Sequence alignment for CL0124

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268KLDFSHLKMELAPQGGFDNQGNTPFGKGTMKPTTINRLLIQAVALTMERQDEFQLQGK...MYDFDDDRVSAFTTMARDN
Q9YQ23_VESV/628-1162KKDFSHLQLQLAPQGGFDCMGNTPYGKGAMSKTSLSRLLASATALALERLEDFQLQAP...EYDFDKNRVTAFTRMASDN
Q80J95_9CALI/650-1163RPDYSHINFILAPQGGFDRQGNTPYGKGVTKIIGATALCARAVALVHERHDDFGLQNK...VYDFDAGKVTAFKAMAADA
Q8JJL0_9CALI/645-1175KQDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSLTARVAGLVHERKDEFQLQGNDLQTYNFDTNRVSAFRKLAADN
Q80RD7_9CALI/641-1177SPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARASGLLHERLDEFELQGPNLTTFNFDRNKIQAFRQLAAEN

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMV0/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
POLG_YEFV1/1503-1655--------------------------------------------------------------------------------
POLG_DEN1W/1493-1642--------------------------------------------------------------------------------

PF01732

A5IYK2_MYCAP/279-649-------------------------------ADFFQYISDRSFELNVNQKVW............................
Q6MUH9_MYCMS/258-617-------------------------------EDYFKYIHERSFQLEINVKQW............................
Q2SR25_MYCCT/264-622-------------------------------EDFFKYIHERSFQLEINVKQW............................
D3VQF5_MYCA6/359-733-------------------------------LDFYQYIYDHSFSLRIGTVEF............................
Q4A635_MYCS5/147-497-------------------------------EEYLESIFKRTFSINFNYSTQ............................
Q4A5A2_MYCS5/91-491-------------------------------FDALKAIADRSFSLYVGMPNP............................
C7LM95_MYCML/189-571-------------------------------EEIYKELYDRTFSIKFLTKLN............................
A5IYA1_MYCAP/186-569-------------------------------KILYKELYDRTFSLKYLTKLS............................
Q4A798_MYCH7/125-523-------------------------------QILYKELYDRTFSVKFGITLA............................
Q4A5G2_MYCS5/337-740-------------------------------ETLYKEIYDRTFSLAYGFNEY............................
Q7NC63_MYCGA/244-661-------------------------------QLIYKEIWDRTFSIRPGTFTS............................
C5J6P1_MYCCR/115-482-------------------------------EQAYEKLKNRTFAIAFNSIDR............................
Q7NAU7_MYCGA/221-623-------------------------------QEIYKKIYDRTFSLEFYTRYT............................
Q7NAG1_MYCGA/203-712-------------------------------NEIYKKAAMQTYAIEFFNHNS............................
Q7NAF2_MYCGA/203-710-------------------------------NEIYKKVALQTFAIEFSNFNE............................
Q4A5P6_MYCS5/166-643-------------------------------NDLYKNTALQTYSISYVNEIK............................
D1J8A8_MYCHP/334-723-------------------------------NEHYRDIASQTFGIRFLTPIE............................
B1RXG0_UREUR/379-750-------------------------------NEKYRDEALQTLGISSLTLKD............................
MALP_UREPA/376-752-------------------------------NEKYRQEAMQTFSLGILNNDS............................
Q9PR98_UREPA/413-786-------------------------------NDMYKQIALQTFGIQIQTPNG............................
Q6MSY9_MYCMS/283-769-------------------------------NETYKTAAIQTFQVSFTAHKDYAAEIEEAEDNIKLFESWDDKQIENYID
Q98Q64_MYCPU/350-715-------------------------------NEMYKKIALQTYSVDVFNPKK............................
Q98QS3_MYCPU/339-702-------------------------------NETYKKIAEQSYSVQFTSKKV............................
Q7NAJ2_MYCGA/204-545-------------------------------NKKYQQLSKITYSIRITNELS............................
Q4A7B5_MYCH7/323-738-------------------------------NQEYKNLTKNSIGVEIVNGDF............................
Q98PH9_MYCPU/101-415-------------------------------NKIYQDNFKTSLSLSIPVVGA............................
Q8EWB5_MYCPE/130-442-------------------------------NETQVKQAKRTVGIGFIRGKG............................
Q8EW95_MYCPE/145-484-------------------------------TDKHAQLAKQVYSVGFHNGTE............................
Y068_MYCGE/48-383-------------------------------SDPYHINYDLTFSLNFASNKR............................
Y084_MYCPN/45-410-------------------------------GDVYHDNYDLTFSLNFATSSK............................
Y588_MYCPN/75-444-------------------------------SDVFKHNYDLTFSLNFTNKSN............................
Y395_MYCGE/89-428-------------------------------SDIYRKGYDLTFTLNFTSFSN............................
Y592_MYCPN/104-443-------------------------------NTKYRPGYDLSFALKFGTSWK............................
Y083_MYCPN/52-447-------------------------------DDIYSKFYDLTFSLNFVNNQA............................
Y582_MYCPN/44-388-------------------------------AEIDHANYDLTFFLGFFNRIE............................
Q4A8M7_MYCH7/557-908-------------------------------SFYFGNSLQDYYQVKIKFSQK............................
Q8EWN7_MYCPE/57-397-------------------------------SNALKWISQRTISLAFELKNK............................
B1RXU5_UREUR/59-344-------------------------------NVSTAYLNKRSIALKFTIPLN............................

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
POLG_POL1M/1566-1731--------------------------------------------------------------------------------
Q9DLK1_FMDVP/1643-1826--------------------------------------------------------------------------------

PF12380

Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF05409

R1A_CVH22/2994-3281--------------------------------------------------------------------------------
R1A_IBVB/2808-3096--------------------------------------------------------------------------------
B6VDX7_THCOV/2516-2804--------------------------------------------------------------------------------
R1AB_FIPV/2932-3219--------------------------------------------------------------------------------
R1A_CVHSA/3269-3559--------------------------------------------------------------------------------
R1A_CVMA5/3362-3648--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569---IVGGKRAQL-------------GDL....PWQVAIKDAS.........G----------------------------
SP24D_ANOGA/50-264---IVGGSVASE-------------GQF....PHQVALLRGNA.........----------------------------
TRY5_AEDAE/40-260---IVGGFEVPV-------------EEV....PFQVSLSGVGS........S----------------------------
UROK_HUMAN/179-419---IIGGEFTTI-------------ENQ....PWFAAIYRRHRGG....SVT----------------------------
MASP1_MOUSE/454-696---IFNGRPAQK-------------GTM....PWIAMLSHLNG........Q----------------------------
CTR1_ANOGA/33-250---VVGGEVAKN-------------GSA....PYQVSLQVPG........WG----------------------------
CFAD_HUMAN/26-248---ILGGREAEA-------------HAR....PYMASVQLNG.........A----------------------------
ACRO_RAT/43-286---IVGGQTSSP-------------GAW....PWMVSLQIFTSHN...SRRY----------------------------
HPT_HUMAN/162-399---ILGGHLDAK-------------GSF....PWQAKMVSHHN.........----------------------------
CASP_MESAU/445-682---IFGGFPAKI-------------QSF....PWQVFFEFPR..........----------------------------
A8JQZ2_DROME/186-427---IVGGTPTRH-------------GLF....PHMAALGWTQGSGSKDQDIK----------------------------
PCE_TACTR/128-370---IIGGREAPI-------------GAW....PWMTAVYIKQGG.....IRS----------------------------
STUB_DROME/544-782---IVGGKSAAF-------------GRW....PWQVSVRRTSFFG...FSST----------------------------
TRYU_DROME/28-254---IVGGADTSS-------------YYT....KYVVQLRRRSSSS...SSYA----------------------------
TRYI_DROME/28-245---IIGGSDQLI-------------RNA....PWQVSIQISAR.........----------------------------
TRYB_MANSE/25-252---IVGGSTTTI-------------QQY....PTIVALLFSRNGN....TFF----------------------------
TRYP_FUSOX/25-244---IVGGTSASA-------------GDF....PFIVSISRNGG.........----------------------------
B1VV86_STRGG/37-252---VVGGTRAAQ-------------GEF....PFMVRLSM.G..........----------------------------
TRY1_HUMAN/24-239---IVGGYNCEE-------------NSV....PYQVSLNS.G.........Y----------------------------
TRYP_PIG/9-224---IVGGYTCAA-------------NSI....PYQVSLNS.G.........S----------------------------
TRY1_SALSA/21-235---IVGGYECKA-------------YSQ....THQVSLNS.G.........Y----------------------------
TRYP_PLEPL/23-242---IIGGHECAA-------------HSR....PFMASLNY.G.........Y----------------------------
DEGP3_ARATH/99-287---KVFTVSSKP-------------RLF...QPWQITMQSEST.......GS----------------------------
DEGP2_ARATH/121-308---VYCTHTAPD-------------YSL....PWQKQRQFTST.......GS----------------------------
E2X833_SHIDY/62-244---YNRGLNTNS-------------HNQ.........LEIRTL.......GS----------------------------
DEGS_HAEIN/37-240---IISFKNAVR-------------IAS....PAVVNVYNRS..........----------------------------
YYXA_BACSU/99-283---DIWGESGEA-------------GSG......SGVIYKKN..........----------------------------
DEGP_SALTY/97-278---QGGGNGGNG-------------GQQ......QKFMALGS..........----------------------------
Q44596_BRUAO/85-261---SQFGASKPR-------------IQQ..........SLGS..........----------------------------
DEGPL_BRUA2/125-298---PRPGHERPV-------------AQG.............S..........----------------------------
O06439_RHOCA/59-235---PQGGPQRQH-------------HAD..........ALGS..........----------------------------
HHOA_SYNY3/95-274---FGRSFPVPP-------------RER......RIAGQGSG..........----------------------------
HTRA_SYNY3/156-334---FGSQMPPMP-------------NER.........VQRGTG.......SG----------------------------
O42417_CHICK/87-286---IVGRHPFSG-------------REV........PISNGS..........----------------------------
A0A0E3T8P7_9CAUD/70-274---KVDEKDRQK-------------YPY....NTIGNVFVKG.........Q----------------------------
ETB_STAAU/59-251---ITDNARSPY-------------NSV...G..TVFVKGST..........----------------------------
SPLB_STAA9/37-234---ENNVTKIQD-------------TNI...FPYTGVVAFKS..........----------------------------
SPLC_STAA9/38-233---KNVTQVKDT-------------NNF....PYNGVVSFKD..........----------------------------
MPR_BACSU/95-311---IIGTDERTR-------------ISSTTSFPYRATVQLSIKYPN..TSST----------------------------
PRTC_STRGR/205-383---IRGGDAYYM-------------NGS...GRCSVGFSVTRG.........----------------------------
Q55353_STRSQ/198-372---LVGGDAYYM-------------GGG....RCSVGFSVTQ..........----------------------------
Q55352_STRSQ/202-378---LVGGDAYYI-------------GNG....RCSIGFSVRQ..........----------------------------
Q54395_STRLI/158-342---ASGGDAIFG-------------GGA....RCSLGFNVTAG.......DG----------------------------
SP1_RARFA/205-391---DDVIVPVR.-------------.......DYWGGDALSG..........----------------------------
CERC_SCHMA/28-256---IRSGEPVQH-------------PAE...FPFIAFLTTER..........----------------------------
Q54344_STRLI/47-254---AISGEPPAA-------------TDH....AFTARLHIGEGDT....LRG----------------------------
CFAB_HUMAN/481-752---VWEHRKGTD-------------YHK...QPWQAKISVIRPS.....KGH----------------------------
PROZ_BOVIN/143-352---RPQGSQQNL-------------LPF....PWQVKLTNSEG........K----------------------------
CAC3_BOVIN/12-246---VVNGEDAVP-------------YSW....SWQVSLQYEKDG.....AFH----------------------------
CELA1_PIG/27-259---VVGGTEAQR-------------NSW....PSQISLQYRSGS.....SWA----------------------------
CTRA_BOVIN/16-238---IVNGEEAVP-------------GSW....PWQVSLQDKTG........F----------------------------
CTRL_HALRU/24-251---IVGGSNAAA-------------GEF....PWQGSLQVRSGT.....SWF----------------------------
COGS_HYPLI/31-252---IINGYEAYT-------------GLF....PYQAGLDI.TLQD....QRR----------------------------
CTRB1_LITVA/46-263---IVGGVEATP-------------HSW....PHQAALFIDD.........M----------------------------
CATG_MOUSE/21-238---IIGGREARP-------------HSY....PYMAFLLIQSPE......GL----------------------------
MCPT2_RAT/21-239---IIGGVESIP-------------HSR....PYMAHLDIVTEK.....GLR----------------------------
ELNE_HUMAN/30-242---IVGGRRARP-------------HAW....PFMVSLQLRGG.........----------------------------
PRTN3_HUMAN/28-243---IVGGHEAQP-------------HSR....PYMASLQMRGNP......GS----------------------------
GRAK_RAT/26-248---IIGGREVQP-------------HSR....PFMASIQYRG.........K----------------------------
GRAM_RAT/21-245---IIGGREAVP-------------HSR....PYMVSLQNTKS.........----------------------------
KLK1_MOUSE/25-253---IVGGFNCEK-------------NSQ....PWQVAVYRFT.........K----------------------------
KLK2_RAT/25-251---IVGGYKCEK-------------NSQ....PWQVAVIN...........E----------------------------
VSPCA_AGKCO/1-217---VIGGDECNI-------------NEH....RFLALVYANGS.........----------------------------
HGF_RAT/496-719---VVNGIPTQT-------------TVG.....WMVSLKYRN.........K----------------------------
ENTK_PIG/800-1029---IVGGNDSRE-------------GAW....PWVVALYYNG.........Q----------------------------
PRSS8_HUMAN/45-281---ITGGSSAVA-------------GQW....PWQVSITYEG.........V----------------------------
HGFA_HUMAN/408-641---IIGGSSSLP-------------GSH....PWLAAIYIGDS.........----------------------------
TPA_HUMAN/311-556---IKGGLFADI-------------ASH....PWQAAIFAKHRRS...PGER----------------------------
H2Q7T9_PANTR/235-462---IVGGQECKD-------------GEC....PWQALLINEEN.......EG----------------------------
THRB_BOVIN/367-616---IVEGQDAEV-------------GLS....PWQVMLFRKSP.......QE----------------------------
PROC_HUMAN/212-445---LIDGKMTRR-------------GDS....PWQVVLLDSKK........K----------------------------

PF13365

A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
A0L9W3_MAGMM/126-265--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRADU/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
DEG15_ARATH/376-594--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
Q11LS4_CHESB/40-170--------------------------------------------------------------------------------
C6XD83_METGS/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6XBL7_METGS/51-179--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
B5HRW8_9ACTN/52-200--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
B9IN99_POPTR/46-189--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
B9M1H9_GEODF/322-480--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------

PF09342

Q7QJ48_ANOGA/1774-1887-------------------------------WPWNTNIYLDGVMI-----------------------------------
Q8WSJ2_BOMMO/1523-1637-------------------------------CPWIAKVYVEGNYR-----------------------------------
NUDEL_DROME/2041-2158-------------------------------WPWLADVYMNGDLW-----------------------------------

PF05579

RPOA_LDVC/1418-1713ITLVWVQFF...-------------..LLAVNVWAGVASVVVLISSWFLARA----------------------------
RPOA_PRRSL/1601-1897LTMLWVHSF...-------------..LVFCLPAAGILSLGITGLLWAIGRF----------------------------
RPOA_LDVP/1420-1715VTLVWVQFF...-------------..LLAVNFWAGVAVAVILISSWFLARA----------------------------
RPOA_SHFV/1368-1665LSMKYIAFFC..-------------CTTAFVDFTSVVVVLTALLVGWILARY----------------------------
Q99AV6_PRRSV/1716-2013LTILWLVFF...-------------..LISVNMPSGILAMVLLVSLWLLGRY----------------------------
RPOA_EAVBU/963-1269LATLFVNLFFPQ-------------ATLVTMGYWACVAALAVYSLMGLRVK.----------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

A1SA55_SHEAM/18-726ADEG.QWQPYQM..PSI.ADKLKA.RGIDIPAEQLADLSRYP..MNAVVG.L----------------------------
E0THX8_PARBH/23-721ADEG.MWTPDQL..PAI.ADDLRE.TGLELDPAALTDLTGFP..MGAVIS.L----------------------------
F2GAE2_ALTMD/22-719AKEG.MFTPEQL..PSI.AGDLKE.TGLEIPASSINNLTAFP..MGAIVS.L----------------------------
A5FMW8_FLAJ1/19-712ADEG.MWFLMFI..ERLNHRDMEK.MGLQLTAEEIYSINHHS.LKDAIVQFN----------------------------
A6GWM2_FLAPJ/17-707AQQGGMWIPSLL..SGMNETEMKN.LGMKISADDIYSVNHSS.LKDAVPHFN----------------------------
A6KZW8_BACV8/17-706GNEG.MWLPCCL..SKQTQQVMKE.MGLELSSEQLYNPGGKA.LANAVVSFG----------------------------
A6L2J7_BACV8/19-726ADEG.MWMLTDL..KEQNAATMYD.MGLDISIDKVYCPDSIS.LKDAVVHFG----------------------------
A6L2J8_BACV8/21-719ADEG.MWLLQLM..QEQHLADRMKAQGLLLEADDIYNPNRVS.LKDAVGIFG----------------------------
A6LID5_PARD8/19-717ADEG.MWLLPLL..KQQKFAEMQA.LGLRLSDQEVYSAEAPS.LKDAVVRFG----------------------------
A7HA06_ANADF/20-725ADEG.MWMPQQI..PDL.APRLQQ.LGFDGDARQFADLTGQP..MGAIVS.L----------------------------
A7HFU9_ANADF/37-699ADEG.MWTYDAF.....PADKVEKKYGFRPSDAWLENARLSS......ARLA----------------------------
Q024G1_SOLUE/22-694GEEG.KWTPQQL..LQFDAAWLKK.QGLELPVSRLWDPARGTGLLAATIS.T----------------------------
Q029T1_SOLUE/24-727AEEG.MWMPQQI..PEM.AAKLRA.LGFRGDAKAFADLSGQP..MGAIVS.L----------------------------
Q07XT1_SHEFN/18-727ADEG.QWQPYQM..PSI.ADKLLQ.RGIDIPASQLADLGQYP..MNAVVS.L----------------------------
Q08VC9_STIAD/18-714AGEG.KWTPQQV..LELDPAWLKA.QGLKLPPQRLWDPKRGTGLLAGTVN.V----------------------------
Q11SC7_CYTH3/21-702ADEG.MWLPFVL...GKNYDQMKK.LGLKITPEQIYSVNNSS.LKDAVVNFG----------------------------
Q12RW4_SHEDO/18-728GDEG.QWQPYQM..PSI.ADKLEQ.HGIKIPAKQLADLSQYP..MNAVVS.L----------------------------
Q1D5W7_MYXXD/35-700ADEG.MWTYNNF.....PSAKVKEKYGFEPSQQWLDNVRLSS......ARLA----------------------------
Q1D9F6_MYXXD/17-714AGEG.KWTPQQV..LELDPAWLRA.QGLQVSPKKLWDPKRGTGLLAGAVN.V----------------------------
Q1DDZ2_MYXXD/18-682ADEG.MWTYDAF.....PSDTVNKAYGFTPTQAWLDHVRLGS......VRLA----------------------------
Q1GVV7_SPHAL/23-684AEEG.MWTFDAV.....PTDAIKAAYGWAPDQKWLDHTRAAA......VRLT----------------------------
Q1IPC2_KORVE/27-692ADEG.MWLFTNP.....PTAAIQKKYGFAITQEWLDHLRLSS......SR.A----------------------------
Q2G546_NOVAD/56-713ADEG.MWTFDAF.....PSAKMQADYGWAPDGRWLDRVQAAA......VRLT----------------------------
Q2IEV3_ANADE/18-687ADEG.MWTYDAF.....PSDRVARKYGFDPSRAWLDRARLAS......ARLA----------------------------
Q2S133_SALRD/5-639SDAGRIWSLVAP.....PADRLVRRYGMEVDSAWAAHLRRSV......LR.L----------------------------
Q2S134_SALRD/69-734FDRGRMWTVENL.....PTSYFQEAHGVTPDDEWRTKARRGA......LRFG----------------------------
Q488S2_COLP3/26-729ADEG.MWQPNQL..PTI.AKELTN.AGLKLNPNDLTDLTGFP..MGAIVS.L----------------------------
Q5LIW7_BACFN/34-723ADEG.MWMLGNL..NKETRKTMKE.LGLQMPADQLYSTRHPS.LKDAVVSFG----------------------------
Q5QV86_IDILO/17-717ADEG.MWMPKQL..PEI.ADKLKA.AGLTIDPNDISKLTEFP..AAAIVS.L----------------------------
Q7MV25_PORGI/21-718ADEG.MWLMQQL...GRKYAQMKE.RGLKMKEYDLYNPNGTS.LKDAVVLFD----------------------------
Q7MWU6_PORGI/24-711ADKG.MWLLNEL..NQENLDRMRE.LGFTLPLDSLYSFDKPS.IANAVVIFG----------------------------
Q7NHA9_GLOVI/34-698AEEG.MWTYDNF.....PSEQVAKKYGFKPDAAWLERVRLAS......LRLA----------------------------
Q7UKL5_RHOBA/28-688ADEG.MYLFNDV.....PRELLRDRHQFEPSEEWLKHLQLSS......VRFN----------------------------
Q8A2L6_BACTN/20-711ADEG.MWLLGNLRKNKQAERVMKE.LGLQMPVNKLYNPKKPA.LANAVVSFG----------------------------
B2FQN5_STRMK/22-717AAEG.MWVPQQL..PEI.AGPLQK.AGLKLSPEQLSNLTGDP..MGAVVA.L----------------------------
E3FSI6_STIAD/18-681ADEG.MWTYNNF.....PAAAVKAQYGFEPTAQWLDKVRLSS......ARIA----------------------------
Q5LB16_BACFN/20-719ADEG.MWMLTDL..KAQNEAAMMD.LGLQIPIEEVYNPDGIA.LKDAVVHFG----------------------------
Q8EAI4_SHEON/18-728ADEG.QWQPYQM..PSI.ADKLSA.RGIDIPADKLADLTSYP..MNAVVG.L----------------------------
Q8EHX9_SHEON/18-716ADEG.MWQPHQL..PAM.ADVLKA.KGLEIDAKSISKLTEFP..MNAVIS.L----------------------------
Q9PC94_XYLFA/22-713AGEG.MWVPQQL..PEI.AGPLKQ.AGLQLSPEQLSNLTGDP..MGAVVS.L----------------------------
R5U6M0_9BACE/21-717ADEG.MWLLQLM..QQQHSIDMMKKQGLKLEAQDLYNPNGVS.LKDAVGIFG----------------------------
R6WQY4_9PORP/22-710ADEG.MWVLKEL..NKQNLERMKE.LGFTPSYEQLYSETDPC.VANAVVIFG----------------------------
R6Y7C6_9PORP/19-717ADEG.MWLLPLL..KGQRFPEMQA.LGLKLQDYDIYSPDSAS.LKDAVVIFG----------------------------
R7EE18_9BACE/20-708ADEG.MWMLGNL..NKQTRQTMKE.LGLQMSVNKLYNTKRPS.LKDAVVSFG----------------------------
R7EGG9_9BACE/23-719ADEG.MWLLQLM..KQQNSIDMMKKQGLKLEADDLYNPNGVS.LKDAVGIFG----------------------------

PF00863

POLG_SPMMV/2424-2646-----------------------AEDK..........HIASRLAIVR....T----------------------------
POLG_RGMVD/1998-2230-----------------------HESKSIAKGLRDYHPVSSNLCALEYYCGD----------------------------

PF03761

Q9U2W2_CAEEL/6-282---------------------------------------------IGVLVFI----------------------------
Q21628_CAEEL/5-298---------------------------------------------SLTYIFV----------------------------
O45371_CAEEL/3-276---------------------------------------------FLTLFIW----------------------------
O76649_CAEEL/2-297---------------------------------------------NIGILIS----------------------------
A8XIB1_CAEBR/15-285---------------------------------------------ILIGIFS----------------------------
A8WNY9_CAEBR/3-296---------------------------------------------LLHLLPL----------------------------
Q9XWZ8_CAEEL/4-272---------------------------------------------QSIITIS----------------------------
O62223_CAEEL/7-278---------------------------------------------IIFYFIF----------------------------
O62231_CAEEL/5-272---------------------------------------------VIVIFFA----------------------------

PF00944

POLS_SFV/112-268--------------------------------------------------------------------------------
POLS_SINDV/107-265--------------------------------------------------------------------------------

PF05580

E3E859_PAEPS/156-365----------------------------------------KAWRLGLYIRDS----------------------------
B2A522_NATTJ/220-428----------------------------------------NEYGIGLYLTDS----------------------------
R6EU85_9FIRM/240-448----------------------------------------GKYKIGVWVRDN----------------------------
R5R857_9FIRM/209-435----------------------------------------GVYKIGVWVRDS----------------------------
D5DLD9_BACMD/201-410----------------------------------------YAYRIGLYIRDS----------------------------
R5E7E8_9CLOT/153-360----------------------------------------NIYKVGIWVRDD----------------------------
H6NL93_9BACL/216-425----------------------------------------KAYRLGLYIRDS----------------------------
D9QRU2_ACEAZ/227-436----------------------------------------GRYMIGLYIDDG----------------------------
R5C627_9FIRM/190-398----------------------------------------GCYKLGIWVRDN----------------------------
R7M5P2_9CLOT/115-318----------------------------------------NTYKTGLYVKDN----------------------------
R5H148_9FIRM/298-508----------------------------------------GVYKLGIWIRDN----------------------------
R6AIL9_9CLOT/311-520----------------------------------------GKAKIGAWVRDS----------------------------
R7FQ12_9CLOT/119-323----------------------------------------GCFKTGLYVKER----------------------------
F6DU87_DESRL/210-419----------------------------------------KRYRVGLFVRDS----------------------------
R6R0T0_9FIRM/204-412----------------------------------------GVYKIGVWVRDD----------------------------
D4J425_9FIRM/145-352----------------------------------------DRYKIGVWLRDD----------------------------
R5YSC4_9FIRM/173-380----------------------------------------GIYKIGLWVRDD----------------------------
R5J4I1_9FIRM/118-321----------------------------------------SGYRLGVLVRDH----------------------------
R6Y3R6_9FIRM/105-307----------------------------------------EKIKTGLYVKDE----------------------------
I4D8U8_DESAJ/208-416----------------------------------------GRYRVGLFVRDE----------------------------
R5A2Q9_9CLOT/168-371----------------------------------------GSFKTGMWVRDS----------------------------
A4XKP9_CALS8/199-405----------------------------------------GVYKIGLWVRDG----------------------------
R7HFV6_9MOLU/114-314----------------------------------------GVIKTGLFVKSS----------------------------
R5MBH1_9MOLU/116-319----------------------------------------NSYKTGIYVKDN----------------------------
B0TEK3_HELMI/215-424----------------------------------------KRFRVGLYVRDR----------------------------
R7K6P1_9FIRM/158-362----------------------------------------KTYKLGLWSKDS----------------------------
R6WI32_9FIRM/144-352----------------------------------------DKYKLGIWVRDN----------------------------
C4ZCY0_EUBR3/233-444----------------------------------------GRYYMGIWVKDD----------------------------
R7FE29_9FIRM/75-280----------------------------------------GCYEAGVWVRDS----------------------------
R7KE68_9FIRM/124-326----------------------------------------KEYKLGLYVKEE----------------------------
Q8XJE5_CLOPE/171-380----------------------------------------GDYKIGLWVRDS----------------------------
D4LFB6_RUMC1/188-392----------------------------------------ACYKAGLWVRDS----------------------------
R6RRV8_9FIRM/198-401----------------------------------------SQYKIGAWVRDN----------------------------
R7B468_9CLOT/225-433----------------------------------------GDYKLGLWIRDD----------------------------
G7M128_9CLOT/180-389----------------------------------------KDYKIGLWIRDS----------------------------
U5S0W6_9CLOT/60-268----------------------------------------NNYKIGLWIRDS----------------------------
R5KFR6_9CLOT/196-405----------------------------------------GSYKAGIWVRDD----------------------------
R7QW48_9FIRM/197-405----------------------------------------GAYKLGIWVRDD----------------------------
R6BUQ9_9FIRM/202-410----------------------------------------GSCKLGVWVRDD----------------------------
R7MCE1_9CLOT/114-318----------------------------------------SIYKTGLYVKEK----------------------------
A5D302_PELTS/204-413----------------------------------------LRYRMGLLIRDS----------------------------
E6UBW1_RUMA7/187-391----------------------------------------GSYKAGMWVRDS----------------------------
R5PM12_9CLOT/193-402----------------------------------------NTYKIGLWVRDA----------------------------
R5CZB6_9FIRM/133-338----------------------------------------GGIRLGAWIRDS----------------------------
R6SMI2_9CLOT/138-343----------------------------------------GRYKTGLYVRDS----------------------------
A4J3G7_DESRM/210-419----------------------------------------QRYRVGLFVRDS----------------------------
E6U2J4_ETHHY/189-392----------------------------------------GVFKAGLWVRDS----------------------------
R5SUE4_9CLOT/122-326----------------------------------------DIYKTGMYVKDS----------------------------
R6XJ65_9FIRM/124-325----------------------------------------NEKSIGLYIRDQ----------------------------
R6QNQ2_9CLOT/190-395----------------------------------------AQYKIGVWVRDS----------------------------
R6KNJ0_9CLOT/215-423----------------------------------------GQYKLGAWVRDD----------------------------
R6T3R8_9FIRM/188-393----------------------------------------GSYKAGMWVRDS----------------------------
R7HTV5_9CLOT/214-418----------------------------------------NNFKLGIWVRDD----------------------------
R5VVX1_9FIRM/191-398----------------------------------------QQYETGLWVRDS----------------------------
R5TNP7_9FIRM/195-403----------------------------------------KIFQIGVWVRDD----------------------------
Q18B75_PEPD6/138-350----------------------------------------GKYKLGLWVRDK----------------------------
G2T3Q8_ROSHA/203-410----------------------------------------GKYRLGIWVRDD----------------------------
R6GHR5_9CLOT/190-395----------------------------------------NIYKLGLWVRDS----------------------------
E6TXR0_BACCJ/201-410----------------------------------------ESFRLGLYIRDS----------------------------
R6KEA9_9FIRM/207-412----------------------------------------GEYKLGLWVKDD----------------------------
R7IWD1_9CLOT/192-400----------------------------------------GKYKLGLWVRDS----------------------------
R5VVV3_9DELT/153-356----------------------------------------GHYRLGLWTRDS----------------------------
R6I8W6_9FIRM/181-382----------------------------------------SKFKAGLWVRDS----------------------------
R7GGP8_9CLOT/117-316----------------------------------------EGYSLGLYIKDC----------------------------
R5J7S8_9CLOT/122-325----------------------------------------NVYKTGLYVKDT----------------------------
R6FK23_9FIRM/138-346----------------------------------------GQQKIGVWVKEK----------------------------
R7P923_9CLOT/115-318----------------------------------------DIYKTGLYVKSS----------------------------
R5KUR7_9CLOT/197-401----------------------------------------GCYKAGMWVRDS----------------------------
I3VWM7_THESW/214-421----------------------------------------QKYKLGLWVRDH----------------------------
R6B2V6_9CLOT/193-402----------------------------------------NEYKLGLWVRDA----------------------------
R7DMS2_9FIRM/123-328----------------------------------------NRYRTGLYIKER----------------------------
R5KNW9_9FIRM/197-403----------------------------------------GEYMLGIWVRDD----------------------------
R7NI61_9MOLU/101-304----------------------------------------GVYKTGLYVKDG----------------------------
F2JMG1_CELLD/213-423----------------------------------------ETYKIGLWIKDS----------------------------
K4L254_9FIRM/158-366----------------------------------------QRYRIGLFIRDE----------------------------
R6GNM4_9FIRM/130-329----------------------------------------GTFELGISMRDK----------------------------
R6Q3J2_9FIRM/197-399----------------------------------------GQWRAGMWVRDS----------------------------
R6N1E9_9FIRM/118-320----------------------------------------NIYRLGLWVRDS----------------------------
R5SZK8_9CLOT/120-323----------------------------------------GVYKTGLYVKDS----------------------------
R5YCX5_9FIRM/210-420----------------------------------------EAYMLGLWVKDD----------------------------
R7C759_9CLOT/199-406----------------------------------------GTYKIGTWVRED----------------------------
W0E9D2_9FIRM/204-412----------------------------------------NRYRVGLYVRNE----------------------------
Q894H5_CLOTE/186-394----------------------------------------GDYKIGLWVRDS----------------------------
C9R866_AMMDK/202-412----------------------------------------RSYRLGLLVQEA----------------------------
R7HB69_9FIRM/198-403----------------------------------------GNYKIGLWVKDD----------------------------
A6TR47_ALKMQ/212-421----------------------------------------ETYRLGLWVRDK----------------------------
R7ESB8_9FIRM/150-355----------------------------------------GQFQTGMWVRDS----------------------------
R6PKG4_9CLOT/142-350----------------------------------------KEYKLGIWVRDN----------------------------
R7M6Q4_9CLOT/189-398----------------------------------------NQYKIGLWVRDA----------------------------
Q0AZD6_SYNWW/215-423----------------------------------------NRCRIGLYVRDG----------------------------
R7N4W4_9FIRM/233-441----------------------------------------GEYKLGIWVRDN----------------------------
R6YA95_9FIRM/170-373----------------------------------------GSFKTGMWVRDS----------------------------
D5WV97_KYRT2/203-412----------------------------------------RTYRIGLYIRDS----------------------------
R5LXL5_9FIRM/207-415----------------------------------------NLRKIGVWVRDD----------------------------
R5DF89_9FIRM/134-342----------------------------------------KEYKLGIWVRDN----------------------------
R6TFF4_9STAP/123-324----------------------------------------NESSIGLYIRDQ----------------------------
A5I2Z7_CLOBH/190-399----------------------------------------NNYKIGLWVRDS----------------------------
R6H4Q6_9CLOT/93-302----------------------------------------NEYKLGLWVRDS----------------------------
R6R368_9FIRM/120-325----------------------------------------NVIKTGLYVKER----------------------------
A3DDL9_CLOTH/220-429----------------------------------------NKYRVGMWVRDS----------------------------
D3E6N1_GEOS4/216-425----------------------------------------QSWRLGLYIRDS----------------------------
F9VK25_ARTSS/181-387----------------------------------------GKNKIGLWVRDS----------------------------
R5QQG0_9FIRM/120-319----------------------------------------AEFSTGLYVKDC----------------------------
G8LW28_CLOCD/215-424----------------------------------------NKYHLGMWVRDS----------------------------
R7L0T4_9FIRM/128-333----------------------------------------DSYRAGMWVRDS----------------------------
L7VQQ3_CLOSH/211-420----------------------------------------GKYRIGIWVRDS----------------------------
C8WXF9_ALIAD/189-396----------------------------------------...ELGVYVRDK----------------------------
Q2RIC4_MOOTA/204-410----------------------------------------GRYRIGVYVRDS----------------------------
R4KQW9_9FIRM/233-441----------------------------------------GRYRIGLFIKNS----------------------------
A9KMA5_CLOPH/226-440----------------------------------------GEYKIGTWIRDD----------------------------
E6SKR3_THEM7/213-420----------------------------------------QRFAIGIWVRDR----------------------------
L0F7L5_DESDL/201-409----------------------------------------DRYRVGLYVRNE----------------------------
I0JNU1_HALH3/190-399----------------------------------------KEYQIGLYIRDS----------------------------
R7EZR7_9BACI/119-323----------------------------------------GVYKTGLYVKDS----------------------------
R6J055_9CLOT/188-393----------------------------------------GCWKAGVWVRDS----------------------------
R5NUG0_9CLOT/150-357----------------------------------------GSYALGLWVKDD----------------------------
G2TKW2_BACCO/202-410----------------------------------------QSYKLGLYIRDS----------------------------
R5N690_9FIRM/195-399----------------------------------------NCYKAGIWVRDS----------------------------
R5VHC6_9FIRM/116-319----------------------------------------NVYKTGLYVKDN----------------------------
R5NBK1_9CLOT/140-350----------------------------------------NSYMLGLWVRDA----------------------------
R5XPM2_9FIRM/142-350----------------------------------------KKYKLGIWVRDN----------------------------
D5X7G9_THEPJ/215-423----------------------------------------SRYRIGLYIRDT----------------------------
F4A1F9_MAHA5/216-427----------------------------------------HKYKLGIWVRDS----------------------------
R7ITE0_9FIRM/153-365----------------------------------------NEYKMGIWVRDD----------------------------
F6CL40_DESK7/196-404----------------------------------------RRYRIGLYVRDS----------------------------
L0EG06_THECK/215-424----------------------------------------RAWRLGLYIRDS----------------------------
R5IDG3_9CLOT/215-423----------------------------------------GSSKLGVWVRDD----------------------------
R6CTL1_9CLOT/120-324----------------------------------------GTLKTGLYVKDM----------------------------
K0B195_CLOA9/214-422----------------------------------------NSYRLGIWVRDK----------------------------
B8D2I8_HALOH/212-421----------------------------------------GKYMIGLYVDDG----------------------------
R6NNU0_9FIRM/215-423----------------------------------------ETYKLGVWVRDD----------------------------
R6VE05_9FIRM/190-398----------------------------------------LKYKLGIWVRDN----------------------------
R6CN52_9FIRM/195-397----------------------------------------GSYRAGMWVRDS----------------------------
R5H2U4_9FIRM/161-364----------------------------------------GQYRIGTWVRDS----------------------------
R5V409_9FIRM/42-246----------------------------------------GSWKTGLLVKER----------------------------
R6GW98_9FIRM/112-314----------------------------------------DKYKTGLFVKDS----------------------------
R7ICH4_9FIRM/201-410----------------------------------------GVVRLGAWVRDS----------------------------
R7BI76_9FIRM/225-433----------------------------------------GRLKIGTWVRDD----------------------------
C4Z0G6_EUBE2/204-408----------------------------------------GEYKLGIWVKDD----------------------------
R6NHB7_9CLOT/187-390----------------------------------------GKYRAGIWVRDS----------------------------
R7R973_9FIRM/209-417----------------------------------------GVYKIGTWLRDS----------------------------
R5HM74_9FIRM/194-402----------------------------------------GTYMLGAWVRDD----------------------------
R6NAF9_9FIRM/131-335----------------------------------------GNYLIGAWVRDS----------------------------
D9SLV5_CLOC7/152-361----------------------------------------GCYKLGVWVRES----------------------------
R5RSY4_9FIRM/191-399----------------------------------------GSYKLGIWVRDN----------------------------
R6HAH9_9FIRM/115-318----------------------------------------GRKRLGIYVREG----------------------------
R5XRH8_9CLOT/130-334----------------------------------------GIYKLGFWVRDK----------------------------
R7FZ38_9FIRM/124-328----------------------------------------GELRLGLWVRES----------------------------
R5I6P6_9FIRM/190-402----------------------------------------GKYKLGIWVRDD----------------------------
B8I3A0_CLOCE/216-424----------------------------------------KKYHIGLWVRDS----------------------------
R6DXQ1_9FIRM/188-391----------------------------------------STYKGGLWIRDS----------------------------
R5E160_9FIRM/211-416----------------------------------------GDYKVGIWVKDD----------------------------
Q97HE0_CLOAB/180-389----------------------------------------ENYKIGLWVRDS----------------------------
R6M2Z6_9CLOT/206-414----------------------------------------GKVKIGTWLRED----------------------------
D6DLB6_CLOSC/286-502----------------------------------------GDYKLGIWIRDD----------------------------
R6RY05_9CLOT/215-423----------------------------------------GTYKLGAWVRDD----------------------------
F4LV06_TEPAE/231-436----------------------------------------...QIGLWVRDI----------------------------
R6UED3_9CLOT/182-387----------------------------------------SCYKIGVWVRDS----------------------------
R5AES8_9CLOT/42-250----------------------------------------HVYRIGAWVRDS----------------------------
B2TRL9_CLOBB/180-389----------------------------------------SDYKLGLWIRDS----------------------------
R5D6V9_9FIRM/122-319----------------------------------------GAWKLGLMLRDG----------------------------
D7CKI9_SYNLT/219-426----------------------------------------NRYRIGLYVRDG----------------------------
R5TH80_9CLOT/132-335----------------------------------------GEYKLGVFVKDS----------------------------
R5MT91_9FIRM/111-313----------------------------------------GVYKSGLYVKDS----------------------------
R6YLB5_9CLOT/118-321----------------------------------------GEYKTGLYVKDT----------------------------
R6MJ71_9FIRM/142-350----------------------------------------GAYKLGIWVRDN----------------------------
D4M5K6_9FIRM/149-357----------------------------------------GNYRLGIWVRDN----------------------------
D9S3S9_THEOJ/214-422----------------------------------------GIYQIGLWVRDI----------------------------
F6B9N5_DESCC/210-419----------------------------------------KRYRIGMFVRDS----------------------------
R6TLY4_9FIRM/137-344----------------------------------------GQYAIGAWIRDS----------------------------
R5ZMQ1_9CLOT/199-408----------------------------------------NEYKLGLWVRDA----------------------------
Q67NC5_SYMTH/207-416----------------------------------------GRWRVGLYIRDG----------------------------
R6TRP0_9CLOT/120-323----------------------------------------GVYKTGIYVKDS----------------------------
R7L6Y3_9CLOT/233-442----------------------------------------EDYKLGLWVRDA----------------------------
R6BNR4_9CLOT/114-319----------------------------------------NIYKTGLYVKDS----------------------------
Q9K975_BACHD/212-422----------------------------------------STFRMGLYIRDS----------------------------
D4KCM7_9FIRM/192-394----------------------------------------AQWRAGMWVRDS----------------------------
R5QDI6_9FIRM/145-349----------------------------------------GEYKLGMWIKDS----------------------------
B1I568_DESAP/211-420----------------------------------------GRYRVGLLVRDS----------------------------
R5NSK8_9FIRM/199-407----------------------------------------NEYKIGIWVRDD----------------------------
R6ZZF6_9FIRM/208-413----------------------------------------GSNKLGIWVRED----------------------------
R6L493_9FIRM/190-397----------------------------------------GSYKLGIWVRDN----------------------------
A8MFI3_ALKOO/213-422----------------------------------------GQYRLGLWVRDK----------------------------
Q8RAC0_CALS4/204-412----------------------------------------KQYRIGLWVRDH----------------------------
R6G9J9_9FIRM/191-398----------------------------------------GSYKLGIWVRDN----------------------------
R5HAQ1_9FIRM/145-350----------------------------------------GAYKLGAWIRDS----------------------------
K4LFQ1_THEPS/206-415----------------------------------------RRYRIGLLVRDG----------------------------
W6RY93_9CLOT/148-357----------------------------------------NNYKLGLWIRDS----------------------------
R5UHP5_9FIRM/212-422----------------------------------------KGYRLGLWVKDD----------------------------
R7G2H0_9FIRM/142-350----------------------------------------NNCMLGIWVRDN----------------------------
R6WHU5_9CLOT/131-335----------------------------------------GERRFGVNVRDK----------------------------
R6S308_9FIRM/142-350----------------------------------------GTKKLGIWVRDN----------------------------
R5B250_9CLOT/200-409----------------------------------------GEVLLGAWVRES----------------------------
R5SFB7_9FIRM/137-344----------------------------------------GVCRLGAWIRDS----------------------------
R6GC90_9FIRM/150-358----------------------------------------KCYQIGVWIRND----------------------------
D9R8M8_CLOSW/214-422----------------------------------------GTYKLGVWVRDD----------------------------
R5RQY0_9FIRM/121-325----------------------------------------QQFSTGLYVKDA----------------------------
R5LJL6_9MOLU/118-321----------------------------------------GVLKTGLYVKDK----------------------------
R7AQT1_9BACE/225-434----------------------------------------GEYKTGIWVKDD----------------------------
X4ZLT8_9BACL/99-308----------------------------------------NVWRLGLFIRDS----------------------------
F8I8Y9_SULAT/220-427----------------------------------------KRWAVGLKLQDR----------------------------
R6MC60_9CLOT/122-326----------------------------------------DIYKTGLYVKDS----------------------------
R6TCX6_9FIRM/135-339----------------------------------------GRYQAGLWLRDT----------------------------
R6R1J4_9FIRM/212-417----------------------------------------GAYKLGIWIRDS----------------------------
R6YL37_9CLOT/139-347----------------------------------------GKYKIGLWVRDS----------------------------
R5XPM6_9FIRM/190-397----------------------------------------GEYKLGIWVRDN----------------------------
A0Q0A9_CLONN/187-396----------------------------------------NAYKIGLWVRDS----------------------------
D4LPR1_9FIRM/190-397----------------------------------------GKYKLGIWVRDD----------------------------
R7DAB6_9FIRM/190-397----------------------------------------GEYKLGIWVRDN----------------------------
C0ZC15_BREBN/214-423----------------------------------------SEYRMGLYIRDS----------------------------
R6QE36_9FIRM/194-400----------------------------------------NANKIGVWVRDS----------------------------
R5K6N9_9CLOT/167-373----------------------------------------NAYMLGLWVKDD----------------------------
R6ZCY0_9FIRM/221-429----------------------------------------GEYKMGIWVRDN----------------------------
R5HLI4_9MOLU/115-317----------------------------------------NTYKTGIYVKDS----------------------------
R6NKY3_9CLOT/194-403----------------------------------------NEYKLGLWVRDS----------------------------
R5JXE7_9FIRM/156-361----------------------------------------SSYKLGLWIKDD----------------------------
R5AF90_9FIRM/133-337----------------------------------------QTYQIGAWIRDS----------------------------
R5TU24_9FIRM/139-347----------------------------------------DEYKLGIWVRDN----------------------------
R6P0Q8_9CLOT/193-398----------------------------------------ISYKAGLWVRDS----------------------------
R6DUC4_9FIRM/127-333----------------------------------------GVWQLGAWIRDS----------------------------
R7F4Z6_9CLOT/192-401----------------------------------------NEYKLGLWVRDA----------------------------
R6X4M8_9FIRM/136-339----------------------------------------GEYRAGLWIKDS----------------------------
R6EKK3_9FIRM/143-351----------------------------------------GEYKIGLWVKEK----------------------------
Q5WF67_BACSK/198-409----------------------------------------HLYRLGLYIRDS----------------------------
R7JU02_9FIRM/197-405----------------------------------------GTCRLGAWVRDN----------------------------
G4KYV3_OSCVS/185-393----------------------------------------GKYAIGAWIRDS----------------------------
Q3AAN6_CARHZ/163-370----------------------------------------KRWRIGVFIRDN----------------------------
R5VSI3_9CLOT/190-396----------------------------------------GTYKIGTWVRED----------------------------
R7MHL3_9FIRM/193-401----------------------------------------KGYFAGMWVRDS----------------------------
R6RU79_9FIRM/211-417----------------------------------------DSYKLGIWVRDN----------------------------
R6Q618_9FIRM/189-393----------------------------------------GCYKVGLWVRDS----------------------------
R7K1G6_9CLOT/231-438----------------------------------------GTYQIGAWLRED----------------------------
L0K691_HALHC/216-425----------------------------------------GYYMIGLYVDDG----------------------------
R5FFJ0_9FIRM/179-381----------------------------------------...TLGLRVKEQ----------------------------
R7G6U2_9FIRM/124-329----------------------------------------NSYKTGLYVKDK----------------------------
R5G573_9FIRM/138-340----------------------------------------GECSLGLYVKDN----------------------------
K0IY14_AMPXN/203-412----------------------------------------DSYKIGLYIRDS----------------------------
R6USZ2_9FIRM/121-326----------------------------------------RSFKSGLYVKDK----------------------------
R6PFE8_9FIRM/190-396----------------------------------------DEYKLGLWVRDN----------------------------
F0T085_SYNGF/158-366----------------------------------------NRNRIGLFIRDE----------------------------
R7HK64_9FIRM/123-327----------------------------------------NVYKTGLYVKDS----------------------------
R6AWH8_9CLOT/116-318----------------------------------------DNYRTGLYVKDG----------------------------
R6FWG8_9CLOT/176-385----------------------------------------NEYKIGLWVRDS----------------------------
R4KDG0_CLOPA/191-400----------------------------------------NGYKLGLWVRDS----------------------------
R5QW36_9FIRM/145-353----------------------------------------GEYRLGIWVRDN----------------------------
R6CRQ2_9CLOT/225-433----------------------------------------GEYKIGIWVRDN----------------------------
R7KGU6_9CLOT/125-328----------------------------------------SVCKTGLYVKDE----------------------------
R6U8G2_9CLOT/145-349----------------------------------------ETYKLEMWVKDS----------------------------
R5A3A4_9CLOT/113-318----------------------------------------NLLKTGLYVKDN----------------------------
R5J0Y5_9FIRM/121-325----------------------------------------NIYKTGLYVKDS----------------------------
D4MXQ8_9FIRM/198-400----------------------------------------HMYKIGTWIRDN----------------------------
Q8EQ48_OCEIH/176-385----------------------------------------KQFKIGLYIRDS----------------------------
R5YPZ4_9MOLU/74-277----------------------------------------NVYKTGLYVKDK----------------------------
SP4B_BACSU/203-412----------------------------------------GKYRIGLYIRDS----------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

POLG_BVDVN/1680-1890--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782LGIASQAWAGHTYFGIDYQYYRDFAENKGKFTVGAKNIEVYNKEGQLVGTSM----------------------------
IGA0_HAEIN/17-865YALTPYTEAALVRDDVDYQIFRDFAENKGRFSVGATNVEVRDKNNHSLGNVL----------------------------
Q5F9W2_NEIG1/19-848YALTPYSEAALVRDDVDYQIFRDFAENKGKFFVGATDLSVKNKRGQNIG.NA----------------------------

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268GLGILSMAGLGKKLRGVTTMEGLKNALKGYKISACTIKWQAKVYSLESDGN.SVNIKEERNILTQQQQSVCTASVALTRL
Q9YQ23_VESV/628-1162GLGVMAAMRLGNRLKNVTTITELESALFGHTIAPCQIVWRGARYSMHTDGK.NMSIQQ.....VTTPAPVEEVNYALKRL
Q80J95_9CALI/650-1163GIPWYKMAAIGCKAMGCTCVEEAMHLLKDYEVAPCQVIYNGATYNVSCI.KGAPMVEK.....VKEPELPKTLVNCVRRI
Q8JJL0_9CALI/645-1175KYGIVETMRVGAALKNVKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDK...VEDHTSQTANEVSSALLRL
Q80RD7_9CALI/641-1177KYGLVDTMRVGGQLKGVRTIPELKQALKNILIKRCQIVYGGSTYTLESDGKGNVKVEK...VQNTNIQINNELAGALHHL

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMV0/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
POLG_YEFV1/1503-1655--------------------------------------------------------------------------------
POLG_DEN1W/1493-1642--------------------------------------------------------------------------------

PF01732

A5IYK2_MYCAP/279-649...................................VDEFVES..............................TRQWSKRL
Q6MUH9_MYCMS/258-617...................................VIDQDEK..............................TLQEIPRL
Q2SR25_MYCCT/264-622...................................VIERDEK..............................TFEEIKRL
D3VQF5_MYCA6/359-733...................................RRDP.................................YRSTPDHL
Q4A635_MYCS5/147-497................................................................................
Q4A5A2_MYCS5/91-491...................................QA...........................................
C7LM95_MYCML/189-571...................................NG..........................................G
A5IYA1_MYCAP/186-569...................................NG..........................................D
Q4A798_MYCH7/125-523...................................KG................................VKLYGEPEENK
Q4A5G2_MYCS5/337-740...................................DPK..................................AENGGNKD
Q7NC63_MYCGA/244-661...................................DN........................................GTA
C5J6P1_MYCCR/115-482...................................T....................................DENDVNDI
Q7NAU7_MYCGA/221-623...................................RKN..................................SSNSNIEQ
Q7NAG1_MYCGA/203-712...................................ELE..................................KIPKGSSK
Q7NAF2_MYCGA/203-710...................................EMA..................................KVQGGQNY
Q4A5P6_MYCS5/166-643...................................GDYVNEVKG............................DIEDTGVN
D1J8A8_MYCHP/334-723...................................GE.........................................ER
B1RXG0_UREUR/379-750...................................GK.........................................KD
MALP_UREPA/376-752...................................HK.........................................NN
Q9PR98_UREPA/413-786...................................KP..........................................R
Q6MSY9_MYCMS/283-769IQLKQLKLNFEDESGQIDKQIATTNRENTGIIDNLQKQKNELESKYKKDKDEISKLGKDGLVKWQQKQIQEYKEKKELKQ
Q98Q64_MYCPU/350-715...................................NA...................................NGEIEDAK
Q98QS3_MYCPU/339-702..............................................................................GN
Q7NAJ2_MYCGA/204-545...................................DSPIKQDNSN...........................HVSENAGD
Q4A7B5_MYCH7/323-738...................................LK.......................FRPDGGQGEPEYLDPKEIVH
Q98PH9_MYCPU/101-415...................................ID........................................QDG
Q8EWB5_MYCPE/130-442...................................MG...........................................
Q8EW95_MYCPE/145-484...................................TI...........................................
Y068_MYCGE/48-383...................................N............................................
Y084_MYCPN/45-410...................................D............................................
Y588_MYCPN/75-444...................................D............................................
Y395_MYCGE/89-428...................................D............................................
Y592_MYCPN/104-443...................................E............................................
Y083_MYCPN/52-447...................................Q............................................
Y582_MYCPN/44-388...................................K....................................TEKDKSQI
Q4A8M7_MYCH7/557-908...................................TESKNIIADFGAKVLEKDSINSSLRARSLVIQLRSNEYDRQTKTN
Q8EWN7_MYCPE/57-397...................................STNKAVY......................................
B1RXU5_UREUR/59-344...................................NN...........................................

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
POLG_POL1M/1566-1731--------------------------------------------------------------------------------
Q9DLK1_FMDVP/1643-1826--------------------------------------------------------------------------------

PF12380

Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF05409

R1A_CVH22/2994-3281--------------------------------------------------------------------------------
R1A_IBVB/2808-3096--------------------------------------------------------------------------------
B6VDX7_THCOV/2516-2804--------------------------------------------------------------------------------
R1AB_FIPV/2932-3219--------------------------------------------------------------------------------
R1A_CVHSA/3269-3559--------------------------------------------------------------------------------
R1A_CVMA5/3362-3648--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569--------------------------------------------------------------------------------
SP24D_ANOGA/50-264--------------------------------------------------------------------------------
TRY5_AEDAE/40-260--------------------------------------------------------------------------------
UROK_HUMAN/179-419--------------------------------------------------------------------------------
MASP1_MOUSE/454-696--------------------------------------------------------------------------------
CTR1_ANOGA/33-250--------------------------------------------------------------------------------
CFAD_HUMAN/26-248--------------------------------------------------------------------------------
ACRO_RAT/43-286--------------------------------------------------------------------------------
HPT_HUMAN/162-399--------------------------------------------------------------------------------
CASP_MESAU/445-682--------------------------------------------------------------------------------
A8JQZ2_DROME/186-427--------------------------------------------------------------------------------
PCE_TACTR/128-370--------------------------------------------------------------------------------
STUB_DROME/544-782--------------------------------------------------------------------------------
TRYU_DROME/28-254--------------------------------------------------------------------------------
TRYI_DROME/28-245--------------------------------------------------------------------------------
TRYB_MANSE/25-252--------------------------------------------------------------------------------
TRYP_FUSOX/25-244--------------------------------------------------------------------------------
B1VV86_STRGG/37-252--------------------------------------------------------------------------------
TRY1_HUMAN/24-239--------------------------------------------------------------------------------
TRYP_PIG/9-224--------------------------------------------------------------------------------
TRY1_SALSA/21-235--------------------------------------------------------------------------------
TRYP_PLEPL/23-242--------------------------------------------------------------------------------
DEGP3_ARATH/99-287--------------------------------------------------------------------------------
DEGP2_ARATH/121-308--------------------------------------------------------------------------------
E2X833_SHIDY/62-244--------------------------------------------------------------------------------
DEGS_HAEIN/37-240--------------------------------------------------------------------------------
YYXA_BACSU/99-283--------------------------------------------------------------------------------
DEGP_SALTY/97-278--------------------------------------------------------------------------------
Q44596_BRUAO/85-261--------------------------------------------------------------------------------
DEGPL_BRUA2/125-298--------------------------------------------------------------------------------
O06439_RHOCA/59-235--------------------------------------------------------------------------------
HHOA_SYNY3/95-274--------------------------------------------------------------------------------
HTRA_SYNY3/156-334--------------------------------------------------------------------------------
O42417_CHICK/87-286--------------------------------------------------------------------------------
A0A0E3T8P7_9CAUD/70-274--------------------------------------------------------------------------------
ETB_STAAU/59-251--------------------------------------------------------------------------------
SPLB_STAA9/37-234--------------------------------------------------------------------------------
SPLC_STAA9/38-233--------------------------------------------------------------------------------
MPR_BACSU/95-311--------------------------------------------------------------------------------
PRTC_STRGR/205-383--------------------------------------------------------------------------------
Q55353_STRSQ/198-372--------------------------------------------------------------------------------
Q55352_STRSQ/202-378--------------------------------------------------------------------------------
Q54395_STRLI/158-342--------------------------------------------------------------------------------
SP1_RARFA/205-391--------------------------------------------------------------------------------
CERC_SCHMA/28-256--------------------------------------------------------------------------------
Q54344_STRLI/47-254--------------------------------------------------------------------------------
CFAB_HUMAN/481-752--------------------------------------------------------------------------------
PROZ_BOVIN/143-352--------------------------------------------------------------------------------
CAC3_BOVIN/12-246--------------------------------------------------------------------------------
CELA1_PIG/27-259--------------------------------------------------------------------------------
CTRA_BOVIN/16-238--------------------------------------------------------------------------------
CTRL_HALRU/24-251--------------------------------------------------------------------------------
COGS_HYPLI/31-252--------------------------------------------------------------------------------
CTRB1_LITVA/46-263--------------------------------------------------------------------------------
CATG_MOUSE/21-238--------------------------------------------------------------------------------
MCPT2_RAT/21-239--------------------------------------------------------------------------------
ELNE_HUMAN/30-242--------------------------------------------------------------------------------
PRTN3_HUMAN/28-243--------------------------------------------------------------------------------
GRAK_RAT/26-248--------------------------------------------------------------------------------
GRAM_RAT/21-245--------------------------------------------------------------------------------
KLK1_MOUSE/25-253--------------------------------------------------------------------------------
KLK2_RAT/25-251--------------------------------------------------------------------------------
VSPCA_AGKCO/1-217--------------------------------------------------------------------------------
HGF_RAT/496-719--------------------------------------------------------------------------------
ENTK_PIG/800-1029--------------------------------------------------------------------------------
PRSS8_HUMAN/45-281--------------------------------------------------------------------------------
HGFA_HUMAN/408-641--------------------------------------------------------------------------------
TPA_HUMAN/311-556--------------------------------------------------------------------------------
H2Q7T9_PANTR/235-462--------------------------------------------------------------------------------
THRB_BOVIN/367-616--------------------------------------------------------------------------------
PROC_HUMAN/212-445--------------------------------------------------------------------------------

PF13365

A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
A0L9W3_MAGMM/126-265--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRADU/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
DEG15_ARATH/376-594--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
Q11LS4_CHESB/40-170--------------------------------------------------------------------------------
C6XD83_METGS/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6XBL7_METGS/51-179--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
B5HRW8_9ACTN/52-200--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
B9IN99_POPTR/46-189--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
B9M1H9_GEODF/322-480--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------

PF09342

Q7QJ48_ANOGA/1774-1887--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1523-1637--------------------------------------------------------------------------------
NUDEL_DROME/2041-2158--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

A1SA55_SHEAM/18-726--------------------------------------------------------------------------------
E0THX8_PARBH/23-721--------------------------------------------------------------------------------
F2GAE2_ALTMD/22-719--------------------------------------------------------------------------------
A5FMW8_FLAJ1/19-712--------------------------------------------------------------------------------
A6GWM2_FLAPJ/17-707--------------------------------------------------------------------------------
A6KZW8_BACV8/17-706--------------------------------------------------------------------------------
A6L2J7_BACV8/19-726--------------------------------------------------------------------------------
A6L2J8_BACV8/21-719--------------------------------------------------------------------------------
A6LID5_PARD8/19-717--------------------------------------------------------------------------------
A7HA06_ANADF/20-725--------------------------------------------------------------------------------
A7HFU9_ANADF/37-699--------------------------------------------------------------------------------
Q024G1_SOLUE/22-694--------------------------------------------------------------------------------
Q029T1_SOLUE/24-727--------------------------------------------------------------------------------
Q07XT1_SHEFN/18-727--------------------------------------------------------------------------------
Q08VC9_STIAD/18-714--------------------------------------------------------------------------------
Q11SC7_CYTH3/21-702--------------------------------------------------------------------------------
Q12RW4_SHEDO/18-728--------------------------------------------------------------------------------
Q1D5W7_MYXXD/35-700--------------------------------------------------------------------------------
Q1D9F6_MYXXD/17-714--------------------------------------------------------------------------------
Q1DDZ2_MYXXD/18-682--------------------------------------------------------------------------------
Q1GVV7_SPHAL/23-684--------------------------------------------------------------------------------
Q1IPC2_KORVE/27-692--------------------------------------------------------------------------------
Q2G546_NOVAD/56-713--------------------------------------------------------------------------------
Q2IEV3_ANADE/18-687--------------------------------------------------------------------------------
Q2S133_SALRD/5-639--------------------------------------------------------------------------------
Q2S134_SALRD/69-734--------------------------------------------------------------------------------
Q488S2_COLP3/26-729--------------------------------------------------------------------------------
Q5LIW7_BACFN/34-723--------------------------------------------------------------------------------
Q5QV86_IDILO/17-717--------------------------------------------------------------------------------
Q7MV25_PORGI/21-718--------------------------------------------------------------------------------
Q7MWU6_PORGI/24-711--------------------------------------------------------------------------------
Q7NHA9_GLOVI/34-698--------------------------------------------------------------------------------
Q7UKL5_RHOBA/28-688--------------------------------------------------------------------------------
Q8A2L6_BACTN/20-711--------------------------------------------------------------------------------
B2FQN5_STRMK/22-717--------------------------------------------------------------------------------
E3FSI6_STIAD/18-681--------------------------------------------------------------------------------
Q5LB16_BACFN/20-719--------------------------------------------------------------------------------
Q8EAI4_SHEON/18-728--------------------------------------------------------------------------------
Q8EHX9_SHEON/18-716--------------------------------------------------------------------------------
Q9PC94_XYLFA/22-713--------------------------------------------------------------------------------
R5U6M0_9BACE/21-717--------------------------------------------------------------------------------
R6WQY4_9PORP/22-710--------------------------------------------------------------------------------
R6Y7C6_9PORP/19-717--------------------------------------------------------------------------------
R7EE18_9BACE/20-708--------------------------------------------------------------------------------
R7EGG9_9BACE/23-719--------------------------------------------------------------------------------

PF00863

POLG_SPMMV/2424-2646--------------------------------------------------------------------------------
POLG_RGMVD/1998-2230--------------------------------------------------------------------------------

PF03761

Q9U2W2_CAEEL/6-282--------------------------------------------------------------------------------
Q21628_CAEEL/5-298--------------------------------------------------------------------------------
O45371_CAEEL/3-276--------------------------------------------------------------------------------
O76649_CAEEL/2-297--------------------------------------------------------------------------------
A8XIB1_CAEBR/15-285--------------------------------------------------------------------------------
A8WNY9_CAEBR/3-296--------------------------------------------------------------------------------
Q9XWZ8_CAEEL/4-272--------------------------------------------------------------------------------
O62223_CAEEL/7-278--------------------------------------------------------------------------------
O62231_CAEEL/5-272--------------------------------------------------------------------------------

PF00944

POLS_SFV/112-268--------------------------------------------------------------------------------
POLS_SINDV/107-265--------------------------------------------------------------------------------

PF05580

E3E859_PAEPS/156-365--------------------------------------------------------------------------------
B2A522_NATTJ/220-428--------------------------------------------------------------------------------
R6EU85_9FIRM/240-448--------------------------------------------------------------------------------
R5R857_9FIRM/209-435--------------------------------------------------------------------------------
D5DLD9_BACMD/201-410--------------------------------------------------------------------------------
R5E7E8_9CLOT/153-360--------------------------------------------------------------------------------
H6NL93_9BACL/216-425--------------------------------------------------------------------------------
D9QRU2_ACEAZ/227-436--------------------------------------------------------------------------------
R5C627_9FIRM/190-398--------------------------------------------------------------------------------
R7M5P2_9CLOT/115-318--------------------------------------------------------------------------------
R5H148_9FIRM/298-508--------------------------------------------------------------------------------
R6AIL9_9CLOT/311-520--------------------------------------------------------------------------------
R7FQ12_9CLOT/119-323--------------------------------------------------------------------------------
F6DU87_DESRL/210-419--------------------------------------------------------------------------------
R6R0T0_9FIRM/204-412--------------------------------------------------------------------------------
D4J425_9FIRM/145-352--------------------------------------------------------------------------------
R5YSC4_9FIRM/173-380--------------------------------------------------------------------------------
R5J4I1_9FIRM/118-321--------------------------------------------------------------------------------
R6Y3R6_9FIRM/105-307--------------------------------------------------------------------------------
I4D8U8_DESAJ/208-416--------------------------------------------------------------------------------
R5A2Q9_9CLOT/168-371--------------------------------------------------------------------------------
A4XKP9_CALS8/199-405--------------------------------------------------------------------------------
R7HFV6_9MOLU/114-314--------------------------------------------------------------------------------
R5MBH1_9MOLU/116-319--------------------------------------------------------------------------------
B0TEK3_HELMI/215-424--------------------------------------------------------------------------------
R7K6P1_9FIRM/158-362--------------------------------------------------------------------------------
R6WI32_9FIRM/144-352--------------------------------------------------------------------------------
C4ZCY0_EUBR3/233-444--------------------------------------------------------------------------------
R7FE29_9FIRM/75-280--------------------------------------------------------------------------------
R7KE68_9FIRM/124-326--------------------------------------------------------------------------------
Q8XJE5_CLOPE/171-380--------------------------------------------------------------------------------
D4LFB6_RUMC1/188-392--------------------------------------------------------------------------------
R6RRV8_9FIRM/198-401--------------------------------------------------------------------------------
R7B468_9CLOT/225-433--------------------------------------------------------------------------------
G7M128_9CLOT/180-389--------------------------------------------------------------------------------
U5S0W6_9CLOT/60-268--------------------------------------------------------------------------------
R5KFR6_9CLOT/196-405--------------------------------------------------------------------------------
R7QW48_9FIRM/197-405--------------------------------------------------------------------------------
R6BUQ9_9FIRM/202-410--------------------------------------------------------------------------------
R7MCE1_9CLOT/114-318--------------------------------------------------------------------------------
A5D302_PELTS/204-413--------------------------------------------------------------------------------
E6UBW1_RUMA7/187-391--------------------------------------------------------------------------------
R5PM12_9CLOT/193-402--------------------------------------------------------------------------------
R5CZB6_9FIRM/133-338--------------------------------------------------------------------------------
R6SMI2_9CLOT/138-343--------------------------------------------------------------------------------
A4J3G7_DESRM/210-419--------------------------------------------------------------------------------
E6U2J4_ETHHY/189-392--------------------------------------------------------------------------------
R5SUE4_9CLOT/122-326--------------------------------------------------------------------------------
R6XJ65_9FIRM/124-325--------------------------------------------------------------------------------
R6QNQ2_9CLOT/190-395--------------------------------------------------------------------------------
R6KNJ0_9CLOT/215-423--------------------------------------------------------------------------------
R6T3R8_9FIRM/188-393--------------------------------------------------------------------------------
R7HTV5_9CLOT/214-418--------------------------------------------------------------------------------
R5VVX1_9FIRM/191-398--------------------------------------------------------------------------------
R5TNP7_9FIRM/195-403--------------------------------------------------------------------------------
Q18B75_PEPD6/138-350--------------------------------------------------------------------------------
G2T3Q8_ROSHA/203-410--------------------------------------------------------------------------------
R6GHR5_9CLOT/190-395--------------------------------------------------------------------------------
E6TXR0_BACCJ/201-410--------------------------------------------------------------------------------
R6KEA9_9FIRM/207-412--------------------------------------------------------------------------------
R7IWD1_9CLOT/192-400--------------------------------------------------------------------------------
R5VVV3_9DELT/153-356--------------------------------------------------------------------------------
R6I8W6_9FIRM/181-382--------------------------------------------------------------------------------
R7GGP8_9CLOT/117-316--------------------------------------------------------------------------------
R5J7S8_9CLOT/122-325--------------------------------------------------------------------------------
R6FK23_9FIRM/138-346--------------------------------------------------------------------------------
R7P923_9CLOT/115-318--------------------------------------------------------------------------------
R5KUR7_9CLOT/197-401--------------------------------------------------------------------------------
I3VWM7_THESW/214-421--------------------------------------------------------------------------------
R6B2V6_9CLOT/193-402--------------------------------------------------------------------------------
R7DMS2_9FIRM/123-328--------------------------------------------------------------------------------
R5KNW9_9FIRM/197-403--------------------------------------------------------------------------------
R7NI61_9MOLU/101-304--------------------------------------------------------------------------------
F2JMG1_CELLD/213-423--------------------------------------------------------------------------------
K4L254_9FIRM/158-366--------------------------------------------------------------------------------
R6GNM4_9FIRM/130-329--------------------------------------------------------------------------------
R6Q3J2_9FIRM/197-399--------------------------------------------------------------------------------
R6N1E9_9FIRM/118-320--------------------------------------------------------------------------------
R5SZK8_9CLOT/120-323--------------------------------------------------------------------------------
R5YCX5_9FIRM/210-420--------------------------------------------------------------------------------
R7C759_9CLOT/199-406--------------------------------------------------------------------------------
W0E9D2_9FIRM/204-412--------------------------------------------------------------------------------
Q894H5_CLOTE/186-394--------------------------------------------------------------------------------
C9R866_AMMDK/202-412--------------------------------------------------------------------------------
R7HB69_9FIRM/198-403--------------------------------------------------------------------------------
A6TR47_ALKMQ/212-421--------------------------------------------------------------------------------
R7ESB8_9FIRM/150-355--------------------------------------------------------------------------------
R6PKG4_9CLOT/142-350--------------------------------------------------------------------------------
R7M6Q4_9CLOT/189-398--------------------------------------------------------------------------------
Q0AZD6_SYNWW/215-423--------------------------------------------------------------------------------
R7N4W4_9FIRM/233-441--------------------------------------------------------------------------------
R6YA95_9FIRM/170-373--------------------------------------------------------------------------------
D5WV97_KYRT2/203-412--------------------------------------------------------------------------------
R5LXL5_9FIRM/207-415--------------------------------------------------------------------------------
R5DF89_9FIRM/134-342--------------------------------------------------------------------------------
R6TFF4_9STAP/123-324--------------------------------------------------------------------------------
A5I2Z7_CLOBH/190-399--------------------------------------------------------------------------------
R6H4Q6_9CLOT/93-302--------------------------------------------------------------------------------
R6R368_9FIRM/120-325--------------------------------------------------------------------------------
A3DDL9_CLOTH/220-429--------------------------------------------------------------------------------
D3E6N1_GEOS4/216-425--------------------------------------------------------------------------------
F9VK25_ARTSS/181-387--------------------------------------------------------------------------------
R5QQG0_9FIRM/120-319--------------------------------------------------------------------------------
G8LW28_CLOCD/215-424--------------------------------------------------------------------------------
R7L0T4_9FIRM/128-333--------------------------------------------------------------------------------
L7VQQ3_CLOSH/211-420--------------------------------------------------------------------------------
C8WXF9_ALIAD/189-396--------------------------------------------------------------------------------
Q2RIC4_MOOTA/204-410--------------------------------------------------------------------------------
R4KQW9_9FIRM/233-441--------------------------------------------------------------------------------
A9KMA5_CLOPH/226-440--------------------------------------------------------------------------------
E6SKR3_THEM7/213-420--------------------------------------------------------------------------------
L0F7L5_DESDL/201-409--------------------------------------------------------------------------------
I0JNU1_HALH3/190-399--------------------------------------------------------------------------------
R7EZR7_9BACI/119-323--------------------------------------------------------------------------------
R6J055_9CLOT/188-393--------------------------------------------------------------------------------
R5NUG0_9CLOT/150-357--------------------------------------------------------------------------------
G2TKW2_BACCO/202-410--------------------------------------------------------------------------------
R5N690_9FIRM/195-399--------------------------------------------------------------------------------
R5VHC6_9FIRM/116-319--------------------------------------------------------------------------------
R5NBK1_9CLOT/140-350--------------------------------------------------------------------------------
R5XPM2_9FIRM/142-350--------------------------------------------------------------------------------
D5X7G9_THEPJ/215-423--------------------------------------------------------------------------------
F4A1F9_MAHA5/216-427--------------------------------------------------------------------------------
R7ITE0_9FIRM/153-365--------------------------------------------------------------------------------
F6CL40_DESK7/196-404--------------------------------------------------------------------------------
L0EG06_THECK/215-424--------------------------------------------------------------------------------
R5IDG3_9CLOT/215-423--------------------------------------------------------------------------------
R6CTL1_9CLOT/120-324--------------------------------------------------------------------------------
K0B195_CLOA9/214-422--------------------------------------------------------------------------------
B8D2I8_HALOH/212-421--------------------------------------------------------------------------------
R6NNU0_9FIRM/215-423--------------------------------------------------------------------------------
R6VE05_9FIRM/190-398--------------------------------------------------------------------------------
R6CN52_9FIRM/195-397--------------------------------------------------------------------------------
R5H2U4_9FIRM/161-364--------------------------------------------------------------------------------
R5V409_9FIRM/42-246--------------------------------------------------------------------------------
R6GW98_9FIRM/112-314--------------------------------------------------------------------------------
R7ICH4_9FIRM/201-410--------------------------------------------------------------------------------
R7BI76_9FIRM/225-433--------------------------------------------------------------------------------
C4Z0G6_EUBE2/204-408--------------------------------------------------------------------------------
R6NHB7_9CLOT/187-390--------------------------------------------------------------------------------
R7R973_9FIRM/209-417--------------------------------------------------------------------------------
R5HM74_9FIRM/194-402--------------------------------------------------------------------------------
R6NAF9_9FIRM/131-335--------------------------------------------------------------------------------
D9SLV5_CLOC7/152-361--------------------------------------------------------------------------------
R5RSY4_9FIRM/191-399--------------------------------------------------------------------------------
R6HAH9_9FIRM/115-318--------------------------------------------------------------------------------
R5XRH8_9CLOT/130-334--------------------------------------------------------------------------------
R7FZ38_9FIRM/124-328--------------------------------------------------------------------------------
R5I6P6_9FIRM/190-402--------------------------------------------------------------------------------
B8I3A0_CLOCE/216-424--------------------------------------------------------------------------------
R6DXQ1_9FIRM/188-391--------------------------------------------------------------------------------
R5E160_9FIRM/211-416--------------------------------------------------------------------------------
Q97HE0_CLOAB/180-389--------------------------------------------------------------------------------
R6M2Z6_9CLOT/206-414--------------------------------------------------------------------------------
D6DLB6_CLOSC/286-502--------------------------------------------------------------------------------
R6RY05_9CLOT/215-423--------------------------------------------------------------------------------
F4LV06_TEPAE/231-436--------------------------------------------------------------------------------
R6UED3_9CLOT/182-387--------------------------------------------------------------------------------
R5AES8_9CLOT/42-250--------------------------------------------------------------------------------
B2TRL9_CLOBB/180-389--------------------------------------------------------------------------------
R5D6V9_9FIRM/122-319--------------------------------------------------------------------------------
D7CKI9_SYNLT/219-426--------------------------------------------------------------------------------
R5TH80_9CLOT/132-335--------------------------------------------------------------------------------
R5MT91_9FIRM/111-313--------------------------------------------------------------------------------
R6YLB5_9CLOT/118-321--------------------------------------------------------------------------------
R6MJ71_9FIRM/142-350--------------------------------------------------------------------------------
D4M5K6_9FIRM/149-357--------------------------------------------------------------------------------
D9S3S9_THEOJ/214-422--------------------------------------------------------------------------------
F6B9N5_DESCC/210-419--------------------------------------------------------------------------------
R6TLY4_9FIRM/137-344--------------------------------------------------------------------------------
R5ZMQ1_9CLOT/199-408--------------------------------------------------------------------------------
Q67NC5_SYMTH/207-416--------------------------------------------------------------------------------
R6TRP0_9CLOT/120-323--------------------------------------------------------------------------------
R7L6Y3_9CLOT/233-442--------------------------------------------------------------------------------
R6BNR4_9CLOT/114-319--------------------------------------------------------------------------------
Q9K975_BACHD/212-422--------------------------------------------------------------------------------
D4KCM7_9FIRM/192-394--------------------------------------------------------------------------------
R5QDI6_9FIRM/145-349--------------------------------------------------------------------------------
B1I568_DESAP/211-420--------------------------------------------------------------------------------
R5NSK8_9FIRM/199-407--------------------------------------------------------------------------------
R6ZZF6_9FIRM/208-413--------------------------------------------------------------------------------
R6L493_9FIRM/190-397--------------------------------------------------------------------------------
A8MFI3_ALKOO/213-422--------------------------------------------------------------------------------
Q8RAC0_CALS4/204-412--------------------------------------------------------------------------------
R6G9J9_9FIRM/191-398--------------------------------------------------------------------------------
R5HAQ1_9FIRM/145-350--------------------------------------------------------------------------------
K4LFQ1_THEPS/206-415--------------------------------------------------------------------------------
W6RY93_9CLOT/148-357--------------------------------------------------------------------------------
R5UHP5_9FIRM/212-422--------------------------------------------------------------------------------
R7G2H0_9FIRM/142-350--------------------------------------------------------------------------------
R6WHU5_9CLOT/131-335--------------------------------------------------------------------------------
R6S308_9FIRM/142-350--------------------------------------------------------------------------------
R5B250_9CLOT/200-409--------------------------------------------------------------------------------
R5SFB7_9FIRM/137-344--------------------------------------------------------------------------------
R6GC90_9FIRM/150-358--------------------------------------------------------------------------------
D9R8M8_CLOSW/214-422--------------------------------------------------------------------------------
R5RQY0_9FIRM/121-325--------------------------------------------------------------------------------
R5LJL6_9MOLU/118-321--------------------------------------------------------------------------------
R7AQT1_9BACE/225-434--------------------------------------------------------------------------------
X4ZLT8_9BACL/99-308--------------------------------------------------------------------------------
F8I8Y9_SULAT/220-427--------------------------------------------------------------------------------
R6MC60_9CLOT/122-326--------------------------------------------------------------------------------
R6TCX6_9FIRM/135-339--------------------------------------------------------------------------------
R6R1J4_9FIRM/212-417--------------------------------------------------------------------------------
R6YL37_9CLOT/139-347--------------------------------------------------------------------------------
R5XPM6_9FIRM/190-397--------------------------------------------------------------------------------
A0Q0A9_CLONN/187-396--------------------------------------------------------------------------------
D4LPR1_9FIRM/190-397--------------------------------------------------------------------------------
R7DAB6_9FIRM/190-397--------------------------------------------------------------------------------
C0ZC15_BREBN/214-423--------------------------------------------------------------------------------
R6QE36_9FIRM/194-400--------------------------------------------------------------------------------
R5K6N9_9CLOT/167-373--------------------------------------------------------------------------------
R6ZCY0_9FIRM/221-429--------------------------------------------------------------------------------
R5HLI4_9MOLU/115-317--------------------------------------------------------------------------------
R6NKY3_9CLOT/194-403--------------------------------------------------------------------------------
R5JXE7_9FIRM/156-361--------------------------------------------------------------------------------
R5AF90_9FIRM/133-337--------------------------------------------------------------------------------
R5TU24_9FIRM/139-347--------------------------------------------------------------------------------
R6P0Q8_9CLOT/193-398--------------------------------------------------------------------------------
R6DUC4_9FIRM/127-333--------------------------------------------------------------------------------
R7F4Z6_9CLOT/192-401--------------------------------------------------------------------------------
R6X4M8_9FIRM/136-339--------------------------------------------------------------------------------
R6EKK3_9FIRM/143-351--------------------------------------------------------------------------------
Q5WF67_BACSK/198-409--------------------------------------------------------------------------------
R7JU02_9FIRM/197-405--------------------------------------------------------------------------------
G4KYV3_OSCVS/185-393--------------------------------------------------------------------------------
Q3AAN6_CARHZ/163-370--------------------------------------------------------------------------------
R5VSI3_9CLOT/190-396--------------------------------------------------------------------------------
R7MHL3_9FIRM/193-401--------------------------------------------------------------------------------
R6RU79_9FIRM/211-417--------------------------------------------------------------------------------
R6Q618_9FIRM/189-393--------------------------------------------------------------------------------
R7K1G6_9CLOT/231-438--------------------------------------------------------------------------------
L0K691_HALHC/216-425--------------------------------------------------------------------------------
R5FFJ0_9FIRM/179-381--------------------------------------------------------------------------------
R7G6U2_9FIRM/124-329--------------------------------------------------------------------------------
R5G573_9FIRM/138-340--------------------------------------------------------------------------------
K0IY14_AMPXN/203-412--------------------------------------------------------------------------------
R6USZ2_9FIRM/121-326--------------------------------------------------------------------------------
R6PFE8_9FIRM/190-396--------------------------------------------------------------------------------
F0T085_SYNGF/158-366--------------------------------------------------------------------------------
R7HK64_9FIRM/123-327--------------------------------------------------------------------------------
R6AWH8_9CLOT/116-318--------------------------------------------------------------------------------
R6FWG8_9CLOT/176-385--------------------------------------------------------------------------------
R4KDG0_CLOPA/191-400--------------------------------------------------------------------------------
R5QW36_9FIRM/145-353--------------------------------------------------------------------------------
R6CRQ2_9CLOT/225-433--------------------------------------------------------------------------------
R7KGU6_9CLOT/125-328--------------------------------------------------------------------------------
R6U8G2_9CLOT/145-349--------------------------------------------------------------------------------
R5A3A4_9CLOT/113-318--------------------------------------------------------------------------------
R5J0Y5_9FIRM/121-325--------------------------------------------------------------------------------
D4MXQ8_9FIRM/198-400--------------------------------------------------------------------------------
Q8EQ48_OCEIH/176-385--------------------------------------------------------------------------------
R5YPZ4_9MOLU/74-277--------------------------------------------------------------------------------
SP4B_BACSU/203-412--------------------------------------------------------------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

POLG_BVDVN/1680-1890--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782--------------------------------------------------------------------------------
IGA0_HAEIN/17-865--------------------------------------------------------------------------------
Q5F9W2_NEIG1/19-848--------------------------------------------------------------------------------

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268RAARAVAY--A-SCIQSAITSI----------------------------------------LQIAGSALVVNRAVKRMF
Q9YQ23_VESV/628-1162AAARAVTY--W-SLAANLVTTT----------------------------------------IQAAASALVVHRAVQRI.
Q80J95_9CALI/650-1163KEARLRCY--C-RMAADVITSI----------------------------------------LQAAGTAFSIYHQIEKR.
Q8JJL0_9CALI/645-1175RQARARYY--I-SCFQDLVYTL----------------------------------------IQVAGASFVVNRISKRF.
Q80RD7_9CALI/641-1177RCARIRYY--V-KCVQEALYSI----------------------------------------IQIAGAAFVTTRIVKRM.

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321-----VED--VFANFFAKKERS------------------------------DELLTRYYGKVVQK-------GNKLMVK
POLG_TUMVJ/107-361-----HEE--ANKERALFLDWE------------------------------ASLKRSSYGIAENE-------KVVMTTR
Q85074_9POTV/144-397-----AAL--QLAVAKATIARE------------------------------EKIKQAALSKFDKN-------SQVKHTG
POLG_ZYMVR/71-312-----FDT--DPEMRFRLTRNE------------------------------.....MSKVKKGPN-------GRMILRK
P90213_9POTV/300-546-----HKE--HAKIEAIRVRKE------------------------------KERDQRIFAALEAK-------LNLGTRR
POLG_PEMVC/44-286-----AEL--EKHLEPYLQKRM------------------------------.....DATIRQTKG-------GTLVYKH
POLG_TVMV/30-273-----KDI--FSSIKERLERKR------------------------------.....HGKICRMKN-------GSIYIKA
POLG_RGMVD/13-255-----QVD--GTWVPRVFEEKE------------------------------MARLLAEKQHARVM-------RATQEMM
POLG_LMV0/179-436-----AQM--EVDKAEQDLAFA------------------------------CLNASLKPRLEGRT-------TATIARR
POLG_PVMA/45-297-----EFT--LAKSLQRQAHGV------------------------------VKVDKHGTARIKRA-------SKHHMSC
POLG_PSBMV/143-396-----ARL--QAAVAKSTIERE------------------------------EKERQFAFSKLEEK-------LRARREK
Q82933_9POTV/2-236-----AGE--WNTVVGKRNQR.------------------------------.......KTEEQRI-------FDAQKRF
POLG_PVYN/41-283-----ADL--ETQLSARLLKQK------------------------------.....YATVRVLKN-------GTFTYRY
Q65892_BYMV/40-283-----ADL--EMRCAERVKR..------------------------------.....MGELCFSKK-------GRYITMI
POLG_BCMNN/77-316-----LKK--NSDLQKRLFIGQ------------------------------.....NSPIKQKKG-------GACFVRS
POLG_ZYMVC/70-309-----FST--D.EMKFRLTRNE------------------------------.....MSKLKKGPS-------GRIVLRK
Q65852_BYMV/40-283-----SDL--EARCAERLKR..------------------------------.....MGELCFSRR-------GRYTTMV
POLG_SBMVG/69-307-----FDQ--DVGIQRRLLVNK------------------------------.....HSSIQSTKE-------GWFDLAS
O73463_MDMV/2-232-----AGT--WTHVTHKWQP..------------------------------.....NLDN.PRDV-------RRIMELF
POLG_PVYHU/41-283-----ASL--EMQLSARLRRQE------------------------------.....FATIRTSKN-------GTCMYRY
POLG_PPVD/59-307-----TAS--AWKGLEEKLQPM------------------------------FAKREFSKTVTKRK-------GLRCFKE
Q85057_9POTV/204-442-----MQQ--NSALQRKLLIQQ------------------------------.....QSTIEQRPK-------GAVQLRF
O39734_9POTV/410-663-----TQQ--AAAEKEKLVWKK------------------------------LDEQLATRNEIRKD-------LKVKWRW
POLG_ZYMVS/71-312-----FNN--DPEDAFRLTRNG------------------------------.....MSKVKKGPN-------GRIILRK
POLG_PRSVH/300-546-----HKE--HAKIAAIQVQKE------------------------------REKDQKVFSALELR-------LNLKSRR
POLG_TEV/53-303-----VIF--GEDYITEADLPY------------------------------TPLHLEVDAEMERM-------YYLGRRA

PF00949

Y298_MYCGA/335-468-----------WPTTPQY---------------------------TKFSV------PSLS--..RR-------Q......
Y577_MYCPN/197-333-----------VESNIAA---------------------------LNLNQ------TEVK--PTRP-------E......
Y589_MYCPN/14-134-----------FEWTKTE---------------------------QRFNH------DDFY--.GSM-------P......
Y591_MYCPN/171-291-----------WECKQGA---------------------------ER.FS------YGYF--YSNM-------A......
Y586_MYCPN/154-286-----------YLLGYPF---------------------------LRNKA------ASLF--LNQT-------EQRKEHM
POLG_YEFV1/1503-1655-----------.HLEDGI---------------------------YGIFQ------STFL--.GAS-------Q......
POLG_DEN1W/1493-1642-----------..LDDGI---------------------------YRILQ------RGLL--.GRS-------Q......

PF01732

A5IYK2_MYCAP/279-649NFARHSGT--AWVIDRVKT..........................TNTDY......YELL--IATN-------IHVFS.L
Q6MUH9_MYCMS/258-617NFANASGT--AWVIDRIDNK.........................EDKNN......YKLL--LATN-------IHVFS.L
Q2SR25_MYCCT/264-622NFANASGT--AWIIDRIKN..........................DDKDN......YELL--LATN-------IHVFN.L
D3VQF5_MYCA6/359-733ATSQTVGT--VWVMDRIISPEA.......................EKDDS......YELL--LATN-------VHVFN.L
Q4A635_MYCS5/147-497...TIAGT--AWVLDYHYDK.........................NNPKE......ITLY--LATN-------FHVATNL
Q4A5A2_MYCS5/91-491...SYVGT--MWLLDYQK...........................ISDTQ......YKMF--FGTN-------FHVAAGI
C7LM95_MYCML/189-571SLSNGTGT--GWLLDYHKY..........................NNENK......YKLF--LATN-------LHVLSEF
A5IYA1_MYCAP/186-569LLSDGTGT--AWLLDYHKYT.........................NSDNK......YKLF--LGTN-------LHVLARF
Q4A798_MYCH7/125-523FLATENGT--IWLLDYHK...........................KDENN......YKLF--FATN-------LHVASHL
Q4A5G2_MYCS5/337-740WVGTLGGT--AWLLDYHKNT.........................QNPNK......YKLF--LATN-------LHVIGYL
Q7NC63_MYCGA/244-661HPIVDQGT--GWVLDYAKNS.........................SNNNQ......LKLF--IATN-------LHVIGNY
C5J6P1_MYCCR/115-482VPYEPTGT--GWLLDAAYN..........................QNKTE......VMLY--IATN-------AHVFARS
Q7NAU7_MYCGA/221-623LYYLNNGT--GWLLDYQVSP.........................QNPDL......YRLF--LATN-------LHVAQTL
Q7NAG1_MYCGA/203-712AYLTYRGT--AWILDYELD..........................SNGYP......TKWY--LATN-------AHVAAGF
Q7NAF2_MYCGA/203-710SSLTYKGT--AWILDYELD..........................DSGYP......TKWY--LATN-------AHVAAAL
Q4A5P6_MYCS5/166-643TVKTNKGT--AWILDYVKPN.........................DSSYP......TKWY--IATN-------IHVIGDL
D1J8A8_MYCHP/334-723KFTNTAGT--TWIMDYQQRS.........................DGKYP......TKWY--FATN-------LHVAD..
B1RXG0_UREUR/379-750TWDKSSGT--TWILDYQKTN.........................DDKYP......TKWY--FATN-------LHVAD..
MALP_UREPA/376-752TYNKTAGT--TWILDYQKTS.........................DNKYP......TKWY--FATN-------LHVAD..
Q9PR98_UREPA/413-786ESDVVAGT--MWIMDYQKRN.........................DNKYP......TKWY--FGTN-------LHVAE..
Q6MSY9_MYCMS/283-769FQASESGT--MWIMDYLTEN.........................DGKNP......TKFY--FGTN-------SHVAK..
Q98Q64_MYCPU/350-715VSTKDIGT--MWILDYEKTN.........................NGKYP......TKWY--FGTN-------VHVID..
Q98QS3_MYCPU/339-702LANTNSGT--MWILDYVKEP.........................NKAYP......TKWL--FATN-------VHVSS..
Q7NAJ2_MYCGA/204-545NVGNWSGT--AWLLDYDLTS.........................DNSYP......TTWY--FASN-------FHVLQHL
Q4A7B5_MYCH7/323-738FSKGFHGT--MNILDYKKED.........................GQKYP......LTWY--FITN-------AHVLNRL
Q98PH9_MYCPU/101-415KPAKASGT--TWILDYQLTE.........................DGSYP......LTWY--FATN-------AHVATYF
Q8EWB5_MYCPE/130-442...INSGT--GWILDYKLTQD........................SSSYP......LTWY--FATN-------AHVIQNL
Q8EW95_MYCPE/145-484......GT--AWILDYKLTS.........................DNSYP......LTWY--FGTN-------AHVIDDL
Y068_MYCGE/48-383....TYGT--GWLIDWKGDENNP......................EKNDP......FKVY--LATN-------LHVIDAL
Y084_MYCPN/45-410....SYGT--GWLIDWKGDENKP......................SNTDP......FLIY--LATN-------LHVVDAL
Y588_MYCPN/75-444....IYGT--GWLFDWKGDEKALGIDGSFVPSITSNIDNSL....LKDDQ......FTVY--LATN-------LHVADAL
Y395_MYCGE/89-428....SYGT--GWLIDWKGDENTT......................QKQGS......FFAY--IATN-------LHVADGL
Y592_MYCPN/104-443....AYGT--GWLIDWKDV..........................KQDNK......FTAY--LATN-------LHVADSL
Y083_MYCPN/52-447....EFGT--GWLIDWKGDENKNLSKNKEGQTASQTRSSSEQTTDQDANL......FTAY--IATN-------LHVADGL
Y582_MYCPN/44-388DFGSIHGT--GWLIDWKEVDKKD......................KKANK......FTVY--LATN-------LHVIQAL
Q4A8M7_MYCH7/557-908TSKITSGT--AWVFDRKLKK.........................DPKNPGKFLPTNTYY--LATN-------LHVIADL
Q8EWN7_MYCPE/57-397....EFGT--AWIYAKEAN..........................QGSND......FSYY--LATN-------MHVLSNL
B1RXU5_UREUR/59-344QAINIFGT--GWIFDFQEDP.........................ITENI......KTYY--LATN-------IHVINLI

PF12381

Q6EEL1_9SECO/2617-2847----------DKGLAKDPNMVT------------------------------------ILTDKLIN-------ISAV---
O11979_9SECO/2603-2833----------YKSLDKDPNMVS------------------------------------ILSNQLTK-------ISCV---
Q1MNG4_9SECO/2627-2857----------RAGVDRDLSMTN------------------------------------LIDTHMAG-------MSCI---

PF00548

Q8JJT0_PSV13/1680-1844----------GPDMEF---AKS------------------------------------IMRSNLCQ-------VTT.---
POLG_HRV8A/1522-1687----------GPEEEF---GRS------------------------------------LLKHNCCV-------VTT.---
Q66776_ERBV1/1905-2095----------STGLTV---NSL------------------------------------SLLNNVVP-------VTVS---
POLG_HPE2W/1517-1692----------APYDGQ---LEH------------------------------------IISQMAYI-------TGS.---
POLG_POL1M/1566-1731----------GPGFDY---AVA------------------------------------MAKRNIVT-------ATT.---
Q9DLK1_FMDVP/1643-1826----------.PPTDL---.QK------------------------------------MVMGNTKP-------VELI---

PF12380

Q9IHZ8_GAVAU/2823-3106---------------F---LVG------------------------------------LVTHEVRT-------GNAT---

PF05409

R1A_CVH22/2994-3281----------GLWLGDIVYCPR------------------------------------HVIASNTT-------SA.I---
R1A_IBVB/2808-3096----------GLWLGDTIYCPR------------------------------------HVLGKFSG-------...D---
B6VDX7_THCOV/2516-2804----------GIWLNNVVYCPR------------------------------------HVFGKFKG-------...E---
R1AB_FIPV/2932-3219----------GLWLGDEVICPR------------------------------------HVIASDTS-------RV.I---
R1A_CVHSA/3269-3559----------GLWLDDTVYCPR------------------------------------HVICTAED-------MLNP---
R1A_CVMA5/3362-3648----------GLWLDDKVYCPR------------------------------------HVICSSAD-------MTDP---

PF00089

CFAI_HUMAN/340-569----ITCG--G-IY----IGGC----------------------------------..WI--L.TA-------AHCL-RA
SP24D_ANOGA/50-264----LTCG--G-SL----IESR----------------------------------..WV--L.TA-------AHCV-YN
TRY5_AEDAE/40-260----HFCG--G-SL----LSER----------------------------------..WV--M.TA-------GHCA-AS
UROK_HUMAN/179-419----YVCG--G-SL----ISPC----------------------------------..WV--I.SA-------THCF-ID
MASP1_MOUSE/454-696----PFCG--G-SL----LGSN----------------------------------..WV--L.TA-------AHCL-HQ
CTR1_ANOGA/33-250----HNCG--G-SL----LNDR----------------------------------..WV--L.TA-------AHCL-VG
CFAD_HUMAN/26-248----HLCG--G-VL----VAEQ----------------------------------..WV--L.SA-------AHCL-ED
ACRO_RAT/43-286----HACG--G-SL----LNSH----------------------------------..WV--L.TA-------AHCF-DN
HPT_HUMAN/162-399----LTTG--A-TL----INEQ----------------------------------..WL--LTTA-------KNLF-LN
CASP_MESAU/445-682----..AG--G-AL----IGEH----------------------------------..WV--L.TA-------AHVV-EG
A8JQZ2_DROME/186-427----WGCG--G-AL----VSEL----------------------------------..YV--L.TA-------AHCA-TS
PCE_TACTR/128-370----VQCG--G-AL----VTNR----------------------------------..HV--I.TA-------SHCV-VN
STUB_DROME/544-782----HRCG--G-AL----INEN----------------------------------..WI--A.TA-------GHCV-DD
TRYU_DROME/28-254----QTCG--G-CI----LDAV----------------------------------..TI--A.TA-------AHCV-YN
TRYI_DROME/28-245----HECG--G-VI----YSKE----------------------------------..II--I.TA-------GHCL-HE
TRYB_MANSE/25-252----QACG--G-II----LNNR----------------------------------..NI--L.TA-------AHCP-HG
TRYP_FUSOX/25-244----PWCG--G-SL----LNAN----------------------------------..TV--L.TA-------AHCV-SG
B1VV86_STRGG/37-252----..CG--G-AL----YAQD----------------------------------..IV--L.TA-------AHCV-SG
TRY1_HUMAN/24-239----HFCG--G-SL----INEQ----------------------------------..WV--V.SA-------GHCY-KS
TRYP_PIG/9-224----HFCG--G-SL----INSQ----------------------------------..WV--V.SA-------AHCY-KS
TRY1_SALSA/21-235----HFCG--G-SL----VNEN----------------------------------..WV--V.SA-------AHCY-KS
TRYP_PLEPL/23-242----HFCG--G-VL----INNQ----------------------------------..WV--L.SV-------AHCW-YN
DEGP3_ARATH/99-287----....--G-FV----ISGK----------------------------------..KI--L.TN-------AHVV-AN
DEGP2_ARATH/121-308----....--A-FM----IGDG----------------------------------..KL--L.TN-------AHCV-EH
E2X833_SHIDY/62-244----....--G-VI----MDQR----------------------------------.GYI--I.TN-------KHVI-ND
DEGS_HAEIN/37-240----.FSS--A-SI----NDND----------------------------------..Q.--L.QV-------NNLG-SG
YYXA_BACSU/99-283----....--.-.D----HSA.----------------------------------..YV--V.TN-------HHVI-EG
DEGP_SALTY/97-278----....--G-VI----IDAA----------------------------------KGYV--V.TN-------NHVV-DN
Q44596_BRUAO/85-261----....--G-VI----VDRS----------------------------------.GII--V.TN-------NHVI-KD
DEGPL_BRUA2/125-298----....--G-FV----ISED----------------------------------.GYV--V.TN-------NHVV-SD
O06439_RHOCA/59-235----....--G-FV----ISAD----------------------------------.GYI--V.TN-------NHVI-KG
HHOA_SYNY3/95-274----....--.-FI----IDNS----------------------------------.GII--L.TN-------AHVV-DG
HTRA_SYNY3/156-334----....--.-FI----VSND----------------------------------.GKI--F.TN-------AHVV-DG
O42417_CHICK/87-286----....--G-FL----VSPD----------------------------------.GLI--V.TN-------AHVV-AN
A0A0E3T8P7_9CAUD/70-274----TSAT--G-VL----IGKN----------------------------------..TV--L.TN-------RHIA-KF
ETB_STAAU/59-251----.LAT--G-VL----IGKN----------------------------------..TI--V.TN-------YHVA-RE
SPLB_STAA9/37-234----..AT--G-FV----VGKN----------------------------------..TI--L.TN-------KHVS-KN
SPLC_STAA9/38-233----..AT--G-FV----IGKN----------------------------------..TI--I.TN-------KHVS-KD
MPR_BACSU/95-311----YGCT--G-FL----VNPN----------------------------------..TV--V.TA-------GHCV-YS
PRTC_STRGR/205-383----....--.-..----.TQN----------------------------------..GF--A.TA-------GHCG-R.
Q55353_STRSQ/198-372----....--G-ST----PGF.----------------------------------....--A.TA-------GHCG-T.
Q55352_STRSQ/202-378----....--G-ST----PGF.----------------------------------....--V.TA-------GHCG-SV
Q54395_STRLI/158-342----..SA--A-FL----TRG.----------------------------------....--....-------.HCG-GG
SP1_RARFA/205-391----..CT--L-AF----PVYG----------------------------------..GF--L.TA-------GHCA-VE
CERC_SCHMA/28-256----TMCT--G-SL----VSTR----------------------------------..AV--L.TA-------GHCV-CS
Q54344_STRLI/47-254----..CS--A-AL----VHQQ----------------------------------..WL--L.TA-------TSCF-AA
CFAB_HUMAN/481-752----ESCM--G-AV----VSEY----------------------------------..FV--L.TA-------AHCF-T.
PROZ_BOVIN/143-352----DFCG--G-VL----IQDN----------------------------------..FV--L.TT-------ATCS-LL
CAC3_BOVIN/12-246----HTCG--G-SL----IAPD----------------------------------..WV--V.TA-------GHCI-ST
CELA1_PIG/27-259----HTCG--G-TL----IRQN----------------------------------..WV--M.TA-------AHCV-DR
CTRA_BOVIN/16-238----HFCG--G-SL----INEN----------------------------------..WV--V.TA-------AHCG-VT
CTRL_HALRU/24-251----HICG--C-VL----YTTS----------------------------------..KA--L.TA-------AHCL-SN
COGS_HYPLI/31-252----VWCG--G-SL----IDNK----------------------------------..WI--L.TA-------AHCV-HD
CTRB1_LITVA/46-263----YFCG--G-SL----ISSE----------------------------------..WV--L.TA-------AHCM-DG
CATG_MOUSE/21-238----SACG--G-FL----VRED----------------------------------..FV--L.TA-------AHCL-G.
MCPT2_RAT/21-239----VICG--G-FL----ISRQ----------------------------------..FV--L.TA-------AHCK-G.
ELNE_HUMAN/30-242----HFCG--A-TL----IAPN----------------------------------..FV--M.SA-------AHCV-AN
PRTN3_HUMAN/28-243----HFCG--G-TL----IHPS----------------------------------..FV--L.TA-------AHCL-RD
GRAK_RAT/26-248----HICG--G-VL----IHPQ----------------------------------..WV--L.TA-------AHCY-SR
GRAM_RAT/21-245----HMCG--G-VL----VHQK----------------------------------..WV--L.TA-------AHCL-SE
KLK1_MOUSE/25-253----YQCG--G-IL----LNAN----------------------------------..WV--L.TA-------AHCH-ND
KLK2_RAT/25-251----YLCG--G-VL----IDPS----------------------------------..WV--I.TA-------AHCY-SN
VSPCA_AGKCO/1-217----.LCG--G-TL----INQE----------------------------------..WV--L.TA-------RHCD-RG
HGF_RAT/496-719----HICG--G-SL----IKES----------------------------------..WV--L.TA-------RQCF-PA
ENTK_PIG/800-1029----LLCG--A-SL----VSRD----------------------------------..WL--V.SA-------AHCV-YG
PRSS8_HUMAN/45-281----HVCG--G-SL----VSEQ----------------------------------..WV--L.SA-------AHCF-PS
HGFA_HUMAN/408-641----.FCA--G-SL----VHTC----------------------------------..WV--V.SA-------AHCF-SH
TPA_HUMAN/311-556----FLCG--G-IL----ISSC----------------------------------..WI--L.SA-------AHCF-QE
H2Q7T9_PANTR/235-462----.FCG--G-TI----LSEF----------------------------------..YI--L.TA-------AHCL-YQ
THRB_BOVIN/367-616----LLCG--A-SL----ISDR----------------------------------..WV--L.TA-------AHCL-LY
PROC_HUMAN/212-445----LACG--A-VL----IHPS----------------------------------..WV--L.TA-------AHCM-DE

PF13365

A9VAG6_MONBE/28-203------GL..G.FY....LGNG...A........................------...V--A-TA.......AHVV-..
B9S6M7_RICCO/99-269------GS..G.TV....IESDDTGG........................------..II--L-TS.......ADLI-..
A9FFZ4_SORC5/137-265------GD..G..............R........................------...I--L-TA.......LSPL-..
D0N1Z1_PHYIT/130-271------GM..G.VF....FSST...L........................------...A--V-TC.......DHNL-..
A1VVN7_POLNA/138-318------GT..G.FL....VGPQ...T........................------...V--I-TS.......YHVV-RP
D4LWF1_9FIRM/167-311------EE..GFVF....LKND...EA.......................------.FYI--M-TY.......SDNM-..
C4ZI06_EUBR3/149-289------GV..G.VI....LRDN...GKQ......................------.LII--L-TE.......KNVV-..
D4M0U9_9FIRM/159-303------VS..G.VI....VADN...GQE......................------.ILI--L-SY.......ASIC-..
D4N037_9FIRM/379-516------GT..G.FL....LKGI...G........................------...L--I-TN.......YHVT-..
C5WUT2_SORBI/32-182------GN..G.FV....VYND...NNT......................------.CLI--L-TC.......QHVL-..
Q1GZ24_METFK/25-167------GT..G.FF....YNRN...G........................------..DF--F-TN.......RHVI-..
Q126C2_POLSJ/74-216------GS..G.VV....IGAD...G........................------..LV--L-TI.......GYLM-..
A2SEV1_METPP/84-217------GS..G.VV....IASD..GL........................------...V--L-TI.......GYLI-..
B0T7U9_CAUSK/55-188------GN..G.VV....ISEN...G........................------..LV--L-TM.......GYLI-..
B9JA65_AGRRK/33-164------GS..G.VV....IRNN...G........................------..LV--L-TI.......GYLI-..
D5SQ02_PLAL2/103-278------AS..G.IL....IRGANPQEP.......................------..VV--L-TC.......YHAV-..
A0L9W3_MAGMM/126-265------GS..G.VL....ISSK...G........................------..YV--A-TA.......AHLV-..
Q75HK9_ORYSJ/40-213------GT..G.FC....IDQR...G........................------..LI--M-TC.......AHCV-..
B7FUE8_PHATC/1283-1490------GS..G.FI....VDKR...LG.......................------..LV--V-TA.......AHVL-..
A9F8J5_SORC5/19-173------GT..G.FL....VGPG...L........................------...V--L-TA.......LHVV-..
Q00YL5_OSTTA/68-221------RS..G.FV....WYVD...AND......................------.CWI--A-TS.......SSGA-..
D2R6U2_PIRSD/68-213------AS..G.II....VSSE...G........................------..EI--V-TA.......SGAL-..
Q7UNU5_RHOBA/96-240------QS..G.FL....VSPA...G........................------..HI--A-TA.......WSYV-..
D5SYB2_PLAL2/75-226------NT..G.FL....ISSE...G........................------..HI--A-TI.......WNHV-..
D5ST85_PLAL2/188-324------AT..A.WV....LAAD...G........................------..VI--V-TN.......YHVF-..
B8EPM5_METSB/283-415------GM..G.FS....VNDE...G........................------..FV--V-TS.......AQIV-..
Q7URA6_RHOBA/240-384------GT..G.TI....IDTN...GDE......................------.ALV--L-TC.......GHLF-..
D2R0U2_PIRSD/218-358------GT..G.TI....IDTH...DDE......................------.ALV--V-TC.......GHLF-..
D1CC35_THET1/99-237------GN..G.VV....MNLD...G........................------..YI--L-TT.......SQVL-..
A4S513_OSTLU/76-226------GS..G.VV....WYID...DAY......................------.AYI--A-TN.......AHCV-..
A4S4E4_OSTLU/26-173------GS..G.VV....VRHR...GV.......................------.ACV--L-TA.......AHVA-..
Q3IXI9_RHOS4/47-206------GA..G.MV....FGQGAGGRL.......................------..LY--L-TN.......FHVV-..
Q08MN7_STIAD/50-171------GP..G.VI....VGSQ...G........................------..QV--L-TS......VEHVS-..
Q7UNU4_RHOBA/89-223------TS..G.VV....IDEQ...G........................------..HV--L-TS.......SWVT-..
B8BSP4_THAPS/582-769------GS..G.FV....VGFD...D........................------..SI--I-DDIDDMKDRCHIL-..
A9F4P7_SORC5/37-166------TT..G.WV....................................------...A--L-GN.......GVVV-..
Q67SY9_SYMTH/37-178------GT..G.VI....LDHY...H........................------...I--I-ST.......AQIV-..
Q1IY94_DEIGD/67-198------GG..G.PVSGTVIGEE...Q........................------...V--L-TV.......AHVL-..
D5SYB3_PLAL2/92-222------TT..G.VI....VGSD...G........................------..WI--V-TS......AFNFI-..
D2R6U3_PIRSD/90-221------TT..G.LI....ISSD...G........................------..YI--I-TS......TFNFL-..
Q21G29_SACD2/103-235------GS..G.FY....IGDG...G........................------..LI--A-TN.......YHVI-..
Q08Q29_STIAD/85-219------GS..A.FF....VSAQ...G........................------..HA--I-TN.......YHVV-..
A4YVG9_BRASO/68-206------GS..G.FL....VSAD...G........................------..LA--I-TN.......YHVV-..
A2SCU5_METPP/86-236------GS..G.FF....VSDD...G........................------..LI--V-TN.......YHVV-..
Q0RIR2_FRAAA/55-221------GS..G.IV....YRSN...G........................------..VI--V-TN.......QHVV-..
A2SLK2_METPP/110-244------GA..G.FV....ISGAE.GL........................------...I--V-TA.......SHAV-..
D1CHW8_THET1/35-167------GS..G.II....WAPS...G........................------..LV--V-TN.......SHVV-..
B2IZX6_NOSP7/35-159------GS..G.VI....WQTD...G........................------..LI--I-TN.......AHVA-..
Q01SP4_SOLUE/26-150------GS..G.IV....WKPD...G........................------..LI--L-TN.......AHVA-..
Q98IG3_RHILO/78-212------AS..A.FH....WSDG...Y........................------...F--V-TA.......EEAV-..
B0U7I8_METS4/36-169------AS..G.FV....WKPG...L........................------...V--V-TA.......DEAL-..
Q89E13_BRADU/35-167------AT..G.FV....WKPG...L........................------...I--V-TA.......DEAL-..
A7H8S6_ANADF/35-169------AS..G.VA....WSAD...G........................------..IV--V-TA.......HHVL-..
Q1DFJ7_MYXXD/51-186------TT..G.IV....WDAE...G........................------..HI--L-TT.......SQAV-..
D1CHW7_THET1/37-171------AS..G.IV....WSAD...G........................------..RI--V-AA.......DHTL-..
D1C9X4_SPHTD/41-176------AT..G.II....WRAD...G........................------..LI--V-TA.......DHVL-..
Q7NEY6_GLOVI/37-172------PS..G.VL....WREG...V........................------...V--V-TA.......DHLL-..
Q01SP5_SOLUE/107-240------SS..G.VF....WRPG...V........................------...I--V-TA.......EHTI-..
C4Z416_EUBE2/141-284------VA..G.LV....VANV...NST......................------.YLV--L-TS.......SSLL-..
Q7EYD8_ORYSJ/206-349------CT..G.VV....IGWD...GANK.....................------RAKI--L-TA.......ASVV-..
Q6ATB3_ORYSJ/64-208------FS..G.IV....VSWNE.TTRS......................------.ATI--V-TC.......SEAV-..
C5Y9X9_SORBI/128-269------CT..G.IF....VGWNE.TTKC......................------.ARI--L-TT.......SDIV-..
C5XIJ1_SORBI/75-220------CS..G.IA....IGCQ...GCV......................------.TRI--L-TS.......ASLV-..
C5WUT6_SORBI/430-572------CT..G.IF....VGNQ...SD.......................------.TRI--L-TS.......ASLV-..
C5YNZ0_SORBI/297-442------CT..G.FF....INYDGCPT........................------...I--L-TS.......ASLV-..
C5YX14_SORBI/284-426------CT..G.FF....IGWN...GS.......................------.TKI--L-TS.......ASLI-..
Q0JIU9_ORYSJ/149-291------CT..G.FF....IEWN...GC.......................------.TSI--L-TS.......ASLV-..
Q82G14_STRAW/89-242------GN..H.FCTASVVRST...AH.......................------.DLI--V-TA.......AHCV-..
C7QED1_CATAD/56-225------CSASL.VRYPTSLSSDR.AL........................------...M--L-TA.......GHCF-..
C9Z823_STRSW/62-228------CS..GSII....RFPDS.LDTD......................------PALV--L-SN.......GHCS-..
C9ZGQ1_STRSW/72-240------CS..GSVVRMPASEDND.PA........................------..LV--M-TN.......GHCL-..
Q93JK9_STRCO/54-222------CS..GSVVRLPASEDD...DP.......................------.ALV--M-SN.......GHCL-..
D2QDD9_SPILD/31-236------GTATL.FF....INEE...G........................------..CA--I-TC.......KHVA-..
C5Y9N3_SORBI/149-346------AT..G.FV....VAAN...DTT......................------.LRV--L-TC.......AHVI-DD
Q92JT1_RHIME/45-189------GS..G.VV....VSVE...G........................------..HV--L-TA.......RHVL-..
B0C7H5_ACAM1/63-201------GS..G.TL....ISKQ...NNT......................------.YLV--L-TN.......QHIL-..
Q15T30_PSEA6/50-191------GF..A.WV....IGERDEYL........................------..YL--V-TA.......NHVI-..
A5E551_LODEL/303-457------GS..T.IL....YKPN...V........................------...F--I-TN.......AHVV-..
A3LV17_PICST/282-443------GT..C.IY....YNET...T........................------...L--V-TN.......FHVL-..
Q6BLK4_DEBHA/295-454------GS..C.VY....YNHT...T........................------...L--V-TN.......NHVI-..
A5DCA5_PICGU/274-427------GT..C.TY....VSSV............................------...L--V-TN.......YHVL-..
D0N2P9_PHYIT/200-360------CT..G.WL....IGSE...G........................------..HL--L-TN.......HHCI-ST
D3QBE9_STANL/212-368------CT..A.FR....VGNT..NR........................------...L--L-TN.......NHCM-..
D3PTY7_STANL/202-361------CT..A.WR....VGSK...N........................------..RL--L-TN.......NHCF-..
A0CQA0_PARTE/272-415------GS..G.IL....VNDQ...LNK......................------QSYI--L-TA.......NHVL-..
C9SS84_VERA1/110-286------GT..A.IC....VDSS...G........................------..IL--M-TC.......AHCV-..
B2ACI3_PODAN/114-282------GT..A.VC....IHPS...G........................------..LL--L-TC.......AHCV-..
B1XYW2_LEPCP/349-527------GT..G.FL....VRAA...DFGLTP.................GE------ELLV--L-TN.......FHVV-..
C1N754_MICPC/393-574------AS..GIVL....TAGD...GARG....................H------PALI--L-TN.......AHVV-..
C1EFA7_MICSR/414-629------AS..GVVIGVHGSGGE...GEEGGGGIGGVGGVEWGGGGGGRPV------RALV--L-TN.......AHVV-..
C0PL31_MAIZE/403-612------AS..G.IV....LNKR...G........................------..LV--L-TN.......AHLL-EP
A9TAV2_PHYPA/699-919------AS..G.VI....LNKT...G........................------..LI--L-TN.......AHLL-EP
DEG15_ARATH/376-594------AS..G.II....LNEH...G........................------..LI--L-TN.......AHLL-EP
Q0PY37_SOLLC/412-632------AS..G.VL....LNKQ...G........................------..LL--L-TN.......AHLL-EP
B9H2S3_POPTR/409-631------AS..G.VL....LNDQ...G........................------..LI--L-TN.......AHLL-EP
A8I3D5_CHLRE/134-313------GS..G.IV....WDTA...GP.......................------..HV--V-TN.......FHII-..
C1N5V8_MICPC/175-398------GV..G.VL....WSDR...G........................------..YV--V-TN.......FHLV-..
D2S688_GEOOG/217-353------GS..G.FV....YAPE...R........................------...V--M-TN.......AHVL-..
D3QA66_STANL/219-357------GS..S.FV....YDAD...RD.......................------..LV--L-TN.......AHVV-..
Q10YA2_TRIEI/28-156------GT..G.FW....VTPG...H........................------...I--L-TC.......VHVI-..
B7KID8_CYAP7/23-153------GT..G.FF....VSPR...L........................------...I--L-TC.......HHVI-..
B1ZW96_OPITP/85-238------GS..G.VV....IAVE...G........................------..RV--L-TN.......AHVT-..
C1MYV6_MICPC/213-422------GS..G.VH....IGGG...W........................------...I--L-TC.......AHCV-CR
D2QY05_PIRSD/202-373------GS..S.VV....TENT...GGK......................------.LRL--F-TN.......AHVI-..
A4YLF4_BRASO/29-179------GS..G.VQ....VDAL...H........................------...V--I-TC.......AHVF-..
Q08Z65_STIAD/79-228------AS..G.VV....IGTE...HTEEG...................R------FSYV--I-TN.......AHAV-..
Q2II41_ANADE/64-213------AS..G.IA....FAHE...GGR......................------.SYV--L-TN.......AHVV-..
B3S5U4_TRIAD/329-491------GS..G.VV....IDRYK.GL........................------...I--I-TC.......SHVV-..
A0LWM1_ACIC1/250-384------GT..A.FALALPQASGSQTT........................------...L--V-TA.......EHVV-..
Q2YD45_NITMU/56-221------GS..G.VA....LGAD...Q........................------...V--I-TT.......CDVA-..
D5UDV9_CELFN/76-207------GS..G.FA....LDEH...T........................------...L--V-TN.......RHVV-..
Q11LS4_CHESB/40-170------GS..G.VH....IGDG...Y........................------...I--I-SA.......SHVV-..
C6XD83_METGS/47-175------GS..G.VI....VAPN...K........................------...V--L-TN.......CHIF-..
C6WVZ4_METML/47-174------GS..G.VV....VEQN...K........................------...V--I-TN.......CHIF-..
B9TJ43_RICCO/62-190------GS..G.VV....VSPE...Y........................------...V--A-TN.......CHVI-..
C6WXC4_METML/54-182------GS..G.VV....VAKD...Q........................------...V--V-TN.......CHVI-..
B9TFS6_RICCO/49-177------GS..G.VV....VAPD...Y........................------...V--A-TN.......CHVL-..
C6XBL7_METGS/51-179------GS..G.VV....VAEN...L........................------...V--A-TN.......CHVL-..
A2SLB0_METPP/51-178------GS..G.VI....VGPG...R........................------...V--V-TN.......CHVT-..
C7RR92_ACCPU/56-182------LS..A.VT....IGEA...Q........................------...V--V-TQ.......CDLV-..
C7RR91_ACCPU/52-180------GS..G.VV....VHAG...R........................------...V--V-TN.......CHVV-..
Q2W2I3_MAGSA/355-483------GS..A.VA....MDER...T........................------...V--V-TN.......CHVI-..
Q3B4M2_PELLD/76-203------GS..G.VV....LPGG...T........................------...V--A-TC.......HHVV-..
C7PQR9_CHIPD/410-553------GT..A.FH....LKGV...G........................------...L--V-TC.......DHCI-..
D2R620_PIRSD/144-326------GT..G.FI....VGPN...L........................------...M--M-TN.......RHVA-EA
Q211I3_RHOPB/126-305------GT..G.WI....VGSD...LGS......................------.DII--V-TN.......AHVG-SE
C7PQU4_CHIPD/127-299------GT..G.WM....VAPD...I........................------...V--V-TN.......RHVA-QE
A6LC71_PARD8/50-181------GT..G.FF....ITET...G........................------..EA--L-SG.......YSLF-..
C3Y9V9_BRAFL/396-567------GS..G.FL....IGRK...K........................------...M--L-TN.......NHIY-EM
C3Y7C8_BRAFL/939-1107------GT..G.FL....LSKG...K........................------...V--L-TC.......YHVY-..
C3YHU1_BRAFL/637-805------GT..G.FL....LNKG...K........................------...V--L-TC.......YHVY-..
Q1D137_MYXXD/39-183------GT..G.FL....VTER...L........................------...V--V-TC.......WHVL-..
B5HRW8_9ACTN/52-200------GA..G.FL....VAEG...V........................------...V--V-TC.......AHVI-..
B8M3P5_TALSN/58-198------AS..A.FL....VNKQ...FG.......................------..LF--F-TA.......AHAV-..
NM111_PICGU/100-246------AT..G.FV....VDSE...RG.......................------..YI--L-TN.......RHVV-..
D0MZM5_PHYIT/91-230------AT..G.FV....VDAE...KG.......................------..II--L-TN.......RHVV-..
YH05_SCHPO/99-245------AT..G.FV....VNKTL.GL........................------...I--L-SN.......RHVV-..
C1EGI7_MICSR/60-206------AT..G.FV....VDAA...RG.......................------..LI--L-TN.......RHVL-..
A9RQ61_PHYPA/48-194------AT..G.FV....VDKQ...RG.......................------..II--L-TN.......RHVV-..
B9IN99_POPTR/46-189------GS..G.VI....IDEG...R........................------..HI--I-TC.......ARVL-..
Q10V37_TRIEI/25-170------GT..GFAF....YRKD...NY.......................------.TYL--L-TC.......AHVV-..
A6L245_BACV8/25-170------GT..A.FY....IGNG...Y........................------...L--L-TA.......YHVV-..
Q7Q9T3_ANOGA/284-425------GT..G.CA....FELN...GK.......................------.RYI--I-SC.......SHVL-..
F111B_HUMAN/475-664------AT..C.FV....FNGG...Y........................------...I--F-TC.......RHVV-..
D4A8N0_RAT/367-556------AT..C.FV....FKGL...Y........................------...I--L-TC.......RHVI-TS
A8ZQB3_ACAM1/33-191------GT..G.FY....LSGR...Y........................------...I--I-TC.......AHVV-KE
B0JTN4_MICAN/27-184------GA..G.FL....ISSE...Y........................------...L--I-TC.......AHVV-..
B8HMX0_CYAP4/25-181------GA..G.FL....VSDR...Y........................------...L--L-TC.......AHVV-..
Q9Z529_STRCO/60-203------GT..G.FL....ADHH...G........................------..TV--L-TS.......HEAV-..
C6XKV2_HIRBI/68-210------GT..A.FS....IDQK...G........................------..LW--M-TA.......RHVV-..
B0T391_CAUSK/70-212------GT..A.FS....VDDG...G........................------..SW--L-TA.......RHVV-..
Q0C5Y2_HYPNA/27-169------GT..A.FA....VNSR...G........................------..DW--L-TA.......RHVV-..
D2R618_PIRSD/120-277------GS..G.FL....VGSD...L........................------...I--I-TN.......YHVL-..
Q1DE46_MYXXD/139-306------GT..G.FL....VSPS...V........................------...V--L-TN.......FHVI-..
B8ICT9_METNO/161-326------GT..G.FL....VGSG...L........................------...V--L-TN.......WHVI-..
B3PHV0_CELJU/204-337------GT..G.FY....FNSI...G........................------..QL--L-TA.......NHVL-..
A9ERE8_SORC5/153-297------GT..G.FL....VTGD...F........................------...L--V-TN.......HHVL-..
B2J8D1_NOSP7/164-308------GT..G.FL....VAED...L........................------...L--L-TN.......NHVL-..
C6X4V5_FLAB3/104-266------GT..G.FL....LAPG...I........................------...L--I-TN.......NHVF-..
Y4FB_RHISN/90-251------GT..G.FL....IGPR...L........................------...L--L-TN.......NHVI-..
A9GTT3_SORC5/149-297------GT..G.FL....IEGR...L........................------...L--L-TN.......HHVI-..
B8END1_METSB/102-257------AT..G.FL....ISAD...L........................------...F--L-TN.......QHVV-..
D2BAE5_STRRD/123-274------GT..G.FL....VSPR...L........................------...L--L-TN.......HHVF-..
D2R623_PIRSD/145-303------GT..G.SM....ISPS...L........................------...F--M-TN.......SHVL-..
Q9RTZ8_DEIRA/130-275------GT..G.WL....CSPQ...V........................------...M--V-TN.......HHVL-..
D0LEN3_GORB4/141-289------GT..G.FL....VSPT...L........................------...L--L-TN.......HHVL-..
E3IWP0_FRASU/134-282------GT..G.SL....VSPE...L........................------...L--L-TN.......HHVL-..
A1WX57_HALHL/64-228------GT..G.FV....IADG...N........................------..AV--L-TN.......QHVL-..
Q3SMJ5_THIDA/81-243------GT..GFAV....LDGR...H........................------...V--V-SC.......AHIF-..
Q15WK4_PSEA6/58-219------GS..G.FV....FGDG...T........................------..LI--A-TN.......FHVV-..
D0LGQ1_HALO1/668-816------GS..G.VI....VARD...GNE......................------.LAI--L-TN.......RHVV-..
Q0AUX9_SYNWW/105-235------GT..G.IN....LEAE...G........................------..MI--I-TN.......RHVV-..
B9M1H9_GEODF/322-480------GS..G.FL....VRGSELCLGWG....................D------APVF--V-TN.......AHVV-..
D3PR00_MEIRD/62-196------GS..G.FF....ISAD...G........................------..LV--M-TA.......YHVI-..
D3FST1_BACPE/122-248------GT..G.FI....VSSE...G........................------..LI--V-SN.......DHVV-..
Q1D8L6_MYXXD/88-220------CT..G.TL....IQASAGPV........................------...V--L-TA.......GHCV-..
B0CAU9_ACAM1/85-242------GT..A.FV....VSQD...NA.......................------.VFL--L-TA.......HHLF-..
D3B2A3_POLPA/90-296------GT..G.FC....VKKD...I........................------...I--I-TA.......AHVL-..
D2R1J4_PIRSD/67-236------GT..A.FL....VGDG...I........................------...A--L-TT.......RHVV-EL
E0U9M4_CYAP2/69-211------QS..G.IL....ITED...KNT......................------.YWI--M-TC...........-..
B7KH20_CYAP7/52-196------QS..G.VL....LSQD..ENQ.......................------.YWV--L-TC...........-..
D2Q0V1_KRIFD/123-243------AT..G.VL....LPDG...I........................------...V--L-TA.......ASAI-..
B3QZR5_PHYMT/297-472------GS..GIIFKYHKIKDT..EYE.......................------.YYV--L-TN.......RHVI-I.
Q84SQ1_ORYSJ/91-253------GS..G.FI....ISST...ADG......................------KCIV--L-TC.......RHVV-..
NS1AB_HASV1/447-565------GT..G.FF....SGND............................------...I--V-TA.......AHVV-..
B8HSI3_CYAP4/55-201------GT..G.VI....INRS...ADL......................------.YTV--L-TV.......KHVA-..
B7KEX9_CYAP7/49-192------GT..G.FF....IEVEGICA........................------...V--L-TA.......AHVV-..
Q11A08_TRIEI/47-187------GT..GFFV....PGET...GV.......................------.CKV--L-TA.......AHVV-..
Q111L2_TRIEI/52-195------GT..G.FF....VEVE...GKSE.....................------VCSV--L-TA.......AHVV-..
Q113N3_TRIEI/93-237------GS..G.VI....IGRK...DSV......................------.YYV--L-TA.......DHIS-..
B0C4I5_ACAM1/51-195------GS..G.VL....IKRN...DNI......................------.YTV--L-TA.......AHVI-..
B0C7H5_ACAM1/295-465------GS..G.VI....IARQ...GQT......................------.YTV--L-TA.......NHVV-..
B0JV48_MICAN/59-215------GS..G.SI....IAKE...GKV......................------.YTV--L-TA.......SHVI-..

PF09342

Q7QJ48_ANOGA/1774-1887------CS--G-LI----IDAS------------------------------------WI--I-VS-------GSCT---
Q8WSJ2_BOMMO/1523-1637------CT--G-VL----VDLS------------------------------------WV--L-VS-------HACL---
NUDEL_DROME/2041-2158------CI--G-VL----IDKH------------------------------------WV--M-VH-------ESCL---

PF05579

RPOA_LDVC/1418-1713----TSSL--G-LITPYDVHMITATPRGA.....SSLASAPEGTYLAAVR------RSAL--TGRC-------CMFV-PT
RPOA_PRRSL/1601-1897----TQVA--G-IITPYDIHQYTSGPRGA.....AAVATAPEGTYMAAVR------RAAL--TGRT-------LIFT-PS
RPOA_LDVP/1420-1715----TSST--G-LVTPYDVHLVTSTPRGA.....SSLASAPEGTYLAAVR------RSAL--TGRC-------CMFV-PT
RPOA_SHFV/1368-1665----TGIG--G-FVTPYDIHDVVKSQRDG.....VAVANAPPNTYLGAVR------RAAL--TGKP-------AFFV-AN
Q99AV6_PRRSV/1716-2013----TNVA--G-LVTPYDIHHYTSGPRGV.....AALATAPDGTYLAAVR------RAAL--TGRT-------MLFT-PS
RPOA_EAVBU/963-1269----VNVP--M-CVTPAHFLLLARSAGQSREQMLRVSAAAPTNSLLGVAR------DCYV--TGTT-------RLYI-PK

PF02907

POLG_HCVJL/1060-1208-------A--G-EI--------------------------------------------QI--LSTA--------------
POLG_HCVNZ/1062-1210-------T--G-EV--------------------------------------------QV--LSTA--------------
POLG_HCVEV/1057-1205-------E--G-EV--------------------------------------------QF--LSTA--------------
O56074_9FLAV/1007-1154-------E--G-SI--------------------------------------------VV--LGTS--------------
Q96898_9FLAV/992-1139-------H--G-NV--------------------------------------------VV--LGTS--------------
Q9WM98_9FLAV/924-1071-------.--G-NV--------------------------------------------MV--LGTA--------------
POLG_GBVB/970-1118-------T--G-TI--------------------------------------------FR--LGSL--------------
Q9Q9A7_9HEPC/1060-1208-------A--G-EI--------------------------------------------QV--LSTV--------------
Q9QIX6_9HEPC/1056-1204-------E--G-EV--------------------------------------------QV--VSTA--------------

PF10459

A1SA55_SHEAM/18-726----GYCT--ASFV----SPQG------------------------------------LA--V-TN-------HHCA-FR
E0THX8_PARBH/23-721----GGCT--ASFV----SDEG------------------------------------LV--V-TN-------HHCA-RG
F2GAE2_ALTMD/22-719----GGCS--ASFV----SDKG------------------------------------LA--V-TN-------HHCA-RG
A5FMW8_FLAJ1/19-712----GGCT--AEIV----SKEG------------------------------------LV--L-TN-------HHCG-YN
A6GWM2_FLAPJ/17-707----GGCT--SEVI----SPKG------------------------------------LI--L-TN-------HHCG-FD
A6KZW8_BACV8/17-706----GFCS--GVVV----SPDG------------------------------------LV--F-TN-------HHCG-YD
A6L2J7_BACV8/19-726----GGCT--GEII----SAEG------------------------------------LV--L-TN-------HHCG-YS
A6L2J8_BACV8/21-719----GGCT--GEII----SPDG------------------------------------LI--L-TN-------HHCG-YG
A6LID5_PARD8/19-717----GGCT--GEMI----SPDG------------------------------------LV--L-TN-------HHCG-YS
A7HA06_ANADF/20-725----GGCS--ASFV----SPDG------------------------------------LV--A-TN-------HHCV-IG
A7HFU9_ANADF/37-699----GGCS--ASFV----SEDG------------------------------------LV--M-TN-------HHCA-HE
Q024G1_SOLUE/22-694----GGCS--AGFV----TSTG------------------------------------LF--L-TN-------HHCL-FG
Q029T1_SOLUE/24-727----GGCT--ASFV----SPDG------------------------------------LI--V-TN-------HHCV-TG
Q07XT1_SHEFN/18-727----GYCT--ASFV----SPQG------------------------------------LV--V-TN-------HHCA-YR
Q08VC9_STIAD/18-714----GGCS--GAFI----SSSG------------------------------------LV--I-TN-------HHCV-FS
Q11SC7_CYTH3/21-702----NFCT--GEII----SQDG------------------------------------LI--L-TN-------HHCG-FD
Q12RW4_SHEDO/18-728----GYCT--ASFV----SPQG------------------------------------LV--V-TN-------HHCA-YR
Q1D5W7_MYXXD/35-700----GGCS--ASFV----SANG------------------------------------LV--M-TN-------HHCA-RG
Q1D9F6_MYXXD/17-714----GGCS--GAFI----AASG------------------------------------LV--I-TN-------HHCA-FG
Q1DDZ2_MYXXD/18-682----GGCS--ASFV----SPEG------------------------------------LV--M-TN-------HHCI-RG
Q1GVV7_SPHAL/23-684----GGCS--ASFV----SNEG------------------------------------LI--L-TN-------HHCV-VG
Q1IPC2_KORVE/27-692----PGGS--SEFV----SPDG------------------------------------LL--M-TN-------HHVA-QS
Q2G546_NOVAD/56-713----GGCS--ASFV----SPDG------------------------------------LI--L-TN-------HHCV-VE
Q2IEV3_ANADE/18-687----RGCS--ASFV----SDGG------------------------------------LV--M-TN-------HHCV-HE
Q2S133_SALRD/5-639----PGCT--GALV----SADG------------------------------------LA--L-TT-------ARCV-RR
Q2S134_SALRD/69-734----SGCS--ASFV----SSRG------------------------------------LV--M-TN-------HHCA-RE
Q488S2_COLP3/26-729----GGCT--ASFV----SDQG------------------------------------LV--A-TN-------HHCV-YG
Q5LIW7_BACFN/34-723----GFCS--GVVV----SEDG------------------------------------LV--F-TN-------HHCG-FS
Q5QV86_IDILO/17-717----GGCS--ASFV----SPEG------------------------------------LV--A-TN-------HHCA-YN
Q7MV25_PORGI/21-718----GGCT--GEVV----SDRG------------------------------------LV--L-TN-------HHCG-YD
Q7MWU6_PORGI/24-711----GGCT--GITV----SDQG------------------------------------LI--F-TN-------HHCG-YG
Q7NHA9_GLOVI/34-698----GGCS--GSFV----SPNG------------------------------------LV--M-TN-------HHCA-AT
Q7UKL5_RHOBA/28-688----SGGS--GSFV----SSNG------------------------------------LV--L-TN-------HHVA-SD
Q8A2L6_BACTN/20-711----GFCS--GVVV----SEDG------------------------------------LV--F-TN-------HHCG-FS
B2FQN5_STRMK/22-717----GGCT--ASFV----SPQG------------------------------------LV--V-TN-------HHCA-YG
E3FSI6_STIAD/18-681----GGCS--ASFV----SANG------------------------------------LV--M-TN-------HHCT-RG
Q5LB16_BACFN/20-719----GGCT--GEII----SAEG------------------------------------LV--L-TN-------HHCG-YG
Q8EAI4_SHEON/18-728----GYCT--ASFV----SPQG------------------------------------LV--V-TN-------HHCA-YK
Q8EHX9_SHEON/18-716----GGCT--ASFV----SPKG------------------------------------LV--V-TN-------HHCA-YG
Q9PC94_XYLFA/22-713----GNCT--ASLV----SPEG------------------------------------LV--I-TN-------HHCA-YG
R5U6M0_9BACE/21-717----GGCT--GEII----SPEG------------------------------------LI--L-TN-------HHCG-YA
R6WQY4_9PORP/22-710----GGCS--GITV----SNEG------------------------------------LI--F-TN-------HHCG-FG
R6Y7C6_9PORP/19-717----GGCT--GEIV----SPEG------------------------------------LL--L-TN-------HHCG-YG
R7EE18_9BACE/20-708----GFCS--GVVV----SGDG------------------------------------LV--F-TN-------HHCG-FS
R7EGG9_9BACE/23-719----GGCT--GEII----SPEG------------------------------------LI--L-TN-------HHCG-YG

PF00863

POLG_SPMMV/2424-2646----HKGETHG-IF----HGDK-------------------------------------L--I-TP-------FHTF-K-
POLG_RGMVD/1998-2230----MRTSIYG-VC----YGPY-------------------------------------I--L-TT-------AHLI-K-

PF03761

Q9U2W2_CAEEL/6-282----GIVN--C-LISSQKLTVK------------------------------------------EN-------EERL---
Q21628_CAEEL/5-298----IINI--G-LVVGLNFTDA------------------------------------------EV-------ANLR---
O45371_CAEEL/3-276----IIAC--G-FNNTQPLSYE------------------------------------------EN-------IQRL---
O76649_CAEEL/2-297----LLFL--G-FSSSRIIGEK------------------------------------------EN-------QVLQ---
A8XIB1_CAEBR/15-285----ILIG--S-SEPFRKLSPD------------------------------------------EN-------QSRL---
A8WNY9_CAEBR/3-296----VVFV--V-GVGAGKISEQ------------------------------------------EN-------EQTQ---
Q9XWZ8_CAEEL/4-272----TFII--I-VVSYNELTAE------------------------------------------EN-------DKRL---
O62223_CAEEL/7-278----VIAI--I-PIVTEKLSLK------------------------------------------EN-------KERL---
O62231_CAEEL/5-272----LTGC--I-GCDFYKLTAD------------------------------------------EN-------KDRA---

PF00944

POLS_SFV/112-268------CM--K-------IEND------------------------------------CI--F-EV--------------
POLS_SINDV/107-265------AL--K-------LEAD------------------------------------RL--F-DV--------------

PF05580

E3E859_PAEPS/156-365----AAGV--G-TLTFYAPDQG-------------------------------------V..YGAL-------GHVI.TD
B2A522_NATTJ/220-428----SLGV--G-TLTYKDFENK-------------------------------------E..YGAL-------GHSI.ST
R6EU85_9FIRM/240-448----AQGV--G-TMTYID.ENG-------------------------------------N..FGAL-------GHGI.ND
R5R857_9FIRM/209-435----AQGI--G-TMTYET.ADG-------------------------------------H..FGAL-------GHGI.AD
D5DLD9_BACMD/201-410----AAGI--G-TMTFYDPKSK-------------------------------------K..YGAL-------GHVI.SD
R5E7E8_9CLOT/153-360----LQGL--G-TITYAYGDQ.-------------------------------------...YGAL-------GHSI.TD
H6NL93_9BACL/216-425----AAGV--G-TLTFYAPDQG-------------------------------------V..YGAL-------GHVI.TD
D9QRU2_ACEAZ/227-436----ATGV--G-TMTFYDPQTK-------------------------------------M..YGAL-------GHMI.TE
R5C627_9FIRM/190-398----TQGI--G-TLTYVR.ENG-------------------------------------D..FGAL-------GHGI.SD
R7M5P2_9CLOT/115-318----IKGV--G-TLTFIDPETK-------------------------------------I..FGAL-------GHEI.LE
R5H148_9FIRM/298-508----AQGV--G-TMTYLD.EKN-------------------------------------G..FGAL-------GHGI.ND
R6AIL9_9CLOT/311-520----TVGI--G-TLSFVTEKEK-------------------------------------A..SAAL-------GHAV.LD
R7FQ12_9CLOT/119-323----VLGI--G-TLTYYDPDTK-------------------------------------T..YGAL-------GHEV.KE
F6DU87_DESRL/210-419----TAGV--G-TMTFFHPESK-------------------------------------S..YGAL-------GHVI.SD
R6R0T0_9FIRM/204-412----CQGL--G-TLTYVD.EDN-------------------------------------D..FGTL-------GHSI.SD
D4J425_9FIRM/145-352----TQGI--G-TITYID.ADQ-------------------------------------N..FAAL-------GHGI.TD
R5YSC4_9FIRM/173-380----TQGL--G-TITFVT.SNG-------------------------------------I..FGAL-------GHGI.SD
R5J4I1_9FIRM/118-321----IAGI--G-TVTYYDPETG-------------------------------------S..YGAL-------GHGV.SS
R6Y3R6_9FIRM/105-307----LLGV--G-TVTFYKEETG-------------------------------------T..YFAL-------GHQ....
I4D8U8_DESAJ/208-416----AAGV--G-TLSFIDPVTK-------------------------------------Q..YGAL-------GHVI.TD
R5A2Q9_9CLOT/168-371----AAGI--G-TLTFYDPSTG-------------------------------------M..FAGL-------GHGI.CD
A4XKP9_CALS8/199-405----TSGI--G-TLTFVDKKRG-------------------------------------T..FGAL-------GHGI.SD
R7HFV6_9MOLU/114-314----IMGI--G-TLSYIDPNTL-------------------------------------I..YGAL-------GHEI.VE
R5MBH1_9MOLU/116-319----LLGN--G-TLTYIDPETK-------------------------------------I..YGAL-------GHYI.ID
B0TEK3_HELMI/215-424----ASGV--G-TLTFFEPKSK-------------------------------------S..YGAL-------GHVI.ND
R7K6P1_9FIRM/158-362----SSGV--G-TMTFVR.ANG-------------------------------------A..FASL-------GHPV.TD
R6WI32_9FIRM/144-352----TQGL--G-TVTYLD.ANS-------------------------------------R..FGAL-------GHGI.HD
C4ZCY0_EUBR3/233-444----LAGI--G-TITYYT.KDG-------------------------------------R..FGAL-------GHGI.GD
R7FE29_9FIRM/75-280----SAGI--G-TITFYEPESG-------------------------------------S..FGGL-------GHPV.CD
R7KE68_9FIRM/124-326----VSGI--G-TISFVK.KDG-------------------------------------T..YGAL-------GHRI.SD
Q8XJE5_CLOPE/171-380----TAGV--G-TLTFYDKESG-------------------------------------K..YGAI-------GHPI.TD
D4LFB6_RUMC1/188-392----TAGI--G-TVTYYMPNSG-------------------------------------R..FAGL-------GHPV.CD
R6RRV8_9FIRM/198-401----TQGI--G-TMTYVA..GT-------------------------------------E..FGGL-------GHGI.CD
R7B468_9CLOT/225-433----TQGI--G-TMTYVC.ANG-------------------------------------A..FGAL-------GHGI.SD
G7M128_9CLOT/180-389----TAGV--G-TMTFYDDKTK-------------------------------------T..FGAL-------GHPI.TD
U5S0W6_9CLOT/60-268----TAGI--G-TLTFYDEKSG-------------------------------------M..FAAL-------GHPI.TD
R5KFR6_9CLOT/196-405----LQGI--G-TLTYIM..GT-------------------------------------R..FGAL-------GHGV.ND
R7QW48_9FIRM/197-405----LAGI--G-TMTYLT.DEL-------------------------------------F..YGAL-------GHGV.ND
R6BUQ9_9FIRM/202-410----TQGL--G-TMTYVD.GQK-------------------------------------Q..YGAL-------GHGI.SD
R7MCE1_9CLOT/114-318----ITGI--G-TLSYIDPSTR-------------------------------------I..FGSL-------GHEI.AI
A5D302_PELTS/204-413----TAGI--G-TLTFYDPEKM-------------------------------------I..YGAL-------GHVI.TD
E6UBW1_RUMA7/187-391----SAGI--G-TLTFFDDDSG-------------------------------------I..FGGL-------GHPV.CD
R5PM12_9CLOT/193-402----AAGV--G-TLTFYEPSTN-------------------------------------L..FMAL-------GHGI.SD
R5CZB6_9FIRM/133-338----MAGV--G-TLTYYDPATG-------------------------------------S..YGAL-------GHGI.TD
R6SMI2_9CLOT/138-343----GAGI--G-TVTFIRQNDH-------------------------------------A..FGGL-------GHGI.CD
A4J3G7_DESRM/210-419----TAGV--G-TMTFYHPESR-------------------------------------S..YGAL-------GHII.TD
E6U2J4_ETHHY/189-392----TAGI--G-TVTYFDPQNG-------------------------------------V..YAGL-------GHPV.CD
R5SUE4_9CLOT/122-326----VTGI--G-TLTYIDPNTM-------------------------------------I..YGAL-------GHEI.IE
R6XJ65_9FIRM/124-325----ILGI--G-TLTFITENNQ-------------------------------------...FASL-------GHGV.YD
R6QNQ2_9CLOT/190-395----SAGI--G-TMTFYDNDIG-------------------------------------C..FAGL-------GHGI.CD
R6KNJ0_9CLOT/215-423----TQGI--G-TITYVD.MNG-------------------------------------R..FGAL-------GHGI.SD
R6T3R8_9FIRM/188-393----SAGI--G-TLTFYDPENG-------------------------------------T..FGGL-------GHPV.CD
R7HTV5_9CLOT/214-418----TQGI--G-TLTYVT.KDG-------------------------------------K..FGAL-------GHGI.ND
R5VVX1_9FIRM/191-398----TAGV--G-TFTFYEPESG-------------------------------------A..FGGL-------GHPI.CD
R5TNP7_9FIRM/195-403----LAGI--G-TLTYID.GEG-------------------------------------T..FGAL-------GHGI.TD
Q18B75_PEPD6/138-350----ISGI--G-TMTFYDPSME-------------------------------------K..FKAI-------GHAI.KD
G2T3Q8_ROSHA/203-410----LAGV--G-TLTYYR.QDG-------------------------------------S..FGAL-------GHAV.SD
R6GHR5_9CLOT/190-395----SAGI--G-TVTFWDEKTK-------------------------------------V..FGGL-------GHGI.CD
E6TXR0_BACCJ/201-410----AAGV--G-TLTFYEPNSK-------------------------------------K..YGAL-------GHVI.SD
R6KEA9_9FIRM/207-412----AQGI--G-TLTYID.QSE-------------------------------------H..FGAL-------GHGI.TD
R7IWD1_9CLOT/192-400----AAGV--G-TVTFYNEDTK-------------------------------------C..FSAL-------GHAI.TD
R5VVV3_9DELT/153-356----SSGI--G-TLTYVR.KNL-------------------------------------N..FGSL-------GHPI.CD
R6I8W6_9FIRM/181-382----SAGI--G-TVTFYDRKNG-------------------------------------I..FAGL-------GHAV.CD
R7GGP8_9CLOT/117-316----DLGI--G-TLTFCN.EDG-------------------------------------H..FASL-------GHKM.VD
R5J7S8_9CLOT/122-325----ISGI--G-TLTYIDPGAR-------------------------------------M..YGAL-------GHEI.ID
R6FK23_9FIRM/138-346----IAGI--G-TLSFYDPDTN-------------------------------------V..FAAL-------GHGI.YE
R7P923_9CLOT/115-318----ITGI--G-TLSYIDPETK-------------------------------------I..YGAL-------GHEI.IE
R5KUR7_9CLOT/197-401----TAGI--G-TVTFYNPSSG-------------------------------------N..MAAL-------GHPI.TD
I3VWM7_THESW/214-421----TAGI--G-TLTFYTEDKK-------------------------------------Y..YAAL-------GHAI.TD
R6B2V6_9CLOT/193-402----AAGV--G-TLTFYEPSTN-------------------------------------T..FMAL-------GHGI.SD
R7DMS2_9FIRM/123-328----LIGI--G-TVSFYDPDTK-------------------------------------I..YGAL-------GHAI.ID
R5KNW9_9FIRM/197-403----SQGI--G-TITYVT.DDG-------------------------------------K..YRAL-------GHGI.SD
R7NI61_9MOLU/101-304----VTGI--G-TLTFIDPSTN-------------------------------------I..YGAL-------GHEV.LE
F2JMG1_CELLD/213-423----TQGI--G-TITYIHPKTG-------------------------------------A..FGAL-------GHGI.TD
K4L254_9FIRM/158-366----AAGV--G-TLTFTEPDTK-------------------------------------I..FGAL-------GHVI.TD
R6GNM4_9FIRM/130-329----ISGA--G-MTTFTR.DNG-------------------------------------F..FAAL-------GHKV.ID
R6Q3J2_9FIRM/197-399----SAGV--G-TLTFADEEKG-------------------------------------V..FAGL-------GHPI.SD
R6N1E9_9FIRM/118-320----TAGI--G-TVTYYNPQNN-------------------------------------S..FAAL-------GHGI.ND
R5SZK8_9CLOT/120-323----ITGI--G-TLTYIDPETK-------------------------------------I..FGAL-------GHEI.IE
R5YCX5_9FIRM/210-420----MAGI--G-TLTYYD.KDG-------------------------------------N..FGAL-------GHGI.GD
R7C759_9CLOT/199-406----TQGI--G-TLTYVT.KTG-------------------------------------E..FGTL-------GHGI.TD
W0E9D2_9FIRM/204-412----AAGV--G-TLTFYEPQTR-------------------------------------K..YGAL-------GHVI.ND
Q894H5_CLOTE/186-394----TTGV--G-TLTFYDDKTK-------------------------------------N..FAAL-------GHPI.TD
C9R866_AMMDK/202-412----TAGV--G-TLTFYEPKTR-------------------------------------L..YGAL-------GHAVDLG
R7HB69_9FIRM/198-403----AQGI--G-TMTYID.SSG-------------------------------------G..FGAL-------GHGI.SD
A6TR47_ALKMQ/212-421----TAGV--G-TLTFYDPVSY-------------------------------------K..FGAL-------GHGI.TD
R7ESB8_9FIRM/150-355----GAGI--G-TVTFIVPSTG-------------------------------------G..FGGL-------GHGI.CD
R6PKG4_9CLOT/142-350----AQGL--G-TITFLT.GNS-------------------------------------E..FGAL-------GHGI.HD
R7M6Q4_9CLOT/189-398----AAGV--G-TLTFYEPSSG-------------------------------------M..FGTL-------GHGI.LD
Q0AZD6_SYNWW/215-423----VVGV--G-TLTFWEPDSK-------------------------------------I..FAAL-------GHVI.ID
R7N4W4_9FIRM/233-441----AQGV--G-TMTYVD.EQG-------------------------------------H..FGAL-------GHGI.ND
R6YA95_9FIRM/170-373----AAGI--G-TLTFYDPATG-------------------------------------V..FAGL-------GHGI.CD
D5WV97_KYRT2/203-412----AAGV--G-TLTFYDPVNH-------------------------------------V..YGAL-------GHVI.TD
R5LXL5_9FIRM/207-415----CQGL--G-TLTYVD.DNN-------------------------------------R..FGAL-------GHAI.CE
R5DF89_9FIRM/134-342----AQGL--G-TITYLD.ADS-------------------------------------H..FGAL-------GHGI.HD
R6TFF4_9STAP/123-324----ILGI--G-TMTFITLDNY-------------------------------------...FGSL-------GHGI.YE
A5I2Z7_CLOBH/190-399----TAGV--G-TLTFYHDKSK-------------------------------------K..FAAL-------GHPI.TD
R6H4Q6_9CLOT/93-302----AAGV--G-TVSFYEPSSK-------------------------------------T..FGAL-------GHGI.TD
R6R368_9FIRM/120-325----ILGV--G-TISFYDPINK-------------------------------------S..YGAL-------AHEV.YD
A3DDL9_CLOTH/220-429----TAGI--G-TLTFYDPVTK-------------------------------------G..FGAL-------GHGI.TD
D3E6N1_GEOS4/216-425----AAGV--G-TLTFYAPHQK-------------------------------------V..YGAL-------GHVI.TD
F9VK25_ARTSS/181-387----TAGI--G-TVTFIDPVTG-------------------------------------I..YGAL-------GHPI.TD
R5QQG0_9FIRM/120-319----AKGI--G-TVTYYQLNTG-------------------------------------K..FACL-------GHNM.VD
G8LW28_CLOCD/215-424----TAGI--G-TLTFYDPKNN-------------------------------------A..FGAL-------GHGI.TD
R7L0T4_9FIRM/128-333----SAGI--G-TVTFYDPSTG-------------------------------------I..FAGL-------GHPV.CD
L7VQQ3_CLOSH/211-420----TAGI--G-TLTYIEEETG-------------------------------------K..FGAL-------GHGI.TD
C8WXF9_ALIAD/189-396----AVGV--G-TLTFYDPATG-------------------------------------R..FAAL-------GHLV.TD
Q2RIC4_MOOTA/204-410----TAGV--G-TLTFYDQNKG-------------------------------------V..FGAL-------GHVV.TG
R4KQW9_9FIRM/233-441----TAGV--G-TLTFYEPQTK-------------------------------------T..YGAL-------GHII.AD
A9KMA5_CLOPH/226-440----TQGI--G-TLTFVT.TTG-------------------------------------D..YGAL-------GHGI.TD
E6SKR3_THEM7/213-420----VAGV--G-TLTFYHPDSG-------------------------------------R..YAAL-------GHVV.AD
L0F7L5_DESDL/201-409----AAGV--G-TLTFYEPKTS-------------------------------------Q..YGAL-------GHVI.ND
I0JNU1_HALH3/190-399----AAGI--G-TMTFYHPDSK-------------------------------------K..YGAL-------GHVI.SD
R7EZR7_9BACI/119-323----ILGI--G-SITYIDTSSG-------------------------------------IATYGAL-------GHEI.DE
R6J055_9CLOT/188-393----TAGI--G-TVTYYDPQTG-------------------------------------V..MAAL-------GHPI.TD
R5NUG0_9CLOT/150-357----ISGI--G-TITYTD..GE-------------------------------------R..FAAL-------GHSI.ND
G2TKW2_BACCO/202-410----AAGI--G-TMTFIDPKTK-------------------------------------K..YGAL-------GHVI.SD
R5N690_9FIRM/195-399----MAGV--G-TITFVDSASK-------------------------------------V..FGGL-------GHAV.CD
R5VHC6_9FIRM/116-319----LLGN--G-TLTYIDPKTK-------------------------------------I..YGAL-------GHNV.IE
R5NBK1_9CLOT/140-350----AAGI--G-TLTYYEEATN-------------------------------------T..FAAL-------GHGI.ND
R5XPM2_9FIRM/142-350----VQGL--G-TITFLT.KNS-------------------------------------E..FGAL-------GHGI.HD
D5X7G9_THEPJ/215-423----AAGV--G-TITFYDPKTG-------------------------------------R..YGAL-------GHII.TD
F4A1F9_MAHA5/216-427----TAGV--G-TMTFYEPNNR-------------------------------------I..YGAL-------GHPI.TD
R7ITE0_9FIRM/153-365----TQGI--G-TMTCLT.REG-------------------------------------N..YAAL-------GHGI.SD
F6CL40_DESK7/196-404----AAGV--G-TLTFYEPRSK-------------------------------------K..YGAL-------GHVI.TD
L0EG06_THECK/215-424----AAGV--G-TLTFYAPEQG-------------------------------------V..YGAL-------GHII.TD
R5IDG3_9CLOT/215-423----TQGI--G-TVTYMD.LNG-------------------------------------K..FGAL-------GHGI.SD
R6CTL1_9CLOT/120-324----ISGI--G-TLTYIDPESK-------------------------------------I..YGAL-------GHEV.LE
K0B195_CLOA9/214-422----TAGI--G-TLTFYDEESE-------------------------------------K..FGAL-------GHSI.TD
B8D2I8_HALOH/212-421----VAGV--G-TLTFFDPKSG-------------------------------------E..YGAL-------GHVI.TE
R6NNU0_9FIRM/215-423----LAGI--G-TLTYIS.QDG-------------------------------------S..YGAL-------GHAV.TD
R6VE05_9FIRM/190-398----TQGI--G-TLTFLT.KEG-------------------------------------A..YGAL-------GHGI.SD
R6CN52_9FIRM/195-397----SAGI--G-TMTFFDPETL-------------------------------------A..FAGL-------GHAI.CD
R5H2U4_9FIRM/161-364----AAGI--G-TLTYFDPATG-------------------------------------S..FGGL-------GHPV.SD
R5V409_9FIRM/42-246----ILGI--G-TVTIYDPETN-------------------------------------T..YAAL-------GHQF.SD
R6GW98_9FIRM/112-314----ISGI--G-TLTYVDPETK-------------------------------------I..YGAL-------GHEI.IE
R7ICH4_9FIRM/201-410----TAGI--G-TLSFYDPDSG-------------------------------------Q..YAAL-------GHAI.TD
R7BI76_9FIRM/225-433----CQGL--G-TLTYID.KNG-------------------------------------R..FGAL-------GHGI.SD
C4Z0G6_EUBE2/204-408----TQGV--G-TVTYVC.EDG-------------------------------------T..FAAL-------GHGI.SD
R6NHB7_9CLOT/187-390----SAGI--G-TVTFYDDDGM-------------------------------------Y..FAGL-------GHGV.CD
R7R973_9FIRM/209-417----AQGI--G-TMTFLD.EEL-------------------------------------H..FGAL-------GHGI.ND
R5HM74_9FIRM/194-402----LAGI--G-TLTYYK.EDG-------------------------------------T..YGAL-------GHAV.SD
R6NAF9_9FIRM/131-335----SAGI--G-TVTYYDKSEN-------------------------------------Y..FAGL-------GHGI.CD
D9SLV5_CLOC7/152-361----MAGV--G-TLTFYEPESD-------------------------------------L..FAAL-------GHAV.TD
R5RSY4_9FIRM/191-399----IQGI--G-TLTYVD.QKG-------------------------------------T..FAAL-------GHGI.SD
R6HAH9_9FIRM/115-318----IAGV--G-TVTYYDPESG-------------------------------------A..FGAL-------GHGV.SD
R5XRH8_9CLOT/130-334----ITGI--G-TMTCYDPEKN-------------------------------------Q..FYAI-------GHPI.YD
R7FZ38_9FIRM/124-328----ASGI--G-TITFIDPSGS-------------------------------------T..FAGL-------GHGI.CD
R5I6P6_9FIRM/190-402----TQGI--G-TLTFVT.ENG-------------------------------------K..FGAL-------GHGI.SD
B8I3A0_CLOCE/216-424----TAGI--G-TMTFYDPQTH-------------------------------------G..FGAL-------GHGI.TD
R6DXQ1_9FIRM/188-391----TAGI--G-TVTWYDRTNG-------------------------------------I..FAGL-------GHAV.CD
R5E160_9FIRM/211-416----AQGI--G-TLTYID.SDN-------------------------------------N..FAAL-------GHGI.SA
Q97HE0_CLOAB/180-389----TAGI--G-TLTFYSDKTK-------------------------------------V..FGAL-------GHPI.TD
R6M2Z6_9CLOT/206-414----TEGI--G-TITYIS.PDN-------------------------------------T..YAAL-------GHGI.AD
D6DLB6_CLOSC/286-502----TQGI--G-TMTYVT.QSG-------------------------------------E..YGAL-------GHGI.SD
R6RY05_9CLOT/215-423----TQGI--G-TVTYVD.MNG-------------------------------------S..FGAL-------GHGI.SD
F4LV06_TEPAE/231-436----TAGV--G-TLTFYDPQTG-------------------------------------F..YGAL-------GHII.SD
R6UED3_9CLOT/182-387----SAGI--G-TMTFYHPKSS-------------------------------------A..FGGL-------GHGI.CD
R5AES8_9CLOT/42-250----TAGV--G-TLSFCSAQGD-------------------------------------R..FAAL-------GHAV.SD
B2TRL9_CLOBB/180-389----TAGV--G-TMTFIDSESK-------------------------------------K..FGAL-------GHPI.TD
R5D6V9_9FIRM/122-319----ISGV--G-TLTFYDPATG-------------------------------------I..YGAL-------GHSI.SD
D7CKI9_SYNLT/219-426----VAGV--G-TLSFWDPLTG-------------------------------------R..YAAL-------GHII.AD
R5TH80_9CLOT/132-335----SAGV--G-TVTFYEENSK-------------------------------------R..FAAL-------GHGV.TE
R5MT91_9FIRM/111-313----ITGI--G-TLTYIDPQTR-------------------------------------L..FGAL-------GHEI.IE
R6YLB5_9CLOT/118-321----INGV--G-TLTFIDPNTK-------------------------------------I..FGAL-------GHEI.AD
R6MJ71_9FIRM/142-350----AQGL--G-TITFLN.ADS-------------------------------------E..YGAL-------GHGI.HD
D4M5K6_9FIRM/149-357----VQGL--G-TITFLT.KNN-------------------------------------R..FAAL-------GHGI.HD
D9S3S9_THEOJ/214-422----AAGV--G-TLTFYDPESG-------------------------------------Y..YGAL-------GHII.SD
F6B9N5_DESCC/210-419----TAGV--G-TMTFFDPKTK-------------------------------------A..YGAL-------GHII.SD
R6TLY4_9FIRM/137-344----MAGI--G-TMTYYDPDSG-------------------------------------A..FGAL-------GHGI.TD
R5ZMQ1_9CLOT/199-408----AAGV--G-TLTFYEPSTG-------------------------------------K..FAAL-------GHGI.VD
Q67NC5_SYMTH/207-416----ASGV--G-TLTFYHPPTR-------------------------------------K..FGAL-------GHVI.AE
R6TRP0_9CLOT/120-323----ILGI--G-TLTFVDPNTK-------------------------------------K..FGAL-------GHEI.LE
R7L6Y3_9CLOT/233-442----AAGV--G-TLTFYNPEDN-------------------------------------K..CVAL-------GHGI.TD
R6BNR4_9CLOT/114-319----VVGL--G-TLTYIDPISK-------------------------------------I..YGAL-------GHEI.IL
Q9K975_BACHD/212-422----AAGV--G-TLTFYDPVSK-------------------------------------K..YGAL-------GHVI.SD
D4KCM7_9FIRM/192-394----SAGV--G-TLTFVDVQAG-------------------------------------V..FAGL-------GHPI.SD
R5QDI6_9FIRM/145-349----AAGI--G-TVTFIDPKTL-------------------------------------I..FGGL-------GHGI.CE
B1I568_DESAP/211-420----AAGV--G-TLTFHDPKTG-------------------------------------S..YGAL-------GHVI.TD
R5NSK8_9FIRM/199-407----SQGI--G-TLTFIT.KDG-------------------------------------K..FGAL-------GHGI.SD
R6ZZF6_9FIRM/208-413----TQGI--G-TMTYIT.KNG-------------------------------------K..FGAL-------GHGI.TD
R6L493_9FIRM/190-397----TQGI--G-TITFVD.ENG-------------------------------------S..YGAL-------GHGI.SD
A8MFI3_ALKOO/213-422----TAGV--G-TLSFFHMESG-------------------------------------K..FGAL-------GHAI.TD
Q8RAC0_CALS4/204-412----TAGI--G-TLTFYYPSQK-------------------------------------V..YAAL-------GHAI.TD
R6G9J9_9FIRM/191-398----IQGI--G-TLTYVE.PNG-------------------------------------T..FGAL-------GHGI.SD
R5HAQ1_9FIRM/145-350----MAGI--G-TLTFVDPETG-------------------------------------L..FGTL-------GHGI.ND
K4LFQ1_THEPS/206-415----AAGV--G-TLTFYEAQTK-------------------------------------K..FGAL-------GHEI.TD
W6RY93_9CLOT/148-357----TAGV--G-TLTFYDKKSN-------------------------------------I..FGAL-------GHGI.ID
R5UHP5_9FIRM/212-422----MAGI--G-TLTYFD.QDG-------------------------------------N..FGAL-------GHGI.GN
R7G2H0_9FIRM/142-350----AQGL--G-TVTFLN.SDS-------------------------------------R..FGAL-------GHGI.HD
R6WHU5_9CLOT/131-335----ITGI--G-TLTYVT.TDG-------------------------------------N..FGAL-------GHHI.AD
R6S308_9FIRM/142-350----AQGL--G-TITYLD.SDS-------------------------------------H..FGAL-------GHGI.HD
R5B250_9CLOT/200-409----TAGI--G-TLTFYTMSSM-------------------------------------R..FGAL-------GHAV.TD
R5SFB7_9FIRM/137-344----MAGI--G-TVTFYDPQTG-------------------------------------V..FAAL-------GHGI.TD
R6GC90_9FIRM/150-358----TQGI--G-TITFIR.EDG-------------------------------------T..FAAL-------GHGI.ND
D9R8M8_CLOSW/214-422----TQGI--G-TMTYVD.MNG-------------------------------------Q..FGAL-------GHGI.SD
R5RQY0_9FIRM/121-325----ISGV--G-TLTFYNPATS-------------------------------------T..FGAL-------GHAM.SD
R5LJL6_9MOLU/118-321----INGI--G-TLTYIDPESR-------------------------------------V..FGAL-------GHEI.LE
R7AQT1_9BACE/225-434----SQGI--G-TLTYIA.PDS-------------------------------------S..FGAL-------GHPI.SD
X4ZLT8_9BACL/99-308----AAGV--G-TLTFYAPNQG-------------------------------------V..YGAL-------GHVI.TD
F8I8Y9_SULAT/220-427----TSGV--G-TLSFYNPRTL-------------------------------------Q..YFAL-------GHSM.TD
R6MC60_9CLOT/122-326----ITGV--G-TLTYIDPNTK-------------------------------------L..FGAL-------GHEI.IE
R6TCX6_9FIRM/135-339----TAGI--G-TVTFIDPDTG-------------------------------------E..FGGL-------GHGI.CD
R6R1J4_9FIRM/212-417----IQGI--G-TVTFFDETTD-------------------------------------R..FGAL-------GHGI.YD
R6YL37_9CLOT/139-347----AAGV--G-TLTFYCEQLK-------------------------------------T..FAAL-------GHAI.TD
R5XPM6_9FIRM/190-397----TQGI--G-TLTFVD.EKG-------------------------------------R..YGAL-------GHGI.SD
A0Q0A9_CLONN/187-396----TSGV--G-TLTFYDSKSN-------------------------------------K..FAAL-------GHPI.TD
D4LPR1_9FIRM/190-397----TQGI--G-TLTYVD.ENG-------------------------------------G..FGAL-------GHGI.SD
R7DAB6_9FIRM/190-397----TQGI--G-TLTFVD.QNG-------------------------------------N..YGAL-------GHGI.SD
C0ZC15_BREBN/214-423----AAGV--G-TLTFYDPNSK-------------------------------------A..YGAL-------GHVI.SD
R6QE36_9FIRM/194-400----TQGV--G-TLTYFDKDTK-------------------------------------N..YGAL-------GHPI.VD
R5K6N9_9CLOT/167-373----ISGI--G-TVTFLCGNQ.-------------------------------------...FMAL-------GHSV.SD
R6ZCY0_9FIRM/221-429----AQGV--G-TMTYID.EQG-------------------------------------N..FGAL-------GHGI.ND
R5HLI4_9MOLU/115-317----VSGI--G-TLTFIDPNTK-------------------------------------L..FGAL-------GHEI.TD
R6NKY3_9CLOT/194-403----AAGV--G-TVTFYEPSTK-------------------------------------T..FGAL-------GHGI.TD
R5JXE7_9FIRM/156-361----ISGI--G-TMTYIDEDS.-------------------------------------...FAAL-------GHSV.SD
R5AF90_9FIRM/133-337----IQGI--G-TVTYYDAENG-------------------------------------T..FGAL-------GHGV.YD
R5TU24_9FIRM/139-347----VQGL--G-TITFMT.RDG-------------------------------------A..FGAL-------GHGI.HD
R6P0Q8_9CLOT/193-398----SAGI--G-TLTFYNPEEH-------------------------------------S..FAGL-------GHGI.CD
R6DUC4_9FIRM/127-333----MAGI--G-TLTYYDPATG-------------------------------------Q..YGAL-------GHGI.TD
R7F4Z6_9CLOT/192-401----ASGV--G-TISFYDPNTG-------------------------------------E..FGAL-------GHGI.LD
R6X4M8_9FIRM/136-339----TAGI--G-TLTYIDPAND-------------------------------------S..FGGL-------GHGI.CD
R6EKK3_9FIRM/143-351----IAGI--G-TMTFYDPKTN-------------------------------------A..IASL-------GHGI.YE
Q5WF67_BACSK/198-409----AAGV--G-TMTFYEPQSM-------------------------------------K..YGAL-------GHVI.SD
R7JU02_9FIRM/197-405----MQGI--G-TLTFVE.PDG-------------------------------------T..FAAL-------GHGI.SD
G4KYV3_OSCVS/185-393----MAGI--G-TMTFYDPESN-------------------------------------T..FGAL-------GHGI.TD
Q3AAN6_CARHZ/163-370----IAGL--G-TLSYYNPQDK-------------------------------------T..FGAL-------GHTI.ID
R5VSI3_9CLOT/190-396----TQGI--G-TMTYIT.ENG-------------------------------------R..FGTL-------GHGI.TD
R7MHL3_9FIRM/193-401----TAGI--G-TITFIDKSSG-------------------------------------R..FAGL-------GHPI.CD
R6RU79_9FIRM/211-417----TQGI--G-TMTYME.ENG-------------------------------------K..FGAL-------GHGI.SD
R6Q618_9FIRM/189-393----TAGV--G-TVTFYDKSTN-------------------------------------C..VAAL-------GHPI.TD
R7K1G6_9CLOT/231-438----TEGI--G-TLTFVT.EEN-------------------------------------E..FAAL-------GHGI.TD
L0K691_HALHC/216-425----AAGV--G-TMSFYMPNSG-------------------------------------Y..YGAL-------GHMI.TE
R5FFJ0_9FIRM/179-381----VDGI--G-TLTFVN.TDG-------------------------------------S..FGAL-------GHMI.YD
R7G6U2_9FIRM/124-329----LTGV--G-TLTYYDPSNQ-------------------------------------S..YGAL-------GHEI.YD
R5G573_9FIRM/138-340----ILGV--G-TMTYYDLKTK-------------------------------------K..FASL-------GHGA.ID
K0IY14_AMPXN/203-412----AAGI--G-TMTFLDPQTN-------------------------------------M..YGAL-------GHVI.AD
R6USZ2_9FIRM/121-326----IVGV--G-TLTYYDPSNN-------------------------------------T..YGAL-------GHEI.MD
R6PFE8_9FIRM/190-396----TQGI--G-TMTYID.ENG-------------------------------------K..FGAL-------GHGI.SD
F0T085_SYNGF/158-366----AAGV--G-TLTFIEPKQQ-------------------------------------I..FGAL-------GHVI.TD
R7HK64_9FIRM/123-327----ITGV--G-TLTFIDPNTK-------------------------------------L..FGAL-------GHEI.IE
R6AWH8_9CLOT/116-318----ISGI--G-TLTYIDPETK-------------------------------------I..YGAL-------GHEI.VE
R6FWG8_9CLOT/176-385----TAGI--G-TLTFYDKDSK-------------------------------------T..FGAL-------GHPI.TD
R4KDG0_CLOPA/191-400----TAGV--G-TLTFYHEKSG-------------------------------------K..FAAL-------GHPI.TD
R5QW36_9FIRM/145-353----VQGL--G-TVTFLT.DQS-------------------------------------R..FGAL-------GHGI.HD
R6CRQ2_9CLOT/225-433----AQGI--G-TMTFID.SEG-------------------------------------N..FGAL-------GHGI.SD
R7KGU6_9CLOT/125-328----ITGI--G-TLTYIDPDTK-------------------------------------I..FGAL-------GHEI.LE
R6U8G2_9CLOT/145-349----SAGV--G-TITFYDKKSG-------------------------------------K..FGAL-------GHAV.TE
R5A3A4_9CLOT/113-318----VVGL--G-TLTYIDPVTK-------------------------------------I..WGAL-------GHEI.LL
R5J0Y5_9FIRM/121-325----VTGI--G-TLTFIDPNTK-------------------------------------I..FGAL-------GHEI.QE
D4MXQ8_9FIRM/198-400----TQGI--G-TMTYVKGTS.-------------------------------------...FGGL-------GHGI.YD
Q8EQ48_OCEIH/176-385----AAGI--G-TMTFYDPVSG-------------------------------------K..YGAL-------GHVI.SD
R5YPZ4_9MOLU/74-277----IIGI--G-TLTFIDPNTK-------------------------------------M..YGAL-------GHEI.ME
SP4B_BACSU/203-412----AAGI--G-TMTFYEPKTK-------------------------------------K..YGAL-------GHVI.SD

PF00947

POLG_HE701/883-1009----------N--------------------------------------------------------------YHLA---
POLG_POL1M/899-1025----------N--------------------------------------------------------------YHLA---
POLG_PEV9U/854-980----------N--------------------------------------------------------------RHLA---
POLG_CXB1J/867-993----------N--------------------------------------------------------------RHLA---
POLG_HRV1B/873-998----------N--------------------------------------------------------------LHLF---
POLG_BOVEV/859-985----------N--------------------------------------------------------------RHLA---
POLG_CX16G/881-1007----------N--------------------------------------------------------------RHLA---
POLG_CXA21/897-1023----------N--------------------------------------------------------------YHLA---
POLG_HRV14/874-1000----------N--------------------------------------------------------------YHLM---

PF02122

P1_TYYVF/206-408------ID--G-FKSFTIPQSP------------------------------------------PK-------SCVI---
P1_PLRV1/207-407------VE--G-YKGFSVPQKP------------------------------------------PK-------SAVI---
Q17S70_9LUTE/218-418------TK--G-FGSYDMIMSP------------------------------------------PK-------SCVL---
Q2L3H9_9LUTE/218-419------VQ--G-FKSFAVPMSP------------------------------------------PG-------HSVL---
P1_PNLV/224-424------VE--G-YKPFIIPQKS------------------------------------------PK-------KSVI---
Q65968_9LUTE/202-403------VE--G-YLSFKIPQNP------------------------------------------PK-------NSVL---
Q670I3_9LUTE/214-415------CE--G-YTTFSIPQNP------------------------------------------PK-------HSVV---
Q70AF6_9LUTE/441-642------AS--G-KYWWEMAEEE------------------------------------------DD-------FVVE---
Q83737_9LUTE/202-414------VK--G-FLTFTIKQSP------------------------------------------PR-------NCIL---
P1_PEMVW/318-522------IP--G-VQIKKLREDP------------------------------------------PK-------GVIL---
Q89645_9LUTE/210-411------VS--G-YDSYSIPSTP------------------------------------------PK-------RSVI---
Q8JZ11_9LUTE/202-403------VE--G-FLSFKIPQSP------------------------------------------PK-------NSVL---
Q91AV6_9LUTE/212-414------VR--G-FTTWAVPMKP------------------------------------------PK-------NSIL---
Q9EB08_9VIRU/363-572------KR--E-FAWIPESGKY------------------------------------------WA-------DEDE---
Q9IZF6_9LUTE/208-408------VA--G-FDSYSIPQSP------------------------------------------PK-------KSVI---

PF05578

POLG_BVDVN/1680-1890----------G-PAVCKKITEH------------------------------------------EK-------CHIN---

PF02395

HAP1_HAEIN/17-782----TK.A--P-MIDFSVVSRN-----------------------------------.GVAALVGD-------QYIVSVA
IGA0_HAEIN/17-865----PNGI--P-MIDFSVVDVD-----------------------------------KRIATLINP-------QYVVGVK
Q5F9W2_NEIG1/19-848----LSNV--P-MIDFSVADVN-----------------------------------KRIATVVDP-------QYAVSVK

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268GTRTATLSLEGPPREHKCRVHMA.....KAAGKGPIGHDDVVEKYGLCET....EEDEEVAHTEIPSATMEGKNKGKNKK
Q9YQ23_VESV/628-1162......RSSPTQLESHNCRYHRAERENREVDGAKVTGHLGMVDRYGLCES....EEEEVTPTPPPQKKKAAPIMKTQLES
Q80J95_9CALI/650-1163...............................SRPSFYWDXGYTYRDGPGSFDIFEDDDDGWY......HSEG.KKGKNKK
Q8JJL0_9CALI/645-1175..........................CWERWVKPT.....ETQEASEPEK....EVAQGRWEIEPKDAEPEG.KKGKNKK
Q80RD7_9CALI/641-1177.........................NIQNLWSRPPVGDAEEVTSQDGCPK....PKDDEEFVISSSDITPEG.KKGKNKT

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321R-------------------------------------------------------------------------------
POLG_TUMVJ/107-361G-------------------------------------------------------------------------------
Q85074_9POTV/144-397L-------------------------------------------------------------------------------
POLG_ZYMVR/71-312P-------------------------------------------------------------------------------
P90213_9POTV/300-546K-------------------------------------------------------------------------------
POLG_PEMVC/44-286M-------------------------------------------------------------------------------
POLG_TVMV/30-273A-------------------------------------------------------------------------------
POLG_RGMVD/13-255K-------------------------------------------------------------------------------
POLG_LMV0/179-436R-------------------------------------------------------------------------------
POLG_PVMA/45-297L-------------------------------------------------------------------------------
POLG_PSBMV/143-396L-------------------------------------------------------------------------------
Q82933_9POTV/2-236Y-------------------------------------------------------------------------------
POLG_PVYN/41-283K-------------------------------------------------------------------------------
Q65892_BYMV/40-283P-------------------------------------------------------------------------------
POLG_BCMNN/77-316L-------------------------------------------------------------------------------
POLG_ZYMVC/70-309P-------------------------------------------------------------------------------
Q65852_BYMV/40-283P-------------------------------------------------------------------------------
POLG_SBMVG/69-307L-------------------------------------------------------------------------------
O73463_MDMV/2-232A-------------------------------------------------------------------------------
POLG_PVYHU/41-283K-------------------------------------------------------------------------------
POLG_PPVD/59-307S-------------------------------------------------------------------------------
Q85057_9POTV/204-442C-------------------------------------------------------------------------------
O39734_9POTV/410-663G-------------------------------------------------------------------------------
POLG_ZYMVS/71-312P-------------------------------------------------------------------------------
POLG_PRSVH/300-546R-------------------------------------------------------------------------------
POLG_TEV/53-303L-------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468.IPI----------------------------------------------------------------------------
Y577_MYCPN/197-333..DV----------------------------------------------------------------------------
Y589_MYCPN/14-134.TLT----------------------------------------------------------------------------
Y591_MYCPN/171-291.RLT----------------------------------------------------------------------------
Y586_MYCPN/154-286DKTT----------------------------------------------------------------------------
POLG_YEFV1/1503-1655.RGV----------------------------------------------------------------------------
POLG_DEN1W/1493-1642.VGV----------------------------------------------------------------------------

PF01732

A5IYK2_MYCAP/279-649RNTFDKSLHMKDLKDT................................................................
Q6MUH9_MYCMS/258-617RKTFDKSIFNNK....................................................................
Q2SR25_MYCCT/264-622RNTFDKSIFNNK....................................................................
D3VQF5_MYCA6/359-733RNAFDRSLYFDS....................................................................
Q4A635_MYCS5/147-497RTANDYEFYVQNS...................................................................
Q4A5A2_MYCS5/91-491VTAQNVNENVAQNDV.................................................................
C7LM95_MYCML/189-571SNSLTEEQNKEFNYYD................................................................
A5IYA1_MYCAP/186-569SNSLEKEKQEKLNYYD................................................................
Q4A798_MYCH7/125-523SNTLDENLGKKLNYED................................................................
Q4A5G2_MYCS5/337-740SNTLTEEQDKHLNYFD................................................................
Q7NC63_MYCGA/244-661GNTNSKELDDLLSYSD................................................................
C5J6P1_MYCCR/115-482FNTLDAKYKQTFPEYFTDT.............................................................
Q7NAU7_MYCGA/221-623WNKNDFDRPVTDL...................................................................
Q7NAG1_MYCGA/203-712MKAKSDGSRFTNIVDLNAEKERFEKVQKTFDEGQTKWEGISKNYLDKIEKLHADVKKYHGLKQQAETDGNAAKVSEYENL
Q7NAF2_MYCGA/203-710MKKESDGSRFTNIVDEKAEAQRYQKAKAAFDAGENKWKELTKPYQEKIERLYGEKNRYIGLKQQAETNGDAAKTKEYEDL
Q4A5P6_MYCS5/166-643TFTKSQTDSFGSDFTSIYNEEREKPLIKEARNVKAQIDKLQNEYNEVYAKLQTKE.........................
D1J8A8_MYCHP/334-723................................................................................
B1RXG0_UREUR/379-750................................................................................
MALP_UREPA/376-752................................................................................
Q9PR98_UREPA/413-786................................................................................
Q6MSY9_MYCMS/283-769................................................................................
Q98Q64_MYCPU/350-715................................................................................
Q98QS3_MYCPU/339-702................................................................................
Q7NAJ2_MYCGA/204-545QLAGDSQALIR.....................................................................
Q4A7B5_MYCH7/323-738LVANDYHPDSIYGRDEDAYNSY..........................................................
Q98PH9_MYCPU/101-415SSRDFPESTK......................................................................
Q8EWB5_MYCPE/130-442RVKNDIITPERYENIE................................................................
Q8EW95_MYCPE/145-484KVKDDKLYPEKFGTWDPSATGDNK........................................................
Y068_MYCGE/48-383RNNND...YEPY.NKDSNNQAF..........................................................
Y084_MYCPN/45-410RNPQD...YEPY.NKDSNGQDY..........................................................
Y588_MYCPN/75-444RNDQD...YEPY.KKDQNKQDF..........................................................
Y395_MYCGE/89-428RNIGD...HWPY.SKTDDQREF..........................................................
Y592_MYCPN/104-443RNKDD...YKPY.NKDGNQKEF..........................................................
Y083_MYCPN/52-447KNDQD...YAPY.NKDGWGQPY..........................................................
Y582_MYCPN/44-388KNRED...HPPYNQFD................................................................
Q4A8M7_MYCH7/557-908LNKPDQVYSFSY....................................................................
Q8EWN7_MYCPE/57-397NSLNNTTTRY......................................................................
B1RXU5_UREUR/59-344................................................................................

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
POLG_POL1M/1566-1731--------------------------------------------------------------------------------
Q9DLK1_FMDVP/1643-1826--------------------------------------------------------------------------------

PF12380

Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF05409

R1A_CVH22/2994-3281--------------------------------------------------------------------------------
R1A_IBVB/2808-3096--------------------------------------------------------------------------------
B6VDX7_THCOV/2516-2804--------------------------------------------------------------------------------
R1AB_FIPV/2932-3219--------------------------------------------------------------------------------
R1A_CVHSA/3269-3559--------------------------------------------------------------------------------
R1A_CVMA5/3362-3648--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569S..............KTHRYQI.....W----------------------------------------------------
SP24D_ANOGA/50-264GAL..........VVPASSIVV.....V----------------------------------------------------
TRY5_AEDAE/40-260...............GQTNLQV.....R----------------------------------------------------
UROK_HUMAN/179-419Y.............PKKEDYIV.....Y----------------------------------------------------
MASP1_MOUSE/454-696SLDPEEPTLHSSYLLSPSDFKI.....I----------------------------------------------------
CTR1_ANOGA/33-250H..............APGDLMV.....L----------------------------------------------------
CFAD_HUMAN/26-248A..............ADGKVQV.....L----------------------------------------------------
ACRO_RAT/43-286K.............KKVYDWRL.....V----------------------------------------------------
HPT_HUMAN/162-399HSE..........NATAKDIAP......----------------------------------------------------
CASP_MESAU/445-682................NSDPSM.....Y----------------------------------------------------
A8JQZ2_DROME/186-427G.............SKPPDM.V.....R----------------------------------------------------
PCE_TACTR/128-370S.............AGTDVMPADVFSVR----------------------------------------------------
STUB_DROME/544-782L..............LISQIRI.....R----------------------------------------------------
TRYU_DROME/28-254R..............EAENFLV.....V----------------------------------------------------
TRYI_DROME/28-245R..............SVTLMKV.....R----------------------------------------------------
TRYB_MANSE/25-252D..............AVNRWRV.....R----------------------------------------------------
TRYP_FUSOX/25-244Y..............AQSGFQI.....R----------------------------------------------------
B1VV86_STRGG/37-252...............SGNNTSI....TA----------------------------------------------------
TRY1_HUMAN/24-239..................RIQV.....R----------------------------------------------------
TRYP_PIG/9-224..................RIQV.....R----------------------------------------------------
TRY1_SALSA/21-235..................RVEV.....R----------------------------------------------------
TRYP_PLEPL/23-242................PYAMQV.....M----------------------------------------------------
DEGP3_ARATH/99-287................QTSVKV......----------------------------------------------------
DEGP2_ARATH/121-308..................DTQV......----------------------------------------------------
E2X833_SHIDY/62-244..................ADQI.....I----------------------------------------------------
DEGS_HAEIN/37-240...............VIMSKDG....YI----------------------------------------------------
YYXA_BACSU/99-283............................----------------------------------------------------
DEGP_SALTY/97-278..................AS........----------------------------------------------------
Q44596_BRUAO/85-261................ADEIKV.....A----------------------------------------------------
DEGPL_BRUA2/125-298............................----------------------------------------------------
O06439_RHOCA/59-235.................EDGNT.....V----------------------------------------------------
HHOA_SYNY3/95-274.................ASKVV......----------------------------------------------------
HTRA_SYNY3/156-334..................ADEV......----------------------------------------------------
O42417_CHICK/87-286................RRRVRVK...LA----------------------------------------------------
A0A0E3T8P7_9CAUD/70-274ANG.........DPSKV.SFRP....SI----------------------------------------------------
ETB_STAAU/59-251.................AAKNP.....S----------------------------------------------------
SPLB_STAA9/37-234.................YKVGD.....R----------------------------------------------------
SPLC_STAA9/38-233...................YKV......----------------------------------------------------
MPR_BACSU/95-311..................QDHG.....W----------------------------------------------------
PRTC_STRGR/205-383............................----------------------------------------------------
Q55353_STRSQ/198-372............................----------------------------------------------------
Q55352_STRSQ/202-378.................GNATTG..FNR----------------------------------------------------
Q54395_STRLI/158-342...................ATM.....W----------------------------------------------------
SP1_RARFA/205-391G..............KGHILKT....EM----------------------------------------------------
CERC_SCHMA/28-256...............PLPVIRVSFLTLR----------------------------------------------------
Q54344_STRLI/47-254T..............PGGEV.......K----------------------------------------------------
CFAB_HUMAN/481-752...................VDD......----------------------------------------------------
PROZ_BOVIN/143-352...................YAN......----------------------------------------------------
CAC3_BOVIN/12-246................SRTYQV.....V----------------------------------------------------
CELA1_PIG/27-259................ELTFRV.....V----------------------------------------------------
CTRA_BOVIN/16-238.................TSDVV.....V----------------------------------------------------
CTRL_HALRU/24-251...............SASSYRL....G.----------------------------------------------------
COGS_HYPLI/31-252...............AV.SVVV.....Y----------------------------------------------------
CTRB1_LITVA/46-263................AGFVEV.....V----------------------------------------------------
CATG_MOUSE/21-238.................SSINV.....T----------------------------------------------------
MCPT2_RAT/21-239.................REITV.....I----------------------------------------------------
ELNE_HUMAN/30-242V..............NVRAVRV.....V----------------------------------------------------
PRTN3_HUMAN/28-243I..............PQRLVNV.....V----------------------------------------------------
GRAK_RAT/26-248................GHSPTV.....V----------------------------------------------------
GRAM_RAT/21-245...............PLQQLKL.....V----------------------------------------------------
KLK1_MOUSE/25-253..................KYQV.....W----------------------------------------------------
KLK2_RAT/25-251..................NYQV.....L----------------------------------------------------
VSPCA_AGKCO/1-217..................NMRI.....Y----------------------------------------------------
HGF_RAT/496-719RN............KDLKDYEA.....W----------------------------------------------------
ENTK_PIG/800-1029.................RNLEPSKWKAI----------------------------------------------------
PRSS8_HUMAN/45-281E.............HHKEAYEV.....K----------------------------------------------------
HGFA_HUMAN/408-641S.............PPRDSVSV.....V----------------------------------------------------
TPA_HUMAN/311-556R.............FPPHHLTV.....I----------------------------------------------------
H2Q7T9_PANTR/235-462A..............KR..FKV.....R----------------------------------------------------
THRB_BOVIN/367-616P.............PWDKNFTVDDLLVR----------------------------------------------------
PROC_HUMAN/212-445................SKKLLV.....R----------------------------------------------------

PF13365

A9VAG6_MONBE/28-203............................----------------------------------------------------
B9S6M7_RICCO/99-269............................----------------------------------------------------
A9FFZ4_SORC5/137-265............................----------------------------------------------------
D0N1Z1_PHYIT/130-271............................----------------------------------------------------
A1VVN7_POLNA/138-318LLDAQDMPLQD......SRDRLKITFDA----------------------------------------------------
D4LWF1_9FIRM/167-311............................----------------------------------------------------
C4ZI06_EUBR3/149-289............................----------------------------------------------------
D4M0U9_9FIRM/159-303............................----------------------------------------------------
D4N037_9FIRM/379-516............................----------------------------------------------------
C5WUT2_SORBI/32-182............................----------------------------------------------------
Q1GZ24_METFK/25-167............................----------------------------------------------------
Q126C2_POLSJ/74-216............................----------------------------------------------------
A2SEV1_METPP/84-217............................----------------------------------------------------
B0T7U9_CAUSK/55-188............................----------------------------------------------------
B9JA65_AGRRK/33-164............................----------------------------------------------------
D5SQ02_PLAL2/103-278............................----------------------------------------------------
A0L9W3_MAGMM/126-265............................----------------------------------------------------
Q75HK9_ORYSJ/40-213............................----------------------------------------------------
B7FUE8_PHATC/1283-1490............................----------------------------------------------------
A9F8J5_SORC5/19-173............................----------------------------------------------------
Q00YL5_OSTTA/68-221............................----------------------------------------------------
D2R6U2_PIRSD/68-213............................----------------------------------------------------
Q7UNU5_RHOBA/96-240............................----------------------------------------------------
D5SYB2_PLAL2/75-226............................----------------------------------------------------
D5ST85_PLAL2/188-324............................----------------------------------------------------
B8EPM5_METSB/283-415............................----------------------------------------------------
Q7URA6_RHOBA/240-384............................----------------------------------------------------
D2R0U2_PIRSD/218-358............................----------------------------------------------------
D1CC35_THET1/99-237............................----------------------------------------------------
A4S513_OSTLU/76-226............................----------------------------------------------------
A4S4E4_OSTLU/26-173............................----------------------------------------------------
Q3IXI9_RHOS4/47-206............................----------------------------------------------------
Q08MN7_STIAD/50-171............................----------------------------------------------------
Q7UNU4_RHOBA/89-223............................----------------------------------------------------
B8BSP4_THAPS/582-769............................----------------------------------------------------
A9F4P7_SORC5/37-166............................----------------------------------------------------
Q67SY9_SYMTH/37-178............................----------------------------------------------------
Q1IY94_DEIGD/67-198............................----------------------------------------------------
D5SYB3_PLAL2/92-222............................----------------------------------------------------
D2R6U3_PIRSD/90-221............................----------------------------------------------------
Q21G29_SACD2/103-235............................----------------------------------------------------
Q08Q29_STIAD/85-219............................----------------------------------------------------
A4YVG9_BRASO/68-206............................----------------------------------------------------
A2SCU5_METPP/86-236............................----------------------------------------------------
Q0RIR2_FRAAA/55-221............................----------------------------------------------------
A2SLK2_METPP/110-244............................----------------------------------------------------
D1CHW8_THET1/35-167............................----------------------------------------------------
B2IZX6_NOSP7/35-159............................----------------------------------------------------
Q01SP4_SOLUE/26-150............................----------------------------------------------------
Q98IG3_RHILO/78-212............................----------------------------------------------------
B0U7I8_METS4/36-169............................----------------------------------------------------
Q89E13_BRADU/35-167............................----------------------------------------------------
A7H8S6_ANADF/35-169............................----------------------------------------------------
Q1DFJ7_MYXXD/51-186............................----------------------------------------------------
D1CHW7_THET1/37-171............................----------------------------------------------------
D1C9X4_SPHTD/41-176............................----------------------------------------------------
Q7NEY6_GLOVI/37-172............................----------------------------------------------------
Q01SP5_SOLUE/107-240............................----------------------------------------------------
C4Z416_EUBE2/141-284............................----------------------------------------------------
Q7EYD8_ORYSJ/206-349............................----------------------------------------------------
Q6ATB3_ORYSJ/64-208............................----------------------------------------------------
C5Y9X9_SORBI/128-269............................----------------------------------------------------
C5XIJ1_SORBI/75-220............................----------------------------------------------------
C5WUT6_SORBI/430-572............................----------------------------------------------------
C5YNZ0_SORBI/297-442............................----------------------------------------------------
C5YX14_SORBI/284-426............................----------------------------------------------------
Q0JIU9_ORYSJ/149-291............................----------------------------------------------------
Q82G14_STRAW/89-242............................----------------------------------------------------
C7QED1_CATAD/56-225............................----------------------------------------------------
C9Z823_STRSW/62-228............................----------------------------------------------------
C9ZGQ1_STRSW/72-240............................----------------------------------------------------
Q93JK9_STRCO/54-222............................----------------------------------------------------
D2QDD9_SPILD/31-236............................----------------------------------------------------
C5Y9N3_SORBI/149-346IF........................TV----------------------------------------------------
Q92JT1_RHIME/45-189............................----------------------------------------------------
B0C7H5_ACAM1/63-201............................----------------------------------------------------
Q15T30_PSEA6/50-191............................----------------------------------------------------
A5E551_LODEL/303-457............................----------------------------------------------------
A3LV17_PICST/282-443............................----------------------------------------------------
Q6BLK4_DEBHA/295-454............................----------------------------------------------------
A5DCA5_PICGU/274-427............................----------------------------------------------------
D0N2P9_PHYIT/200-360...........................Q----------------------------------------------------
D3QBE9_STANL/212-368............................----------------------------------------------------
D3PTY7_STANL/202-361............................----------------------------------------------------
A0CQA0_PARTE/272-415............................----------------------------------------------------
C9SS84_VERA1/110-286............................----------------------------------------------------
B2ACI3_PODAN/114-282............................----------------------------------------------------
B1XYW2_LEPCP/349-527............................----------------------------------------------------
C1N754_MICPC/393-574............................----------------------------------------------------
C1EFA7_MICSR/414-629............................----------------------------------------------------
C0PL31_MAIZE/403-612WRFGRTSPSDL......QASFAGEHLNA----------------------------------------------------
A9TAV2_PHYPA/699-919WRFGKPRMVPS.....PVNGSIPKDSGF----------------------------------------------------
DEG15_ARATH/376-594WRYGKGGVYGEG....FKPYVLGAEEFS----------------------------------------------------
Q0PY37_SOLLC/412-632WRFGKTSVNGYNT..KSDVVFTTSNQSE----------------------------------------------------
B9H2S3_POPTR/409-631WRFGKTTVNGGEDGTKLQDPFIPPEEFP----------------------------------------------------
A8I3D5_CHLRE/134-313............................----------------------------------------------------
C1N5V8_MICPC/175-398............................----------------------------------------------------
D2S688_GEOOG/217-353............................----------------------------------------------------
D3QA66_STANL/219-357............................----------------------------------------------------
Q10YA2_TRIEI/28-156............................----------------------------------------------------
B7KID8_CYAP7/23-153............................----------------------------------------------------
B1ZW96_OPITP/85-238............................----------------------------------------------------
C1MYV6_MICPC/213-422DGDATDE..............EESDGDF----------------------------------------------------
D2QY05_PIRSD/202-373............................----------------------------------------------------
A4YLF4_BRASO/29-179............................----------------------------------------------------
Q08Z65_STIAD/79-228............................----------------------------------------------------
Q2II41_ANADE/64-213............................----------------------------------------------------
B3S5U4_TRIAD/329-491............................----------------------------------------------------
A0LWM1_ACIC1/250-384............................----------------------------------------------------
Q2YD45_NITMU/56-221............................----------------------------------------------------
D5UDV9_CELFN/76-207............................----------------------------------------------------
Q11LS4_CHESB/40-170............................----------------------------------------------------
C6XD83_METGS/47-175............................----------------------------------------------------
C6WVZ4_METML/47-174............................----------------------------------------------------
B9TJ43_RICCO/62-190............................----------------------------------------------------
C6WXC4_METML/54-182............................----------------------------------------------------
B9TFS6_RICCO/49-177............................----------------------------------------------------
C6XBL7_METGS/51-179............................----------------------------------------------------
A2SLB0_METPP/51-178............................----------------------------------------------------
C7RR92_ACCPU/56-182............................----------------------------------------------------
C7RR91_ACCPU/52-180............................----------------------------------------------------
Q2W2I3_MAGSA/355-483............................----------------------------------------------------
Q3B4M2_PELLD/76-203............................----------------------------------------------------
C7PQR9_CHIPD/410-553............................----------------------------------------------------
D2R620_PIRSD/144-326............................----------------------------------------------------
Q211I3_RHOPB/126-305FGA.....................RSGA----------------------------------------------------
C7PQU4_CHIPD/127-299FG........................RR----------------------------------------------------
A6LC71_PARD8/50-181............................----------------------------------------------------
C3Y9V9_BRAFL/396-567............................----------------------------------------------------
C3Y7C8_BRAFL/939-1107............................----------------------------------------------------
C3YHU1_BRAFL/637-805............................----------------------------------------------------
Q1D137_MYXXD/39-183............................----------------------------------------------------
B5HRW8_9ACTN/52-200............................----------------------------------------------------
B8M3P5_TALSN/58-198............................----------------------------------------------------
NM111_PICGU/100-246............................----------------------------------------------------
D0MZM5_PHYIT/91-230............................----------------------------------------------------
YH05_SCHPO/99-245............................----------------------------------------------------
C1EGI7_MICSR/60-206............................----------------------------------------------------
A9RQ61_PHYPA/48-194............................----------------------------------------------------
B9IN99_POPTR/46-189............................----------------------------------------------------
Q10V37_TRIEI/25-170............................----------------------------------------------------
A6L245_BACV8/25-170............................----------------------------------------------------
Q7Q9T3_ANOGA/284-425............................----------------------------------------------------
F111B_HUMAN/475-664............................----------------------------------------------------
D4A8N0_RAT/367-556IV........................GE----------------------------------------------------
A8ZQB3_ACAM1/33-191T..........................L----------------------------------------------------
B0JTN4_MICAN/27-184............................----------------------------------------------------
B8HMX0_CYAP4/25-181............................----------------------------------------------------
Q9Z529_STRCO/60-203............................----------------------------------------------------
C6XKV2_HIRBI/68-210............................----------------------------------------------------
B0T391_CAUSK/70-212............................----------------------------------------------------
Q0C5Y2_HYPNA/27-169............................----------------------------------------------------
D2R618_PIRSD/120-277............................----------------------------------------------------
Q1DE46_MYXXD/139-306............................----------------------------------------------------
B8ICT9_METNO/161-326............................----------------------------------------------------
B3PHV0_CELJU/204-337............................----------------------------------------------------
A9ERE8_SORC5/153-297............................----------------------------------------------------
B2J8D1_NOSP7/164-308............................----------------------------------------------------
C6X4V5_FLAB3/104-266............................----------------------------------------------------
Y4FB_RHISN/90-251............................----------------------------------------------------
A9GTT3_SORC5/149-297............................----------------------------------------------------
B8END1_METSB/102-257............................----------------------------------------------------
D2BAE5_STRRD/123-274............................----------------------------------------------------
D2R623_PIRSD/145-303............................----------------------------------------------------
Q9RTZ8_DEIRA/130-275............................----------------------------------------------------
D0LEN3_GORB4/141-289............................----------------------------------------------------
E3IWP0_FRASU/134-282............................----------------------------------------------------
A1WX57_HALHL/64-228............................----------------------------------------------------
Q3SMJ5_THIDA/81-243............................----------------------------------------------------
Q15WK4_PSEA6/58-219............................----------------------------------------------------
D0LGQ1_HALO1/668-816............................----------------------------------------------------
Q0AUX9_SYNWW/105-235............................----------------------------------------------------
B9M1H9_GEODF/322-480............................----------------------------------------------------
D3PR00_MEIRD/62-196............................----------------------------------------------------
D3FST1_BACPE/122-248............................----------------------------------------------------
Q1D8L6_MYXXD/88-220............................----------------------------------------------------
B0CAU9_ACAM1/85-242............................----------------------------------------------------
D3B2A3_POLPA/90-296............................----------------------------------------------------
D2R1J4_PIRSD/67-236F..........................A----------------------------------------------------
E0U9M4_CYAP2/69-211............................----------------------------------------------------
B7KH20_CYAP7/52-196............................----------------------------------------------------
D2Q0V1_KRIFD/123-243............................----------------------------------------------------
B3QZR5_PHYMT/297-472............................----------------------------------------------------
Q84SQ1_ORYSJ/91-253............................----------------------------------------------------
NS1AB_HASV1/447-565............................----------------------------------------------------
B8HSI3_CYAP4/55-201............................----------------------------------------------------
B7KEX9_CYAP7/49-192............................----------------------------------------------------
Q11A08_TRIEI/47-187............................----------------------------------------------------
Q111L2_TRIEI/52-195............................----------------------------------------------------
Q113N3_TRIEI/93-237............................----------------------------------------------------
B0C4I5_ACAM1/51-195............................----------------------------------------------------
B0C7H5_ACAM1/295-465............................----------------------------------------------------
B0JV48_MICAN/59-215............................----------------------------------------------------

PF09342

Q7QJ48_ANOGA/1774-1887--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1523-1637--------------------------------------------------------------------------------
NUDEL_DROME/2041-2158--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

A1SA55_SHEAM/18-726AIQYNSSKEKNYLADGFLATSMDKEPSAGPNERLYVTEA-----------------------------------------
E0THX8_PARBH/23-721SVQYNSTEENNYLADGFLAAANTDELPAAPGTRVYVTVQ-----------------------------------------
F2GAE2_ALTMD/22-719SVQYNSTPENNYLKDGFLAKEIGDELPAAPGTRMFVTVD-----------------------------------------
A5FMW8_FLAJ1/19-712AIAELSTAEQNYLKDGFWAKQKSAEMKP.KSLYVRFFVR-----------------------------------------
A6GWM2_FLAPJ/17-707AIQNHSSVDHDYLTNGFWAMKMEDELPN.ENLVVTFIVS-----------------------------------------
A6KZW8_BACV8/17-706AIQQHSSVEHDYLRDGFVADSLSKELPN.PDLFVSFLIR-----------------------------------------
A6L2J7_BACV8/19-726YIQQHSSVEHDYLTDGFWAMSRKEELPC.KGLTVTFIDR-----------------------------------------
A6L2J8_BACV8/21-719AIQQHSSVEHDYLTDGFWAKSRKEELPT.PGLKFKFVER-----------------------------------------
A6LID5_PARD8/19-717SIQRHSTLEHDYLTDGFWAMSRDKELPN.PGLTVTFIDK-----------------------------------------
A7HA06_ANADF/20-725TLQFNSTPERNLLEDGFVARARAEELWSGPGARVFVTVS-----------------------------------------
A7HFU9_ANADF/37-699CIEQLSTAQKDFVKSGFYAKTLPDEVKC.PTVEVNQLVQ-----------------------------------------
Q024G1_SOLUE/22-694IVQEHSSPARDLITNGFIAGSREEELRG.KVARITVPHR-----------------------------------------
Q029T1_SOLUE/24-727GLQFNSTPARNLLKDGYLAKTRSEELPNGPGSRVFVTSA-----------------------------------------
Q07XT1_SHEFN/18-727GIQYNSKKEHNYLADGFLANTQAEEPSAGPNERLYITQE-----------------------------------------
Q08VC9_STIAD/18-714IVQEHSSPQRDLISQGFLAQNREAELPG.KGARILVPRA-----------------------------------------
Q11SC7_CYTH3/21-702AIQSHSSVEHDYITDGFWAMDRSQELSN.PGLTVTFLIR-----------------------------------------
Q12RW4_SHEDO/18-728AIQYNSKSEHNYLENGFLAKTKADEPSAGPNERLYITEA-----------------------------------------
Q1D5W7_MYXXD/35-700CIDQLSTAKKDYIANGFYAKAQGEETQC.PAMEINQLVK-----------------------------------------
Q1D9F6_MYXXD/17-714VIQEHSTPQRDLITQGFLASKREDELPG.KGSRVQVPRS-----------------------------------------
Q1DDZ2_MYXXD/18-682CIEDLSSPKKDLLAKGFYASSAAQELRC.PKVEANQLVE-----------------------------------------
Q1GVV7_SPHAL/23-684CLQNLSSADSDLVAGGFNAADRARELKC.PGQQAEVVTA-----------------------------------------
Q1IPC2_KORVE/27-692CIHDLSSGGKDYMKDGFYAATREQEPKC.PGIEFLVLTD-----------------------------------------
Q2G546_NOVAD/56-713CAQDNSTDENDLLKLGFVPVRREEELKC.PGQQAEVVTA-----------------------------------------
Q2IEV3_ANADE/18-687CVEELSSAGRDLVASGYLARSGAEELRC.PAMQVDQLLR-----------------------------------------
Q2S133_SALRD/5-639HLNSQGDT.......AIVAARPADERAV.PALHADRLVR-----------------------------------------
Q2S134_SALRD/69-734HITDVRRDGEALLKNGFYAAARSDERRA.PDLHVDQLVE-----------------------------------------
Q488S2_COLP3/26-729SVQYNSTAENNLLKNGFLAKNFAEELPATPGSRIYVTEE-----------------------------------------
Q5LIW7_BACFN/34-723SIQQHSSVDHDYLKDGFTAHSREEELPN.PELYVRFLLR-----------------------------------------
Q5QV86_IDILO/17-717SIAHNSTPENDLLANGFLAKGLDAEVPAAPGSRIFVTKA-----------------------------------------
Q7MV25_PORGI/21-718MIQAHSTLEHNYLENGFWAMREADELPN.KDISVVFIDK-----------------------------------------
Q7MWU6_PORGI/24-711AIQSQSTVDHDYLRDGFVSRTMGEELPI.PGLSVKYLRK-----------------------------------------
Q7NHA9_GLOVI/34-698CIEELSTAQQNYIESGFLARRPEAELKC.PDVELNQLTA-----------------------------------------
Q7UKL5_RHOBA/28-688TLAKLSSKERNLIDDGFLAKSFDEELKA.PDLELNQLIS-----------------------------------------
Q8A2L6_BACTN/20-711SIQQHSSVEHDYLKDGFVARNLGEELPN.PELYVRFLLR-----------------------------------------
B2FQN5_STRMK/22-717AIQLNSTAQKNLIKDGFNAPTLKDELSAGPNARVFVLDQ-----------------------------------------
E3FSI6_STIAD/18-681CIEQLSTADKDYIANGFYAKAPTDELKC.PAMEINQLAE-----------------------------------------
Q5LB16_BACFN/20-719AIQQHSSVDHDYLTNGFWAMNRNEELPC.KGLTVTFIDR-----------------------------------------
Q8EAI4_SHEON/18-728AIQYNTKKEHNYLEQGFLATSMDKEPSAGPNERLYITEA-----------------------------------------
Q8EHX9_SHEON/18-716SIQYNSTPEKNLLQDGFLAKTFADELPAAPGSRVYVTED-----------------------------------------
Q9PC94_XYLFA/22-713AIQLNSTPKKNLIKEGFNALTQADEVSAGPNARIYVLEQ-----------------------------------------
R5U6M0_9BACE/21-717SIQQHSSVEHDYLTDGFWATSRDKELPT.PGLKFTFIER-----------------------------------------
R6WQY4_9PORP/22-710SIQQLSSVEHDYLKDGFVSQSKEEELPV.PGLTVRYLRE-----------------------------------------
R6Y7C6_9PORP/19-717CIQRHSTLEHDYLTDGFWAMSRDQELPN.PGMTVTFIDK-----------------------------------------
R7EE18_9BACE/20-708SIQQHSSVEHDYLKDGFVARNLSEELPN.PELYVRFLLH-----------------------------------------
R7EGG9_9BACE/23-719AIQQHSSVEHDYLTDGFWAMNRSEELPT.PGLKFRFVHR-----------------------------------------

PF00863

POLG_SPMMV/2424-2646--------------------------------------------------------------------------------
POLG_RGMVD/1998-2230--------------------------------------------------------------------------------

PF03761

Q9U2W2_CAEEL/6-282--------------------------------------------------------------------------------
Q21628_CAEEL/5-298--------------------------------------------------------------------------------
O45371_CAEEL/3-276--------------------------------------------------------------------------------
O76649_CAEEL/2-297--------------------------------------------------------------------------------
A8XIB1_CAEBR/15-285--------------------------------------------------------------------------------
A8WNY9_CAEBR/3-296--------------------------------------------------------------------------------
Q9XWZ8_CAEEL/4-272--------------------------------------------------------------------------------
O62223_CAEEL/7-278--------------------------------------------------------------------------------
O62231_CAEEL/5-272--------------------------------------------------------------------------------

PF00944

POLS_SFV/112-268--------------------------------------------------------------------------------
POLS_SINDV/107-265--------------------------------------------------------------------------------

PF05580

E3E859_PAEPS/156-365M.------------------------------------------------------------------------------
B2A522_NATTJ/220-428W.------------------------------------------------------------------------------
R6EU85_9FIRM/240-448V.------------------------------------------------------------------------------
R5R857_9FIRM/209-435A.------------------------------------------------------------------------------
D5DLD9_BACMD/201-410M.------------------------------------------------------------------------------
R5E7E8_9CLOT/153-360V.------------------------------------------------------------------------------
H6NL93_9BACL/216-425M.------------------------------------------------------------------------------
D9QRU2_ACEAZ/227-436P.------------------------------------------------------------------------------
R5C627_9FIRM/190-398V.------------------------------------------------------------------------------
R7M5P2_9CLOT/115-318K.------------------------------------------------------------------------------
R5H148_9FIRM/298-508T.------------------------------------------------------------------------------
R6AIL9_9CLOT/311-520A.------------------------------------------------------------------------------
R7FQ12_9CLOT/119-323T.------------------------------------------------------------------------------
F6DU87_DESRL/210-419I.------------------------------------------------------------------------------
R6R0T0_9FIRM/204-412S.------------------------------------------------------------------------------
D4J425_9FIRM/145-352V.------------------------------------------------------------------------------
R5YSC4_9FIRM/173-380L.------------------------------------------------------------------------------
R5J4I1_9FIRM/118-321L.------------------------------------------------------------------------------
R6Y3R6_9FIRM/105-307A.------------------------------------------------------------------------------
I4D8U8_DESAJ/208-416A.------------------------------------------------------------------------------
R5A2Q9_9CLOT/168-371M.------------------------------------------------------------------------------
A4XKP9_CALS8/199-405I.------------------------------------------------------------------------------
R7HFV6_9MOLU/114-314S.------------------------------------------------------------------------------
R5MBH1_9MOLU/116-319S.------------------------------------------------------------------------------
B0TEK3_HELMI/215-424A.------------------------------------------------------------------------------
R7K6P1_9FIRM/158-362S.------------------------------------------------------------------------------
R6WI32_9FIRM/144-352V.------------------------------------------------------------------------------
C4ZCY0_EUBR3/233-444GT------------------------------------------------------------------------------
R7FE29_9FIRM/75-280A.------------------------------------------------------------------------------
R7KE68_9FIRM/124-326P.------------------------------------------------------------------------------
Q8XJE5_CLOPE/171-380S.------------------------------------------------------------------------------
D4LFB6_RUMC1/188-392V.------------------------------------------------------------------------------
R6RRV8_9FIRM/198-401M.------------------------------------------------------------------------------
R7B468_9CLOT/225-433G.------------------------------------------------------------------------------
G7M128_9CLOT/180-389C.------------------------------------------------------------------------------
U5S0W6_9CLOT/60-268I.------------------------------------------------------------------------------
R5KFR6_9CLOT/196-405V.------------------------------------------------------------------------------
R7QW48_9FIRM/197-405A.------------------------------------------------------------------------------
R6BUQ9_9FIRM/202-410V.------------------------------------------------------------------------------
R7MCE1_9CLOT/114-318R.------------------------------------------------------------------------------
A5D302_PELTS/204-413L.------------------------------------------------------------------------------
E6UBW1_RUMA7/187-391S.------------------------------------------------------------------------------
R5PM12_9CLOT/193-402I.------------------------------------------------------------------------------
R5CZB6_9FIRM/133-338V.------------------------------------------------------------------------------
R6SMI2_9CLOT/138-343G.------------------------------------------------------------------------------
A4J3G7_DESRM/210-419I.------------------------------------------------------------------------------
E6U2J4_ETHHY/189-392A.------------------------------------------------------------------------------
R5SUE4_9CLOT/122-326K.------------------------------------------------------------------------------
R6XJ65_9FIRM/124-325N.------------------------------------------------------------------------------
R6QNQ2_9CLOT/190-395S.------------------------------------------------------------------------------
R6KNJ0_9CLOT/215-423S.------------------------------------------------------------------------------
R6T3R8_9FIRM/188-393A.------------------------------------------------------------------------------
R7HTV5_9CLOT/214-418I.------------------------------------------------------------------------------
R5VVX1_9FIRM/191-398T.------------------------------------------------------------------------------
R5TNP7_9FIRM/195-403T.------------------------------------------------------------------------------
Q18B75_PEPD6/138-350S.------------------------------------------------------------------------------
G2T3Q8_ROSHA/203-410G.------------------------------------------------------------------------------
R6GHR5_9CLOT/190-395V.------------------------------------------------------------------------------
E6TXR0_BACCJ/201-410M.------------------------------------------------------------------------------
R6KEA9_9FIRM/207-412N.------------------------------------------------------------------------------
R7IWD1_9CLOT/192-400I.------------------------------------------------------------------------------
R5VVV3_9DELT/153-356A.------------------------------------------------------------------------------
R6I8W6_9FIRM/181-382V.------------------------------------------------------------------------------
R7GGP8_9CLOT/117-316K.------------------------------------------------------------------------------
R5J7S8_9CLOT/122-325K.------------------------------------------------------------------------------
R6FK23_9FIRM/138-346S.------------------------------------------------------------------------------
R7P923_9CLOT/115-318S.------------------------------------------------------------------------------
R5KUR7_9CLOT/197-401V.------------------------------------------------------------------------------
I3VWM7_THESW/214-421I.------------------------------------------------------------------------------
R6B2V6_9CLOT/193-402I.------------------------------------------------------------------------------
R7DMS2_9FIRM/123-328N.------------------------------------------------------------------------------
R5KNW9_9FIRM/197-403I.------------------------------------------------------------------------------
R7NI61_9MOLU/101-304S.------------------------------------------------------------------------------
F2JMG1_CELLD/213-423A.------------------------------------------------------------------------------
K4L254_9FIRM/158-366I.------------------------------------------------------------------------------
R6GNM4_9FIRM/130-329S.------------------------------------------------------------------------------
R6Q3J2_9FIRM/197-399S.------------------------------------------------------------------------------
R6N1E9_9FIRM/118-320I.------------------------------------------------------------------------------
R5SZK8_9CLOT/120-323A.------------------------------------------------------------------------------
R5YCX5_9FIRM/210-420G.------------------------------------------------------------------------------
R7C759_9CLOT/199-406V.------------------------------------------------------------------------------
W0E9D2_9FIRM/204-412A.------------------------------------------------------------------------------
Q894H5_CLOTE/186-394I.------------------------------------------------------------------------------
C9R866_AMMDK/202-412G.------------------------------------------------------------------------------
R7HB69_9FIRM/198-403E.------------------------------------------------------------------------------
A6TR47_ALKMQ/212-421I.------------------------------------------------------------------------------
R7ESB8_9FIRM/150-355A.------------------------------------------------------------------------------
R6PKG4_9CLOT/142-350V.------------------------------------------------------------------------------
R7M6Q4_9CLOT/189-398V.------------------------------------------------------------------------------
Q0AZD6_SYNWW/215-423A.------------------------------------------------------------------------------
R7N4W4_9FIRM/233-441V.------------------------------------------------------------------------------
R6YA95_9FIRM/170-373M.------------------------------------------------------------------------------
D5WV97_KYRT2/203-412V.------------------------------------------------------------------------------
R5LXL5_9FIRM/207-415E.------------------------------------------------------------------------------
R5DF89_9FIRM/134-342V.------------------------------------------------------------------------------
R6TFF4_9STAP/123-324N.------------------------------------------------------------------------------
A5I2Z7_CLOBH/190-399V.------------------------------------------------------------------------------
R6H4Q6_9CLOT/93-302I.------------------------------------------------------------------------------
R6R368_9FIRM/120-325N.------------------------------------------------------------------------------
A3DDL9_CLOTH/220-429I.------------------------------------------------------------------------------
D3E6N1_GEOS4/216-425M.------------------------------------------------------------------------------
F9VK25_ARTSS/181-387V.------------------------------------------------------------------------------
R5QQG0_9FIRM/120-319D.------------------------------------------------------------------------------
G8LW28_CLOCD/215-424V.------------------------------------------------------------------------------
R7L0T4_9FIRM/128-333T.------------------------------------------------------------------------------
L7VQQ3_CLOSH/211-420I.------------------------------------------------------------------------------
C8WXF9_ALIAD/189-396A.------------------------------------------------------------------------------
Q2RIC4_MOOTA/204-410S.------------------------------------------------------------------------------
R4KQW9_9FIRM/233-441F.------------------------------------------------------------------------------
A9KMA5_CLOPH/226-440V.------------------------------------------------------------------------------
E6SKR3_THEM7/213-420P.------------------------------------------------------------------------------
L0F7L5_DESDL/201-409V.------------------------------------------------------------------------------
I0JNU1_HALH3/190-399M.------------------------------------------------------------------------------
R7EZR7_9BACI/119-323K.------------------------------------------------------------------------------
R6J055_9CLOT/188-393V.------------------------------------------------------------------------------
R5NUG0_9CLOT/150-357N.------------------------------------------------------------------------------
G2TKW2_BACCO/202-410M.------------------------------------------------------------------------------
R5N690_9FIRM/195-399V.------------------------------------------------------------------------------
R5VHC6_9FIRM/116-319S.------------------------------------------------------------------------------
R5NBK1_9CLOT/140-350V.------------------------------------------------------------------------------
R5XPM2_9FIRM/142-350M.------------------------------------------------------------------------------
D5X7G9_THEPJ/215-423V.------------------------------------------------------------------------------
F4A1F9_MAHA5/216-427M.------------------------------------------------------------------------------
R7ITE0_9FIRM/153-365I.------------------------------------------------------------------------------
F6CL40_DESK7/196-404I.------------------------------------------------------------------------------
L0EG06_THECK/215-424M.------------------------------------------------------------------------------
R5IDG3_9CLOT/215-423S.------------------------------------------------------------------------------
R6CTL1_9CLOT/120-324Q.------------------------------------------------------------------------------
K0B195_CLOA9/214-422A.------------------------------------------------------------------------------
B8D2I8_HALOH/212-421T.------------------------------------------------------------------------------
R6NNU0_9FIRM/215-423M.------------------------------------------------------------------------------
R6VE05_9FIRM/190-398T.------------------------------------------------------------------------------
R6CN52_9FIRM/195-397S.------------------------------------------------------------------------------
R5H2U4_9FIRM/161-364V.------------------------------------------------------------------------------
R5V409_9FIRM/42-246G.------------------------------------------------------------------------------
R6GW98_9FIRM/112-314S.------------------------------------------------------------------------------
R7ICH4_9FIRM/201-410G.------------------------------------------------------------------------------
R7BI76_9FIRM/225-433I.------------------------------------------------------------------------------
C4Z0G6_EUBE2/204-408N.------------------------------------------------------------------------------
R6NHB7_9CLOT/187-390V.------------------------------------------------------------------------------
R7R973_9FIRM/209-417T.------------------------------------------------------------------------------
R5HM74_9FIRM/194-402G.------------------------------------------------------------------------------
R6NAF9_9FIRM/131-335C.------------------------------------------------------------------------------
D9SLV5_CLOC7/152-361S.------------------------------------------------------------------------------
R5RSY4_9FIRM/191-399V.------------------------------------------------------------------------------
R6HAH9_9FIRM/115-318P.------------------------------------------------------------------------------
R5XRH8_9CLOT/130-334V.------------------------------------------------------------------------------
R7FZ38_9FIRM/124-328P.------------------------------------------------------------------------------
R5I6P6_9FIRM/190-402V.------------------------------------------------------------------------------
B8I3A0_CLOCE/216-424A.------------------------------------------------------------------------------
R6DXQ1_9FIRM/188-391T.------------------------------------------------------------------------------
R5E160_9FIRM/211-416N.------------------------------------------------------------------------------
Q97HE0_CLOAB/180-389V.------------------------------------------------------------------------------
R6M2Z6_9CLOT/206-414A.------------------------------------------------------------------------------
D6DLB6_CLOSC/286-502S.------------------------------------------------------------------------------
R6RY05_9CLOT/215-423S.------------------------------------------------------------------------------
F4LV06_TEPAE/231-436A.------------------------------------------------------------------------------
R6UED3_9CLOT/182-387V.------------------------------------------------------------------------------
R5AES8_9CLOT/42-250V.------------------------------------------------------------------------------
B2TRL9_CLOBB/180-389C.------------------------------------------------------------------------------
R5D6V9_9FIRM/122-319S.------------------------------------------------------------------------------
D7CKI9_SYNLT/219-426V.------------------------------------------------------------------------------
R5TH80_9CLOT/132-335T.------------------------------------------------------------------------------
R5MT91_9FIRM/111-313K.------------------------------------------------------------------------------
R6YLB5_9CLOT/118-321K.------------------------------------------------------------------------------
R6MJ71_9FIRM/142-350V.------------------------------------------------------------------------------
D4M5K6_9FIRM/149-357I.------------------------------------------------------------------------------
D9S3S9_THEOJ/214-422S.------------------------------------------------------------------------------
F6B9N5_DESCC/210-419I.------------------------------------------------------------------------------
R6TLY4_9FIRM/137-344S.------------------------------------------------------------------------------
R5ZMQ1_9CLOT/199-408V.------------------------------------------------------------------------------
Q67NC5_SYMTH/207-416G.------------------------------------------------------------------------------
R6TRP0_9CLOT/120-323K.------------------------------------------------------------------------------
R7L6Y3_9CLOT/233-442I.------------------------------------------------------------------------------
R6BNR4_9CLOT/114-319N.------------------------------------------------------------------------------
Q9K975_BACHD/212-422V.------------------------------------------------------------------------------
D4KCM7_9FIRM/192-394S.------------------------------------------------------------------------------
R5QDI6_9FIRM/145-349A.------------------------------------------------------------------------------
B1I568_DESAP/211-420G.------------------------------------------------------------------------------
R5NSK8_9FIRM/199-407V.------------------------------------------------------------------------------
R6ZZF6_9FIRM/208-413A.------------------------------------------------------------------------------
R6L493_9FIRM/190-397V.------------------------------------------------------------------------------
A8MFI3_ALKOO/213-422V.------------------------------------------------------------------------------
Q8RAC0_CALS4/204-412I.------------------------------------------------------------------------------
R6G9J9_9FIRM/191-398A.------------------------------------------------------------------------------
R5HAQ1_9FIRM/145-350V.------------------------------------------------------------------------------
K4LFQ1_THEPS/206-415S.------------------------------------------------------------------------------
W6RY93_9CLOT/148-357S.------------------------------------------------------------------------------
R5UHP5_9FIRM/212-422G.------------------------------------------------------------------------------
R7G2H0_9FIRM/142-350T.------------------------------------------------------------------------------
R6WHU5_9CLOT/131-335S.------------------------------------------------------------------------------
R6S308_9FIRM/142-350I.------------------------------------------------------------------------------
R5B250_9CLOT/200-409P.------------------------------------------------------------------------------
R5SFB7_9FIRM/137-344V.------------------------------------------------------------------------------
R6GC90_9FIRM/150-358G.------------------------------------------------------------------------------
D9R8M8_CLOSW/214-422S.------------------------------------------------------------------------------
R5RQY0_9FIRM/121-325S.------------------------------------------------------------------------------
R5LJL6_9MOLU/118-321S.------------------------------------------------------------------------------
R7AQT1_9BACE/225-434P.------------------------------------------------------------------------------
X4ZLT8_9BACL/99-308M.------------------------------------------------------------------------------
F8I8Y9_SULAT/220-427G.------------------------------------------------------------------------------
R6MC60_9CLOT/122-326K.------------------------------------------------------------------------------
R6TCX6_9FIRM/135-339I.------------------------------------------------------------------------------
R6R1J4_9FIRM/212-417V.------------------------------------------------------------------------------
R6YL37_9CLOT/139-347I.------------------------------------------------------------------------------
R5XPM6_9FIRM/190-397V.------------------------------------------------------------------------------
A0Q0A9_CLONN/187-396V.------------------------------------------------------------------------------
D4LPR1_9FIRM/190-397V.------------------------------------------------------------------------------
R7DAB6_9FIRM/190-397V.------------------------------------------------------------------------------
C0ZC15_BREBN/214-423V.------------------------------------------------------------------------------
R6QE36_9FIRM/194-400V.------------------------------------------------------------------------------
R5K6N9_9CLOT/167-373N.------------------------------------------------------------------------------
R6ZCY0_9FIRM/221-429M.------------------------------------------------------------------------------
R5HLI4_9MOLU/115-317K.------------------------------------------------------------------------------
R6NKY3_9CLOT/194-403I.------------------------------------------------------------------------------
R5JXE7_9FIRM/156-361Y.------------------------------------------------------------------------------
R5AF90_9FIRM/133-337V.------------------------------------------------------------------------------
R5TU24_9FIRM/139-347M.------------------------------------------------------------------------------
R6P0Q8_9CLOT/193-398I.------------------------------------------------------------------------------
R6DUC4_9FIRM/127-333V.------------------------------------------------------------------------------
R7F4Z6_9CLOT/192-401I.------------------------------------------------------------------------------
R6X4M8_9FIRM/136-339G.------------------------------------------------------------------------------
R6EKK3_9FIRM/143-351S.------------------------------------------------------------------------------
Q5WF67_BACSK/198-409V.------------------------------------------------------------------------------
R7JU02_9FIRM/197-405I.------------------------------------------------------------------------------
G4KYV3_OSCVS/185-393V.------------------------------------------------------------------------------
Q3AAN6_CARHZ/163-370P.------------------------------------------------------------------------------
R5VSI3_9CLOT/190-396M.------------------------------------------------------------------------------
R7MHL3_9FIRM/193-401A.------------------------------------------------------------------------------
R6RU79_9FIRM/211-417T.------------------------------------------------------------------------------
R6Q618_9FIRM/189-393V.------------------------------------------------------------------------------
R7K1G6_9CLOT/231-438A.------------------------------------------------------------------------------
L0K691_HALHC/216-425A.------------------------------------------------------------------------------
R5FFJ0_9FIRM/179-381V.------------------------------------------------------------------------------
R7G6U2_9FIRM/124-329V.------------------------------------------------------------------------------
R5G573_9FIRM/138-340G.------------------------------------------------------------------------------
K0IY14_AMPXN/203-412I.------------------------------------------------------------------------------
R6USZ2_9FIRM/121-326S.------------------------------------------------------------------------------
R6PFE8_9FIRM/190-396T.------------------------------------------------------------------------------
F0T085_SYNGF/158-366M.------------------------------------------------------------------------------
R7HK64_9FIRM/123-327K.------------------------------------------------------------------------------
R6AWH8_9CLOT/116-318S.------------------------------------------------------------------------------
R6FWG8_9CLOT/176-385G.------------------------------------------------------------------------------
R4KDG0_CLOPA/191-400V.------------------------------------------------------------------------------
R5QW36_9FIRM/145-353V.------------------------------------------------------------------------------
R6CRQ2_9CLOT/225-433V.------------------------------------------------------------------------------
R7KGU6_9CLOT/125-328K.------------------------------------------------------------------------------
R6U8G2_9CLOT/145-349T.------------------------------------------------------------------------------
R5A3A4_9CLOT/113-318S.------------------------------------------------------------------------------
R5J0Y5_9FIRM/121-325Q.------------------------------------------------------------------------------
D4MXQ8_9FIRM/198-400M.------------------------------------------------------------------------------
Q8EQ48_OCEIH/176-385M.------------------------------------------------------------------------------
R5YPZ4_9MOLU/74-277K.------------------------------------------------------------------------------
SP4B_BACSU/203-412M.------------------------------------------------------------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

POLG_BVDVN/1680-1890--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782HNG.GYNDVDFGAEGRNPD...........QHRFTYQIVKRNNYQAWERK.........HPYDGDYHMPRLHKFVTEAEP
IGA0_HAEIN/17-865HVSNGVSELHFGNLNGNMNNGNAKSHRDVSSEENRYFSVEKNEYPTKLNGKAVTTEDQTQKRREDYYMPRLDKFVTEVAP
Q5F9W2_NEIG1/19-848HAKAEVHTFYYGQYNGHNDV.........ADKENEYRVVEQNNYEPHKAWSA.....SNLGRLEDYNMARFNKFVTEVAP

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268GRGRRNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDGGIGETEMEIRHRVFYKSKSR
Q9YQ23_VESV/628-1162KKGKKGKSNAFSRRGLSDEEYDEYKKIREDRGGNYSIQEYLEDRERFERDLAERQADDADYDVG...AIRQKYFGRGKAA
Q80J95_9CALI/650-1163GRGRP...GVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLADRER.EEELLERDEEEAIFGDG.........FGLKATR
Q8JJL0_9CALI/645-1175GRGKK..HTAFSSKGLSDEEYDEFKRIREERNGKYSIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIF..RPTR
Q80RD7_9CALI/641-1177GRGKK..HTAFSSKGLSDEEYDEYKRIREERNGKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIF..RPTR

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMV0/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------T-----------------------------------
Y577_MYCPN/197-333--------------------------------------------A-----------------------------------
Y589_MYCPN/14-134--------------------------------------------K-----------------------------------
Y591_MYCPN/171-291--------------------------------------------K-----------------------------------
Y586_MYCPN/154-286--------------------------------------------Q-----------------------------------
POLG_YEFV1/1503-1655--------------------------------------------G-----------------------------------
POLG_DEN1W/1493-1642--------------------------------------------G-----------------------------------

PF01732

A5IYK2_MYCAP/279-649............................................S-----------------------------------
Q6MUH9_MYCMS/258-617............................................V-----------------------------------
Q2SR25_MYCCT/264-622............................................L-----------------------------------
D3VQF5_MYCA6/359-733............................................D-----------------------------------
Q4A635_MYCS5/147-497............................................P-----------------------------------
Q4A5A2_MYCS5/91-491............................................A-----------------------------------
C7LM95_MYCML/189-571............................................P-----------------------------------
A5IYA1_MYCAP/186-569............................................P-----------------------------------
Q4A798_MYCH7/125-523............................................P-----------------------------------
Q4A5G2_MYCS5/337-740............................................P-----------------------------------
Q7NC63_MYCGA/244-661............................................P-----------------------------------
C5J6P1_MYCCR/115-482............................................N-----------------------------------
Q7NAU7_MYCGA/221-623............................................E-----------------------------------
Q7NAG1_MYCGA/203-712IKKIQDNDLPAAYKEKDSKTSEEWNKLPFEYRKAWSDSQETLKAG-----------------------------------
Q7NAF2_MYCGA/203-710IKKIEDIELPAAYQEQNANATVEWNKLDLQFRIDYDKAAKDLKAG-----------------------------------
Q4A5P6_MYCS5/166-643.............HENDQALKARADKLNFELAPPLQKKLKDLNAQ-----------------------------------
D1J8A8_MYCHP/334-723............................................A-----------------------------------
B1RXG0_UREUR/379-750............................................T-----------------------------------
MALP_UREPA/376-752............................................A-----------------------------------
Q9PR98_UREPA/413-786............................................A-----------------------------------
Q6MSY9_MYCMS/283-769............................................A-----------------------------------
Q98Q64_MYCPU/350-715............................................K-----------------------------------
Q98QS3_MYCPU/339-702............................................S-----------------------------------
Q7NAJ2_MYCGA/204-545............................................N-----------------------------------
Q4A7B5_MYCH7/323-738............................................N-----------------------------------
Q98PH9_MYCPU/101-415............................................Y-----------------------------------
Q8EWB5_MYCPE/130-442............................................N-----------------------------------
Q8EW95_MYCPE/145-484............................................F-----------------------------------
Y068_MYCGE/48-383............................................N-----------------------------------
Y084_MYCPN/45-410............................................G-----------------------------------
Y588_MYCPN/75-444............................................T-----------------------------------
Y395_MYCGE/89-428............................................N-----------------------------------
Y592_MYCPN/104-443............................................L-----------------------------------
Y083_MYCPN/52-447............................................P-----------------------------------
Y582_MYCPN/44-388............................................I-----------------------------------
Q4A8M7_MYCH7/557-908............................................L-----------------------------------
Q8EWN7_MYCPE/57-397............................................E-----------------------------------
B1RXU5_UREUR/59-344............................................S-----------------------------------

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
POLG_POL1M/1566-1731--------------------------------------------------------------------------------
Q9DLK1_FMDVP/1643-1826--------------------------------------------------------------------------------

PF12380

Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF05409

R1A_CVH22/2994-3281--------------------------------------------------------------------------------
R1A_IBVB/2808-3096--------------------------------------------------------------------------------
B6VDX7_THCOV/2516-2804--------------------------------------------------------------------------------
R1AB_FIPV/2932-3219--------------------------------------------------------------------------------
R1A_CVHSA/3269-3559--------------------------------------------------------------------------------
R1A_CVMA5/3362-3648--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569--------------------------------------------------------------------------------
SP24D_ANOGA/50-264--------------------------------------------------------------------------------
TRY5_AEDAE/40-260--------------------------------------------------------------------------------
UROK_HUMAN/179-419--------------------------------------------------------------------------------
MASP1_MOUSE/454-696--------------------------------------------------------------------------------
CTR1_ANOGA/33-250--------------------------------------------------------------------------------
CFAD_HUMAN/26-248--------------------------------------------------------------------------------
ACRO_RAT/43-286--------------------------------------------------------------------------------
HPT_HUMAN/162-399--------------------------------------------------------------------------------
CASP_MESAU/445-682--------------------------------------------------------------------------------
A8JQZ2_DROME/186-427--------------------------------------------------------------------------------
PCE_TACTR/128-370--------------------------------------------------------------------------------
STUB_DROME/544-782--------------------------------------------------------------------------------
TRYU_DROME/28-254--------------------------------------------------------------------------------
TRYI_DROME/28-245--------------------------------------------------------------------------------
TRYB_MANSE/25-252--------------------------------------------------------------------------------
TRYP_FUSOX/25-244--------------------------------------------------------------------------------
B1VV86_STRGG/37-252--------------------------------------------------------------------------------
TRY1_HUMAN/24-239--------------------------------------------------------------------------------
TRYP_PIG/9-224--------------------------------------------------------------------------------
TRY1_SALSA/21-235--------------------------------------------------------------------------------
TRYP_PLEPL/23-242--------------------------------------------------------------------------------
DEGP3_ARATH/99-287--------------------------------------------------------------------------------
DEGP2_ARATH/121-308--------------------------------------------------------------------------------
E2X833_SHIDY/62-244--------------------------------------------------------------------------------
DEGS_HAEIN/37-240--------------------------------------------------------------------------------
YYXA_BACSU/99-283--------------------------------------------------------------------------------
DEGP_SALTY/97-278--------------------------------------------------------------------------------
Q44596_BRUAO/85-261--------------------------------------------------------------------------------
DEGPL_BRUA2/125-298--------------------------------------------------------------------------------
O06439_RHOCA/59-235--------------------------------------------------------------------------------
HHOA_SYNY3/95-274--------------------------------------------------------------------------------
HTRA_SYNY3/156-334--------------------------------------------------------------------------------
O42417_CHICK/87-286--------------------------------------------------------------------------------
A0A0E3T8P7_9CAUD/70-274--------------------------------------------------------------------------------
ETB_STAAU/59-251--------------------------------------------------------------------------------
SPLB_STAA9/37-234--------------------------------------------------------------------------------
SPLC_STAA9/38-233--------------------------------------------------------------------------------
MPR_BACSU/95-311--------------------------------------------------------------------------------
PRTC_STRGR/205-383--------------------------------------------------------------------------------
Q55353_STRSQ/198-372--------------------------------------------------------------------------------
Q55352_STRSQ/202-378--------------------------------------------------------------------------------
Q54395_STRLI/158-342--------------------------------------------------------------------------------
SP1_RARFA/205-391--------------------------------------------------------------------------------
CERC_SCHMA/28-256--------------------------------------------------------------------------------
Q54344_STRLI/47-254--------------------------------------------------------------------------------
CFAB_HUMAN/481-752--------------------------------------------------------------------------------
PROZ_BOVIN/143-352--------------------------------------------------------------------------------
CAC3_BOVIN/12-246--------------------------------------------------------------------------------
CELA1_PIG/27-259--------------------------------------------------------------------------------
CTRA_BOVIN/16-238--------------------------------------------------------------------------------
CTRL_HALRU/24-251--------------------------------------------------------------------------------
COGS_HYPLI/31-252--------------------------------------------------------------------------------
CTRB1_LITVA/46-263--------------------------------------------------------------------------------
CATG_MOUSE/21-238--------------------------------------------------------------------------------
MCPT2_RAT/21-239--------------------------------------------------------------------------------
ELNE_HUMAN/30-242--------------------------------------------------------------------------------
PRTN3_HUMAN/28-243--------------------------------------------------------------------------------
GRAK_RAT/26-248--------------------------------------------------------------------------------
GRAM_RAT/21-245--------------------------------------------------------------------------------
KLK1_MOUSE/25-253--------------------------------------------------------------------------------
KLK2_RAT/25-251--------------------------------------------------------------------------------
VSPCA_AGKCO/1-217--------------------------------------------------------------------------------
HGF_RAT/496-719--------------------------------------------------------------------------------
ENTK_PIG/800-1029--------------------------------------------------------------------------------
PRSS8_HUMAN/45-281--------------------------------------------------------------------------------
HGFA_HUMAN/408-641--------------------------------------------------------------------------------
TPA_HUMAN/311-556--------------------------------------------------------------------------------
H2Q7T9_PANTR/235-462--------------------------------------------------------------------------------
THRB_BOVIN/367-616--------------------------------------------------------------------------------
PROC_HUMAN/212-445--------------------------------------------------------------------------------

PF13365

A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
A0L9W3_MAGMM/126-265--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRADU/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
DEG15_ARATH/376-594--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
Q11LS4_CHESB/40-170--------------------------------------------------------------------------------
C6XD83_METGS/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6XBL7_METGS/51-179--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
B5HRW8_9ACTN/52-200--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
B9IN99_POPTR/46-189--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
B9M1H9_GEODF/322-480--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------

PF09342

Q7QJ48_ANOGA/1774-1887--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1523-1637--------------------------------------------------------------------------------
NUDEL_DROME/2041-2158--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

A1SA55_SHEAM/18-726--------------------------------------------------------------------------------
E0THX8_PARBH/23-721--------------------------------------------------------------------------------
F2GAE2_ALTMD/22-719--------------------------------------------------------------------------------
A5FMW8_FLAJ1/19-712--------------------------------------------------------------------------------
A6GWM2_FLAPJ/17-707--------------------------------------------------------------------------------
A6KZW8_BACV8/17-706--------------------------------------------------------------------------------
A6L2J7_BACV8/19-726--------------------------------------------------------------------------------
A6L2J8_BACV8/21-719--------------------------------------------------------------------------------
A6LID5_PARD8/19-717--------------------------------------------------------------------------------
A7HA06_ANADF/20-725--------------------------------------------------------------------------------
A7HFU9_ANADF/37-699--------------------------------------------------------------------------------
Q024G1_SOLUE/22-694--------------------------------------------------------------------------------
Q029T1_SOLUE/24-727--------------------------------------------------------------------------------
Q07XT1_SHEFN/18-727--------------------------------------------------------------------------------
Q08VC9_STIAD/18-714--------------------------------------------------------------------------------
Q11SC7_CYTH3/21-702--------------------------------------------------------------------------------
Q12RW4_SHEDO/18-728--------------------------------------------------------------------------------
Q1D5W7_MYXXD/35-700--------------------------------------------------------------------------------
Q1D9F6_MYXXD/17-714--------------------------------------------------------------------------------
Q1DDZ2_MYXXD/18-682--------------------------------------------------------------------------------
Q1GVV7_SPHAL/23-684--------------------------------------------------------------------------------
Q1IPC2_KORVE/27-692--------------------------------------------------------------------------------
Q2G546_NOVAD/56-713--------------------------------------------------------------------------------
Q2IEV3_ANADE/18-687--------------------------------------------------------------------------------
Q2S133_SALRD/5-639--------------------------------------------------------------------------------
Q2S134_SALRD/69-734--------------------------------------------------------------------------------
Q488S2_COLP3/26-729--------------------------------------------------------------------------------
Q5LIW7_BACFN/34-723--------------------------------------------------------------------------------
Q5QV86_IDILO/17-717--------------------------------------------------------------------------------
Q7MV25_PORGI/21-718--------------------------------------------------------------------------------
Q7MWU6_PORGI/24-711--------------------------------------------------------------------------------
Q7NHA9_GLOVI/34-698--------------------------------------------------------------------------------
Q7UKL5_RHOBA/28-688--------------------------------------------------------------------------------
Q8A2L6_BACTN/20-711--------------------------------------------------------------------------------
B2FQN5_STRMK/22-717--------------------------------------------------------------------------------
E3FSI6_STIAD/18-681--------------------------------------------------------------------------------
Q5LB16_BACFN/20-719--------------------------------------------------------------------------------
Q8EAI4_SHEON/18-728--------------------------------------------------------------------------------
Q8EHX9_SHEON/18-716--------------------------------------------------------------------------------
Q9PC94_XYLFA/22-713--------------------------------------------------------------------------------
R5U6M0_9BACE/21-717--------------------------------------------------------------------------------
R6WQY4_9PORP/22-710--------------------------------------------------------------------------------
R6Y7C6_9PORP/19-717--------------------------------------------------------------------------------
R7EE18_9BACE/20-708--------------------------------------------------------------------------------
R7EGG9_9BACE/23-719--------------------------------------------------------------------------------

PF00863

POLG_SPMMV/2424-2646--------------------------------------------------------------------------------
POLG_RGMVD/1998-2230--------------------------------------------------------------------------------

PF03761

Q9U2W2_CAEEL/6-282--------------------------------------------------------------------------------
Q21628_CAEEL/5-298--------------------------------------------------------------------------------
O45371_CAEEL/3-276--------------------------------------------------------------------------------
O76649_CAEEL/2-297--------------------------------------------------------------------------------
A8XIB1_CAEBR/15-285--------------------------------------------------------------------------------
A8WNY9_CAEBR/3-296--------------------------------------------------------------------------------
Q9XWZ8_CAEEL/4-272--------------------------------------------------------------------------------
O62223_CAEEL/7-278--------------------------------------------------------------------------------
O62231_CAEEL/5-272--------------------------------------------------------------------------------

PF00944

POLS_SFV/112-268--------------------------------------------------------------------------------
POLS_SINDV/107-265--------------------------------------------------------------------------------

PF05580

E3E859_PAEPS/156-365--------------------------------------------------------------------------------
B2A522_NATTJ/220-428--------------------------------------------------------------------------------
R6EU85_9FIRM/240-448--------------------------------------------------------------------------------
R5R857_9FIRM/209-435--------------------------------------------------------------------------------
D5DLD9_BACMD/201-410--------------------------------------------------------------------------------
R5E7E8_9CLOT/153-360--------------------------------------------------------------------------------
H6NL93_9BACL/216-425--------------------------------------------------------------------------------
D9QRU2_ACEAZ/227-436--------------------------------------------------------------------------------
R5C627_9FIRM/190-398--------------------------------------------------------------------------------
R7M5P2_9CLOT/115-318--------------------------------------------------------------------------------
R5H148_9FIRM/298-508--------------------------------------------------------------------------------
R6AIL9_9CLOT/311-520--------------------------------------------------------------------------------
R7FQ12_9CLOT/119-323--------------------------------------------------------------------------------
F6DU87_DESRL/210-419--------------------------------------------------------------------------------
R6R0T0_9FIRM/204-412--------------------------------------------------------------------------------
D4J425_9FIRM/145-352--------------------------------------------------------------------------------
R5YSC4_9FIRM/173-380--------------------------------------------------------------------------------
R5J4I1_9FIRM/118-321--------------------------------------------------------------------------------
R6Y3R6_9FIRM/105-307--------------------------------------------------------------------------------
I4D8U8_DESAJ/208-416--------------------------------------------------------------------------------
R5A2Q9_9CLOT/168-371--------------------------------------------------------------------------------
A4XKP9_CALS8/199-405--------------------------------------------------------------------------------
R7HFV6_9MOLU/114-314--------------------------------------------------------------------------------
R5MBH1_9MOLU/116-319--------------------------------------------------------------------------------
B0TEK3_HELMI/215-424--------------------------------------------------------------------------------
R7K6P1_9FIRM/158-362--------------------------------------------------------------------------------
R6WI32_9FIRM/144-352--------------------------------------------------------------------------------
C4ZCY0_EUBR3/233-444--------------------------------------------------------------------------------
R7FE29_9FIRM/75-280--------------------------------------------------------------------------------
R7KE68_9FIRM/124-326--------------------------------------------------------------------------------
Q8XJE5_CLOPE/171-380--------------------------------------------------------------------------------
D4LFB6_RUMC1/188-392--------------------------------------------------------------------------------
R6RRV8_9FIRM/198-401--------------------------------------------------------------------------------
R7B468_9CLOT/225-433--------------------------------------------------------------------------------
G7M128_9CLOT/180-389--------------------------------------------------------------------------------
U5S0W6_9CLOT/60-268--------------------------------------------------------------------------------
R5KFR6_9CLOT/196-405--------------------------------------------------------------------------------
R7QW48_9FIRM/197-405--------------------------------------------------------------------------------
R6BUQ9_9FIRM/202-410--------------------------------------------------------------------------------
R7MCE1_9CLOT/114-318--------------------------------------------------------------------------------
A5D302_PELTS/204-413--------------------------------------------------------------------------------
E6UBW1_RUMA7/187-391--------------------------------------------------------------------------------
R5PM12_9CLOT/193-402--------------------------------------------------------------------------------
R5CZB6_9FIRM/133-338--------------------------------------------------------------------------------
R6SMI2_9CLOT/138-343--------------------------------------------------------------------------------
A4J3G7_DESRM/210-419--------------------------------------------------------------------------------
E6U2J4_ETHHY/189-392--------------------------------------------------------------------------------
R5SUE4_9CLOT/122-326--------------------------------------------------------------------------------
R6XJ65_9FIRM/124-325--------------------------------------------------------------------------------
R6QNQ2_9CLOT/190-395--------------------------------------------------------------------------------
R6KNJ0_9CLOT/215-423--------------------------------------------------------------------------------
R6T3R8_9FIRM/188-393--------------------------------------------------------------------------------
R7HTV5_9CLOT/214-418--------------------------------------------------------------------------------
R5VVX1_9FIRM/191-398--------------------------------------------------------------------------------
R5TNP7_9FIRM/195-403--------------------------------------------------------------------------------
Q18B75_PEPD6/138-350--------------------------------------------------------------------------------
G2T3Q8_ROSHA/203-410--------------------------------------------------------------------------------
R6GHR5_9CLOT/190-395--------------------------------------------------------------------------------
E6TXR0_BACCJ/201-410--------------------------------------------------------------------------------
R6KEA9_9FIRM/207-412--------------------------------------------------------------------------------
R7IWD1_9CLOT/192-400--------------------------------------------------------------------------------
R5VVV3_9DELT/153-356--------------------------------------------------------------------------------
R6I8W6_9FIRM/181-382--------------------------------------------------------------------------------
R7GGP8_9CLOT/117-316--------------------------------------------------------------------------------
R5J7S8_9CLOT/122-325--------------------------------------------------------------------------------
R6FK23_9FIRM/138-346--------------------------------------------------------------------------------
R7P923_9CLOT/115-318--------------------------------------------------------------------------------
R5KUR7_9CLOT/197-401--------------------------------------------------------------------------------
I3VWM7_THESW/214-421--------------------------------------------------------------------------------
R6B2V6_9CLOT/193-402--------------------------------------------------------------------------------
R7DMS2_9FIRM/123-328--------------------------------------------------------------------------------
R5KNW9_9FIRM/197-403--------------------------------------------------------------------------------
R7NI61_9MOLU/101-304--------------------------------------------------------------------------------
F2JMG1_CELLD/213-423--------------------------------------------------------------------------------
K4L254_9FIRM/158-366--------------------------------------------------------------------------------
R6GNM4_9FIRM/130-329--------------------------------------------------------------------------------
R6Q3J2_9FIRM/197-399--------------------------------------------------------------------------------
R6N1E9_9FIRM/118-320--------------------------------------------------------------------------------
R5SZK8_9CLOT/120-323--------------------------------------------------------------------------------
R5YCX5_9FIRM/210-420--------------------------------------------------------------------------------
R7C759_9CLOT/199-406--------------------------------------------------------------------------------
W0E9D2_9FIRM/204-412--------------------------------------------------------------------------------
Q894H5_CLOTE/186-394--------------------------------------------------------------------------------
C9R866_AMMDK/202-412--------------------------------------------------------------------------------
R7HB69_9FIRM/198-403--------------------------------------------------------------------------------
A6TR47_ALKMQ/212-421--------------------------------------------------------------------------------
R7ESB8_9FIRM/150-355--------------------------------------------------------------------------------
R6PKG4_9CLOT/142-350--------------------------------------------------------------------------------
R7M6Q4_9CLOT/189-398--------------------------------------------------------------------------------
Q0AZD6_SYNWW/215-423--------------------------------------------------------------------------------
R7N4W4_9FIRM/233-441--------------------------------------------------------------------------------
R6YA95_9FIRM/170-373--------------------------------------------------------------------------------
D5WV97_KYRT2/203-412--------------------------------------------------------------------------------
R5LXL5_9FIRM/207-415--------------------------------------------------------------------------------
R5DF89_9FIRM/134-342--------------------------------------------------------------------------------
R6TFF4_9STAP/123-324--------------------------------------------------------------------------------
A5I2Z7_CLOBH/190-399--------------------------------------------------------------------------------
R6H4Q6_9CLOT/93-302--------------------------------------------------------------------------------
R6R368_9FIRM/120-325--------------------------------------------------------------------------------
A3DDL9_CLOTH/220-429--------------------------------------------------------------------------------
D3E6N1_GEOS4/216-425--------------------------------------------------------------------------------
F9VK25_ARTSS/181-387------------------------------------------