYRTR/87-190-----------------------------------------------------------------------------IKY
CHO2_PYRTR/425-530-----------------------------------------------------------------------------FRH
B3RI13_TRIAD/89-192-----------------------------------------------------------------------------FKF
CHO2_SCHJY/478-583-----------------------------------------------------------------------------FRH
B6QQY2_TALMQ/89-189-----------------------------------------------------------------------------I..
B8LBH8_THAPS/30-132-----------------------------------------------------------------------------ITT
B8PB22_POSPM/91-194-----------------------------------------------------------------------------DTL
CHO2_PICPG/450-564-----------------------------------------------------------------------------LRF
C4R5S7_PICPG/98-201-----------------------------------------------------------------------------FRY
CHO2_CLAL4/444-555-----------------------------------------------------------------------------LRI
C5DC91_LACTC/106-209-----------------------------------------------------------------------------VRK
CHO2_LACTC/450-558-----------------------------------------------------------------------------TQI
C5DZ83_ZYGRC/102-205-----------------------------------------------------------------------------IAV
CHO2_ZYGRC/430-538-----------------------------------------------------------------------------TQF
C5G0L0_ARTOC/115-215-----------------------------------------------------------------------------L..
C6WWJ2_METML/43-146-----------------------------------------------------------------------------VCR
C7YM51_NECH7/94-197-----------------------------------------------------------------------------VQA
CHO2_NECH7/505-609-----------------------------------------------------------------------------LKH
CHO2_SORMK/496-600-----------------------------------------------------------------------------LKH
E3I110_RHOVT/77-175-----------------------------------------------------------------------------WRF
D2U841_XANAP/75-178-----------------------------------------------------------------------------PAR
D2V512_NAEGR/65-168-----------------------------------------------------------------------------IMY
D2VYZ6_NAEGR/455-563-----------------------------------------------------------------------------TQL
D3AX06_POLPA/89-193-----------------------------------------------------------------------------ATL
D3BED6_POLPA/557-662-----------------------------------------------------------------------------WRQ
D3BN57_POLPA/99-202-----------------------------------------------------------------------------LQT
CHO2_SCHPO/491-596-----------------------------------------------------------------------------LRH
CHO1_SCHPO/110-213-----------------------------------------------------------------------------VQG
Q0AM70_MARMM/72-173-----------------------------------------------------------------------------ISL
Q0AQW8_MARMM/72-173-----------------------------------------------------------------------------VSL
CHO2_PHANO/462-567-----------------------------------------------------------------------------LRH
Q0UN81_PHANO/69-173-----------------------------------------------------------------------------SSN
Q11IW9_CHESB/45-148-----------------------------------------------------------------------------ILF
Q1GIY9_RUEST/78-176-----------------------------------------------------------------------------LRY
A0A0D1CJ51_USTMA/99-202-----------------------------------------------------------------------------VKP
PEMTL_DICDI/82-186-----------------------------------------------------------------------------ANM
PEM2_DICDI/98-201-----------------------------------------------------------------------------VEV
Q6C649_YARLI/97-200-----------------------------------------------------------------------------VKP
CHO2_YARLI/531-635-----------------------------------------------------------------------------LKY
CHO2_KLULA/451-559-----------------------------------------------------------------------------NTI
Q6CV75_KLULA/106-209-----------------------------------------------------------------------------FTY
Q6FUV4_CANGA/106-209-----------------------------------------------------------------------------ITN
CHO2_CANGA/431-540-----------------------------------------------------------------------------SQI
Q752Z0_ASHGO/100-203-----------------------------------------------------------------------------VRY
Q86IF9_DICDI/521-626-----------------------------------------------------------------------------WRQ
Q8TN26_METAC/121-221-----------------------------------------------------------------------------YIV
Q98I61_RHILO/42-146-----------------------------------------------------------------------------GFV
E7QGU3_YEASZ/100-199-----------------------------------------------------------------------------...
F1SB04_PIG/61-160-----------------------------------------------------------------------------...
F7BHJ5_XENTR/62-163-----------------------------------------------------------------------------..Y
G1MZ29_MELGA/96-197-----------------------------------------------------------------------------..H
CHO2_YEAST/471-577-----------------------------------------------------------------------------.QL
CHO2_CANAL/468-576-----------------------------------------------------------------------------LRV
Q5KHK0_CRYNJ/121-221-----------------------------------------------------------------------------...
Q8DW48_STRMU/70-169-----------------------------------------------------------------------------..I
Q8PE74_XANCP/100-199-----------------------------------------------------------------------------...

PF07298

B2JUD7_BURP8/3-190------------------------------------------------------------------------------IL
A1VI53_POLNA/3-190------------------------------------------------------------------------------ML
Q12HL7_POLSJ/3-190------------------------------------------------------------------------------VL
A2SBS8_METPP/3-190------------------------------------------------------------------------------VL
Q223I4_RHOFT/3-190------------------------------------------------------------------------------YL
A1K5T7_AZOSB/6-191------------------------------------------------------------------------------VL
A1WT38_HALHL/3-190------------------------------------------------------------------------------IL
A6VV32_MARMS/3-191------------------------------------------------------------------------------IL
Q0AQE8_MARMM/3-183------------------------------------------------------------------------------VL
A1AZI2_PARDP/3-180------------------------------------------------------------------------------IL
Q28U80_JANSC/6-185------------------------------------------------------------------------------LL
Q5LXD7_RUEPO/5-179------------------------------------------------------------------------------LL
Q1GLH3_RUEST/3-179------------------------------------------------------------------------------LL
A8LJK3_DINSH/5-184------------------------------------------------------------------------------VL
Q169U5_ROSDO/3-182------------------------------------------------------------------------------LL
A0KG00_AERHH/3-186------------------------------------------------------------------------------LL
Q6N9Q3_RHOPA/31-253------------------------------------------------------------------------------EF
Q219Y9_RHOPB/14-236------------------------------------------------------------------------------EF
Q5LUC0_RUEPO/7-220------------------------------------------------------------------------------EF
Q0C1Y5_HYPNA/14-233------------------------------------------------------------------------------EF
Q169M4_ROSDO/6-220------------------------------------------------------------------------------TF
A8LNX8_DINSH/42-256------------------------------------------------------------------------------EF
A9CGK0_AGRFC/3-221------------------------------------------------------------------------------EL
Q2JYB9_RHIEC/5-223------------------------------------------------------------------------------EF
Q92Z13_RHIME/3-221------------------------------------------------------------------------------EF
B0U8Q9_METS4/2-221------------------------------------------------------------------------------EF
Q2VYZ8_MAGSA/17-229------------------------------------------------------------------------------HL
Q60BH7_METCA/3-224------------------------------------------------------------------------------NL
A7HZ42_PARL1/3-227------------------------------------------------------------------------------QL
Q1GUJ7_SPHAL/6-226------------------------------------------------------------------------------LL
Q2GC12_NOVAD/7-219------------------------------------------------------------------------------PL
Q8DMH0_THEEB/15-236------------------------------------------------------------------------------IM
Q113R6_TRIEI/12-233------------------------------------------------------------------------------II
Q8YQ81_NOSS1/13-234------------------------------------------------------------------------------VM
Q9ALA6_SYNE7/12-229------------------------------------------------------------------------------IM
Q7V3C9_PROMP/9-231------------------------------------------------------------------------------LI
A9CI20_AGRFC/3-191------------------------------------------------------------------------------FL
Q92UK4_RHIME/3-191------------------------------------------------------------------------------IL
Q89MZ5_BRADU/5-191------------------------------------------------------------------------------VM
A7IF98_XANP2/3-187------------------------------------------------------------------------------MM
B0UL45_METS4/3-192------------------------------------------------------------------------------VL
Q0C445_HYPNA/3-190------------------------------------------------------------------------------YL
Q3JDP5_NITOC/3-187------------------------------------------------------------------------------QF
Q9AAA0_CAUCR/3-186------------------------------------------------------------------------------IL
Q11KH3_CHESB/3-188------------------------------------------------------------------------------VL
B4EFU3_BURCJ/3-190------------------------------------------------------------------------------VL
C5B332_METEA/3-195------------------------------------------------------------------------------VM
Q2JMU2_SYNJB/23-239------------------------------------------------------------------------------..
Q2K5L0_RHIEC/3-191------------------------------------------------------------------------------LL
Q3SR07_NITWN/1-185------------------------------------------------------------------------------.M
Q46HM6_PROMT/12-228------------------------------------------------------------------------------VM
Q63MK0_BURPS/3-190------------------------------------------------------------------------------VL

PF02544

Q19605_CAEEL/97-243------------------TKSP-------------------------------------------------------VAI
YN67_SCHPO/146-295------------------ATMP-------------------------------------------------------LRN
Q20344_CAEEL/97-243------------------TKSP-------------------------------------------------------LLI
S5A1_RAT/110-259------------------KPTL-------------------------------------------------------LVT
S5A2_HUMAN/105-254------------------RPYP-------------------------------------------------------AIL
PORED_CAEEL/189-309------------------DDIS-------------------------------------------------------LTQ
Q23431_CAEEL/103-253------------------NQSP-------------------------------------------------------VKI
DET2_ARATH/111-262------------------NGFP-------------------------------------------------------ITI
TECR_YEAST/154-310------------------ATMP-------------------------------------------------------IFN
S5A1_HUMAN/110-259------------------KPMP-------------------------------------------------------LLA

PF06966

YJD4_SCHPO/67-320--------LWGVSVWTKNTSQV-------------------------------------------------------DRL
Q10E47_ORYSJ/24-252--------FFIITALLRFDKVT-------------------------------------------------------DFA
Q8PAZ9_XANCP/20-250--------GWLWQRRSGNAGPV-------------------------------------------------------DVL
Q9A3U2_CAUCR/70-299--------LWAVSLRTKDVSFI-------------------------------------------------------DAW
Q9VSM5_DROME/25-264--------FFLINSVLQMDKLT-------------------------------------------------------DFA
Q9CHY6_LACLA/17-245--------WFLIATSKKNYGLI-------------------------------------------------------DIA
Q7CY59_AGRFC/19-248--------AWALQRATGSSGWI-------------------------------------------------------DTV
O81042_ARATH/64-303--------FWVIGLLQSSHWMI-------------------------------------------------------DVY
O53731_MYCTU/17-243--------AFAIGRRIGRYNVV-------------------------------------------------------DVV
Q8Y9D9_LISMO/16-244--------WFIISKIKGKYSLV-------------------------------------------------------DIA
Q984A1_RHILO/21-257--------AWLVAIRTGSSGWV-------------------------------------------------------DAI
B9DFE9_ARATH/24-252--------FFVITALFKFDQVT-------------------------------------------------------DFA

PF01222

LBR_CHICK/175-609EEIYAEKKIFEAIKTPEKPSSK....TKELEFGGRFGTFMLMFFLPATVLYLVLMCKQDDPSLMNFPPLPALESLWETKV
ERG24_NEUCR/17-490RQQHYEFGG.PIGAFGITFGLPILVHVFNLFCNDISGCPAPSLLHPKSLDLAQLKREIGWPDNGVFGL.....FSWSATL
STS1_SCHPO/7-453KSAPREFGG.AKGALAIMTGFP....CLMYYLWACSKFNDSQFIKPESFTIAGFQNFFRTLGHYIYVG...AY..PTRYA
ERG4_YEAST/34-473NEIEYEFGG.TTGVIGMLIGFP....LLMYYMWICAEFYHGKVALPKAG..ESWMHFIKHLYQLVLEN...GI..PEKYD
ERG24_YEAST/8-438RTTEFEFGG.LIGALGISIGLP....VFTIILNQMIRPDYFIKGFFQNFDIVELWNGIKP..LRYYLG........NREL

PF04140

Q9EWQ7_STRCO/75-167MLAL..ALS-----------------------------------------------------------------------
Q99YI2_STRP1/81-173LLLM...LL-----------------------------------------------------------------------
P91402_CAEEL/171-267WIGTLGCII-----------------------------------------------------------------------
Q9KF68_BACHD/72-166AIPFAWFLF-----------------------------------------------------------------------
MAM4_SCHPO/121-215ALGF.L.CL-----------------------------------------------------------------------
Q9CM58_PASMU/75-167LAIL...VF-----------------------------------------------------------------------
ICMT_HUMAN/161-257VTGLLMVVF-----------------------------------------------------------------------
STE14_YEAST/123-219VLGCLLVIL-----------------------------------------------------------------------
Q9RTL5_DEIRA/91-184ALLL..FLA-----------------------------------------------------------------------
B6IT05_RHOCS/73-163.LAL..FVL-----------------------------------------------------------------------
F7EBZ7_XENTR/175-268.LIM..VLF-----------------------------------------------------------------------
Q2G1E3_STAA8/100-189.V.I..LIF-----------------------------------------------------------------------

PF04191

Q5KDE7_CRYNJ/603-709VLGLSLIAL-----------------------------------------------------------------------
A4HJV7_LEIBR/438-543MVGMLLVGI-----------------------------------------------------------------------
PEMT_HUMAN/89-192L.GLALLGL-----------------------------------------------------------------------
CHO2_ASPCL/504-608VLGAGLISL-----------------------------------------------------------------------
A1CQK4_ASPCL/70-170..GAVLFGI-----------------------------------------------------------------------
A3LQ40_PICST/106-209A.AVATFGL-----------------------------------------------------------------------
CHO2_PICST/449-558FVGLLLIFT-----------------------------------------------------------------------
A4HJL2_LEIBR/106-210T.GTALLLS-----------------------------------------------------------------------
CHO2_MAGO7/497-601VTGTGLVAL-----------------------------------------------------------------------
CHO2_PICGU/462-570FLGALLILT-----------------------------------------------------------------------
CHO2_LODEL/480-589FIGTLLIFT-----------------------------------------------------------------------
A5UZK8_ROSS1/43-144IVGVVLCGC-----------------------------------------------------------------------
A7TIE1_VANPO/140-243V.GVTLFGF-----------------------------------------------------------------------
CHO22_VANPO/452-560IFGGILCAI-----------------------------------------------------------------------
CHO21_VANPO/439-547IFGLLLCAI-----------------------------------------------------------------------
A8NIW8_COPC7/92-195I.AVVLFGL-----------------------------------------------------------------------
CHO2_MALGO/537-642VLGVLLILV-----------------------------------------------------------------------
A8PVU2_MALGO/102-205L.AVVLIAS-----------------------------------------------------------------------
A9B4Y9_HERA2/33-137WLGLVIGIA-----------------------------------------------------------------------
A9V3D6_MONBE/125-229AVGAATVLV-----------------------------------------------------------------------
CHO2_LACBS/492-596TLGALLVGL-----------------------------------------------------------------------
B1MLL6_MYCA9/108-208IVGEVLTIG-----------------------------------------------------------------------
B1WZT5_CYAA5/96-194IIGGILLIS-----------------------------------------------------------------------
B2AR50_PODAN/95-198A.AYALLAL-----------------------------------------------------------------------
CHO2_PODAN/496-600VIGVSLIAL-----------------------------------------------------------------------
B2JAT8_NOSP7/42-145ALGVLAIIC-----------------------------------------------------------------------
B2VTC6_PYRTR/87-190S.AIPLFLM-----------------------------------------------------------------------
CHO2_PYRTR/425-530VLGAGMIAL-----------------------------------------------------------------------
B3RI13_TRIAD/89-192I.GTALMVV-----------------------------------------------------------------------
CHO2_SCHJY/478-583VLGLTFIAL-----------------------------------------------------------------------
B6QQY2_TALMQ/89-189..AYGLFAT-----------------------------------------------------------------------
B8LBH8_THAPS/30-132FLGPSMILL-----------------------------------------------------------------------
B8PB22_POSPM/91-194V.PAALFAI-----------------------------------------------------------------------
CHO2_PICPG/450-564ILAALMILG-----------------------------------------------------------------------
C4R5S7_PICPG/98-201L.GIASFLF-----------------------------------------------------------------------
CHO2_CLAL4/444-555FLGLLLIIT-----------------------------------------------------------------------
C5DC91_LACTC/106-209A.GMVLSAF-----------------------------------------------------------------------
CHO2_LACTC/450-558IFGFLLCWL-----------------------------------------------------------------------
C5DZ83_ZYGRC/102-205A.GRFLAII-----------------------------------------------------------------------
CHO2_ZYGRC/430-538IFGLLLCAV-----------------------------------------------------------------------
C5G0L0_ARTOC/115-215..AYGLFAT-----------------------------------------------------------------------
C6WWJ2_METML/43-146EVGVLLFVL-----------------------------------------------------------------------
C7YM51_NECH7/94-197A.ALTLFAV-----------------------------------------------------------------------
CHO2_NECH7/505-609VLGAGLVAL-----------------------------------------------------------------------
CHO2_SORMK/496-600VVGLGLIAL-----------------------------------------------------------------------
E3I110_RHOVT/77-175LAGMICVVI-----------------------------------------------------------------------
D2U841_XANAP/75-178WLGCALLIG-----------------------------------------------------------------------
D2V512_NAEGR/65-168G.GYALQVI-----------------------------------------------------------------------
D2VYZ6_NAEGR/455-563VAGIILILL-----------------------------------------------------------------------
D3AX06_POLPA/89-193L.GNSCFIF-----------------------------------------------------------------------
D3BED6_POLPA/557-662IIGILLILL-----------------------------------------------------------------------
D3BN57_POLPA/99-202V.SYALYAI-----------------------------------------------------------------------
CHO2_SCHPO/491-596ALGFGLIAL-----------------------------------------------------------------------
CHO1_SCHPO/110-213I.AKLIFCF-----------------------------------------------------------------------
Q0AM70_MARMM/72-173ALGGGLFLG-----------------------------------------------------------------------
Q0AQW8_MARMM/72-173AAGGLLLVA-----------------------------------------------------------------------
CHO2_PHANO/462-567VLGAGLLLL-----------------------------------------------------------------------
Q0UN81_PHANO/69-173TLPIPLFLT-----------------------------------------------------------------------
Q11IW9_CHESB/45-148AAGWLIGLA-----------------------------------------------------------------------
Q1GIY9_RUEST/78-176AVGLPLMVM-----------------------------------------------------------------------
A0A0D1CJ51_USTMA/99-202V.AALLFAS-----------------------------------------------------------------------
PEMTL_DICDI/82-186I.GDSCFIF-----------------------------------------------------------------------
PEM2_DICDI/98-201L.SYILYGF-----------------------------------------------------------------------
Q6C649_YARLI/97-200L.AIVLFAV-----------------------------------------------------------------------
CHO2_YARLI/531-635ILGALLIAL-----------------------------------------------------------------------
CHO2_KLULA/451-559TFGLLLLAI-----------------------------------------------------------------------
Q6CV75_KLULA/106-209V.GIAYIAF-----------------------------------------------------------------------
Q6FUV4_CANGA/106-209I.GYAFLIV-----------------------------------------------------------------------
CHO2_CANGA/431-540IFGLICCAL-----------------------------------------------------------------------
Q752Z0_ASHGO/100-203A.GAGLFVF-----------------------------------------------------------------------
Q86IF9_DICDI/521-626ILGLMLILI-----------------------------------------------------------------------
Q8TN26_METAC/121-221IAGDMLVVL-----------------------------------------------------------------------
Q98I61_RHILO/42-146PVGGVLIVA-----------------------------------------------------------------------
E7QGU3_YEASZ/100-199.LGVALFGL-----------------------------------------------------------------------
F1SB04_PIG/61-160.LGLALLGV-----------------------------------------------------------------------
F7BHJ5_XENTR/62-163YLSWMLIGA-----------------------------------------------------------------------
G1MZ29_MELGA/96-197YSGLAIMAV-----------------------------------------------------------------------
CHO2_YEAST/471-577IFGLILVAL-----------------------------------------------------------------------
CHO2_CANAL/468-576FLGLLLIYT-----------------------------------------------------------------------
Q5KHK0_CRYNJ/121-221AAAIALFAS-----------------------------------------------------------------------
Q8DW48_STRMU/70-169YLGILLMIL-----------------------------------------------------------------------
Q8PE74_XANCP/100-199.GACALIAG-----------------------------------------------------------------------

PF07298

B2JUD7_BURP8/3-190ILGLLIFLGGHSVRI-----------------------------------------------------------------
A1VI53_POLNA/3-190ILGLVLFLGVHSTRI-----------------------------------------------------------------
Q12HL7_POLSJ/3-190ILGLILFLGVHSTRI-----------------------------------------------------------------
A2SBS8_METPP/3-190ILGLVLFLGTHSVRI-----------------------------------------------------------------
Q223I4_RHOFT/3-190ILGLIVFLGVHSVRI-----------------------------------------------------------------
A1K5T7_AZOSB/6-191VLGLLLFLGPHSLRI-----------------------------------------------------------------
A1WT38_HALHL/3-190LLGLILFLGTHSVRV-----------------------------------------------------------------
A6VV32_MARMS/3-191VMGLVIFFFVHSVRL-----------------------------------------------------------------
Q0AQE8_MARMM/3-183TAGLVLFLGVHCLRL-----------------------------------------------------------------
A1AZI2_PARDP/3-180ILGLALWWGAHLFKR-----------------------------------------------------------------
Q28U80_JANSC/6-185IAGLALWVAAHAWKR-----------------------------------------------------------------
Q5LXD7_RUEPO/5-179ILGIAVWWAAHLFKR-----------------------------------------------------------------
Q1GLH3_RUEST/3-179ILGIILWWGAHLFKR-----------------------------------------------------------------
A8LJK3_DINSH/5-184IAGLALWAGAHYFKR-----------------------------------------------------------------
Q169U5_ROSDO/3-182IAGLILWIAAHYFKR-----------------------------------------------------------------
A0KG00_AERHH/3-186TLGVLLFTLIHLYPC-----------------------------------------------------------------
Q6N9Q3_RHOPA/31-253VAAFAVFLLSHAIPA-----------------------------------------------------------------
Q219Y9_RHOPB/14-236IAAFAVFLASHAVPS-----------------------------------------------------------------
Q5LUC0_RUEPO/7-220VAALAVFLLSHVIPV-----------------------------------------------------------------
Q0C1Y5_HYPNA/14-233LGAALVFLVSHALPA-----------------------------------------------------------------
Q169M4_ROSDO/6-220AGVFALFFATHSIPV-----------------------------------------------------------------
A8LNX8_DINSH/42-256ILAFTVFFLSHGVPV-----------------------------------------------------------------
A9CGK0_AGRFC/3-221VAALSLFVALHSVPA-----------------------------------------------------------------
Q2JYB9_RHIEC/5-223LAAFALFVALHSIPA-----------------------------------------------------------------
Q92Z13_RHIME/3-221LLALFVFLTLHSIPA-----------------------------------------------------------------
B0U8Q9_METS4/2-221AAALATFLVAHSVPA-----------------------------------------------------------------
Q2VYZ8_MAGSA/17-229VLSVAAFLGAHSLSN-----------------------------------------------------------------
Q60BH7_METCA/3-224ALAMLFFVGIHFLIS-----------------------------------------------------------------
A7HZ42_PARL1/3-227WAAAAFFLGIHLVIA-----------------------------------------------------------------
Q1GUJ7_SPHAL/6-226ITTCVLFVGTHLLM.-----------------------------------------------------------------
Q2GC12_NOVAD/7-219AAATSCFVGSHFLL.-----------------------------------------------------------------
Q8DMH0_THEEB/15-236VGLLLLFAIAHSG..-----------------------------------------------------------------
Q113R6_TRIEI/12-233LGLLLSFAIAHSG..-----------------------------------------------------------------
Q8YQ81_NOSS1/13-234LGLQLTFAIAHSG..-----------------------------------------------------------------
Q9ALA6_SYNE7/12-229LALLLLFAIAHSG..-----------------------------------------------------------------
Q7V3C9_PROMP/9-231LGLILIFAVIHSG..-----------------------------------------------------------------
A9CI20_AGRFC/3-191VLCLALFLLTHLLKV-----------------------------------------------------------------
Q92UK4_RHIME/3-191VLGIIIFLGMHLVRV-----------------------------------------------------------------
Q89MZ5_BRADU/5-191ILGLVLFFAAHVFTT-----------------------------------------------------------------
A7IF98_XANP2/3-187LFGLLVFLGIHVVGS-----------------------------------------------------------------
B0UL45_METS4/3-192LLGLALFLGTHAFTM-----------------------------------------------------------------
Q0C445_HYPNA/3-190ILGLIIFFGAHLFSA-----------------------------------------------------------------
Q3JDP5_NITOC/3-187LLGLALFFGMHSISI-----------------------------------------------------------------
Q9AAA0_CAUCR/3-186VLGLVLFLGIHSVRI-----------------------------------------------------------------
Q11KH3_CHESB/3-188VLGLVLFLGVHSVRI-----------------------------------------------------------------
B4EFU3_BURCJ/3-190ILGLAIFLGVHSVRI-----------------------------------------------------------------
C5B332_METEA/3-195ILGLVLFLGTHAFSM-----------------------------------------------------------------
Q2JMU2_SYNJB/23-239LALILGFACAHSG..-----------------------------------------------------------------
Q2K5L0_RHIEC/3-191IVGIILFLGVHLVRV-----------------------------------------------------------------
Q3SR07_NITWN/1-185IAGLVLSLGVHLVVT-----------------------------------------------------------------
Q46HM6_PROMT/12-228ILLLFCFAVIHSG..-----------------------------------------------------------------
Q63MK0_BURPS/3-190ILGLVIFLGTHSIRL-----------------------------------------------------------------

PF02544

Q19605_CAEEL/97-243VAAATF.FCAYNGFL-----------------------------------------------------------------
YN67_SCHPO/146-295IFKNCAHYHLLSGLF-----------------------------------------------------------------
Q20344_CAEEL/97-243VAAAVA.FCTYNGTL-----------------------------------------------------------------
S5A1_RAT/110-259FVLAFL.FCTFNGYV-----------------------------------------------------------------
S5A2_HUMAN/105-254ILRGTA.FCTGNGVL-----------------------------------------------------------------
PORED_CAEEL/189-309WAGAVL.FWICN...-----------------------------------------------------------------
Q23431_CAEEL/103-253VIMAFG.FSVLNGFI-----------------------------------------------------------------
DET2_ARATH/111-262AALAFT.FNLLNGYI-----------------------------------------------------------------
TECR_YEAST/154-310LFKNCFHYWVLSGLI-----------------------------------------------------------------
S5A1_HUMAN/110-259CTMAIM.FCTCNGYL-----------------------------------------------------------------

PF06966

YJD4_SCHPO/67-320WPILPTAFSLHFLFYG....LGYNIASRR---------------------------------------------------
Q10E47_ORYSJ/24-252GSTNFIILAILTLAL......KGA.WHFR---------------------------------------------------
Q8PAZ9_XANCP/20-250WAGCLAVAAPYCAWM......SEG.ALLP---------------------------------------------------
Q9A3U2_CAUCR/70-299WGPSMALLAWSTLL.......QGA.HTPH---------------------------------------------------
Q9VSM5_DROME/25-264GGVNFIIISLLTFFLGQIDRPSKA.YDSR---------------------------------------------------
Q9CHY6_LACLA/17-245WGGGFVLTAVVSYLF......SPR.ITIQ---------------------------------------------------
Q7CY59_AGRFC/19-248WSASVGLGGVLAVLF......AEG.DGWR---------------------------------------------------
O81042_ARATH/64-303WTVIPVMLVHYFASH.....PLSQYNKLR---------------------------------------------------
O53731_MYCTU/17-243WGLGFVAVAVAAATL......GHG.DPVR---------------------------------------------------
Q8Y9D9_LISMO/16-244WGGGFVVVAWTGFLT......TFS.VTTQ---------------------------------------------------
Q984A1_RHILO/21-257WSFAVGIIGAFLALVP....FVEGDNDHR---------------------------------------------------
B9DFE9_ARATH/24-252GSTNFVILAVLTLVL......KAS.WHFR---------------------------------------------------

PF01222

LBR_CHICK/175-609FGVFLLWFFFQALFYLLPIGKVVEGLPLS..NPRKLQYRINGFYA...FLLTAAAIGTLLYFQ.FELHYLYDHFVQFAVS
ERG24_NEUCR/17-490WTLG..YYALSLVQYRFLPGHHVEGTELS..TGGRLKYKLNAFNSAMCTLAILAAGTIAQGAEFPVWTFISDNFAQIISA
STS1_SCHPO/7-453FLVFWSFCIVQAVMYLTLPGVRTQGLPLKHRNNERLPYLCNAIWS...FYTTIVILAVLHVTHVFPITTFIDMFGPLMSV
ERG4_YEAST/34-473WTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWT...LYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTC
ERG24_YEAST/8-438WTVYCLWYGILAVLDVILPGRVMKGVQLR..DGSKLSYKINGIAMSTTLVLVLAIRWKLTDGQLPELQYLYENHVSLCII

PF04140

Q9EWQ7_STRCO/75-167-----------------------------------------------AQALRWW--------------------------
Q99YI2_STRP1/81-173-----------------------------------------------SVAVLYE--------------------------
P91402_CAEEL/171-267-----------------------------------------------GEIFRKV--------------------------
Q9KF68_BACHD/72-166-----------------------------------------------AQILRLW--------------------------
MAM4_SCHPO/121-215-----------------------------------------------GQYLRSS--------------------------
Q9CM58_PASMU/75-167-----------------------------------------------AIAMLFY--------------------------
ICMT_HUMAN/161-257-----------------------------------------------GECLRKA--------------------------
STE14_YEAST/123-219-----------------------------------------------GQYTRTI--------------------------
Q9RTL5_DEIRA/91-184-----------------------------------------------LQPLRYW--------------------------
B6IT05_RHOCS/73-163-----------------------------------------------LQAGRVW--------------------------
F7EBZ7_XENTR/175-268-----------------------------------------------GELLRKC--------------------------
Q2G1E3_STAA8/100-189-----------------------------------------------AYIMLFM--------------------------

PF04191

Q5KDE7_CRYNJ/603-709-----------------------------------------------HIWSAVS--------------------------
A4HJV7_LEIBR/438-543-----------------------------------------------NGYVSWS--------------------------
PEMT_HUMAN/89-192-----------------------------------------------GVVLVLS--------------------------
CHO2_ASPCL/504-608-----------------------------------------------QIWTSVS--------------------------
A1CQK4_ASPCL/70-170-----------------------------------------------GSILVLT--------------------------
A3LQ40_PICST/106-209-----------------------------------------------GNIFVLT--------------------------
CHO2_PICST/449-558-----------------------------------------------QSWINSS--------------------------
A4HJL2_LEIBR/106-210-----------------------------------------------GTTLVVS--------------------------
CHO2_MAGO7/497-601-----------------------------------------------QIWTAVS--------------------------
CHO2_PICGU/462-570-----------------------------------------------QVWINSS--------------------------
CHO2_LODEL/480-589-----------------------------------------------QTWINAS--------------------------
A5UZK8_ROSS1/43-144-----------------------------------------------GAMLAGA--------------------------
A7TIE1_VANPO/140-243-----------------------------------------------GQLLVLT--------------------------
CHO22_VANPO/452-560-----------------------------------------------QMWCNSE--------------------------
CHO21_VANPO/439-547-----------------------------------------------QIWCNVE--------------------------
A8NIW8_COPC7/92-195-----------------------------------------------GQLFVIT--------------------------
CHO2_MALGO/537-642-----------------------------------------------HMWSARS--------------------------
A8PVU2_MALGO/102-205-----------------------------------------------GTVFVLS--------------------------
A9B4Y9_HERA2/33-137-----------------------------------------------GLAVAIS--------------------------
A9V3D6_MONBE/125-229-----------------------------------------------GTVLTSA--------------------------
CHO2_LACBS/492-596-----------------------------------------------HVWASME--------------------------
B1MLL6_MYCA9/108-208-----------------------------------------------GLGMATL--------------------------
B1WZT5_CYAA5/96-194-----------------------------------------------GFFLAFW--------------------------
B2AR50_PODAN/95-198-----------------------------------------------GNILVIS--------------------------
CHO2_PODAN/496-600-----------------------------------------------QLWTSSS--------------------------
B2JAT8_NOSP7/42-145-----------------------------------------------AGLIVTS--------------------------
B2VTC6_PYRTR/87-190-----------------------------------------------GNTLVLT--------------------------
CHO2_PYRTR/425-530-----------------------------------------------QVWTAMS--------------------------
B3RI13_TRIAD/89-192-----------------------------------------------GTILVLT--------------------------
CHO2_SCHJY/478-583-----------------------------------------------HIYTSVS--------------------------
B6QQY2_TALMQ/89-189-----------------------------------------------GNVLVLS--------------------------
B8LBH8_THAPS/30-132-----------------------------------------------GLFIVYK--------------------------
B8PB22_POSPM/91-194-----------------------------------------------GQVFVVT--------------------------
CHO2_PICPG/450-564-----------------------------------------------QFLTVHQ--------------------------
C4R5S7_PICPG/98-201-----------------------------------------------GNVLVLS--------------------------
CHO2_CLAL4/444-555-----------------------------------------------QVMINTS--------------------------
C5DC91_LACTC/106-209-----------------------------------------------GQVLVAT--------------------------
CHO2_LACTC/450-558-----------------------------------------------QKWCDDE--------------------------
C5DZ83_ZYGRC/102-205-----------------------------------------------GQVLVAT--------------------------
CHO2_ZYGRC/430-538-----------------------------------------------QTWCNAE--------------------------
C5G0L0_ARTOC/115-215-----------------------------------------------GNVLVLS--------------------------
C6WWJ2_METML/43-146-----------------------------------------------SSFLARW--------------------------
C7YM51_NECH7/94-197-----------------------------------------------GNVLVVT--------------------------
CHO2_NECH7/505-609-----------------------------------------------QLWTAFS--------------------------
CHO2_SORMK/496-600-----------------------------------------------QVWTATS--------------------------
E3I110_RHOVT/77-175-----------------------------------------------GFGFTIY--------------------------
D2U841_XANAP/75-178-----------------------------------------------GLALRLW--------------------------
D2V512_NAEGR/65-168-----------------------------------------------GSLLVMG--------------------------
D2VYZ6_NAEGR/455-563-----------------------------------------------NIYQSTS--------------------------
D3AX06_POLPA/89-193-----------------------------------------------GILLNIW--------------------------
D3BED6_POLPA/557-662-----------------------------------------------NVWSSVS--------------------------
D3BN57_POLPA/99-202-----------------------------------------------GGILVGA--------------------------
CHO2_SCHPO/491-596-----------------------------------------------HIYTSVS--------------------------
CHO1_SCHPO/110-213-----------------------------------------------GSVLVLS--------------------------
Q0AM70_MARMM/72-173-----------------------------------------------GAYVIFL--------------------------
Q0AQW8_MARMM/72-173-----------------------------------------------GAGVIAA--------------------------
CHO2_PHANO/462-567-----------------------------------------------QLWTSTS--------------------------
Q0UN81_PHANO/69-173-----------------------------------------------GNTLVLT--------------------------
Q11IW9_CHESB/45-148-----------------------------------------------GLSINIA--------------------------
Q1GIY9_RUEST/78-176-----------------------------------------------AFGITLW--------------------------
A0A0D1CJ51_USTMA/99-202-----------------------------------------------GNIFVLS--------------------------
PEMTL_DICDI/82-186-----------------------------------------------GILLNIW--------------------------
PEM2_DICDI/98-201-----------------------------------------------GGILVLA--------------------------
Q6C649_YARLI/97-200-----------------------------------------------GNVLVLT--------------------------
CHO2_YARLI/531-635-----------------------------------------------HGWTSKS--------------------------
CHO2_KLULA/451-559-----------------------------------------------QIWCNTE--------------------------
Q6CV75_KLULA/106-209-----------------------------------------------GQLLVLS--------------------------
Q6FUV4_CANGA/106-209-----------------------------------------------GQILVIS--------------------------
CHO2_CANGA/431-540-----------------------------------------------QIWCNTE--------------------------
Q752Z0_ASHGO/100-203-----------------------------------------------GQVLVLS--------------------------
Q86IF9_DICDI/521-626-----------------------------------------------NLWSSLS--------------------------
Q8TN26_METAC/121-221-----------------------------------------------GYFLIFL--------------------------
Q98I61_RHILO/42-146-----------------------------------------------AAAVLLH--------------------------
E7QGU3_YEASZ/100-199-----------------------------------------------GQVLVLS--------------------------
F1SB04_PIG/61-160-----------------------------------------------GSVFVLS--------------------------
F7BHJ5_XENTR/62-163-----------------------------------------------GGVLVVS--------------------------
G1MZ29_MELGA/96-197-----------------------------------------------GTLFVIS--------------------------
CHO2_YEAST/471-577-----------------------------------------------QTWCDKE--------------------------
CHO2_CANAL/468-576-----------------------------------------------QFWINFS--------------------------
Q5KHK0_CRYNJ/121-221-----------------------------------------------GQTFVIT--------------------------
Q8DW48_STRMU/70-169-----------------------------------------------GIIFRVY--------------------------
Q8PE74_XANCP/100-199-----------------------------------------------GLGLRVW--------------------------

PF07298

B2JUD7_BURP8/3-190----------------------------------------------FAEGWRKA--------------------------
A1VI53_POLNA/3-190----------------------------------------------VADGWRTA--------------------------
Q12HL7_POLSJ/3-190----------------------------------------------VADGWRTQ--------------------------
A2SBS8_METPP/3-190----------------------------------------------FAEPWRTR--------------------------
Q223I4_RHOFT/3-190----------------------------------------------VADDWRTQ--------------------------
A1K5T7_AZOSB/6-191----------------------------------------------FADDWRHR--------------------------
A1WT38_HALHL/3-190----------------------------------------------VADDWRSN--------------------------
A6VV32_MARMS/3-191----------------------------------------------VAPNWREK--------------------------
Q0AQE8_MARMM/3-183----------------------------------------------.VPGLRDT--------------------------
A1AZI2_PARDP/3-180----------------------------------------------LAPQRR..--------------------------
Q28U80_JANSC/6-185----------------------------------------------VAPAHR..--------------------------
Q5LXD7_RUEPO/5-179----------------------------------------------AMPARR..--------------------------
Q1GLH3_RUEST/3-179----------------------------------------------VAPAQR..--------------------------
A8LJK3_DINSH/5-184----------------------------------------------LMPAQR..--------------------------
Q169U5_ROSDO/3-182----------------------------------------------LMPQQR..--------------------------
A0KG00_AERHH/3-186----------------------------------------------FAGAHRAR--------------------------
Q6N9Q3_RHOPA/31-253----------------------------------------------.RPAVRAR--------------------------
Q219Y9_RHOPB/14-236----------------------------------------------.RPAVRAA--------------------------
Q5LUC0_RUEPO/7-220----------------------------------------------.RPPVRPW--------------------------
Q0C1Y5_HYPNA/14-233----------------------------------------------.RPGIRIR--------------------------
Q169M4_ROSDO/6-220----------------------------------------------.RPPVKKR--------------------------
A8LNX8_DINSH/42-256----------------------------------------------.RPPMRPW--------------------------
A9CGK0_AGRFC/3-221----------------------------------------------.VPAVRGR--------------------------
Q2JYB9_RHIEC/5-223----------------------------------------------.VPTIRAE--------------------------
Q92Z13_RHIME/3-221----------------------------------------------.IPAIRER--------------------------
B0U8Q9_METS4/2-221----------------------------------------------.VPRLRGR--------------------------
Q2VYZ8_MAGSA/17-229----------------------------------------------.WKPLRGP--------------------------
Q60BH7_METCA/3-224----------------------------------------------.GTSLRDR--------------------------
A7HZ42_PARL1/3-227----------------------------------------------.GSGARGR--------------------------
Q1GUJ7_SPHAL/6-226----------------------------------------------.SHPLRAG--------------------------
Q2GC12_NOVAD/7-219----------------------------------------------.SGPLRRV--------------------------
Q8DMH0_THEEB/15-236----------------------------------------------.LASLRPW--------------------------
Q113R6_TRIEI/12-233----------------------------------------------.LAALRSW--------------------------
Q8YQ81_NOSS1/13-234----------------------------------------------.GAALRPW--------------------------
Q9ALA6_SYNE7/12-229----------------------------------------------.LAALRPW--------------------------
Q7V3C9_PROMP/9-231----------------------------------------------.GAALRSR--------------------------
A9CI20_AGRFC/3-191----------------------------------------------VAPQFRAR--------------------------
Q92UK4_RHIME/3-191----------------------------------------------VAPGFRAG--------------------------
Q89MZ5_BRADU/5-191----------------------------------------------.KREARAQ--------------------------
A7IF98_XANP2/3-187----------------------------------------------.LRGLRAK--------------------------
B0UL45_METS4/3-192----------------------------------------------.LRGPRAA--------------------------
Q0C445_HYPNA/3-190----------------------------------------------FRSRAPGR--------------------------
Q3JDP5_NITOC/3-187----------------------------------------------VALPLRDQ--------------------------
Q9AAA0_CAUCR/3-186----------------------------------------------LAAPLRDA--------------------------
Q11KH3_CHESB/3-188----------------------------------------------AAPQFRDR--------------------------
B4EFU3_BURCJ/3-190----------------------------------------------VADGWRSA--------------------------
C5B332_METEA/3-195----------------------------------------------.ARAKRGE--------------------------
Q2JMU2_SYNJB/23-239----------------------------------------------.LAYLRPW--------------------------
Q2K5L0_RHIEC/3-191----------------------------------------------VAPDLRRS--------------------------
Q3SR07_NITWN/1-185----------------------------------------------.RREFRAR--------------------------
Q46HM6_PROMT/12-228----------------------------------------------.GAALRVK--------------------------
Q63MK0_BURPS/3-190----------------------------------------------VAGDWRAA--------------------------

PF02544

Q19605_CAEEL/97-243-----------------QGY--------------------------WNAFYQP.....-----...EEPWTT--------
YN67_SCHPO/146-295-----------------LA.--------------------------.YFIYGPWH...-----...ANDYIK--------
Q20344_CAEEL/97-243-----------------QGV--------------------------WNSYYQL.....-----...EEELTY--------
S5A1_RAT/110-259-----------------QSR--------------------------YLSQFAVY....-----...AEDWVT--------
S5A2_HUMAN/105-254-----------------QGY--------------------------YLIYCAEY....-----...PDGWYT--------
PORED_CAEEL/189-309-----------------...--------------------------.WKQHQL.....-----...AEQIAN--------
Q23431_CAEEL/103-253-----------------QGT--------------------------WNAFYQPE....-----...FDTLHP--------
DET2_ARATH/111-262-----------------QAR--------------------------WVSHYKD..DYE-----...DGNWFW--------
TECR_YEAST/154-310-----------------SFG--------------------------YFGYGFPFGNAK-----LFKYYSYLK--------
S5A1_HUMAN/110-259-----------------QSR--------------------------YLSHCAVY....-----...ADDWVT--------

PF06966

YJD4_SCHPO/67-320----LMIMAFLQTLWSARLT--------------------------YNYYRKGGYNRG-----.AEDYRWVRVRQIMPKW
Q10E47_ORYSJ/24-252----QVVLTVLVVIWGLRLG--------------------------LFLLMR.ILQWG-----..EDKRFDEMRDNLG..
Q8PAZ9_XANCP/20-250----RVLVAVLGGVWGARLA--------------------------WHLGVR.VFGDP-----.HEDGRYRALREHWNGD
Q9A3U2_CAUCR/70-299----GLLLTGLCTLWAARLG--------------------------LYLLWR.WRKHG-----..ADRRYVAIFAHYEKT
Q9VSM5_DROME/25-264----QLMVTLFVCLWGARLS--------------------------GYLLYR.IVKLG-----..RDKQFEDTRRNI...
Q9CHY6_LACLA/17-245----NSLILVLVILWGVRLA--------------------------IHLGRR.NWNKP-----..EDYRYTNMRKRWGNN
Q7CY59_AGRFC/19-248----RAVVFFLVVVWSLRLA--------------------------GHIGMR.TRGGG-----..EDPRYAKLIEEWGSA
O81042_ARATH/64-303----SMIVITLTWIWSIRLT--------------------------HNYFRRENWEWG-----AREDWRFNDLRKQYGKH
O53731_MYCTU/17-243----RWLLLALVSTWGLRLS--------------------------WHMYRK.TAGQG-----..EDPRYADLLR..GAT
Q8Y9D9_LISMO/16-244----SITILILVTLWGVRLF--------------------------WHLARR.NWNKP-----..EDYRYVNMRKRWGTT
Q984A1_RHILO/21-257----RWLVALLALVWSLRLG--------------------------VHIAGR.TIGDS-----.RDDPRYRQLKQQWGAS
B9DFE9_ARATH/24-252----QIVLTLLVVVWGLRLG--------------------------IFLLMR.ILQWG-----..EDRRFDEQRGNIV..

PF01222

LBR_CHICK/175-609AAAFSMALSIYLYIRSLKAPE..........EDLAPGGNSGYLVYDFFTGHELNPRIG.....SFDLKYFCELRPGLIGW
ERG24_NEUCR/17-490NILFAFALAIFVYVRSFDVKPGNKD.....MRQLAAGGVTGSLIYDFYIGRELNPRITLPLIGQVDIKEFMEMRPGLLGW
STS1_SCHPO/7-453AIITAFVCTFVLYTGTLLFGDRLFD.........KPHRLSGNPIYDAFMGACLNPRLG....KLLDFKMFFEVRIPWFIL
ERG4_YEAST/34-473AIISGFAFSIILYLWTLFISH.............DYHRMTGNHLYDFFMGAPLNPRWG.....ILDLKMFFEVRLPWFTL
ERG24_YEAST/8-438SILFSFFLATYCYVASFIPLIFKKNGNGKREKILALGGNSGNIIYDWFIGRELNPRLG.....PLDIKMFSELRPGMLLW

PF04140

Q9EWQ7_STRCO/75-167--------------------------------------------------CI-ATLGP----------------------
Q99YI2_STRP1/81-173--------------------------------------------------VT-RILGD----------------------
P91402_CAEEL/171-267--------------------------------------------------GM-VHAGL----------------------
Q9KF68_BACHD/72-166--------------------------------------------------AL-SSLGR----------------------
MAM4_SCHPO/121-215--------------------------------------------------AM-VQAGQ----------------------
Q9CM58_PASMU/75-167--------------------------------------------------VI-YELKE----------------------
ICMT_HUMAN/161-257--------------------------------------------------AM-FTAGS----------------------
STE14_YEAST/123-219--------------------------------------------------AM-HTAGH----------------------
Q9RTL5_DEIRA/91-184--------------------------------------------------VM-HTLGR----------------------
B6IT05_RHOCS/73-163--------------------------------------------------VV-ASLGP----------------------
F7EBZ7_XENTR/175-268--------------------------------------------------AM-LTAGS----------------------
Q2G1E3_STAA8/100-189--------------------------------------------------VI-KTLGG----------------------

PF04191

Q5KDE7_CRYNJ/603-709--------------------------------------------------SY-EVLGD----------------------
A4HJV7_LEIBR/438-543--------------------------------------------------IY-KAIGD----------------------
PEMT_HUMAN/89-192--------------------------------------------------SF-FALGF----------------------
CHO2_ASPCL/504-608--------------------------------------------------IY-ESLGE----------------------
A1CQK4_ASPCL/70-170--------------------------------------------------SM-YALGV----------------------
A3LQ40_PICST/106-209--------------------------------------------------SM-YALGV----------------------
CHO2_PICST/449-558--------------------------------------------------II-DSIGY----------------------
A4HJL2_LEIBR/106-210--------------------------------------------------SF-LRLGV----------------------
CHO2_MAGO7/497-601--------------------------------------------------IY-DELGE----------------------
CHO2_PICGU/462-570--------------------------------------------------II-DSIGY----------------------
CHO2_LODEL/480-589--------------------------------------------------II-DLIGY----------------------
A5UZK8_ROSS1/43-144--------------------------------------------------GL-LHLGA----------------------
A7TIE1_VANPO/140-243--------------------------------------------------SM-YQLGI----------------------
CHO22_VANPO/452-560--------------------------------------------------IR-AAISD----------------------
CHO21_VANPO/439-547--------------------------------------------------TR-DAISD----------------------
A8NIW8_COPC7/92-195--------------------------------------------------ST-WQLGI----------------------
CHO2_MALGO/537-642--------------------------------------------------SY-RVLGP----------------------
A8PVU2_MALGO/102-205--------------------------------------------------SM-WMLGI----------------------
A9B4Y9_HERA2/33-137--------------------------------------------------SA-RHFRQ----------------------
A9V3D6_MONBE/125-229--------------------------------------------------SF-IRLGI----------------------
CHO2_LACBS/492-596--------------------------------------------------SF-EVLGV----------------------
B1MLL6_MYCA9/108-208--------------------------------------------------VV-AQNNY----------------------
B1WZT5_CYAA5/96-194--------------------------------------------------AV-KAISI----------------------
B2AR50_PODAN/95-198--------------------------------------------------ST-WQLGI----------------------
CHO2_PODAN/496-600--------------------------------------------------IY-ESLGE----------------------
B2JAT8_NOSP7/42-145--------------------------------------------------AF-RTMNR----------------------
B2VTC6_PYRTR/87-190--------------------------------------------------SM-WALGV----------------------
CHO2_PYRTR/425-530--------------------------------------------------IY-ESLGE----------------------
B3RI13_TRIAD/89-192--------------------------------------------------SY-WRLGF----------------------
CHO2_SCHJY/478-583--------------------------------------------------IF-DDLGN----------------------
B6QQY2_TALMQ/89-189--------------------------------------------------SM-WALGV----------------------
B8LBH8_THAPS/30-132--------------------------------------------------SA-SDLKN----------------------
B8PB22_POSPM/91-194--------------------------------------------------ST-WALGV----------------------
CHO2_PICPG/450-564--------------------------------------------------MI-DSIGL----------------------
C4R5S7_PICPG/98-201--------------------------------------------------SM-WKLGI----------------------
CHO2_CLAL4/444-555--------------------------------------------------IV-DSIGY----------------------
C5DC91_LACTC/106-209--------------------------------------------------SM-YQLGV----------------------
CHO2_LACTC/450-558--------------------------------------------------IL-TAISE----------------------
C5DZ83_ZYGRC/102-205--------------------------------------------------SM-WKLRI----------------------
CHO2_ZYGRC/430-538--------------------------------------------------IR-SAISD----------------------
C5G0L0_ARTOC/115-215--------------------------------------------------SM-WALGI----------------------
C6WWJ2_METML/43-146--------------------------------------------------SF-ITMRK----------------------
C7YM51_NECH7/94-197--------------------------------------------------ST-WRLGI----------------------
CHO2_NECH7/505-609--------------------------------------------------VY-DSLGE----------------------
CHO2_SORMK/496-600--------------------------------------------------IY-ESLGE----------------------
E3I110_RHOVT/77-175--------------------------------------------------GY-FDLGI----------------------
D2U841_XANAP/75-178--------------------------------------------------AI-RVLAR----------------------
D2V512_NAEGR/65-168--------------------------------------------------AY-YQLGI----------------------
D2VYZ6_NAEGR/455-563--------------------------------------------------TH-EVLGD----------------------
D3AX06_POLPA/89-193--------------------------------------------------TL-YCLGI----------------------
D3BED6_POLPA/557-662--------------------------------------------------TL-EVLGE----------------------
D3BN57_POLPA/99-202--------------------------------------------------TY-YRLGI----------------------
CHO2_SCHPO/491-596--------------------------------------------------IY-EDLGQ----------------------
CHO1_SCHPO/110-213--------------------------------------------------SM-YKLGL----------------------
Q0AM70_MARMM/72-173--------------------------------------------------GR-YAYGS----------------------
Q0AQW8_MARMM/72-173--------------------------------------------------GR-IAYGS----------------------
CHO2_PHANO/462-567--------------------------------------------------IY-DSLGE----------------------
Q0UN81_PHANO/69-173--------------------------------------------------SM-YALGV----------------------
Q11IW9_CHESB/45-148--------------------------------------------------AL-RRLRL----------------------
Q1GIY9_RUEST/78-176--------------------------------------------------GY-RFLGL----------------------
A0A0D1CJ51_USTMA/99-202--------------------------------------------------SM-WALGV----------------------
PEMTL_DICDI/82-186--------------------------------------------------TL-KALGI----------------------
PEM2_DICDI/98-201--------------------------------------------------AY-LKLGI----------------------
Q6C649_YARLI/97-200--------------------------------------------------SM-YALGV----------------------
CHO2_YARLI/531-635--------------------------------------------------IH-DSLGH----------------------
CHO2_KLULA/451-559--------------------------------------------------IF-HSIKE----------------------
Q6CV75_KLULA/106-209--------------------------------------------------SM-YQLGI----------------------
Q6FUV4_CANGA/106-209--------------------------------------------------SM-YQLGI----------------------
CHO2_CANGA/431-540--------------------------------------------------IR-SAISD----------------------
Q752Z0_ASHGO/100-203--------------------------------------------------SM-WRLGV----------------------
Q86IF9_DICDI/521-626--------------------------------------------------TF-EVLGE----------------------
Q8TN26_METAC/121-221--------------------------------------------------VF-RENPF----------------------
Q98I61_RHILO/42-146--------------------------------------------------AF-ARFAL----------------------
E7QGU3_YEASZ/100-199--------------------------------------------------SM-YKLGI----------------------
F1SB04_PIG/61-160--------------------------------------------------SF-LALGF----------------------
F7BHJ5_XENTR/62-163--------------------------------------------------SF-LALGF----------------------
G1MZ29_MELGA/96-197--------------------------------------------------SF-LALGF----------------------
CHO2_YEAST/471-577--------------------------------------------------TR-LAISD----------------------
CHO2_CANAL/468-576--------------------------------------------------II-DSIGY----------------------
Q5KHK0_CRYNJ/121-221--------------------------------------------------SM-WALGV----------------------
Q8DW48_STRMU/70-169--------------------------------------------------AI-NYLGK----------------------
Q8PE74_XANCP/100-199--------------------------------------------------AI-QVLAR----------------------

PF07298

B2JUD7_BURP8/3-190--------------------------------------------------TI.ERMGA----------------------
A1VI53_POLNA/3-190--------------------------------------------------MI.GRLGE----------------------
Q12HL7_POLSJ/3-190--------------------------------------------------MI.AKVGE----------------------
A2SBS8_METPP/3-190--------------------------------------------------TL.ARVGE----------------------
Q223I4_RHOFT/3-190--------------------------------------------------TR.ARIGP----------------------
A1K5T7_AZOSB/6-191--------------------------------------------------RV.AALGE----------------------
A1WT38_HALHL/3-190--------------------------------------------------QI.AAYGE----------------------
A6VV32_MARMS/3-191--------------------------------------------------SM.AIHGE----------------------
Q0AQE8_MARMM/3-183--------------------------------------------------LQ.ARLGA----------------------
A1AZI2_PARDP/3-180--------------------------------------------------...AVMGD----------------------
Q28U80_JANSC/6-185--------------------------------------------------...ASFGD----------------------
Q5LXD7_RUEPO/5-179--------------------------------------------------...AAMGD----------------------
Q1GLH3_RUEST/3-179--------------------------------------------------...ASLGD----------------------
A8LJK3_DINSH/5-184--------------------------------------------------...AAMGD----------------------
Q169U5_ROSDO/3-182--------------------------------------------------...AAMGN----------------------
A0KG00_AERHH/3-186--------------------------------------------------LR.ERLGE----------------------
Q6N9Q3_RHOPA/31-253--------------------------------------------------LV.GALGE----------------------
Q219Y9_RHOPB/14-236--------------------------------------------------MV.ARLGE----------------------
Q5LUC0_RUEPO/7-220--------------------------------------------------LV.ARLGA----------------------
Q0C1Y5_HYPNA/14-233--------------------------------------------------LV.SLLGR----------------------
Q169M4_ROSDO/6-220--------------------------------------------------LV.RHLGA----------------------
A8LNX8_DINSH/42-256--------------------------------------------------LE.ARLGA----------------------
A9CGK0_AGRFC/3-221--------------------------------------------------LI.AAVGR----------------------
Q2JYB9_RHIEC/5-223--------------------------------------------------II.RRVGR----------------------
Q92Z13_RHIME/3-221--------------------------------------------------LL.FLLGR----------------------
B0U8Q9_METS4/2-221--------------------------------------------------LV.ARLGR----------------------
Q2VYZ8_MAGSA/17-229--------------------------------------------------IE.ARYGK----------------------
Q60BH7_METCA/3-224--------------------------------------------------LV.AYRGE----------------------
A7HZ42_PARL1/3-227--------------------------------------------------IV.ATIGE----------------------
Q1GUJ7_SPHAL/6-226--------------------------------------------------LA.SRLGE----------------------
Q2GC12_NOVAD/7-219--------------------------------------------------IA.KSLGR----------------------
Q8DMH0_THEEB/15-236--------------------------------------------------AE.KRLGA----------------------
Q113R6_TRIEI/12-233--------------------------------------------------AE.NKIGP----------------------
Q8YQ81_NOSS1/13-234--------------------------------------------------AE.KYTGP----------------------
Q9ALA6_SYNE7/12-229--------------------------------------------------GE.TKIGA----------------------
Q7V3C9_PROMP/9-231--------------------------------------------------AE.AFMGA----------------------
A9CI20_AGRFC/3-191--------------------------------------------------MI.AAMGE----------------------
Q92UK4_RHIME/3-191--------------------------------------------------II.DSRGK----------------------
Q89MZ5_BRADU/5-191--------------------------------------------------AI.ARLGE----------------------
A7IF98_XANP2/3-187--------------------------------------------------LI.AQVGE----------------------
B0UL45_METS4/3-192--------------------------------------------------LI.ARVGE----------------------
Q0C445_HYPNA/3-190--------------------------------------------------DIREKLGY----------------------
Q3JDP5_NITOC/3-187--------------------------------------------------L..AAKSE----------------------
Q9AAA0_CAUCR/3-186--------------------------------------------------QV.AA.NP----------------------
Q11KH3_CHESB/3-188--------------------------------------------------VV.GSRGL----------------------
B4EFU3_BURCJ/3-190--------------------------------------------------TI.DRIGE----------------------
C5B332_METEA/3-195--------------------------------------------------VI.GRIGE----------------------
Q2JMU2_SYNJB/23-239--------------------------------------------------GE.SRLGS----------------------
Q2K5L0_RHIEC/3-191--------------------------------------------------MI.ASLGE----------------------
Q3SR07_NITWN/1-185--------------------------------------------------LI.SSYGE----------------------
Q46HM6_PROMT/12-228--------------------------------------------------AE.SVIGA----------------------
Q63MK0_BURPS/3-190--------------------------------------------------QI.ATLGE----------------------

PF02544

Q19605_CAEEL/97-243--------------------------------------------------..RKLVGS----------------------
YN67_SCHPO/146-295--------------------------------------------------PNHLLFLI----------------------
Q20344_CAEEL/97-243--------------------------------------------------..RHLIGS----------------------
S5A1_RAT/110-259--------------------------------------------------HPCFLTGF----------------------
S5A2_HUMAN/105-254--------------------------------------------------DIRFSLGV----------------------
PORED_CAEEL/189-309--------------------------------------------------........----------------------
Q23431_CAEEL/103-253--------------------------------------------------KFFVFLGA----------------------
DET2_ARATH/111-262--------------------------------------------------.WRFVIGM----------------------
TECR_YEAST/154-310--------------------------------------------------LDDLSTLI----------------------
S5A1_HUMAN/110-259--------------------------------------------------DPRFLIGF----------------------

PF06966

YJD4_SCHPO/67-320.....IYPLFHYFYIHIFQVLHLYLLAS--PTYIAMLAGNER.....AF.GAWDWIAL----------------------
Q10E47_ORYSJ/24-252.........KLAV.FWIFQAVWVWTVSL--PVTIVNASDSDP.....SI.EARDIIGW----------------------
Q8PAZ9_XANCP/20-250.......QRKFLG.FFLAQAMVVVLFSV--PFLAA.ASNPNP.....AW.SVWSSLAI----------------------
Q9A3U2_CAUCR/70-299KRWNFAT.TSLII.VFGLQAVLSYFVAL--PVQLGQGP........GVL.GGLAYAGA----------------------
Q9VSM5_DROME/25-264........IRYAV.FWTFQAVWVYIVSL--PVIIINSPRHSQPRAPKTM.TTLDSTGT----------------------
Q9CHY6_LACLA/17-245....FPKLKAFLT.VFMVQYLLLIIISL--PIIQVN.SNVNS.....QF.YWWQILGI----------------------
Q7CY59_AGRFC/19-248......ASLRLFI.FLQIQAIAAFILVL--AVYLATG..NGQ.....VFPRVIDVFAT----------------------
O81042_ARATH/64-303....WWWL.SFFS.VYVSQQIFLIGICL--PLYVIHS.....I..DEPL.NIWDFISS----------------------
O53731_MYCTU/17-243.....PVQ.ALRK.VFGLQGLLTLFVSF--PLQLSAVTGPTP....KPL.LAVGGVGL----------------------
Q8Y9D9_LISMO/16-244....LVNLKAFLN.VFVLQGVLLFIIAL--PITHSFA.NETA.....TF.AWWQILGI----------------------
Q984A1_RHILO/21-257.......SSSRLFWFLQVQAAAAFLLAM--SI.MAAAHKPAP.....EL.GPGDWIGV----------------------
B9DFE9_ARATH/24-252.........RLII.FWTLQAVWVWTVSL--PLTLVNASDGGG.....SL.KPADVIGW----------------------

PF01222

LBR_CHICK/175-609VVINLAMLLAEMKIHNQSMPSLSMILVNSFQLLYVVDALWNEEAVLTTMDITHDGFGFMLAFGDLVWVPFVYSLQAFYLV
ERG24_NEUCR/17-490IILNCAFIAKQYRLYGYVTDSILFITAI..QAFYVFDGIYMEPAVLTTMDITTDGFGFMLSFGDVVWVPFMYSTQTRYLS
STS1_SCHPO/7-453FFISVGAAVRQYETYGTVSPQVLFVCLG..HYLYANACSKGEQLIVPTWDMAYEKFGFMLIFWNMAGVPFTYSHCTLYLF
ERG4_YEAST/34-473YFITLGACLKQWETYGYVTPQLGVVMLA..HWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLY
ERG24_YEAST/8-438LLINLSCLHHHYLKTGKINDALVLVNFL..QGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLSLVPFTYSLQARYLS

PF04140

Q9EWQ7_STRCO/75-167------------------Y-WNTRVIV..VPGT--------RPVGAG---------------------------------
Q99YI2_STRP1/81-173------------------I-WTVKLML..AKDH--------KYVDHW---------------------------------
P91402_CAEEL/171-267------------------A-FTHRLAMTKRSDH--------RLVKDG---------------------------------
Q9KF68_BACHD/72-166------------------F-WNTRIMI..LPDA--------NVIASG---------------------------------
MAM4_SCHPO/121-215------------------S-FSHIVASKRNKDH--------LLVTDG---------------------------------
Q9CM58_PASMU/75-167------------------I-WTVKLYI..LPEH--------HINRSF---------------------------------
ICMT_HUMAN/161-257------------------N-FNHVVQNEKSDTH--------TLVTSG---------------------------------
STE14_YEAST/123-219------------------S-FSHIVKTKKESDH--------VLVKTG---------------------------------
Q9RTL5_DEIRA/91-184------------------Y-WNTRILI..VPGG--------QRVTSG---------------------------------
B6IT05_RHOCS/73-163------------------Y-WTTRIIT..LPGA--------PLIRRG---------------------------------
F7EBZ7_XENTR/175-268------------------N-FNHIVQNEKSDSH--------TLVTSG---------------------------------
Q2G1E3_STAA8/100-189------------------I-WTLKLFI..LPNH--------PIIKSG---------------------------------

PF04191

Q5KDE7_CRYNJ/603-709------------------FGWLYSDFFL.IEQIPS......QLAYTG---------------------------------
A4HJV7_LEIBR/438-543------------------YGYFYGDFFI.DKVP.A......KLNYSG---------------------------------
PEMT_HUMAN/89-192------------------AGTFLGDYFG.ILKE........ARVTVF---------------------------------
CHO2_ASPCL/504-608------------------FGWFYGDFFF.D.AS.P......KLTYNG---------------------------------
A1CQK4_ASPCL/70-170------------------TGTYLGDYFG.ILMD........APVTGF---------------------------------
A3LQ40_PICST/106-209------------------TGTYLGDYFG.ILMN........ERVTGF---------------------------------
CHO2_PICST/449-558------------------FGWFYGDFFI.PKSY.SS...MQHLTKAG---------------------------------
A4HJL2_LEIBR/106-210------------------TGTYLGDYFD.ILMD........ERVTAF---------------------------------
CHO2_MAGO7/497-601------------------FGWFFGDFFF.N.NR.T......KLTYRS---------------------------------
CHO2_PICGU/462-570------------------FGWFYGDFFL.P.TS.PQ...RSHLTKAG---------------------------------
CHO2_LODEL/480-589------------------FGWFYGDFFI.PKSQ.SF...ANHLTKAG---------------------------------
A5UZK8_ROSS1/43-144------------------NLTPFPRP...RDDG........RLVQHG---------------------------------
A7TIE1_VANPO/140-243------------------TGTYLGDYFG.ILMD........ERVTAF---------------------------------
CHO22_VANPO/452-560------------------FGWFYGDFFL......INYISERRLTSQG---------------------------------
CHO21_VANPO/439-547------------------FGWFYGDFFL......TNYITTRKLTSQG---------------------------------
A8NIW8_COPC7/92-195------------------TGTFLGDYFG.ILMD........HRVEGF---------------------------------
CHO2_MALGO/537-642------------------FGWLYGDFFI.DAYP.K......RLSYTG---------------------------------
A8PVU2_MALGO/102-205------------------TGTYLGDYFG.ILMD........HMVTGF---------------------------------
A9B4Y9_HERA2/33-137------------------MGTNIMTF...GQPD........RLVISG---------------------------------
A9V3D6_MONBE/125-229------------------FGTYMGEFFG.VMLS........EKITTF---------------------------------
CHO2_LACBS/492-596------------------FGWFFGDFFM.EEFP.T......HLEYTG---------------------------------
B1MLL6_MYCA9/108-208------------------AAASITV....ESGQ........TVTATG---------------------------------
B1WZT5_CYAA5/96-194------------------HDSL.......GLEG........ELITKG---------------------------------
B2AR50_PODAN/95-198------------------TGTFLGDYFG.ILMD........KMVTGF---------------------------------
CHO2_PODAN/496-600------------------FGWFYGDFFF.E.SP.R......PPTYNS---------------------------------
B2JAT8_NOSP7/42-145------------------AQTEVNPS...RPTT........AIVSDG---------------------------------
B2VTC6_PYRTR/87-190------------------TGTYLGDYFG.ILMD........EPVTTF---------------------------------
CHO2_PYRTR/425-530------------------FGWFCGDFFF.DPPS.K......SLTYNG---------------------------------
B3RI13_TRIAD/89-192------------------TGTFLGDYFG.ILLE........ERVTTF---------------------------------
CHO2_SCHJY/478-583------------------FGWFYGDFFL.PVQS.P......KLSYRG---------------------------------
B6QQY2_TALMQ/89-189------------------TGTYLGDYFG.ILMD........APVTGF---------------------------------
B8LBH8_THAPS/30-132------------------NLSPYPVP...SEKG........ALIDSG---------------------------------
B8PB22_POSPM/91-194------------------TGTFLGDYFG.ILMD........HRVEGF---------------------------------
CHO2_PICPG/450-564------------------FGWYYGDFFI.GVLS.SHKSEVTTLSRSG---------------------------------
C4R5S7_PICPG/98-201------------------TGTYLGDYFG.ILME........DRVTSF---------------------------------
CHO2_CLAL4/444-555------------------FGWFYGDFFI.PKASVLPQ..RAHLSKGG---------------------------------
C5DC91_LACTC/106-209------------------TGTYLGDYFG.ILMD........NIVTAF---------------------------------
CHO2_LACTC/450-558------------------FGWFYGDFFL......TNYISSRKLNSRG---------------------------------
C5DZ83_ZYGRC/102-205------------------TGTYLGDYFG.ILMD........EIVTDF---------------------------------
CHO2_ZYGRC/430-538------------------FGWFYGDFFL......SNYIPTKSLTSHG---------------------------------
C5G0L0_ARTOC/115-215------------------TGTYLGDYFG.ILMD........APVTGF---------------------------------
C6WWJ2_METML/43-146------------------IGTSGNPR...ETST........ALAING---------------------------------
C7YM51_NECH7/94-197------------------TGTFLGDYFG.ILMD........EMVTGF---------------------------------
CHO2_NECH7/505-609------------------FGWFCGDFFF.D.QQ.A......KLTYKS---------------------------------
CHO2_SORMK/496-600------------------FGWFYGDFFF.D.SK.R......QLTYTS---------------------------------
E3I110_RHOVT/77-175------------------ENTY.......GADE........GLVTGG---------------------------------
D2U841_XANAP/75-178------------------WFTVDLTI...QHGQ........RLVGHG---------------------------------
D2V512_NAEGR/65-168------------------TGTYLGDYFG.ILME........DRITSF---------------------------------
D2VYZ6_NAEGR/455-563------------------HGWFYGDFFYTETNQ.N.....KQPSYTG---------------------------------
D3AX06_POLPA/89-193------------------KGMYNGDSFG.HIMD........APVTGG---------------------------------
D3BED6_POLPA/557-662------------------FGWFYGDFFI.DEVP.T......KLYYTG---------------------------------
D3BN57_POLPA/99-202------------------TGTYLGDYFG.ILMK........ERVYGF---------------------------------
CHO2_SCHPO/491-596------------------YGWFYGDFFL.PSRS.P......KLVYQG---------------------------------
CHO1_SCHPO/110-213------------------VGTYLGDYFG.FLLP........ERVSGF---------------------------------
Q0AM70_MARMM/72-173------------------QERVYG.....LLED........ELIQHG---------------------------------
Q0AQW8_MARMM/72-173------------------QKRVYG.....LLED........RLIEGG---------------------------------
CHO2_PHANO/462-567------------------FGWFCGDFFF.DPPS.S......NLTYSG---------------------------------
Q0UN81_PHANO/69-173------------------TGTYLGDYFG.ILMD........APVTTF---------------------------------
Q11IW9_CHESB/45-148------------------AKTTVMPT...RSAT........QLVTDG---------------------------------
Q1GIY9_RUEST/78-176------------------DNTY.......CDTG........GLVTGG---------------------------------
A0A0D1CJ51_USTMA/99-202------------------TGTYLGDYFG.ILMD........SIVTGF---------------------------------
PEMTL_DICDI/82-186------------------KGMYNGDSFG.HIMD........SPVTGG---------------------------------
PEM2_DICDI/98-201------------------TGTYLGDYFG.ILMK........ERVTGF---------------------------------
Q6C649_YARLI/97-200------------------TGTYLGDYFG.ILMN........ERVTGF---------------------------------
CHO2_YARLI/531-635------------------FGWFYGDFFL.D.RK.Q......NLTYSG---------------------------------
CHO2_KLULA/451-559------------------FGWFYGDFFL......PNLIDKRKLKNDG---------------------------------
Q6CV75_KLULA/106-209------------------TGTYLGDYFG.ILMD........HRVTSF---------------------------------
Q6FUV4_CANGA/106-209------------------TGTYLGDYFG.ILMN........DRVTAF---------------------------------
CHO2_CANGA/431-540------------------FGWFYGDFFL......INYIVDRKLTTQG---------------------------------
Q752Z0_ASHGO/100-203------------------TGTYLGDYFG.ILME........DRVTSF---------------------------------
Q86IF9_DICDI/521-626------------------FGWFYGDFFI.EDIP.S......NLYYTG---------------------------------
Q8TN26_METAC/121-221------------------AAATIQV....SSDQ........QVITTG---------------------------------
Q98I61_RHILO/42-146------------------EGLGTPAPVA.PTER.........LVIGG---------------------------------
E7QGU3_YEASZ/100-199------------------TGTYLGDYFG.ILMD........ERVTGF---------------------------------
F1SB04_PIG/61-160------------------TGTFLGDYFG.ILME........ARVTRF---------------------------------
F7BHJ5_XENTR/62-163------------------VGTYLGDYFG.ILME........KKVTGF---------------------------------
G1MZ29_MELGA/96-197------------------TGTFLGDYFG.ILME........AKVTCF---------------------------------
CHO2_YEAST/471-577------------------FGWFYGDFFL.SNYI.ST....RKLTSQG---------------------------------
CHO2_CANAL/468-576------------------FGWFYGDFFI.PKSQ.SS...IKNITTAG---------------------------------
Q5KHK0_CRYNJ/121-221------------------TGTYLGDYFG.ILMS........HRVTSF---------------------------------
Q8DW48_STRMU/70-169------------------AFTLTVQA...TDNQ........KLISSG---------------------------------
Q8PE74_XANCP/100-199------------------WFTVDVTI...QADH........QLVRSG---------------------------------

PF07298

B2JUD7_BURP8/3-190------------------KNWKAAYSVVSLVGL--------VLIIWGYGIARRE.PVVLWTSP..AWSPHLTGVLTLIAF
A1VI53_POLNA/3-190------------------KRWKGLYALVSLVGF--------GLVIWGFGLARQQ.PVQWWAPP..FATRHLAWLLTALAF
Q12HL7_POLSJ/3-190------------------KPWKGVYALLSIAGF--------VLLVWGYGLARQS.PVVLWTPP..VGMRHVAALLMLLAF
A2SBS8_METPP/3-190------------------ARWKAAYAVVSLIGF--------VLLAWGYGLARQQ.PVLLWTPP..VAMRHIAALLTLVAF
Q223I4_RHOFT/3-190------------------LAWKGLYSVLSLLGF--------ALIVWGFGLARQQ.PVQLWSPP..VALRHLASLLTLLSF
A1K5T7_AZOSB/6-191------------------KRWKGIYAAVAAVGL--------VLVVWGYGLTRDV.PVAIWSAP..VWTRHLAAVLTLPAF
A1WT38_HALHL/3-190------------------IPWKTAYSALSLVGL--------IIAIYGYGLTRVD.AVWVWMPP..NWTAHLMALVMIPAF
A6VV32_MARMS/3-191------------------MRWKMRFGMITLIAV--------GLIVMGYSQTRLE.PVWLWFPP..VWTRHLAGLLVLVAL
Q0AQE8_MARMM/3-183------------------TPYKLTYTVISLIGF--------GLIIYGKVIAHPT..PSIWTTP..GWGHQAALFAVPVGI
A1AZI2_PARDP/3-180------------------RG.KGVVAGLLALSV--------VLMVVGYRQADGP...YWWGAS..APLKGINNLLVLVAF
Q28U80_JANSC/6-185------------------KG.KGIVAGLVVLSV--------ILMVIGYRGAEGA...FYWGRS..PALVGINNILMVLAF
Q5LXD7_RUEPO/5-179------------------RG.KGMVALALLGSV--------VLMVIGYRMTDYI...HVWAPP..SYLTHANNLLVLVAI
Q1GLH3_RUEST/3-179------------------KG.RGLVALVLLVSV--------VLMVLGYRGTEYI...HVWAPA..PFLVHVNNTLMLFAL
A8LJK3_DINSH/5-184------------------KG.KAVVAVAIVASI--------VLMVIGYRGAEFV...FLWSPP..AFMTHVNNTLMLFAL
Q169U5_ROSDO/3-182------------------AG.KGGVAVAIIASL--------VLMVMGYRAAEFI...PVWQPP..AFMMHVNNTLMLFAL
A0KG00_AERHH/3-186------------------NRYKGLFSLLVFIAI--------ACIIAGWRTASPL...PLYFLP..VWGPTLMMAVMPIAL
Q6N9Q3_RHOPA/31-253------------------RGFLIAYSIESLLVL--------TWLIVATERAPFV...ELWPFE..TWQMWVPNLALPLAC
Q219Y9_RHOPB/14-236------------------RGFLALYSGVSLLVL--------AWLIGAAGRAPLL...PLWPFE..PWQMLAPNLAMPFVC
Q5LUC0_RUEPO/7-220------------------RGFGIAYSLFSIAVL--------GWLILAAARAPYV...EVIPPL..PALRWVPILIMLPVC
Q0C1Y5_HYPNA/14-233------------------WAYLALYSAVSLALF--------AWLIIAAGRAPYV...WLWFWG..PHGLWLANGLMALAL
Q169M4_ROSDO/6-220------------------KGFTTAYSALSLCIL--------ALLIWAAGQAPFV...LLWAEA..AWHRPAILVGMLAAC
A8LNX8_DINSH/42-256------------------RGFTLAYSALSLGVL--------AWLIGAAGRAPFV...PLWDWA..PWQAHLVLAAMLPVC
A9CGK0_AGRFC/3-221------------------PAYLGAYSVVSLLTL--------SWVFHAALSVDYI...PLWDVA..PWQAHVTFLAAPIGL
Q2JYB9_RHIEC/5-223------------------PVYFVGYSAASTLAL--------IWVFSAALALDYI...PLWELT..PGNAAAAFVLAPFGI
Q92Z13_RHIME/3-221------------------AGYFSLYSFASILAL--------AWVLYAALDVDHI...PLWQPS..AWQAWLTMIAAPVGV
B0U8Q9_METS4/2-221------------------RAYLVAYSALSLALL--------AWLIVAARRAGTV...ALWEPA..RWQWAVPLALMPVAL
Q2VYZ8_MAGSA/17-229------------------AGFYAGYSVVSTILL--------VWVIAAALNSPTV...VVWEQQ..PWMRWVPPLVMPVAC
Q60BH7_METCA/3-224------------------QAFRAAFSVLSLLAL--------GWVVFAYRQAPYV...ETWGQL..TGFKPIAAVLMLVSF
A7HZ42_PARL1/3-227------------------RAWLALFSLASIAGI--------SWLAYSFNEAVAGPNHLYWVPP..LWALHLSPLVILVAT
Q1GUJ7_SPHAL/6-226------------------RGFQIVYSIVAIATF--------ILVVQAWRGMPPE..PPLWPVG..DGLWALASLIVLFAS
Q2GC12_NOVAD/7-219------------------PTYLTIYSLVAIATL--------TWAIVAFDRAPAA..PALWDGT.NAVAWALASVLTIVSL
Q8DMH0_THEEB/15-236------------------RLYRIFFASVSLPLA--------TILILYFLAHRYD.GVQLWQLQEVPGMGALVWGLSALSF
Q113R6_TRIEI/12-233------------------RLYRILFALVSLPLA--------VILIIYFFNHRYD.GLQLWQLQGVPIVKPIVWTFSAISF
Q8YQ81_NOSS1/13-234------------------RLYRIFFALVSLPLA--------VILIIYFFNHRYD.GLQLWQVQNVPGVQAVVWVSSAISF
Q9ALA6_SYNE7/12-229------------------RGYRILFALVSLPLA--------VVTISYFILHRYD.GALLWQLQGIPWIAPLVWVLTAISF
Q7V3C9_PROMP/9-231------------------RLWRLLFVSLSLPSA--------LILISYFLAHRYD.GIRLWNFQGNHYVFLLVWILTAISF
A9CI20_AGRFC/3-191------------------GPFKGVYSLVSLITL--------GLVIYAFGEARQE.TGMLWNPP..VFMSHIAVTLMLPAM
Q92UK4_RHIME/3-191------------------GTWMGLYTIVSLVGL--------CLIIYGFSQARGE.TGMLYDPP..TFLRHIALLLMLVAF
Q89MZ5_BRADU/5-191------------------GTYKILYALVSLAGL--------ALIIWGFGHYRATGWIDVWYPP..KAMKHITLALMLPAV
A7IF98_XANP2/3-187------------------AAYKGFFSLLAISGL--------LLTAYGFALWRASGAPDLWDPP..LGMTHLTKLLMVFAC
B0UL45_METS4/3-192------------------GPYKLGYSVLALVGL--------IVLGIGYGRYRSEGYIDIWSPP..VWTRHLALLLVLVAF
Q0C445_HYPNA/3-190------------------GPYMGLYTLVSAVGL--------GLFLWGFGAMRPA..PILYTPP..AGLAHLNLVLMLPAL
Q3JDP5_NITOC/3-187------------------IGWKILYGSVSLIGI--------ILISRGYVDLRQA.PTLLYVSP..IWLHHVVTILLLPTF
Q9AAA0_CAUCR/3-186------------------KRWRGLYSLVAAAGL--------GLIIWGWIVYRPA.APQLYDPP..AWGRHAAMLLVWLAF
Q11KH3_CHESB/3-188------------------GAWKGIYSLAAFLGL--------VLIVWGYWLARQN.PVVLYTPA..TWMQHLTLLLMLPVF
B4EFU3_BURCJ/3-190------------------KGWKGGYAIASIVGF--------VLIIWGYGIARAG.ATLLWVSP..VGVRHLTGMLTAVAF
C5B332_METEA/3-195------------------GRFKLGYTLLSVLGL--------ILTIYGYGLYRQEGMIPVWSPP..LWTRHLAVLLTLFAF
Q2JMU2_SYNJB/23-239------------------RLYRIFFALVSLSLA--------PLLLIYFFNHRYD.GVILWDLQAVPGIRTTVALLSALSF
Q2K5L0_RHIEC/3-191------------------KGWRAGYSIASILTL--------ILLIYGFGQARQV.TGMLYNPP..VWTAHIAITLMLIAM
Q3SR07_NITWN/1-185------------------GPYKIGFSLISAVGV--------ALTLWGFLSYRATGVIDVWYPP..RVMKHIAEALILPSI
Q46HM6_PROMT/12-228------------------RAWRLIFAFASIPSA--------VILVGYFIAHRYD.GFRFWNLQGVSELIPLIWILSAISF
Q63MK0_BURPS/3-190------------------PRWKGIYALASVIGF--------ALIVWGYGLARAD.TASLWFPP..LGIRHLTGLLTAIAF

PF02544

Q19605_CAEEL/97-243------------------LMYCTGMYINHKSDT--------ILR..--------------..--------ELRADGGTGY
YN67_SCHPO/146-295------------------VGWAFAVLSNFRTHI--------ILR..--------------..--------DLRPAGSKKR
Q20344_CAEEL/97-243------------------ILYFSGMFINHKSDN--------ILM..--------------..--------TLRKPGETGY
S5A1_RAT/110-259------------------ALWLVGMVINIHSDH--------ILR..--------------..--------NLRKPGETGY
S5A2_HUMAN/105-254------------------FLFILGMGINIHSDY--------ILR..--------------..--------QLRKPGEISY
PORED_CAEEL/189-309------------------.........TRKGPR--------GLI..--------------..--------.....RNYAY
Q23431_CAEEL/103-253------------------WLFVIGFITHCVSDL--------HLI..--------------..--------TLRNDYLNSY
DET2_ARATH/111-262------------------VVFITGMYINITSDR--------TLV..--------------..--------RLKKENRGGY
TECR_YEAST/154-310------------------GLFVLSELWNFYCHI--------KLRLW--------------GD--------YQKKHGNAKI
S5A1_HUMAN/110-259------------------GLWLTGMLINIHSDH--------ILR..--------------..--------NLRKPGDTGY

PF06966

YJD4_SCHPO/67-320------------------ELFMFMFVLEMLADQ--------QQWDYYEARNHYNVDKTVPPR--------FKYDLLSLGR
Q10E47_ORYSJ/24-252------------------IMWLIGAGMEAIADQ--------QKLTF................--------.KNSPSNRGR
Q8PAZ9_XANCP/20-250------------------VVWLIAVGGEALADR--------QLSAH................--------.KANPANRGK
Q9A3U2_CAUCR/70-299------------------ALTIVGILFETIGDA--------QLTAF................--------.KANPDNAGK
Q9VSM5_DROME/25-264------------------GMFIVGLLAETYADL--------QKFSF................--------.RQDPANQGK
Q9CHY6_LACLA/17-245------------------IIWIFGFIFEVFGDR--------QLEVF................--------.KKLPQNKGK
Q7CY59_AGRFC/19-248------------------VVALTALAGEALSDA--------QLSKF................--------.RRTPEAKTG
O81042_ARATH/64-303------------------AICLTGIVMAYFADT--------QLHEFVTGN........QKLK--------EQGKPK...I
O53731_MYCTU/17-243------------------AVWLVGITFEAVGDW--------QLWVF................--------.KSDPANRGV
Q8Y9D9_LISMO/16-244------------------VIWIIGFIFEVGGDL--------QLENF................--------.KKNPANKGK
Q984A1_RHILO/21-257------------------AIWVVAIGGEALADR--------QLNAF................--------.RGDPRNKGK
B9DFE9_ARATH/24-252------------------TMWVFGFLIEAAADQ--------QKLSF................--------.KNSPENRGK

PF01222

LBR_CHICK/175-609GH.PIAISWP..VAAAITILNCIGYYIFRSANS--------QKNNFR...........RNPADPKLSY..LKVIPTATGK
ERG24_NEUCR/17-490VH.PQQLGAFG..LIAVGAVLAAGYSIFRLSNS--------QKNNFR...........TNPEDPSVKH..LTYLQTKTGS
STS1_SCHPO/7-453SHDPSVYNWSTQYTTGIYVLLLCCYYIFDTCNG--------QKNHFRNQIYGTEVHRKTFPQLPWLIIKNPTFIRCANGG
ERG4_YEAST/34-473YHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANA--------QKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGS
ERG24_YEAST/8-438VS.PVELGWV..KVVGILAIMFLGFHIFHSANK--------QKSEFR...............QGKLEN..LKSIQTKRGT

PF04140

Q9EWQ7_STRCO/75-167------------------------------PYRFLRHPNYLA.VVVEVAALPLVHSA-----------------------
Q99YI2_STRP1/81-173------------------------------LFKTIKHPNYFLNIAPELVGIALLCHA-----------------------
P91402_CAEEL/171-267------------------------------IYAYLRHPGYFGWFLWAVSTQIILCNP-----------------------
Q9KF68_BACHD/72-166------------------------------PYRYIKHPNYAV.VIIEIAMLPLFFKA-----------------------
MAM4_SCHPO/121-215------------------------------IYAYVRHPSYVGFFIWALGTQMLLGNF-----------------------
Q9CM58_PASMU/75-167------------------------------LFKYVRHPNYFLNIIPELIGLSLFCQA-----------------------
ICMT_HUMAN/161-257------------------------------VYAWFRHPSYVGWFYWSIGTQVMLCNP-----------------------
STE14_YEAST/123-219------------------------------VYSWSRHPSYLGFFWWAIGTQLLLLNP-----------------------
Q9RTL5_DEIRA/91-184------------------------------PFRFLGHPNYTV.VALELAAAPLAVGA-----------------------
B6IT05_RHOCS/73-163------------------------------PFRHVRHPNYLV.VTGEIAVLPLAFGA-----------------------
F7EBZ7_XENTR/175-268------------------------------VYSWFRHPSYVGWFYWSIGTQVLLCNP-----------------------
Q2G1E3_STAA8/100-189------------------------------LYKITKHPNYFLNIIPELIGVLLLTHA-----------------------

PF04191

Q5KDE7_CRYNJ/603-709------------------------------IYRFLNNPERSMGGAAFFGLWLI.SNS-----------------------
A4HJV7_LEIBR/438-543------------------------------IYRYLNNPDSSLGMSAYYGIALL.SGS-----------------------
PEMT_HUMAN/89-192------------------------------PFNILDNPMYWGSTANYLGWAIM.HAS-----------------------
CHO2_ASPCL/504-608------------------------------IYRFLNNPERVLGLAGVWGAVLI.TSS-----------------------
A1CQK4_ASPCL/70-170------------------------------PFSATGSPMYWGSTLNFLGVALY.FGK-----------------------
A3LQ40_PICST/106-209------------------------------PFNVNDNPMYNGSTLCFLGTALW.YGK-----------------------
CHO2_PICST/449-558------------------------------VYRYLNNPEQIFGVCGVMGVFIM.VPS-----------------------
A4HJL2_LEIBR/106-210------------------------------PFSHFDNPMYLGATLNFLAASII.QNN-----------------------
CHO2_MAGO7/497-601------------------------------IYRFLNNPERVMGSLGLYGAALI.TWS-----------------------
CHO2_PICGU/462-570------------------------------VYRYLNNPEQLFGVCGVMGLTLI.APS-----------------------
CHO2_LODEL/480-589------------------------------VYRYLNNPEQIFGVCGVMGVFII.WPT-----------------------
A5UZK8_ROSS1/43-144------------------------------AYAIVRHPIYSGIIIGAFGWSLL.RGS-----------------------
A7TIE1_VANPO/140-243------------------------------PFNVSNNPMYQGSTLSFLGTALI.YGK-----------------------
CHO22_VANPO/452-560------------------------------IYRYLNNPEAILGTAGIWGTALM.TNF-----------------------
CHO21_VANPO/439-547------------------------------IYRYLNNPEAILGVAGIWGSVLM.TNF-----------------------
A8NIW8_COPC7/92-195------------------------------PFNILNDPMYVGSTMSFIATALW.TER-----------------------
CHO2_MALGO/537-642------------------------------IYRFLNNPERSMGSAAFFGMALL.SGS-----------------------
A8PVU2_MALGO/102-205------------------------------PFSVLNDPMYVGSTLNFVGVALW.YAR-----------------------
A9B4Y9_HERA2/33-137------------------------------WFRWSRNPMYLGFGLSLLGIALL.LGA-----------------------
A9V3D6_MONBE/125-229------------------------------PFDVVDNPMYFGSSLMHIGLAIM.EQS-----------------------
CHO2_LACBS/492-596------------------------------IYRYLNNPE.AMGGAAWFGLALI.SGS-----------------------
B1MLL6_MYCA9/108-208------------------------------LYGLVRHPMYTGSLVMMVGMPLA.LGS-----------------------
B1WZT5_CYAA5/96-194------------------------------VYNYSRNPEYIGDLILFLGYSLL.TNS-----------------------
B2AR50_PODAN/95-198------------------------------PFNITSAPMYYGSTMSFLGSALL.YGK-----------------------
CHO2_PODAN/496-600------------------------------IYRFLNNPERVLGAAGFWGLALI.TWS-----------------------
B2JAT8_NOSP7/42-145------------------------------VFRLSRNPIYLSLTLFYIGIALL.LGA-----------------------
B2VTC6_PYRTR/87-190------------------------------PFNVSSSPMYHGSTMSFLATAIW.FGK-----------------------
CHO2_PYRTR/425-530------------------------------IYRFLNNPERVLGLAGVWGIAII.TWS-----------------------
B3RI13_TRIAD/89-192------------------------------PFNIFDNPMYIGSTSNFLGLALR.SAS-----------------------
CHO2_SCHJY/478-583------------------------------IYRYLNNPERFFGSAAFWGMALI.SNS-----------------------
B6QQY2_TALMQ/89-189------------------------------PFNVTGSPMYWGSTLSFLGTSLY.YGK-----------------------
B8LBH8_THAPS/30-132------------------------------IYGLMRHPMYTGVLIGMAGLSLV.TDS-----------------------
B8PB22_POSPM/91-194------------------------------PFNVLRDPMYVGSTMSFVAVSLW.FER-----------------------
CHO2_PICPG/450-564------------------------------IYHFLNNPERVTSNLTVWALYLLFNNS-----------------------
C4R5S7_PICPG/98-201------------------------------PFNIDDNPMYNGSTLCFLGTGLY.YGK-----------------------
CHO2_CLAL4/444-555------------------------------VYRYLNNPEQIFGVCGVMGVTMI.VPT-----------------------
C5DC91_LACTC/106-209------------------------------PFNVSNNPMYHGSTLTFLGTSLY.YGK-----------------------
CHO2_LACTC/450-558------------------------------IYRYLSNPERFLGVAGCWGAVLI.THF-----------------------
C5DZ83_ZYGRC/102-205------------------------------PFNVSSNPMYQGSTLTFIGYTLM.EGK-----------------------
CHO2_ZYGRC/430-538------------------------------IYRYLNNPETILGVAGVWGTVLM.TDF-----------------------
C5G0L0_ARTOC/115-215------------------------------PFNITSAPMYWGSTMSFLAVALY.HGK-----------------------
C6WWJ2_METML/43-146------------------------------PFRISRNPIYLAMTGMYLGISFF.TNS-----------------------
C7YM51_NECH7/94-197------------------------------PFNVTSSPMYTGSTMSFLATALY.FGK-----------------------
CHO2_NECH7/505-609------------------------------IYRFLNNPDRFFGTAGVWGAALI.TWS-----------------------
CHO2_SORMK/496-600------------------------------IYRFLNNPERVFGTAGLWGAALI.TWS-----------------------
E3I110_RHOVT/77-175------------------------------LYRFSRNPQYVASILGFFGTGLA.NGS-----------------------
D2U841_XANAP/75-178------------------------------PYRYLRHPSYTGALLAFYGLAVG.MGN-----------------------
D2V512_NAEGR/65-168------------------------------PFNVTDNPMYNGSTLWFLGHSLV.KSS-----------------------
D2VYZ6_NAEGR/455-563------------------------------IYRYLNNPEIVLGYCAYFGLALI.SKS-----------------------
D3AX06_POLPA/89-193------------------------------VYQYFNDPQYVGTTISCLGYAIR.YQS-----------------------
D3BED6_POLPA/557-662------------------------------IYRFLNNPDSVLGFAGYYGLSLI.GGS-----------------------
D3BN57_POLPA/99-202------------------------------PFNVMSNPMYNGSTILFLAHALH.GKS-----------------------
CHO2_SCHPO/491-596------------------------------IYRYVNNPERFLGCSAYWGLALI.SSS-----------------------
CHO1_SCHPO/110-213------------------------------PFNVNDNPMYNGSTLCFLSTALR.YGK-----------------------
Q0AM70_MARMM/72-173------------------------------IYRRTRNPQYVGYSGMFLGAAIA.AGS-----------------------
Q0AQW8_MARMM/72-173------------------------------IYRFSRNPQYVGYAAMFFGAAAA.AGS-----------------------
CHO2_PHANO/462-567------------------------------IYRFLNNPERVLGLAGVWGLALI.TWN-----------------------
Q0UN81_PHANO/69-173------------------------------PFNVSEAPMYHGSTLSFLATALW.FGK-----------------------
Q11IW9_CHESB/45-148------------------------------PFSFSRNPIYLGGTLIVIAIGLI.VGN-----------------------
Q1GIY9_RUEST/78-176------------------------------MYEYSRNPQYVTSVLATVGLGIT.TGS-----------------------
A0A0D1CJ51_USTMA/99-202------------------------------PFNVMANPMYWGSSMSFTAVALW.FGK-----------------------
PEMTL_DICDI/82-186------------------------------PYQFFSDPQYVGTTIAALGVAIR.NQS-----------------------
PEM2_DICDI/98-201------------------------------PFNVMNNPMYNGSVMLFIAHALS.YKS-----------------------
Q6C649_YARLI/97-200------------------------------PFNVSNNPMYHGSTLCFLASALW.YAK-----------------------
CHO2_YARLI/531-635------------------------------IYRYLNNPERFFGIAGIWGLALM.TNS-----------------------
CHO2_KLULA/451-559------------------------------IYRYLNNPERVFGVAGIWGTVLI.NNF-----------------------
Q6CV75_KLULA/106-209------------------------------PFNYFDNPMYQGSTFTFLGYALY.NGK-----------------------
Q6FUV4_CANGA/106-209------------------------------PFNVSNNPMYQGSTFSFIGTSLI.AGK-----------------------
CHO2_CANGA/431-540------------------------------IYRYLNNPEAILGVAGVWGSVLM.TDF-----------------------
Q752Z0_ASHGO/100-203------------------------------PFNVSDNPMYQGSTLTFLGTSLY.YGK-----------------------
Q86IF9_DICDI/521-626------------------------------IYRFLNNPDSVTGFAGFYGLSLI.AGS-----------------------
Q8TN26_METAC/121-221------------------------------VYSIVRHPMYAAGLIIFSGTPLA.LGS-----------------------
Q98I61_RHILO/42-146------------------------------IYRHVRNPMYVAVLSIILGQALL.FSS-----------------------
E7QGU3_YEASZ/100-199------------------------------PFNVSNNPMYQGSTLSFLGIALY.KGK-----------------------
F1SB04_PIG/61-160------------------------------PFSVLDNPMYWGSTAVYLGWALM.HAS-----------------------
F7BHJ5_XENTR/62-163------------------------------PFNVMENPMYWGSTANYLGLALL.NAS-----------------------
G1MZ29_MELGA/96-197------------------------------PFSILDNPMYWGSTAVYLGWSLM.HAS-----------------------
CHO2_YEAST/471-577------------------------------IYRYLNHPEAVLGVVGVWGTVLM.TNF-----------------------
CHO2_CANAL/468-576------------------------------VYRYLNNPEQIFGVCGVMGIFLI.YPT-----------------------
Q5KHK0_CRYNJ/121-221------------------------------PFNVLSDPMYVGSFLTHLGTALW.FQS-----------------------
Q8DW48_STRMU/70-169------------------------------PYSIVRNPAYTGTIISILGLAFI.TLN-----------------------
Q8PE74_XANCP/100-199------------------------------PYRWLRHPSYTGALLCFYGMALG.MGN-----------------------

PF07298

B2JUD7_BURP8/3-190ILFP-AAHAPGNH.................FKSIVKHPMTAGVGLWALAHLFV-SAT-----------------------
A1VI53_POLNA/3-190ILLA-AAYVPRNA.................IKARLHHPMVLGVMFWAVAHLLA-NGN-----------------------
Q12HL7_POLSJ/3-190ILLV-ATYVPRNA.................IKATLHHPMLLSVKVWALAHLLA-NGT-----------------------
A2SBS8_METPP/3-190VLLA-AAYVPGNG.................LKAKLHHPMVLSVKVWAFAHLLA-NGT-----------------------
Q223I4_RHOFT/3-190VLLA-AAYVPGNI.................IKERIHHPMVLGVKLWALAHLLA-NGN-----------------------
A1K5T7_AZOSB/6-191VLLV-AAYLPGSH.................IKATLRHPMLAGTALWAFAHLLA-NGT-----------------------
A1WT38_HALHL/3-190ILLF-SAYGPANR.................IRNAVGHPMLLAVALWALAHLMA-NGR-----------------------
A6VV32_MARMS/3-191FFVG-SALVPHTT.................MKKKVGYPMLIAIKIWAFAHLIS-NGS-----------------------
Q0AQE8_MARMM/3-183ILLT-SAYAPGH..................IRRWVRHPMLAGVVVWSGAHLLA-NAE-----------------------
A1AZI2_PARDP/3-180YFFA-ADGMKTR..................ITRHLRHPQLTGFALWAFAHLVP-NGD-----------------------
Q28U80_JANSC/6-185YIYA-VGGPKGDRVW...............LGTKLRHPQLTGYSLWAIAHLLV-NGD-----------------------
Q5LXD7_RUEPO/5-179WMMS-PAGTKGK..................LLHKMRHPMLAGFRAWAAAHLLV-NGD-----------------------
Q1GLH3_RUEST/3-179YFTS-PGPNKGA..................LFHKMRHPMLTGFKIWAVAHLLV-NGD-----------------------
A8LJK3_DINSH/5-184WVYG-SSAAKGAKAW...............PANKIRHPQLTGVKIWALAHLLV-NGD-----------------------
Q169U5_ROSDO/3-182WVYG-SSAAKGAKAW...............PAYKLRHPQLVGFKIWALAHLLV-NGD-----------------------
A0KG00_AERHH/3-186ILFC-SGQGPNH..................LRRWLVHPQLLGTLLWAGAHLAV-NSE-----------------------
Q6N9Q3_RHOPA/31-253QFAA-FGIGAANPLSFGGDPRKPFDPQHPGVVGIVRHPLLWAIGLWAGAHVVP-NGD-----------------------
Q219Y9_RHOPB/14-236LLAA-FGVGAANPLSFGGNPRLAFDPEQPGIVGAARHPLLWAIALWSGAHLVP-NGD-----------------------
Q5LUC0_RUEPO/7-220LLAV-AGLRAVNPLSFGGLGRGVFDPTRPGILALSRHPLLLALALWSGAHLLA-NGS-----------------------
Q0C1Y5_HYPNA/14-233LLVI-GGTAIANPFSLGGLAERAYNPARPGILAVTRHPLLWAMVLWSLAHLIA-NGD-----------------------
Q169M4_ROSDO/6-220LILA-ASIGQPNPFSFGGRDNDAFDPTDCGIIGYMRHPLLSVLALWALLHVLA-NGD-----------------------
A8LNX8_DINSH/42-256VIIA-LTLGRPNPFSFGGARNDIFDPDRPGIVRVTRHPLLLALAIWAGAHLFP-NGD-----------------------
A9CGK0_AGRFC/3-221FFVL-AGLLSVNPLSISVRQ....GQQPGAIVRITRHPVLVGFLFWSLGHVVP-NGD-----------------------
Q2JYB9_RHIEC/5-223FLVI-AGLLSANPLSITLNR....SPNPGAITKITRHPVLWGFAAWASGHIAA-NGD-----------------------
Q92Z13_RHIME/3-221FLVL-AGLFSVNPLSVSIRQ....GQKPGSIVSVTRHPVLWGFAIWALGHLVA-NGD-----------------------
B0U8Q9_METS4/2-221FLIA-AGLFAANPLSVSLRA....GAEPGPVTAVTRHPLMWGFLIWALAHIPP-NGD-----------------------
Q2VYZ8_MAGSA/17-229LFWM-LGLSQKNPFSIGPGGAG.YDPARPGIVRLTRHPIIWGLGLWSAAHILP-NGH-----------------------
Q60BH7_METCA/3-224IFVV-AGLTTPNPTAVSGESVLNDAEAARGILRITRHPFLWGLSLWALVHVIA-NGD-----------------------
A7HZ42_PARL1/3-227FFVV-VGITTPNPTAVGADALADKPDTVKGMLRITRHPFLWGAAIWALWHILV-NGD-----------------------
Q1GUJ7_SPHAL/6-226ILFV-GSLV.GNPALAAPGAEKAAQAAPRGVFAITRHPMMWGFALWALAHVMV-MPT-----------------------
Q2GC12_NOVAD/7-219AFFI-PSFA.GNPVLPGRKAAGLGTVVPTGVFTITRHPMMWAFALWALAHIIV-APT-----------------------
Q8DMH0_THEEB/15-236LFLY-PATFNLLEIAAVQKPE..VHLYETGIIRITRHPQLWGQLIWCVAHTLW-LGT-----------------------
Q113R6_TRIEI/12-233LFLY-PSTFNLLEIAAIQKPQ..VHLHETGIIRITRHPQMVGQVIWCIAHTLW-LGT-----------------------
Q8YQ81_NOSS1/13-234LFLY-PATFNLLEIAAIQKPQ..VHLYETGIIRITRHPQMVGQVIWCIAHTLW-LGT-----------------------
Q9ALA6_SYNE7/12-229LLLY-PATFNLLEIAAIAQPQ..VRLYETGITRITRHPQTFGQILWCLAHSLW-LGT-----------------------
Q7V3C9_PROMP/9-231LFLY-PATYNLLEIPSVLKPQ..VRIYGTGIMRITRHPQAFGQIIWCLAHTLW-IGT-----------------------
A9CI20_AGRFC/3-191ICLI-ASLIPAGH.................IATKTKHPLILSVKIWALAHLLA-NGE-----------------------
Q92UK4_RHIME/3-191IVLA-AGFLPAGR.................IAVALKHPQVLSIKIWALAHLLA-NGE-----------------------
Q89MZ5_BRADU/5-191ILVV-ASYLRGR..................IYATLKHPMLAGIKLWAAAHLLA-NGD-----------------------
A7IF98_XANP2/3-187IALV-ASEVPSH..................IKAWLKHPMLVAVKIWALAHLLA-NGD-----------------------
B0UL45_METS4/3-192VAFA-AAYLPGR..................IKGALKHPMLAGVKIWAAAHLLA-NGD-----------------------
Q0C445_HYPNA/3-190ILLA-AAYTPTGR.................IRKAVKHPMLVAVKIWAFGHLLA-NGE-----------------------
Q3JDP5_NITOC/3-187ILFL-APYFPGR..................INNTVKHPQLVAVMIWAVAHLLV-NGT-----------------------
Q9AAA0_CAUCR/3-186ILLP-TANAPAGR.................IKATLRHPMLLGVILWSAGHLLV-NGD-----------------------
Q11KH3_CHESB/3-188PLMA-ASHRPGR..................ISTAVGHPMLLGTVIWGLAHLLA-NGT-----------------------
B4EFU3_BURCJ/3-190VLIA-ASYVPRNR.................IKTLVGHPMLAGVMVWAVAHLLV-NGT-----------------------
C5B332_METEA/3-195ISLA-AAYLPGH..................LRARLKHPMLLAVKIWATAHLLA-NGD-----------------------
Q2JMU2_SYNJB/23-239FFLY-PATFNLLEIAAIRKPE..IHLFETGIIRITRHPQMVGQVIWCVAHTLW-IGS-----------------------
Q2K5L0_RHIEC/3-191ICLV-ASLLPAGH.................IATRTKHPMVLSVKIWALAHLLA-NGE-----------------------
Q3SR07_NITWN/1-185ILVV-ASYIRGR..................IYAKLKHPMLAGIKLWATAHLLA-NGD-----------------------
Q46HM6_PROMT/12-228LFLY-PATYNLLEIPAVLKPK..VRIYATGIIRVTRHPQAIGQIIWCFAHLLW-IGT-----------------------
Q63MK0_BURPS/3-190VLLV-AAYVPGTR.................IKALVGHPMLAGVMVWAGAHLLA-NGT-----------------------

PF02544

Q19605_CAEEL/97-243KIPT.GF-----------------------LYEYISCPNYAGEIMEWIGYSILA--------------------------
YN67_SCHPO/146-295VIPT.GY-----------------------GFNLVSFPNYFFESLGWLFFALLT--------------------------
Q20344_CAEEL/97-243KIPT.GF-----------------------LYEYISCPNYFGEIMEWIGYAILG--------------------------
S5A1_RAT/110-259KIPR.GG-----------------------LFEYVSAANYFGELVEWCGFALAS--------------------------
S5A2_HUMAN/105-254RIPQ.GG-----------------------LFTYVSGANFLGEIIEWIGYALAT--------------------------
PORED_CAEEL/189-309GICF.GG-----------------------WFNLVSCPHFLFEICIYLSLFLVI--------------------------
Q23431_CAEEL/103-253SIPR.GH-----------------------YFEYISCPNYFGECLQWIGYALAA--------------------------
DET2_ARATH/111-262VIPR.GG-----------------------WFELVSCPNYFGEAIEWLGWAVMT--------------------------
TECR_YEAST/154-310RVPLNQG-----------------------IFNLFVAPNYTFEVWSWIWFTFVF--------------------------
S5A1_HUMAN/110-259KIPR.GG-----------------------LFEYVTAANYFGEIMEWCGYALAS--------------------------

PF06966

YJD4_SCHPO/67-320GFNA-TG-----------------------LFRWSRHPNFLAEQLIWLSFYLFGAIA--------------------..S
Q10E47_ORYSJ/24-252.WCN-VG-----------------------LWSYTRHPNYFGEIFLWWGIFVASTPV--------------------..L
Q8PAZ9_XANCP/20-250.TCR-TG-----------------------LWRYSRHPNYFFEFVHWFAYLALAVGA--------------------..G
Q9A3U2_CAUCR/70-299.VMD-KG-----------------------LWRYTRHPNYFGDACVWWGLYLIAAET--------------------..G
Q9VSM5_DROME/25-264.FCN-DG-----------------------LWSVSRHPNYFGEVVIWWGIFAISLNV--------------------..I
Q9CHY6_LACLA/17-245.LLT-SG-----------------------LWSLTRHPNYFGESMCWWGIFLISLTT--------------------..L
Q7CY59_AGRFC/19-248.VCE-TG-----------------------LWRYSRHPNYFFEWLFWCSFPLLAIQE--------------------...
O81042_ARATH/64-303PNLD-SG-----------------------LWRYSRHPNYLGEQLWWWGLVIFAWNL--------------------..G
O53731_MYCTU/17-243.IMD-RG-----------------------LWAWTRHPNYFGDACVWWGLWLITIND--------------------..W
Q8Y9D9_LISMO/16-244.LLT-SG-----------------------FWSVTRHPNYFGEALSWWGVFLVALTQ--------------------..L
Q984A1_RHILO/21-257.VCD-VG-----------------------LWRLSRHPNYFFEWLGWLAYMAIAIGS--------------------PWA
B9DFE9_ARATH/24-252.WCD-VG-----------------------VWKYSRHPNYFGEMLLWWGIFVAASPV--------------------..L

PF01222

LBR_CHICK/175-609GLLV-TG-----------------------WWGFVRHPNYLGDIIMALAWSLPCGFN.......................
ERG24_NEUCR/17-490RLIT-SG-----------------------WWGIARHINYLGDWLQSWPYSLPTGIAGYQILSAGSNAPGAITMLDGREV
STS1_SCHPO/7-453TLLT-SG-----------------------WYRYARKIHYTADFFQSLSWALITGFQ.......................
ERG4_YEAST/34-473YLLI-DG-----------------------WYTLARKIHYTADWTQSLVWALSCGFN.......................
ERG24_YEAST/8-438KLLC-DG-----------------------WWAKSQHINYFGDWLISLSWCLATWFQ.......................

PF04140

Q9EWQ7_STRCO/75-167-----WLTAAVFTAANAMLLT.VRLRCEN---------------------------------------------------
Q99YI2_STRP1/81-173-----KITAMLLFPCYIVVIY.LRIREEN---------------------------------------------------
P91402_CAEEL/171-267-----..ICCVVYAYVTWHFFASRIYDEE---------------------------------------------------
Q9KF68_BACHD/72-166-----YVTAFLFSLLNAIVLY.IRIHTEE---------------------------------------------------
MAM4_SCHPO/121-215-----..VSTLLFSLVLWKFFSQRITTEE---------------------------------------------------
Q9CM58_PASMU/75-167-----KYTALIGLPIYLLILG.VRIKQEE---------------------------------------------------
ICMT_HUMAN/161-257-----..ICGVSYALTVWRFFRDRTEEEE---------------------------------------------------
STE14_YEAST/123-219-----..LSLVIFIFVLWKFFSDRIRVEE---------------------------------------------------
Q9RTL5_DEIRA/91-184-----WRTAVAFSLLNAALLLGVRIPAED---------------------------------------------------
B6IT05_RHOCS/73-163-----WEIALVFSFLNAALLF.HRIRQEE---------------------------------------------------
F7EBZ7_XENTR/175-268-----..LCLFGYTFASWRFFRERIEEEE---------------------------------------------------
Q2G1E3_STAA8/100-189-----TYTTILLVP.YAYFLY.VRIKQEE---------------------------------------------------

PF04191

Q5KDE7_CRYNJ/603-709-----KLV.FALALASHLSHWWFLTFVER---------------------------------------------------
A4HJV7_LEIBR/438-543-----PVV.LVVSVVSHAAAKMFEAIVEE---------------------------------------------------
PEMT_HUMAN/89-192-----PTG.LLLTVLVALTYIVALL.YEE---------------------------------------------------
CHO2_ASPCL/504-608-----GAI.TFLALLSHTLTLAFIQFVER---------------------------------------------------
A1CQK4_ASPCL/70-170-----AAG.LLLTAEVFIVYWFALQ.WED---------------------------------------------------
A3LQ40_PICST/106-209-----PAG.IAVAGFVFVMYKIALL.FEE---------------------------------------------------
CHO2_PICST/449-558-----VEN.LVCCFLWVANNFVRINFIER---------------------------------------------------
A4HJL2_LEIBR/106-210-----AVG.VLLTGLVALVYHVSTRYFES---------------------------------------------------
CHO2_MAGO7/497-601-----RAI.FVLALISHLLTLAFISYVEK---------------------------------------------------
CHO2_PICGU/462-570-----LEN.FVCCLLWVSNNFFRINFVEK---------------------------------------------------
CHO2_LODEL/480-589-----FEN.LTCCVLWVLSNFIRINFIEK---------------------------------------------------
A5UZK8_ROSS1/43-144-----II..ALVLSVALLVFFHLKSRREE---------------------------------------------------
A7TIE1_VANPO/140-243-----SAG.LLVAFMVQTMYNLALK.LEE---------------------------------------------------
CHO22_VANPO/452-560-----CYENIILAIIWTSTNFIFVKFIEK---------------------------------------------------
CHO21_VANPO/439-547-----SKTNVTLAVLWTVTNLIFVKLIEE---------------------------------------------------
A8NIW8_COPC7/92-195-----PAG.LFISAYVYIVYRIALL.FEG---------------------------------------------------
CHO2_MALGO/537-642-----LTA.TVVAQLAHLSHWWFLGCVEG---------------------------------------------------
A8PVU2_MALGO/102-205-----PSG.LLLSVLVWVTYRVALC.FES---------------------------------------------------
A9B4Y9_HERA2/33-137-----AISNLVLVIAFVIIVDRWYIAFEE---------------------------------------------------
A9V3D6_MONBE/125-229-----PVG.VVLGAVVFWWYYMAAL.YEE---------------------------------------------------
CHO2_LACBS/492-596-----KLV.LSLAVIRHLANWWFLSSVEN---------------------------------------------------
B1MLL6_MYCA9/108-208-----YW..GLLATVPAAAALVVRIIDEE---------------------------------------------------
B1WZT5_CYAA5/96-194-----WM..VMITDTGLALWFFLAPFTEE---------------------------------------------------
B2AR50_PODAN/95-198-----PAG.ILLTLHVLIVYIIAIQ.FEN---------------------------------------------------
CHO2_PODAN/496-600-----KAV.FVMALVSQLLMLGFISFVEK---------------------------------------------------
B2JAT8_NOSP7/42-145-----LWA.LLLLFPLLVIVQIGIVQREE---------------------------------------------------
B2VTC6_PYRTR/87-190-----PAG.ILLTGLVAVAYSIACK.WED---------------------------------------------------
CHO2_PYRTR/425-530-----PAV.FYVATTAHILNLAFLQFVEK---------------------------------------------------
B3RI13_TRIAD/89-192-----PCG.IIMSGFVYLVYWIGLL.LEE---------------------------------------------------
CHO2_SCHJY/478-583-----SWI.FFLALLAQVSTLGIIRFVEK---------------------------------------------------
B6QQY2_TALMQ/89-189-----VAG.LLLTLEVFVLYWFALR.WED---------------------------------------------------
B8LBH8_THAPS/30-132-----VL..RMLLTVVLYFVLDVKSDYEE---------------------------------------------------
B8PB22_POSPM/91-194-----PAG.LLITFYVYAVYLIALR.FEG---------------------------------------------------
CHO2_PICPG/450-564-----NKIFLVIALLFTMNNLIVLNFIEK---------------------------------------------------
C4R5S7_PICPG/98-201-----PAG.VFASLVVYLMYQIALK.FEE---------------------------------------------------
CHO2_CLAL4/444-555-----YDN.FMICLLWMLNNFFRINFVER---------------------------------------------------
C5DC91_LACTC/106-209-----AAG.VFATVLVNLVYNIAQQ.FEE---------------------------------------------------
CHO2_LACTC/450-558-----SPYNLILAALWTAANIALVKLVEE---------------------------------------------------
C5DZ83_ZYGRC/102-205-----AAG.LLLSFMVYSMYYFALK.FEE---------------------------------------------------
CHO2_ZYGRC/430-538-----SWENIALACLWSGCNFIIVKFIEQ---------------------------------------------------
C5G0L0_ARTOC/115-215-----PAG.LLLTAEVFICYKIACL.WEE---------------------------------------------------
C6WWJ2_METML/43-146-----LWS.LVLLVPLLSVMHWGVIFREE---------------------------------------------------
C7YM51_NECH7/94-197-----PAG.ILLTVWVYIVYKIALL.YED---------------------------------------------------
CHO2_NECH7/505-609-----RSI.FLMALVTQILTVFYISYIER---------------------------------------------------
CHO2_SORMK/496-600-----RAI.FLMALAGHFLTLAFLAYVEK---------------------------------------------------
E3I110_RHOVT/77-175-----AQ..SAVLCGLAILVYVVLPYTEE---------------------------------------------------
D2U841_XANAP/75-178-----VLS.LLAIVLPVTWVFVHRIRIEE---------------------------------------------------
D2V512_NAEGR/65-168-----PAG.ILMAICVFVMYKFACL.FEE---------------------------------------------------
D2VYZ6_NAEGR/455-563-----YAV.LGLAILSQFATYLFVKFVEK---------------------------------------------------
D3AX06_POLPA/89-193-----ING.FICTAAMGLVFYISVKFVEG---------------------------------------------------
D3BED6_POLPA/557-662-----LPL.FAIAISSQVANFLFVKYVEH---------------------------------------------------
D3BN57_POLPA/99-202-----VAG.IFLSLIVFITYRIALT.FEE---------------------------------------------------
CHO2_SCHPO/491-596-----AWI.FLIAILAQLSNLAIIRLVEQ---------------------------------------------------
CHO1_SCHPO/110-213-----VAG.LLLTLEVFFVYRIALK.FEE---------------------------------------------------
Q0AM70_MARMM/72-173-----GLA.MLSALVFTAIIHVFITWVEE---------------------------------------------------
Q0AQW8_MARMM/72-173-----ILA.LTSSALFALIIHVFITRVEE---------------------------------------------------
CHO2_PHANO/462-567-----PPI.FYLAATAHILNLAFLQFVER---------------------------------------------------
Q0UN81_PHANO/69-173-----PAG.VLLTGVVAVAYGVARR.WED---------------------------------------------------
Q11IW9_CHESB/45-148-----AWF.LLFALLAAFATQKLAIEPEE---------------------------------------------------
Q1GIY9_RUEST/78-176-----WT..TVALALVLFALYFLFVLNEE---------------------------------------------------
A0A0D1CJ51_USTMA/99-202-----PAG.LLLSVLVVIVYALALR.FEE---------------------------------------------------
PEMTL_DICDI/82-186-----IYG.FLCTILVGVVFYISATFVET---------------------------------------------------
PEM2_DICDI/98-201-----VAG.LVLSFVVYVVYKFALI.FEE---------------------------------------------------
Q6C649_YARLI/97-200-----PAG.LLITAFVSLMYSIALK.FEE---------------------------------------------------
CHO2_YARLI/531-635-----PGV.GILAFLWTLEGMAFIKFVEQ---------------------------------------------------
CHO2_KLULA/451-559-----SNWNLWLATTWTMFNWFTVKFIET---------------------------------------------------
Q6CV75_KLULA/106-209-----PAG.LIATLVVHVMYNIALR.FEE---------------------------------------------------
Q6FUV4_CANGA/106-209-----PAG.LILAFFVHAMYYMALK.FEE---------------------------------------------------
CHO2_CANGA/431-540-----AWENIALGMLWTATNFVLVKFIET---------------------------------------------------
Q752Z0_ASHGO/100-203-----AAG.VFAALLVNLMYTMALK.LEE---------------------------------------------------
Q86IF9_DICDI/521-626-----FPL.FALSIFSQVANFLFIKFVEK---------------------------------------------------
Q8TN26_METAC/121-221-----WW..GLLILVPIMLVIIWRLLEEE---------------------------------------------------
Q98I61_RHILO/42-146-----WTL.VAYAVIGAVVMGSFVRFYEE---------------------------------------------------
E7QGU3_YEASZ/100-199-----PAG.LVVSAVVYFMYKIALR.WEE---------------------------------------------------
F1SB04_PIG/61-160-----PTG.LLLTLVVAAIYKLAIL.FEE---------------------------------------------------
F7BHJ5_XENTR/62-163-----PAG.LLLTALVALCYKVAIL.YEG---------------------------------------------------
G1MZ29_MELGA/96-197-----PAG.LLLTAVVAISYTIAVL.YEG---------------------------------------------------
CHO2_YEAST/471-577-----AVTNIILAVLWTLTNFILVKFIET---------------------------------------------------
CHO2_CANAL/468-576-----VEN.FVCVGLWVVNNFIRINFIEK---------------------------------------------------
Q5KHK0_CRYNJ/121-221-----PAG.IVLAAWVWIVYAVALK.FEG---------------------------------------------------
Q8DW48_STRMU/70-169-----IFN.ILIVFIILSIGYAIRIRTEE---------------------------------------------------
Q8PE74_XANCP/100-199-----ALS.LLVIVLPVTWVFLRRIRVEE---------------------------------------------------

PF07298

B2JUD7_BURP8/3-190-----LHAVVLFGAFLVWAVFDYAAARRR.......DRA.EGVVYPGGTLSR..................DVMPVVAGVV
A1VI53_POLNA/3-190-----RAHVLLFGSFLVWAGLSFRAARAR.......DRA.ALAVYPAGTASG..................TLMAVLAGMA
Q12HL7_POLSJ/3-190-----LAGVVLFGSFLVWAVVCFKAARGR.......DRV.AQTVYPPGTATG..................TAITMAVGLV
A2SBS8_METPP/3-190-----LADVLLFGGFLVWAVLCFRAARGR.......DRA.TGVATPPGRAGA..................TAITVVVGAV
Q223I4_RHOFT/3-190-----LGHVVLFGSFLAWAIVDFTASRRR.......DRT.LGTRYPGGTAGA..................TGITVALGVG
A1K5T7_AZOSB/6-191-----LADLLLFGGFLAWSATDFVSARRR.......EPT.SRITRPALKV....................DATAVLLGIV
A1WT38_HALHL/3-190-----LGDLVFFGAFLAWASVTFVAARER.......DRR.QAASPTPAQRWG..................NAWAIGGGLI
A6VV32_MARMS/3-191-----LADVILFGSFLVWSIVSFAVYRRR.......DRK.AGVVRDQESGVQF.................DLAAFTFAMV
Q0AQE8_MARMM/3-183-----ASAVLLFGSFFVWSLVTFIAACLR............ETPPPVVKGWGG.................DLTAIVLGLI
A1AZI2_PARDP/3-180-----LPSFVLFGGLLVWALVEMVVINRA.......QPD.WTPPAGPFPARK..................EIMAVAGAVV
Q28U80_JANSC/6-185-----TPSFVLFGGLLVWALGSVVAINAA.......EGP.WT.PPNRAPKRK..................ELTYVIATVV
Q5LXD7_RUEPO/5-179-----LASIILFGGLFLWGIVEVAAINAA.......EPE.WT.PGEPGTLGK..................DAMFLVASVV
Q1GLH3_RUEST/3-179-----LASVILFGGLLAWAVVEVITINKS.......EPN.WQ.PNPKGSLAK..................DAMFFVASIV
A8LJK3_DINSH/5-184-----LASIVLFGGLLAWAVGEVILINKA.......EPD.WT.PPETAGMKT..................KIRLAVITVV
Q169U5_ROSDO/3-182-----LASIILFGGLLGWAVGSVILINKA.......EPE.WT.APERAGMAT..................RVRLAIITLV
A0KG00_AERHH/3-186-----ARSLVLFGGIGLWALVSIVWISVR.........D.WQRHPRPVANWYG.................TGLSVGAGLA
Q6N9Q3_RHOPA/31-253-----LAHVLLFGFFAMIAVIGMLIIDRR.KRR.QLGAERWAELAARTSFWPFAALISGR..FRPQTWRISSLRLCIGLA
Q219Y9_RHOPB/14-236-----LAHALLFGFFALIALAGMVMIDRR.KQR.RLGYEAWHALARNTSFWPFAALLQGR..FRPRSYGVDAKRLAIALV
Q5LUC0_RUEPO/7-220-----LAHVILFGLFAGFAVMGMALIDRR.KRR.ELGAD.WARLAAGTARLSPRGL..........PALLAPRVLWPAAL
Q0C1Y5_HYPNA/14-233-----LAHVLLFGSLGVFSVVGILAMETR.SRM.RGGAL.WSQMIRGTSLVPFAALLTG....NARWRELLQLRMLLLPV
Q169M4_ROSDO/6-220-----LAHVLLFGTLGLFAYVGPRIIDAR.NRR.DMGAEAWEALVGETRRQRRIRV..........PSPAMMLRLGAGVI
A8LNX8_DINSH/42-256-----LAHVILFGTFAAFALLGGRLVDRR.ARR.TLGSQ.WSPLLQKSRQTPVFRAF.........PLGESLLRLGLGVV
A9CGK0_AGRFC/3-221-----LRSVILFGGFALFSLGGMAMTEKR.ARK.RLGNA.WNATAAGSATVPFAAILSGKT.RIAVDGPMLLAAALTGLT
Q2JYB9_RHIEC/5-223-----LRSLLLFGGFAVFALGAISMTDKR.AKR.RLGVS.WTRLAEHTSIWPFGACFKGEQ.PRLDVPMLLAGLASAVMV
Q92Z13_RHIME/3-221-----VRSLILFGGFALFALGTIPMIEKR.ARR.RLGDQ.WQRQSAKTSILPFAALFTGRTRLSGDTPIATATVATAVLT
B0U8Q9_METS4/2-221-----LVSVVLFGGMAAFSLAGFALLDAK.ARR.RLGAERWRALSRGTSVVPFAAILAGR..ARLGPVRPLLPAAAAALA
Q2VYZ8_MAGSA/17-229-----LAGLLLFVPLLLLCLVGPRILDAK.RRK.SLGDRHWREMAERAVFEPRALL...........AELGWARICGGLA
Q60BH7_METCA/3-224-----VAALLLFGSLLALCLAGTRSIDAK.RRR.TYGDR.WERFAAATSNVPFMAIKEGR..NRLELGEIGWQRLGIAVA
A7HZ42_PARL1/3-227-----KASIIFFGTFALLAILGTFSIDDK.KRK.RMGES.WTAFAARTSNLPFAAIFAGR..NQLKLGELGWWRILAALI
Q1GUJ7_SPHAL/6-226-----PGQIVLSATIAFLALAGSAGQDVK.KAR.LMGDA.WRGWAARTSFVPFARQVGGA..APWADAMPRAHALLGGII
Q2GC12_NOVAD/7-219-----GRSLIFMSGMIVLALLGSHFQDKR.KIA.GNNRE.FAPWQRRTSYWPRLDK...........LGAIGLIWLLAAL
Q8DMH0_THEEB/15-236-----SFTLLTSLGLIAHHCFGVWHGDRR.WYA.RHGEA.FAALKNRTSIIPFKAIWEGK...QQLVWQEFLRPAYGGVV
Q113R6_TRIEI/12-233-----SFTFVTSVGLILHHLFGVWHGDRR.LQK.RFGES.YDQLKSRTSVIPFLAIIQGR...QTLHLQEFIRWAYLGIG
Q8YQ81_NOSS1/13-234-----SFTLVTSFGLILHHLFGVWHGDRR.MSK.RYGEA.FEIVKQRTSIIPFAAIIDGR...QSIKWEEFIRPAYLGVA
Q9ALA6_SYNE7/12-229-----SFMMVASAGLIAHHLFSIWHGDRR.LQK.RYGEA.FEALKSRTSIIPFLAIAQGK...QTLVWKEFLRPAYLGVA
Q7V3C9_PROMP/9-231-----SFTFITSIGLILHHLFAIWHGDKR.LEI.KFGEE.FYKYKESTSIIPFVAIFDGR...QQIKLKEFFKLSQIGIL
A9CI20_AGRFC/3-191-----TSSILLFASFLAWGVVMRISLKRR.......ERA.GEKVVRDFVSSRY.................DLVAIVGGIV
Q92UK4_RHIME/3-191-----TSSVLLFGSFLAWAVILRISLKRR.......ERA.GEKVLPVFKSARN.................DVLAVVIGLV
Q89MZ5_BRADU/5-191-----LGSIILFGSFLGWAVFDRISLKHR.......TDA.GGPPIPVGGVSN..................DLIAVAVGVV
A7IF98_XANP2/3-187-----VASIVLFGSVLAWAVYDRIAVKRR.......GDP.LPVAPNNYAG....................DALVVGGGLV
B0UL45_METS4/3-192-----LGSILLFGSILAWAVAARISVKRR..DE.VKAHA..GPAAAPAGWRN..................DALAVGIGVV
Q0C445_HYPNA/3-190-----LNSVILFGSFLGYAVIDRIALKKR.......GDN.GPAPDAPVSAMG..................DIAAVGIGVA
Q3JDP5_NITOC/3-187-----LADLLLFGSFLLWAIVDRISMMNR.......ATR..SVPSVPQSKAN..................DIIVVVVGLA
Q9AAA0_CAUCR/3-186-----QASVLLFGAFLVWAVVDLFSAIGR.......KEP.APVVVKPRA.....................DLTAVLGGTV
Q11KH3_CHESB/3-188-----LADLLLFGGIAVWGTVDWVSSVQR.......PRE..PVAKGKPSPRN..................DVMAVVGGLV
B4EFU3_BURCJ/3-190-----VHAVVLFGAFFVWSIVDFVVSRAR.......DRS.DGVRYPAGGLAG..................DLATVAAGLV
C5B332_METEA/3-195-----LGSILLFGSFLAWAVVARISAKRRALTAGQVAQQ.HGGQAAPAGWRN..................DAIAVVVGVV
Q2JMU2_SYNJB/23-239-----SFMVVTSLGLIAYHLFAVWHGDHR.LER.KYGQA.FRDLKARTSVIPGLAILQKR...QQLRPQEFFRWAYLGVF
Q2K5L0_RHIEC/3-191-----TSSVLLFAAFLAWGVIVRISLKRR.......ERA.GEITLRPFVSAKY.................DLYALVIGIV
Q3SR07_NITWN/1-185-----LGSIILFGSILAWAVIDRISLKHR.......SDP.GGLPIPVGGVRN..................DVIAIVVGVV
Q46HM6_PROMT/12-228-----SFTLVTCLGLIAHHLFAIWHGDRR.LSL.KFGQE.FEDVKKRTSVVPFLAVLDGR...QKLQIKEFLRPSQMGIL
Q63MK0_BURPS/3-190-----LHAELLFAAFFVWAFVDFIASRAR.......DRR.DGVRYPAGSLAR..................DGVAIAVGLL

PF02544

Q19605_CAEEL/97-243-----WNLPALAFAI...FTIANIGPRAV--------------------------------------------AHHKWYK
YN67_SCHPO/146-295-----KSWASWIFLF...VGSAQMFVWAK--------------------------------------------KKHARYL
Q20344_CAEEL/97-243-----WNLPALAFAI...FTFANIGPRAI--------------------------------------------AHHNWYK
S5A1_RAT/110-259-----WSLQGVVFAL...FTLSTLLTRAK--------------------------------------------QHHQWYH
S5A2_HUMAN/105-254-----WSLPALAFAF...FSLCFLGLRAF--------------------------------------------HHHRFYL
PORED_CAEEL/189-309-----P..DAYVYRFIIMFVCINQTFAAL--------------------------------------------ITHSWYH
Q23431_CAEEL/103-253-----RSFPAIAFAF...FIVCNLAPRAM--------------------------------------------SHHKWYQ
DET2_ARATH/111-262-----WSWAGIGFFL...YTCSNLFPRAR--------------------------------------------ASHKWYI
TECR_YEAST/154-310-----K......FNL...FAVLFLTVSTA--------------------------------------------QMYAWAQ
S5A1_HUMAN/110-259-----WSVQGAAFAF...FTFCFLSGRAK--------------------------------------------EHHEWYL

PF06966

YJD4_SCHPO/67-320ESLLNWTIFA..WLGLVGVFQGSTRLTEK--------------------------------------------MSCEKY.
Q10E47_ORYSJ/24-252SGAEWLVILGPVFLTLLLLFVSGIPLLEA--------------------------------------------SADKRFG
Q8PAZ9_XANCP/20-250PWLLALCALGPVVMFVFLYRFTGIPYTEQ--------------------------------------------QALRSRG
Q9A3U2_CAUCR/70-299LGA..WALPGPLLMTFLLTKWSGVPTTEG--------------------------------------------KMRK...
Q9VSM5_DROME/25-264SGHEWVAIASPIFTTMIILFLSGIPLRER--------------------------------------------SADEKYK
Q9CHY6_LACLA/17-245STL..WLVISPLLITSLLLFVSGVPILE.--------------------------------------------...KKYK
Q7CY59_AGRFC/19-248QVLSWASLAAPVMMYWLLVHVSGIPPLEE--------------------------------------------HMLKSRG
O81042_ARATH/64-303QG...WTLIGALVNTLCLVYVT.I.LVER--------------------------------------------RMVKQQY
O53731_MYCTU/17-243APL..ATVGSPLLMTYLLVDVSGARLTE.--------------------------------------------...RYLK
Q8Y9D9_LISMO/16-244TDL..WLITSPIVITLLLLFVSGVPLLE.--------------------------------------------...KKYQ
Q984A1_RHILO/21-257YPWGFAALAGPILMYWLLVHVSGIPPLEA--------------------------------------------HMLRSRG
B9DFE9_ARATH/24-252EGAEYLVIFGPLFLTLLLLFVSGIPLLEA--------------------------------------------SADKKHG

PF01222

LBR_CHICK/175-609.........HILPYFYVIYFICLLVHREA--------------------------------------------RDEHHCK
ERG24_NEUCR/17-490VQGEARGWGIVFTYFYILYFAILLIHRDL--------------------------------------------RDDEKCS
STS1_SCHPO/7-453.........SPLPYFYPCFFFVVLVHRVS--------------------------------------------RDIKKCK
ERG4_YEAST/34-473.........SVFPWFFPVFFLVVLIHRAF--------------------------------------------RDQAKCK
ERG24_YEAST/8-438.........TPLTYYYSLYFATLLLHRQQ--------------------------------------------RDEHKCR

PF04140

Q9EWQ7_STRCO/75-167--------TALA-----Q------
Q99YI2_STRP1/81-173--------KLLA-----E------
P91402_CAEEL/171-267--------KDLI-----S------
Q9KF68_BACHD/72-166--------EALQ-----A------
MAM4_SCHPO/121-215--------AYLV-----S------
Q9CM58_PASMU/75-167--------SAMA-----H------
ICMT_HUMAN/161-257--------ISLI-----H------
STE14_YEAST/123-219--------KYLI-----E------
Q9RTL5_DEIRA/91-184--------RALA-----E------
B6IT05_RHOCS/73-163--------RALA-----.------
F7EBZ7_XENTR/175-268--------FSLI-----H------
Q2G1E3_STAA8/100-189--------KLMN-----.------

PF04191

Q5KDE7_CRYNJ/603-709--------PHMQ-----RLYGKR.
A4HJV7_LEIBR/438-543--------PHMR-----KHYGD.Q
PEMT_HUMAN/89-192--------PFTA-----EIYRQKA
CHO2_ASPCL/504-608--------PHMQ-----KLYGR.S
A1CQK4_ASPCL/70-170--------PFTA-----EIYAKRE
A3LQ40_PICST/106-209--------PFTA-----KIYAARD
CHO2_PICST/449-558--------WHMI-----KVYGEQE
A4HJL2_LEIBR/106-210--------PFTA-----MIYSKRG
CHO2_MAGO7/497-601--------PHMQ-----KIYGQ.S
CHO2_PICGU/462-570--------VHMI-----KVYGEKE
CHO2_LODEL/480-589--------WHMI-----RLYGEQE
A5UZK8_ROSS1/43-144--------RWLV-----ERY.PEY
A7TIE1_VANPO/140-243--------PFTA-----QIYAKRD
CHO22_VANPO/452-560--------PHVS-----KIYG.NE
CHO21_VANPO/439-547--------PHVS-----KVYG.NG
A8NIW8_COPC7/92-195--------PFTD-----MIYSNRA
CHO2_MALGO/537-642--------PHMR-----RLYGA.D
A8PVU2_MALGO/102-205--------PFTA-----NIYREAA
A9B4Y9_HERA2/33-137--------RAML-----AKFGEQY
A9V3D6_MONBE/125-229--------PLMV-----EMYKKDL
CHO2_LACBS/492-596--------PHMR-----KLYGD.S
B1MLL6_MYCA9/108-208--------KMLR-----HDL.QGY
B1WZT5_CYAA5/96-194--------PWLQ-----ERYGEEY
B2AR50_PODAN/95-198--------PFTS-----GIYAKRE
CHO2_PODAN/496-600--------PHMQ-----KIYGQ.N
B2JAT8_NOSP7/42-145--------NYLE-----RKFGDEY
B2VTC6_PYRTR/87-190--------PFTS-----MIYQKRE
CHO2_PYRTR/425-530--------PHVI-----KLYGE.N
B3RI13_TRIAD/89-192--------PYTE-----EIYRQKN
CHO2_SCHJY/478-583--------PHMQ-----RIYGS.G
B6QQY2_TALMQ/89-189--------PFTA-----EIYAKRE
B8LBH8_THAPS/30-132--------TLLV-----ESYGKEY
B8PB22_POSPM/91-194--------PFTD-----MIYSNRA
CHO2_PICPG/450-564--------PHMV-----KLYGEQN
C4R5S7_PICPG/98-201--------PFTA-----KIYAKRE
CHO2_CLAL4/444-555--------SHMI-----KIYGERE
C5DC91_LACTC/106-209--------PFTA-----QIYAKRD
CHO2_LACTC/450-558--------PHVS-----KVYG.TS
C5DZ83_ZYGRC/102-205--------PFTA-----MIYAKRD
CHO2_ZYGRC/430-538--------PHMA-----KLYG.DN
C5G0L0_ARTOC/115-215--------PFTV-----EIYSKRD
C6WWJ2_METML/43-146--------RYLA-----KQFGQAY
C7YM51_NECH7/94-197--------PFTS-----GIYAKRE
CHO2_NECH7/505-609--------PHMQ-----KIYGR.S
CHO2_SORMK/496-600--------PHMQ-----KVYGR.N
E3I110_RHOVT/77-175--------PWLE-----RAYGDVY
D2U841_XANAP/75-178--------TMLT-----EAFPLDY
D2V512_NAEGR/65-168--------PFTA-----MIYAKRD
D2VYZ6_NAEGR/455-563--------PHMD-----KIYGAKN
D3AX06_POLPA/89-193--------PHMN-----RIYENKN
D3BED6_POLPA/557-662--------PHMK-----KLYGT.K
D3BN57_POLPA/99-202--------PFTA-----HIYSKRT
CHO2_SCHPO/491-596--------PHMQ-----KVYGN.T
CHO1_SCHPO/110-213--------PFTA-----KIYAARD
Q0AM70_MARMM/72-173--------PHMR-----RTFGDAF
Q0AQW8_MARMM/72-173--------PHLD-----RVFAAAY
CHO2_PHANO/462-567--------PHMQ-----RLYGR.K
Q0UN81_PHANO/69-173--------PFTG-----EIYAKRE
Q11IW9_CHESB/45-148--------RHLA-----QHFGKRY
Q1GIY9_RUEST/78-176--------RWLL-----KGYGKAF
A0A0D1CJ51_USTMA/99-202--------PFTA-----NIYKQAE
PEMTL_DICDI/82-186--------PHLK-----NIYSNRS
PEM2_DICDI/98-201--------SFTN-----YIYSTAA
Q6C649_YARLI/97-200--------PFTG-----EIYAKRD
CHO2_YARLI/531-635--------PHMQ-----RIYGT.S
CHO2_KLULA/451-559--------PHLL-----KVYG.TK
Q6CV75_KLULA/106-209--------PFTA-----KIYAKRA
Q6FUV4_CANGA/106-209--------PFTA-----EIYAKRD
CHO2_CANGA/431-540--------PHVS-----KVYGPSA
Q752Z0_ASHGO/100-203--------PFTA-----MIYAKRD
Q86IF9_DICDI/521-626--------PHMK-----RLYGS.K
Q8TN26_METAC/121-221--------KFLS-----ENL.PGY
Q98I61_RHILO/42-146--------PTLA-----RRYGADY
E7QGU3_YEASZ/100-199--------PFTA-----MIYANR.
F1SB04_PIG/61-160--------PFTA-----EIYRQR.
F7BHJ5_XENTR/62-163--------PFTE-----EIYRKK.
G1MZ29_MELGA/96-197--------PFTE-----EIYRQK.
CHO2_YEAST/471-577--------PHVN-----KIYGK..
CHO2_CANAL/468-576--------SHMV-----KLYGEQ.
Q5KHK0_CRYNJ/121-221--------PFTD-----KIYSAK.
Q8DW48_STRMU/70-169--------EVLE-----QHFGR..
Q8PE74_XANCP/100-199--------AALR-----RAFPTRY

PF07298

B2JUD7_BURP8/3-190LWVAFVFFLHGW-----L.IGVKP
A1VI53_POLNA/3-190AWAVFAFWAHGL-----L.IGIRP
Q12HL7_POLSJ/3-190AWAGFAFWAHGV-----L.IGVRP
A2SBS8_METPP/3-190AWAVFAFWAHGA-----W.IGVRP
Q223I4_RHOFT/3-190AWIAFALWLHGL-----L.IGVRP
A1K5T7_AZOSB/6-191AWAIFARFLHGP-----L.IGVPP
A1WT38_HALHL/3-190GYIVFALFLHIP-----I.TGVPA
A6VV32_MARMS/3-191TWFAIAFYLHQA-----I.IGVSP
Q0AQE8_MARMM/3-183AALIILN.FHMY-----L.FGVAV
A1AZI2_PARDP/3-180VLLVVGL.IHAW-----L..GYNP
Q28U80_JANSC/6-185IVVVVML.IHWA-----L..GVQP
Q5LXD7_RUEPO/5-179LMAVIGY.IHGL-----V..G..P
Q1GLH3_RUEST/3-179LLGVIGY.IHGL-----V..GPSP
A8LJK3_DINSH/5-184LYLVIGG.IHAW-----L..GVWP
Q169U5_ROSDO/3-182LYALISA.VHIW-----A..GVWP
A0KG00_AERHH/3-186LTALLIFWGHGM-----L.TGIPL
Q6N9Q3_RHOPA/31-253AWLSLLL.LHPL-----V.IGVSP
Q219Y9_RHOPB/14-236AWLTLLA.LHAP-----V.IGVSP
Q5LUC0_RUEPO/7-220LYLALLL.AHAP-----V.IGVSP
Q0C1Y5_HYPNA/14-233VWGGLIL.LHRP-----V.VGVSP
Q169M4_ROSDO/6-220LYLVLVF.LHPV-----V.IGVPV
A8LNX8_DINSH/42-256LYLVLIG.VHPW-----L.FGVSP
A9CGK0_AGRFC/3-221VWWLLAG.GHAM-----L.FGADP
Q2JYB9_RHIEC/5-223LWLLFAG.GHSA-----M.FGADP
Q92Z13_RHIME/3-221LWLLAG..GHAA-----L.FYADP
B0U8Q9_METS4/2-221AYAWFLAQGHAL-----L.IGPDP
Q2VYZ8_MAGSA/17-229LYPVLLW.LHPM-----V.IGLSP
Q60BH7_METCA/3-224LYLAMLH.FHAK-----I.FGVSP
A7HZ42_PARL1/3-227VFGALFY.AHLW-----L.FGVSP
Q1GUJ7_SPHAL/6-226LWLAASW.AHGA-----L.GYMVA
Q2GC12_NOVAD/7-219VWVIITL.IHWE-----L.FGIPA
Q8DMH0_THEEB/15-236IFVALLWWLHPY-----F.YHVTP
Q113R6_TRIEI/12-233LFVLLFWQAHPL-----L.IRATG
Q8YQ81_NOSS1/13-234IFVALLWWAHPL-----L.FVATS
Q9ALA6_SYNE7/12-229IAIGLFWFAHRW-----I.....P
Q7V3C9_PROMP/9-231IAIAIIWWSHKY-----INIAVTT
A9CI20_AGRFC/3-191LWGAFILKLHEW-----L.IGVQP
Q92UK4_RHIME/3-191AFVLFVWKLHEL-----L.IGVQP
Q89MZ5_BRADU/5-191AYLALAFAFHPV-----V.IGVPV
A7IF98_XANP2/3-187LYAALAYLFHPY-----V.IGVPV
B0UL45_METS4/3-192AWFVFARVLHPW-----L.IGVAV
Q0C445_HYPNA/3-190AYLFLLFWFHPI-----L.TGMPA
Q3JDP5_NITOC/3-187VYAAIVFWLHET-----L.LGVKP
Q9AAA0_CAUCR/3-186AYLIFVFVLHRL-----L.FGVSP
Q11KH3_CHESB/3-188IYAIFVAGLHRL-----L.FGVSP
B4EFU3_BURCJ/3-190AWAVFALFLHGP-----L.IGVRP
C5B332_METEA/3-195AWFVFGKYLHPL-----L.IGVA.
Q2JMU2_SYNJB/23-239SFVLILYAFHPQ-----M.VS...
Q2K5L0_RHIEC/3-191VWALIIWKLHEW-----L.IGVSP
Q3SR07_NITWN/1-185VYVAIGALFHPF-----V.LGVP.
Q46HM6_PROMT/12-228IAVFFFWWSHKF-----I......
Q63MK0_BURPS/3-190VWALFAFVLHGW-----L.IGVRP

PF02544

Q19605_CAEEL/97-243ETF.PGYPPNRR-----ILIPRIF
YN67_SCHPO/146-295KEF.PNYPRSRK-----IMIPFFL
Q20344_CAEEL/97-243EKF.PKYPPTRR-----ALIPYIY
S5A1_RAT/110-259EKF.EDYPKSRK-----ILIPFVL
S5A2_HUMAN/105-254KMF.EDYPKSRK-----ALIPFIF
PORED_CAEEL/189-309KTF.PKYPKSRK-----ALIPYVL
Q23431_CAEEL/103-253KMFGEQYPRDRH-----ALVPGVW
DET2_ARATH/111-262AKFKEEYPKTRK-----AVIPFVY
TECR_YEAST/154-310KKN.KKYHTRRA-----FLIPFVF
S5A1_HUMAN/110-259RKF.EEYPKFRK-----IIIPFLF

PF06966

YJD4_SCHPO/67-320..--PLYRVYQD-----KV-----
Q10E47_ORYSJ/24-252QN--EEYRTYKN-----TT-----
Q8PAZ9_XANCP/20-250..--EDYAQYQR-----ST-----
Q9A3U2_CAUCR/70-299SK--PGYEEYVA-----RT-----
Q9VSM5_DROME/25-264DQ--LEYRKYKA-----ST-----
Q9CHY6_LACLA/17-245NR--EDFKEYAK-----TT-----
Q7CY59_AGRFC/19-248..--EKFRALQR-----RV-----
O81042_ARATH/64-303RA--EAYRAYQK-----TT-----
O53731_MYCTU/17-243GR--PGFAEYQR-----RT-----
Q8Y9D9_LISMO/16-244DR--ADFQAYAN-----KT-----
Q984A1_RHILO/21-257..--VQFRRYQE-----RV-----
B9DFE9_ARATH/24-252NS--GAYRSYKK-----TT-----

PF01222

LBR_CHICK/175-609KKYGLAWERYCQRVPYTHISLHLL
ERG24_NEUCR/17-490KKYGDDWEKYKKLVKW.RIVPGIY
STS1_SCHPO/7-453AKYGADFDEYCRICPY.LFIPYIF
ERG4_YEAST/34-473RKYGKDWDEYCKHCPY.VFIPYVF
ERG24_YEAST/8-438LKYGENWEEYERKVPY.KIIPYVY

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window