Sequence alignment for CL0124

PF01732

A5IYK2_MYCAP/279-649---------------------------------------------------ADFF-QYISDRS-------------FELN
D9QW46_MYCMG/258-617---------------------------------------------------EDYF-KYIHERS-------------FQLE
Q2SR25_MYCCT/264-622---------------------------------------------------EDFF-KYIHERS-------------FQLE
D3VQF5_MYCA6/359-733---------------------------------------------------LDFY-QYIYDHS-------------FSLR
Q4A635_MYCS5/147-497---------------------------------------------------EEYL-ESIFKRT-------------FSIN
Q4A5A2_MYCS5/91-491---------------------------------------------------FDAL-KAIADRS-------------FSLY
C7LM95_MYCML/189-571---------------------------------------------------EEIY-KELYDRT-------------FSIK
A5IYA1_MYCAP/186-569---------------------------------------------------KILY-KELYDRT-------------FSLK
Q4A798_MYCH7/125-523---------------------------------------------------QILY-KELYDRT-------------FSVK
Q4A5G2_MYCS5/337-740---------------------------------------------------ETLY-KEIYDRT-------------FSLA
D3FFM3_MYCGH/244-661---------------------------------------------------QLIY-KEIWDRT-------------FSIR
C5J6P1_MYCCR/115-482---------------------------------------------------EQAY-EKLKNRT-------------FAIA
D3FH76_MYCGH/221-623---------------------------------------------------QEIY-KKIYDRT-------------FSLE
D3FHN8_MYCGH/203-712---------------------------------------------------NEIY-KKAAMQT-------------YAIE
D3FHQ1_MYCGH/203-710---------------------------------------------------NEIY-KKVALQT-------------FAIE
Q4A5P6_MYCS5/166-643---------------------------------------------------NDLY-KNTALQT-------------YSIS
D1J8A8_MYCHP/334-723---------------------------------------------------NEHY-RDIASQT-------------FGIR
B1RXG0_UREUR/379-750---------------------------------------------------NEKY-RDEALQT-------------LGIS
A0A024FAH6_UREPR/376-752---------------------------------------------------NEKY-RQEAMQT-------------FSLG
B1AI32_UREP2/413-786---------------------------------------------------NDMY-KQIALQT-------------FGIQ
D9QXV8_MYCMG/283-769---------------------------------------------------NETY-KTAAIQT-------------FQVS
C7LKT8_MYCML/288-775---------------------------------------------------NKTY-KTAAIQT-------------FQVS
Q98Q64_MYCPU/350-715---------------------------------------------------NEMY-KKIALQT-------------YSVD
Q98QS3_MYCPU/339-702---------------------------------------------------NETY-KKIAEQS-------------YSVQ
D3FJ19_MYCGF/216-600---------------------------------------------------NDHY-RDFSKTV-------------YSLY
D3FHK1_MYCGH/204-545---------------------------------------------------NKKY-QQLSKIT-------------YSIR
Q4A7B5_MYCH7/323-738---------------------------------------------------NQEY-KNLTKNS-------------IGVE
Q98PH9_MYCPU/101-415---------------------------------------------------NKIY-QDNFKTS-------------LSLS
Q8EWB5_MYCPE/130-442---------------------------------------------------NETQ-VKQAKRT-------------VGIG
Q8EW95_MYCPE/145-484---------------------------------------------------TDKH-AQLAKQV-------------YSVG
Y068_MYCGE/48-383---------------------------------------------------SDPY-HINYDLT-------------FSLN
H0PPR7_MYCPM/45-410---------------------------------------------------GDVY-HDNYDLT-------------FSLN
M1GCC9_MYCPM/75-444---------------------------------------------------SDVF-KHNYDLT-------------FSLN
J3UDP5_MYCGT/89-428---------------------------------------------------SDIY-RKGYDLT-------------FTLN
M1GHC3_MYCPM/104-443---------------------------------------------------NTKY-RPGYDLS-------------FALK
Y083_MYCPN/52-447---------------------------------------------------DDIY-SKFYDLT-------------FSLN
M1GE88_MYCPM/44-388---------------------------------------------------AEID-HANYDLT-------------FFLG
Q4A8M7_MYCH7/557-908---------------------------------------------------SFYF-GNSLQDY-------------YQVK
Q8EWN7_MYCPE/57-397---------------------------------------------------SNAL-KWISQRT-------------ISLA
B1RXU5_UREUR/59-344---------------------------------------------------NVST-AYLNKRS-------------IALK

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q76VQ5_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF00944

POLS_SFV/112-268--------------------------------------------------------------------------------
POLS_SINDV/107-265--------------------------------------------------------------------------------

PF10459

A1SA55_SHEAM/18-726---------------------------------------------------ADEG.QWQPYQM..PSI.ADKLKA.RGID
E0THX8_PARBH/23-721---------------------------------------------------ADEG.MWTPDQL..PAI.ADDLRE.TGLE
F2GAE2_ALTMD/22-719---------------------------------------------------AKEG.MFTPEQL..PSI.AGDLKE.TGLE
A5FMW8_FLAJ1/19-712---------------------------------------------------ADEG.MWFLMFI..ERLNHRDMEK.MGLQ
A6GWM2_FLAPJ/17-707---------------------------------------------------AQQGGMWIPSLL..SGMNETEMKN.LGMK
A6KZW8_BACV8/17-706---------------------------------------------------GNEG.MWLPCCL..SKQTQQVMKE.MGLE
A6L2J7_BACV8/19-726---------------------------------------------------ADEG.MWMLTDL..KEQNAATMYD.MGLD
A6L2J8_BACV8/21-719---------------------------------------------------ADEG.MWLLQLM..QEQHLADRMKAQGLL
A6LID5_PARD8/19-717---------------------------------------------------ADEG.MWLLPLL..KQQKFAEMQA.LGLR
A7HA06_ANADF/20-725---------------------------------------------------ADEG.MWMPQQI..PDL.APRLQQ.LGFD
A7HFU9_ANADF/37-699---------------------------------------------------ADEG.MWTYDAF.....PADKVEKKYGFR
Q024G1_SOLUE/22-694---------------------------------------------------GEEG.KWTPQQL..LQFDAAWLKK.QGLE
Q029T1_SOLUE/24-727---------------------------------------------------AEEG.MWMPQQI..PEM.AAKLRA.LGFR
Q07XT1_SHEFN/18-727---------------------------------------------------ADEG.QWQPYQM..PSI.ADKLLQ.RGID
Q08VC9_STIAD/18-714---------------------------------------------------AGEG.KWTPQQV..LELDPAWLKA.QGLK
Q11SC7_CYTH3/21-702---------------------------------------------------ADEG.MWLPFVL...GKNYDQMKK.LGLK
Q12RW4_SHEDO/18-728---------------------------------------------------GDEG.QWQPYQM..PSI.ADKLEQ.HGIK
Q1D5W7_MYXXD/35-700---------------------------------------------------ADEG.MWTYNNF.....PSAKVKEKYGFE
Q1D9F6_MYXXD/17-714---------------------------------------------------AGEG.KWTPQQV..LELDPAWLRA.QGLQ
Q1DDZ2_MYXXD/18-682---------------------------------------------------ADEG.MWTYDAF.....PSDTVNKAYGFT
Q1GVV7_SPHAL/23-684---------------------------------------------------AEEG.MWTFDAV.....PTDAIKAAYGWA
Q1IPC2_KORVE/27-692---------------------------------------------------ADEG.MWLFTNP.....PTAAIQKKYGFA
Q2G546_NOVAD/56-713---------------------------------------------------ADEG.MWTFDAF.....PSAKMQADYGWA
Q2IEV3_ANADE/18-687---------------------------------------------------ADEG.MWTYDAF.....PSDRVARKYGFD
Q2S133_SALRD/5-639---------------------------------------------------SDAGRIWSLVAP.....PADRLVRRYGME
Q2S134_SALRD/69-734---------------------------------------------------FDRGRMWTVENL.....PTSYFQEAHGVT
Q488S2_COLP3/26-729---------------------------------------------------ADEG.MWQPNQL..PTI.AKELTN.AGLK
Q5LIW7_BACFN/34-723---------------------------------------------------ADEG.MWMLGNL..NKETRKTMKE.LGLQ
Q5QV86_IDILO/17-717---------------------------------------------------ADEG.MWMPKQL..PEI.ADKLKA.AGLT
Q7MV25_PORGI/21-718---------------------------------------------------ADEG.MWLMQQL...GRKYAQMKE.RGLK
Q7MWU6_PORGI/24-711---------------------------------------------------ADKG.MWLLNEL..NQENLDRMRE.LGFT
Q7NHA9_GLOVI/34-698---------------------------------------------------AEEG.MWTYDNF.....PSEQVAKKYGFK
Q7UKL5_RHOBA/28-688---------------------------------------------------ADEG.MYLFNDV.....PRELLRDRHQFE
Q8A2L6_BACTN/20-711---------------------------------------------------ADEG.MWLLGNLRKNKQAERVMKE.LGLQ
B2FQN5_STRMK/22-717---------------------------------------------------AAEG.MWVPQQL..PEI.AGPLQK.AGLK
E3FSI6_STIAD/18-681---------------------------------------------------ADEG.MWTYNNF.....PAAAVKAQYGFE
Q5LB16_BACFN/20-719---------------------------------------------------ADEG.MWMLTDL..KAQNEAAMMD.LGLQ
Q8EAI4_SHEON/18-728---------------------------------------------------ADEG.QWQPYQM..PSI.ADKLSA.RGID
Q8EHX9_SHEON/18-716---------------------------------------------------ADEG.MWQPHQL..PAM.ADVLKA.KGLE
Q9PC94_XYLFA/22-713---------------------------------------------------AGEG.MWVPQQL..PEI.AGPLKQ.AGLQ
R5U6M0_9BACE/21-717---------------------------------------------------ADEG.MWLLQLM..QQQHSIDMMKKQGLK
R6WQY4_9PORP/22-710---------------------------------------------------ADEG.MWVLKEL..NKQNLERMKE.LGFT
R6Y7C6_9PORP/19-717---------------------------------------------------ADEG.MWLLPLL..KGQRFPEMQA.LGLK
R7EE18_9BACE/20-708---------------------------------------------------ADEG.MWMLGNL..NKQTRQTMKE.LGLQ
R7EGG9_9BACE/23-719---------------------------------------------------ADEG.MWLLQLM..KQQNSIDMMKKQGLK

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF05409

R1A_CVH22/2994-3281------------------------------------------------------G-LWLGDIVYCPRHVIASNTTSA.ID
R1A_IBVB/2808-3096------------------------------------------------------G-LWLGDTIYCPRHVLGKFSG...DQ
B6VDX7_THCOV/2516-2804------------------------------------------------------G-IWLNNVVYCPRHVFGKFKG...EQ
R1AB_FIPV/2932-3219------------------------------------------------------G-LWLGDEVICPRHVIASDTSRV.IN
R1A_CVHSA/3269-3559------------------------------------------------------G-LWLDDTVYCPRHVICTAEDMLNPN
R1A_CVMA5/3362-3648------------------------------------------------------G-LWLDDKVYCPRHVICSSADMTDPD

PF09342

Q7QJ48_ANOGA/1774-1887--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1523-1637--------------------------------------------------------------------------------
NUDEL_DROME/2041-2158--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569---------------------------------------------------IVGG-------------------------
SP24D_ANOGA/50-264---------------------------------------------------IVGG-------------------------
TRY5_AEDAE/40-260---------------------------------------------------IVGG-------------------------
A0A024QZM9_HUMAN/179-419---------------------------------------------------IIGG-------------------------
MASP1_MOUSE/454-696---------------------------------------------------IFNG-------------------------
CTR1_ANOGA/33-250---------------------------------------------------VVGG-------------------------
CFAD_HUMAN/26-248---------------------------------------------------ILGG-------------------------
ACRO_RAT/43-286---------------------------------------------------IVGG-------------------------
HPT_HUMAN/162-399---------------------------------------------------ILGG-------------------------
CASP_MESAU/445-682---------------------------------------------------IFGG-------------------------
A8JQZ2_DROME/186-427---------------------------------------------------IVGG-------------------------
PCE_TACTR/128-370---------------------------------------------------IIGG-------------------------
STUB_DROME/544-782---------------------------------------------------IVGG-------------------------
TRYU_DROME/28-254---------------------------------------------------IVGG-------------------------
TRYI_DROME/28-245---------------------------------------------------IIGG-------------------------
TRYB_MANSE/25-252---------------------------------------------------IVGG-------------------------
TRYP_FUSOX/25-244---------------------------------------------------IVGG-------------------------
B1VV86_STRGG/37-252---------------------------------------------------VVGG-------------------------
TRY1_HUMAN/24-239---------------------------------------------------IVGG-------------------------
TRYP_PIG/9-224---------------------------------------------------IVGG-------------------------
TRY1_SALSA/21-235---------------------------------------------------IVGG-------------------------
TRYP_PLEPL/23-242---------------------------------------------------IIGG-------------------------
DEGP3_ARATH/99-287---------------------------------------------------KVFT-------------------------
DEGP2_ARATH/121-308---------------------------------------------------VYCT-------------------------
A0A017I371_ECOLX/62-244---------------------------------------------------YNRG-------------------------
DEGS_HAEIN/37-240---------------------------------------------------IISF-------------------------
J7JYL9_BACIU/99-283---------------------------------------------------DIWG-------------------------
A0A017R133_SALET/97-278---------------------------------------------------QGGG-------------------------
Q44596_BRUAO/85-261---------------------------------------------------SQFG-------------------------
A0A024EQG8_BRUCA/125-298---------------------------------------------------PRPG-------------------------
O06439_RHOCA/59-235---------------------------------------------------PQGG-------------------------
F7UK65_SYNYG/95-274---------------------------------------------------FGRS-------------------------
M1LZP5_9SYNC/156-334---------------------------------------------------FGSQ-------------------------
O42417_CHICK/87-286---------------------------------------------------IVGR-------------------------
A0A028WZQ9_STAAU/70-274---------------------------------------------------KVDE-------------------------
ETB_STAAU/59-251---------------------------------------------------ITDN-------------------------
A0A008AS15_STAAU/37-234---------------------------------------------------ENNV-------------------------
A0A008ARX4_STAAU/38-233---------------------------------------------------KNVT-------------------------
J7JN12_BACIU/95-311---------------------------------------------------IIGT-------------------------
PRTC_STRGR/205-383---------------------------------------------------IRGG-------------------------
Q55353_STRSQ/198-372---------------------------------------------------LVGG-------------------------
Q55352_STRSQ/202-378---------------------------------------------------LVGG-------------------------
Q54395_STRLI/158-342---------------------------------------------------ASGG-------------------------
SP1_RARFA/205-391---------------------------------------------------DDVI-------------------------
CERC_SCHMA/28-256---------------------------------------------------IRSG-------------------------
Q54344_STRLI/47-254---------------------------------------------------AISG-------------------------
CFAB_HUMAN/481-752---------------------------------------------------VWEH-------------------------
PROZ_BOVIN/143-352---------------------------------------------------RPQG-------------------------
CAC3_BOVIN/12-246---------------------------------------------------VVNG-------------------------
CELA1_PIG/27-259---------------------------------------------------VVGG-------------------------
CTRA_BOVIN/16-238---------------------------------------------------IVNG-------------------------
CTRL_HALRU/24-251---------------------------------------------------IVGG-------------------------
COGS_HYPLI/31-252---------------------------------------------------IING-------------------------
CTRB1_LITVA/46-263---------------------------------------------------IVGG-------------------------
CATG_MOUSE/21-238---------------------------------------------------IIGG-------------------------
MCPT2_RAT/21-239---------------------------------------------------IIGG-------------------------
ELNE_HUMAN/30-242---------------------------------------------------IVGG-------------------------
PRTN3_HUMAN/28-243---------------------------------------------------IVGG-------------------------
GRAK_RAT/26-248---------------------------------------------------IIGG-------------------------
GRAM_RAT/21-245---------------------------------------------------IIGG-------------------------
KLK1_MOUSE/25-253---------------------------------------------------IVGG-------------------------
KLK2_RAT/25-251---------------------------------------------------IVGG-------------------------
VSPCA_AGKCO/1-217---------------------------------------------------VIGG-------------------------
HGF_RAT/496-719---------------------------------------------------VVNG-------------------------
ENTK_PIG/800-1029---------------------------------------------------IVGG-------------------------
PRSS8_HUMAN/45-281---------------------------------------------------ITGG-------------------------
HGFA_HUMAN/408-641---------------------------------------------------IIGG-------------------------
TPA_HUMAN/311-556---------------------------------------------------IKGG-------------------------
H2Q7T9_PANTR/235-462---------------------------------------------------IVGG-------------------------
THRB_BOVIN/367-616---------------------------------------------------IVEG-------------------------
PROC_HUMAN/212-445---------------------------------------------------LIDG-------------------------

PF12380

Q9IHZ8_GAVAU/2823-3106---------------------------------------------------FLVG-------------------------

PF12381

Q6EEL1_9SECO/2617-2847----------------------DKGLAKDPNMVTILTDKLINISAVIVNLTPTRRAYMNVV-------------------
O11979_9SECO/2603-2833----------------------YKSLDKDPNMVSILSNQLTKISCVILNVTPGRTAYLNVM-------------------
Q1MNG4_9SECO/2627-2857----------------------RAGVDRDLSMTNLIDTHMAGMSCIIISELGNVFRTFGVL-------------------

PF00863

POLG_SPMMV/2424-2646--------------------AEDK..........HIASRLAIVR....THKGETHGIFH---------------------
POLG_RGMVD/1998-2230--------------------HESKSIAKGLRDYHPVSSNLCALEYYCGDMRTSIYGVCY---------------------

PF02395

HAP1_HAEIN/17-782-------LGIASQAWAGHTYFGIDYQYYRDFAENKGKFTVGAKNIEVYNKEGQLVGTSMTK.APMIDFSVVSRN.GVAAL
IGA0_HAEIN/17-865-------YALTPYTEAALVRDDVDYQIFRDFAENKGRFSVGATNVEVRDKNNHSLGNVLPNGIPMIDFSVVDVDKRIATL
Q5F9W2_NEIG1/19-848-------YALTPYSEAALVRDDVDYQIFRDFAENKGKFFVGATDLSVKNKRGQNIG.NALSNVPMIDFSVADVNKRIATV

PF05578

POLG_BVDVN/1680-1890-----------------------GPAVCKKITEHE------KCHINILDKLTAFFG-IMPR--------------GTTPR

PF01577

POLG_PEMVM/73-321------------------VEDVFANFFAKKER----SDELLTRYYGKVVQKGNKLMVKRAP-------------------
POLG_TUMVJ/107-361------------------HEEANKERALFLDW----EASLKRSSYGIAENEKVVMTTRGVS-------------------
Q85074_9POTV/144-397------------------AALQLAVAKATIAR----EEKIKQAALSKFDKNSQVKHTGLKD-------------------
POLG_ZYMVR/71-312------------------FDTDPEMRFRLTRN----E.....MSKVKKGPNGRMILRKPRA-------------------
P90213_9POTV/300-546------------------HKEHAKIEAIRVRK----EKERDQRIFAALEAKLNLGTRRKGQ-------------------
POLG_PEMVC/44-286------------------AELEKHLEPYLQKR----M.....DATIRQTKGGTLVYKHMSE-------------------
POLG_TVMV/30-273------------------KDIFSSIKERLERK----R.....HGKICRMKNGSIYIKAASS-------------------
POLG_RGMVD/13-255------------------QVDGTWVPRVFEEK----EMARLLAEKQHARVMRATQEMMKAP-------------------
POLG_LMV0/179-436------------------AQMEVDKAEQDLAF----ACLNASLKPRLEGRTTATIARRRDG-------------------
POLG_PVMA/45-297------------------EFTLAKSLQRQAHG----VVKVDKHGTARIKRASKHHMSCLEQ-------------------
POLG_PSBMV/143-396------------------ARLQAAVAKSTIER----EEKERQFAFSKLEEKLRARREKLKD-------------------
Q82933_9POTV/2-236------------------AGEWNTVVGKRNQR----........KTEEQRIFDAQKRFYET-------------------
POLG_PVYN/41-283------------------ADLETQLSARLLKQ----K.....YATVRVLKNGTFTYRYKTD-------------------
Q65892_BYMV/40-283------------------ADLEMRCAERVKR.----......MGELCFSKKGRYITMIPKP-------------------
POLG_BCMNN/77-316------------------LKKNSDLQKRLFIG----Q.....NSPIKQKKGGACFVRSLSF-------------------
POLG_ZYMVC/70-309------------------FSTD.EMKFRLTRN----E.....MSKLKKGPSGRIVLRKPSK-------------------
Q65852_BYMV/40-283------------------SDLEARCAERLKR.----......MGELCFSRRGRYTTMVPKP-------------------
POLG_SBMVG/69-307------------------FDQDVGIQRRLLVN----K.....HSSIQSTKEGWFDLASLNF-------------------
O73463_MDMV/2-232------------------AGTWTHVTHKWQP.----......NLDN.PRDVRRIMELFAAK-------------------
POLG_PVYHU/41-283------------------ASLEMQLSARLRRQ----E.....FATIRTSKNGTCMYRYKTD-------------------
POLG_PPVD/59-307------------------TASAWKGLEEKLQP----MFAKREFSKTVTKRKGLRCFKESSE-------------------
Q85057_9POTV/204-442------------------MQQNSALQRKLLIQ----Q.....QSTIEQRPKGAVQLRFCSY-------------------
O39734_9POTV/410-663------------------TQQAAAEKEKLVWK----KLDEQLATRNEIRKDLKVKWRWGLY-------------------
POLG_ZYMVS/71-312------------------FNNDPEDAFRLTRN----G.....MSKVKKGPNGRIILRKPKA-------------------
POLG_PRSVH/300-546------------------HKEHAKIAAIQVQK----EREKDQKVFSALELRLNLKSRRRNQ-------------------
POLG_TEV/53-303------------------VIFGEDYITEADLP----YTPLHLEVDAEMERMYYLGRRALTH-------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268------------------KLDFSHLKMELAPQGGFDNQGNTPFGKGTMKPTTINRLLIQAV-------------------
Q9YQ23_VESV/628-1162------------------KKDFSHLQLQLAPQGGFDCMGNTPYGKGAMSKTSLSRLLASAT-------------------
Q80J95_9CALI/650-1163------------------RPDYSHINFILAPQGGFDRQGNTPYGKGVTKIIGATALCARAV-------------------
Q8JJL0_9CALI/645-1175------------------KQDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSLTARVA-------------------
Q80RD7_9CALI/641-1177------------------SPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARAS-------------------

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713----------------------ITLVWVQFF.....LLAVNVWAGVASVVVLI--SSWFLA-------------------
RPOA_PRRSL/1601-1897----------------------LTMLWVHSF.....LVFCLPAAGILSLGITG--LLWAIG-------------------
RPOA_LDVP/1420-1715----------------------VTLVWVQFF.....LLAVNFWAGVAVAVILI--SSWFLA-------------------
RPOA_SHFV/1368-1665----------------------LSMKYIAFFC..CTTAFVDFTSVVVVLTALL--VGWILA-------------------
Q99AV6_PRRSV/1716-2013----------------------LTILWLVFF.....LISVNMPSGILAMVLLV--SLWLLG-------------------
RPOA_EAVBU/963-1269----------------------LATLFVNLFFPQATLVTMGYWACVAALAVYS--LMGLRV-------------------

PF05580

B2A522_NATTJ/220-429----------------------..NEY------------------------GI--GLYLTD-------------------
R6EU85_9FIRM/238-449----------------------RTGKY------------------------KI--GVWVRD-------------------
R5R857_9FIRM/207-436----------------------EEGVY------------------------KI--GVWVRD-------------------
D5DLD9_BACMD/199-411----------------------QDYAY------------------------RI--GLYIRD-------------------
R5E7E8_9CLOT/152-361----------------------.ANIY------------------------KV--GIWVRD-------------------
H6NL93_9BACL/215-426----------------------.DKAY------------------------RL--GLYIRD-------------------
D9QRU2_ACEAZ/225-437----------------------HSGRY------------------------MI--GLYIDD-------------------
R5C627_9FIRM/188-399----------------------EDGCY------------------------KL--GIWVRD-------------------
R7M5P2_9CLOT/113-319----------------------EGNTY------------------------KT--GLYVKD-------------------
R5H148_9FIRM/296-509----------------------TEGVY------------------------KL--GIWIRD-------------------
R6AIL9_9CLOT/309-520----------------------TDGKA------------------------KI--GAWVRD-------------------
R7FQ12_9CLOT/118-324----------------------.NGCF------------------------KT--GLYVKE-------------------
F6DU87_DESRL/208-419----------------------ETKRY------------------------RV--GLFVRD-------------------
R6R0T0_9FIRM/202-413----------------------SDGVY------------------------KI--GVWVRD-------------------
D4J425_9FIRM/143-352----------------------AEDRY------------------------KI--GVWLRD-------------------
R5YSC4_9FIRM/171-381----------------------KNGIY------------------------KI--GLWVRD-------------------
R5J4I1_9FIRM/116-322----------------------TPSGY------------------------RL--GVLVRD-------------------
R6Y3R6_9FIRM/105-308----------------------..EKI------------------------KT--GLYVKD-------------------
I4D8U8_DESAJ/207-417----------------------.TGRY------------------------RV--GLFVRD-------------------
R5A2Q9_9CLOT/166-372----------------------GDGSF------------------------KT--GMWVRD-------------------
A4XKP9_CALS8/197-406----------------------SEGVY------------------------KI--GLWVRD-------------------
R7HFV6_9MOLU/114-315----------------------..GVI------------------------KT--GLFVKS-------------------
R5MBH1_9MOLU/114-320----------------------NNNSY------------------------KT--GIYVKD-------------------
B0TEK3_HELMI/213-425----------------------ETKRF------------------------RV--GLYVRD-------------------
R7K6P1_9FIRM/157-363----------------------.TKTY------------------------KL--GLWSKD-------------------
R6WI32_9FIRM/142-352----------------------EKDKY------------------------KL--GIWVRD-------------------
C4ZCY0_EUBR3/231-444----------------------DDGRY------------------------YM--GIWVKD-------------------
R7FE29_9FIRM/73-281----------------------KDGCY------------------------EA--GVWVRD-------------------
R7KE68_9FIRM/124-327----------------------..KEY------------------------KL--GLYVKE-------------------
Q8XJE5_CLOPE/169-381----------------------SEGDY------------------------KI--GLWVRD-------------------
D4LFB6_RUMC1/186-392----------------------ADACY------------------------KA--GLWVRD-------------------
R6RRV8_9FIRM/196-402----------------------TDSQY------------------------KI--GAWVRD-------------------
R7B468_9CLOT/223-433----------------------QEGDY------------------------KL--GLWIRD-------------------
G7M128_9CLOT/178-390----------------------NSKDY------------------------KI--GLWIRD-------------------
U5S0W6_9CLOT/58-269----------------------EGNNY------------------------KI--GLWIRD-------------------
R5KFR6_9CLOT/194-405----------------------ADGSY------------------------KA--GIWVRD-------------------
R7QW48_9FIRM/195-406----------------------EDGAY------------------------KL--GIWVRD-------------------
R6BUQ9_9FIRM/200-411----------------------QNGSC------------------------KL--GVWVRD-------------------
R7MCE1_9CLOT/112-319----------------------EGSIY------------------------KT--GLYVKE-------------------
A5D302_PELTS/202-414----------------------ETLRY------------------------RM--GLLIRD-------------------
E6UBW1_RUMA7/185-391----------------------SEGSY------------------------KA--GMWVRD-------------------
R5PM12_9CLOT/191-403----------------------SKNTY------------------------KI--GLWVRD-------------------
R5CZB6_9FIRM/131-339----------------------EDGGI------------------------RL--GAWIRD-------------------
R6SMI2_9CLOT/136-344----------------------ADGRY------------------------KT--GLYVRD-------------------
A4J3G7_DESRM/208-419----------------------ETQRY------------------------RV--GLFVRD-------------------
E6U2J4_ETHHY/187-393----------------------TDGVF------------------------KA--GLWVRD-------------------
R5SUE4_9CLOT/120-327----------------------KNDIY------------------------KT--GMYVKD-------------------
R6XJ65_9FIRM/122-326----------------------STNEK------------------------SI--GLYIRD-------------------
R6QNQ2_9CLOT/190-396----------------------..AQY------------------------KI--GVWVRD-------------------
R6KNJ0_9CLOT/213-424----------------------ADGQY------------------------KL--GAWVRD-------------------
R6T3R8_9FIRM/186-393----------------------ENGSY------------------------KA--GMWVRD-------------------
R7HTV5_9CLOT/212-419----------------------EKNNF------------------------KL--GIWVRD-------------------
R5VVX1_9FIRM/189-398----------------------ADQQY------------------------ET--GLWVRD-------------------
R5TNP7_9FIRM/195-404----------------------..KIF------------------------QI--GVWVRD-------------------
Q18B75_PEPD6/136-351----------------------ENGKY------------------------KL--GLWVRD-------------------
G2T3Q8_ROSHA/201-410----------------------ETGKY------------------------RL--GIWVRD-------------------
R6GHR5_9CLOT/188-396----------------------TDNIY------------------------KL--GLWVRD-------------------
E6TXR0_BACCJ/199-411----------------------GEESF------------------------RL--GLYIRD-------------------
R6KEA9_9FIRM/205-413----------------------TNGEY------------------------KL--GLWVKD-------------------
R7IWD1_9CLOT/190-401----------------------KDGKY------------------------KL--GLWVRD-------------------
R5VVV3_9DELT/151-357----------------------TAGHY------------------------RL--GLWTRD-------------------
R6I8W6_9FIRM/179-383----------------------VDSKF------------------------KA--GLWVRD-------------------
R7GGP8_9CLOT/115-317----------------------GNEGY------------------------SL--GLYIKD-------------------
R5J7S8_9CLOT/120-326----------------------EDNVY------------------------KT--GLYVKD-------------------
R6FK23_9FIRM/136-347----------------------GSGQQ------------------------KI--GVWVKE-------------------
R7P923_9CLOT/113-319----------------------DKDIY------------------------KT--GLYVKS-------------------
R5KUR7_9CLOT/195-402----------------------SEGCY------------------------KA--GMWVRD-------------------
I3VWM7_THESW/212-422----------------------DDQKY------------------------KL--GLWVRD-------------------
R6B2V6_9CLOT/191-403----------------------SNNEY------------------------KL--GLWVRD-------------------
R7DMS2_9FIRM/121-329----------------------EDNRY------------------------RT--GLYIKE-------------------
R5KNW9_9FIRM/195-404----------------------SDGEY------------------------ML--GIWVRD-------------------
R7NI61_9MOLU/99-305----------------------ENGVY------------------------KT--GLYVKD-------------------
F2JMG1_CELLD/211-424----------------------SEETY------------------------KI--GLWIKD-------------------
K4L254_9FIRM/156-367----------------------ETQRY------------------------RI--GLFIRD-------------------
R6GNM4_9FIRM/129-330----------------------.NGTF------------------------EL--GISMRD-------------------
R6Q3J2_9FIRM/196-400----------------------.AGQW------------------------RA--GMWVRD-------------------
R6N1E9_9FIRM/116-321----------------------EDNIY------------------------RL--GLWVRD-------------------
R5SZK8_9CLOT/118-324----------------------KSGVY------------------------KT--GLYVKD-------------------
R5YCX5_9FIRM/208-421----------------------TKEAY------------------------ML--GLWVKD-------------------
D5HI76_9FIRM/160-369----------------------ENGAY------------------------LL--GAWVKD-------------------
E3E859_PAEPS/137-349----------------------DDKAW------------------------RL--GLYIRD-------------------
R7C759_9CLOT/197-406----------------------SDGTY------------------------KI--GTWVRE-------------------
W0E9D2_9FIRM/202-413----------------------ETNRY------------------------RV--GLYVRN-------------------
Q894H5_CLOTE/184-395----------------------KDGDY------------------------KI--GLWVRD-------------------
C9R866_AMMDK/202-413----------------------..RSY------------------------RL--GLLVQE-------------------
R7HB69_9FIRM/196-404----------------------EGGNY------------------------KI--GLWVKD-------------------
A6TR47_ALKMQ/210-422----------------------EGETY------------------------RL--GLWVRD-------------------
R7ESB8_9FIRM/148-356----------------------RDGQF------------------------QT--GMWVRD-------------------
R6PKG4_9CLOT/140-351----------------------AEKEY------------------------KL--GIWVRD-------------------
R7M6Q4_9CLOT/187-399----------------------SGNQY------------------------KI--GLWVRD-------------------
Q0AZD6_SYNWW/215-424----------------------..NRC------------------------RI--GLYVRD-------------------
R7N4W4_9FIRM/231-442----------------------QGGEY------------------------KL--GIWVRD-------------------
R6YA95_9FIRM/168-374----------------------GEGSF------------------------KT--GMWVRD-------------------
D5WV97_KYRT2/201-413----------------------DQRTY------------------------RI--GLYIRD-------------------
R5LXL5_9FIRM/206-416----------------------.ENLR------------------------KI--GVWVRD-------------------
R5DF89_9FIRM/133-343----------------------.KKEY------------------------KL--GIWVRD-------------------
R6TFF4_9STAP/121-325----------------------QNNES------------------------SI--GLYIRD-------------------
A5I2Z7_CLOBH/188-400----------------------KDNNY------------------------KI--GLWVRD-------------------
R6H4Q6_9CLOT/91-303----------------------SNNEY------------------------KL--GLWVRD-------------------
R6R368_9FIRM/120-325----------------------..NVI------------------------KT--GLYVKE-------------------
A3DDL9_CLOTH/218-430----------------------EDNKY------------------------RV--GMWVRD-------------------
D3E6N1_GEOS4/214-426----------------------EDQSW------------------------RL--GLYIRD-------------------
F9VK25_ARTSS/179-388----------------------VDGKN------------------------KI--GLWVRD-------------------
R5QQG0_9FIRM/118-320----------------------NNAEF------------------------ST--GLYVKD-------------------
G8LW28_CLOCD/213-425----------------------EDNKY------------------------HL--GMWVRD-------------------
R7L0T4_9FIRM/126-334----------------------SDDSY------------------------RA--GMWVRD-------------------
L7VQQ3_CLOSH/209-420----------------------EDGKY------------------------RI--GIWVRD-------------------
C8WXF9_ALIAD/189-397----------------------.....------------------------EL--GVYVRD-------------------
Q2RIC4_MOOTA/202-411----------------------ETGRY------------------------RI--GVYVRD-------------------
R4KQW9_9FIRM/232-442----------------------.TGRY------------------------RI--GLFIKN-------------------
A9KMA5_CLOPH/225-441----------------------.TGEY------------------------KI--GTWIRD-------------------
E6SKR3_THEM7/211-421----------------------DQQRF------------------------AI--GIWVRD-------------------
L0F7L5_DESDL/200-410----------------------.TDRY------------------------RV--GLYVRN-------------------
I0JNU1_HALH3/188-400----------------------QEKEY------------------------QI--GLYIRD-------------------
R7EZR7_9BACI/117-324----------------------DNGVY------------------------KT--GLYVKD-------------------
R6J055_9CLOT/186-394----------------------ADGCW------------------------KA--GVWVRD-------------------
R5NUG0_9CLOT/148-357----------------------KDGSY------------------------AL--GLWVKD-------------------
G2TKW2_BACCO/200-411----------------------SGQSY------------------------KL--GLYIRD-------------------
R5N690_9FIRM/193-400----------------------NDNCY------------------------KA--GIWVRD-------------------
R5VHC6_9FIRM/114-320----------------------KDNVY------------------------KT--GLYVKD-------------------
R5NBK1_9CLOT/138-351----------------------ADNSY------------------------ML--GLWVRD-------------------
R5XPM2_9FIRM/140-351----------------------AAKKY------------------------KL--GIWVRD-------------------
D5X7G9_THEPJ/213-424----------------------ETSRY------------------------RI--GLYIRD-------------------
F4A1F9_MAHA5/214-428----------------------EEHKY------------------------KL--GIWVRD-------------------
R7ITE0_9FIRM/151-366----------------------GDNEY------------------------KM--GIWVRD-------------------
F6CL40_DESK7/195-404----------------------.TRRY------------------------RI--GLYVRD-------------------
L0EG06_THECK/213-424----------------------EDRAW------------------------RL--GLYIRD-------------------
R5IDG3_9CLOT/213-423----------------------TDGSS------------------------KL--GVWVRD-------------------
R6CTL1_9CLOT/118-325----------------------ENGTL------------------------KT--GLYVKD-------------------
K0B195_CLOA9/212-423----------------------QDNSY------------------------RL--GIWVRD-------------------
B8D2I8_HALOH/210-421----------------------KQGKY------------------------MI--GLYVDD-------------------
R6NNU0_9FIRM/213-424----------------------KEETY------------------------KL--GVWVRD-------------------
R6VE05_9FIRM/188-399----------------------QDLKY------------------------KL--GIWVRD-------------------
R6CN52_9FIRM/193-397----------------------SEGSY------------------------RA--GMWVRD-------------------
R5H2U4_9FIRM/159-365----------------------ANGQY------------------------RI--GTWVRD-------------------
R5V409_9FIRM/40-247----------------------ANGSW------------------------KT--GLLVKE-------------------
R6GW98_9FIRM/110-315----------------------TEDKY------------------------KT--GLFVKD-------------------
R7ICH4_9FIRM/200-411----------------------.TGVV------------------------RL--GAWVRD-------------------
R7BI76_9FIRM/223-434----------------------ENGRL------------------------KI--GTWVRD-------------------
C4Z0G6_EUBE2/202-409----------------------VAGEY------------------------KL--GIWVKD-------------------
R6NHB7_9CLOT/186-391----------------------.DGKY------------------------RA--GIWVRD-------------------
R7R973_9FIRM/207-417----------------------QNGVY------------------------KI--GTWLRD-------------------
R5HM74_9FIRM/192-403----------------------KNGTY------------------------ML--GAWVRD-------------------
R6NAF9_9FIRM/129-336----------------------TAGNY------------------------LI--GAWVRD-------------------
D9SLV5_CLOC7/150-362----------------------KDGCY------------------------KL--GVWVRE-------------------
R5RSY4_9FIRM/189-400----------------------EDGSY------------------------KL--GIWVRD-------------------
R6HAH9_9FIRM/113-319----------------------QDGRK------------------------RL--GIYVRE-------------------
R5XRH8_9CLOT/128-335----------------------EDGIY------------------------KL--GFWVRD-------------------
R7FZ38_9FIRM/122-328----------------------SDGEL------------------------RL--GLWVRE-------------------
R5I6P6_9FIRM/188-403----------------------SSGKY------------------------KL--GIWVRD-------------------
B8I3A0_CLOCE/214-425----------------------NDKKY------------------------HI--GLWVRD-------------------
R6DXQ1_9FIRM/186-391----------------------EDSTY------------------------KG--GLWIRD-------------------
R5E160_9FIRM/209-416----------------------DEGDY------------------------KV--GIWVKD-------------------
Q97HE0_CLOAB/178-390----------------------SDENY------------------------KI--GLWVRD-------------------
R6M2Z6_9CLOT/204-415----------------------EDGKV------------------------KI--GTWLRE-------------------
D6DLB6_CLOSC/284-503----------------------KDGDY------------------------KL--GIWIRD-------------------
R6RY05_9CLOT/213-424----------------------EDGTY------------------------KL--GAWVRD-------------------
F4LV06_TEPAE/231-437----------------------.....------------------------QI--GLWVRD-------------------
R6UED3_9CLOT/180-388----------------------GNSCY------------------------KI--GVWVRD-------------------
R5AES8_9CLOT/40-251----------------------EEHVY------------------------RI--GAWVRD-------------------
B2TRL9_CLOBB/178-390----------------------ENSDY------------------------KL--GLWIRD-------------------
R5D6V9_9FIRM/120-320----------------------KDGAW------------------------KL--GLMLRD-------------------
D7CKI9_SYNLT/217-427----------------------ETNRY------------------------RI--GLYVRD-------------------
R5TH80_9CLOT/131-336----------------------.SGEY------------------------KL--GVFVKD-------------------
R5MT91_9FIRM/109-314----------------------ENGVY------------------------KS--GLYVKD-------------------
R6YLB5_9CLOT/116-322----------------------SNGEY------------------------KT--GLYVKD-------------------
R6MJ71_9FIRM/140-351----------------------EGGAY------------------------KL--GIWVRD-------------------
D4M5K6_9FIRM/147-358----------------------SKGNY------------------------RL--GIWVRD-------------------
D9S3S9_THEOJ/212-423----------------------RDGIY------------------------QI--GLWVRD-------------------
F6B9N5_DESCC/208-419----------------------ETKRY------------------------RI--GMFVRD-------------------
R6TLY4_9FIRM/135-345----------------------DQGQY------------------------AI--GAWIRD-------------------
R5ZMQ1_9CLOT/197-409----------------------EDNEY------------------------KL--GLWVRD-------------------
Q67NC5_SYMTH/205-417----------------------ETGRW------------------------RV--GLYIRD-------------------
R6TRP0_9CLOT/118-324----------------------SDGVY------------------------KT--GIYVKD-------------------
R7L6Y3_9CLOT/231-443----------------------TGEDY------------------------KL--GLWVRD-------------------
R6BNR4_9CLOT/112-320----------------------ENNIY------------------------KT--GLYVKD-------------------
Q9K975_BACHD/210-423----------------------GESTF------------------------RM--GLYIRD-------------------
D4KCM7_9FIRM/190-395----------------------QNAQW------------------------RA--GMWVRD-------------------
R5QDI6_9FIRM/143-350----------------------SEGEY------------------------KL--GMWIKD-------------------
B1I568_DESAP/210-421----------------------.TGRY------------------------RV--GLLVRD-------------------
R5NSK8_9FIRM/197-408----------------------GNNEY------------------------KI--GIWVRD-------------------
R6ZZF6_9FIRM/206-414----------------------KDGSN------------------------KL--GIWVRE-------------------
R6L493_9FIRM/188-398----------------------MQGSY------------------------KL--GIWVRD-------------------
A8MFI3_ALKOO/211-423----------------------EDGQY------------------------RL--GLWVRD-------------------
Q8RAC0_THETN/202-413----------------------EDKQY------------------------RI--GLWVRD-------------------
R6G9J9_9FIRM/189-399----------------------EDGSY------------------------KL--GIWVRD-------------------
R5HAQ1_9FIRM/143-351----------------------TDGAY------------------------KL--GAWIRD-------------------
K4LFQ1_THEPS/205-416----------------------.TRRY------------------------RI--GLLVRD-------------------
W6RY93_9CLOT/147-358----------------------.DNNY------------------------KL--GLWIRD-------------------
R5UHP5_9FIRM/210-422----------------------EHKGY------------------------RL--GLWVKD-------------------
R7G2H0_9FIRM/141-351----------------------.KNNC------------------------ML--GIWVRD-------------------
R6WHU5_9CLOT/129-336----------------------KNGER------------------------RF--GVNVRD-------------------
R6S308_9FIRM/140-351----------------------EDGTK------------------------KL--GIWVRD-------------------
R5B250_9CLOT/199-410----------------------.DGEV------------------------LL--GAWVRE-------------------
R5SFB7_9FIRM/135-345----------------------QDGVC------------------------RL--GAWIRD-------------------
R6GC90_9FIRM/148-359----------------------KNKCY------------------------QI--GVWIRN-------------------
D9R8M8_CLOSW/212-423----------------------EDGTY------------------------KL--GVWVRD-------------------
R5RQY0_9FIRM/119-326----------------------ENQQF------------------------ST--GLYVKD-------------------
R5LJL6_9MOLU/116-322----------------------SDGVL------------------------KT--GLYVKD-------------------
R7AQT1_9BACE/223-435----------------------TKGEY------------------------KT--GIWVKD-------------------
X4ZLT8_9BACL/97-309----------------------NDNVW------------------------RL--GLFIRD-------------------
F8I8Y9_SULAT/218-427----------------------HDKRW------------------------AV--GLKLQD-------------------
R6MC60_9CLOT/120-327----------------------EGDIY------------------------KT--GLYVKD-------------------
R6TCX6_9FIRM/133-340----------------------DDGRY------------------------QA--GLWLRD-------------------
R6R1J4_9FIRM/210-418----------------------ADGAY------------------------KL--GIWIRD-------------------
R6YL37_9CLOT/137-348----------------------KQGKY------------------------KI--GLWVRD-------------------
R5XPM6_9FIRM/188-398----------------------AGGEY------------------------KL--GIWVRD-------------------
A0Q0A9_CLONN/185-397----------------------TKNAY------------------------KI--GLWVRD-------------------
D4LPR1_9FIRM/188-397----------------------EKGKY------------------------KL--GIWVRD-------------------
R7DAB6_9FIRM/188-398----------------------IKGEY------------------------KL--GIWVRD-------------------
C0ZC15_BREBN/212-424----------------------KDSEY------------------------RM--GLYIRD-------------------
R6QE36_9FIRM/192-401----------------------EDNAN------------------------KI--GVWVRD-------------------
R5K6N9_9CLOT/165-374----------------------NKNAY------------------------ML--GLWVKD-------------------
R6ZCY0_9FIRM/219-430----------------------KNGEY------------------------KM--GIWVRD-------------------
R5HLI4_9MOLU/113-318----------------------DNNTY------------------------KT--GIYVKD-------------------
R6NKY3_9CLOT/192-404----------------------SSNEY------------------------KL--GLWVRD-------------------
R5JXE7_9FIRM/154-361----------------------SESSY------------------------KL--GLWIKD-------------------
R5AF90_9FIRM/131-337----------------------TAQTY------------------------QI--GAWIRD-------------------
R5TU24_9FIRM/138-348----------------------.PDEY------------------------KL--GIWVRD-------------------
R6P0Q8_9CLOT/192-399----------------------.GISY------------------------KA--GLWVRD-------------------
R6DUC4_9FIRM/125-334----------------------NNGVW------------------------QL--GAWIRD-------------------
R7F4Z6_9CLOT/190-402----------------------NDNEY------------------------KL--GLWVRD-------------------
R6X4M8_9FIRM/134-340----------------------ADGEY------------------------RA--GLWIKD-------------------
R6EKK3_9FIRM/141-352----------------------TSGEY------------------------KI--GLWVKE-------------------
Q5WF67_BACSK/196-410----------------------GDHLY------------------------RL--GLYIRD-------------------
R7JU02_9FIRM/195-406----------------------QDGTC------------------------RL--GAWVRD-------------------
G4KYV3_OSCVS/183-394----------------------GDGKY------------------------AI--GAWIRD-------------------
Q3AAN6_CARHZ/161-371----------------------EEKRW------------------------RI--GVFIRD-------------------
R5VSI3_9CLOT/188-396----------------------EDGTY------------------------KI--GTWVRE-------------------
R7MHL3_9FIRM/191-401----------------------SKKGY------------------------FA--GMWVRD-------------------
R6RU79_9FIRM/209-417----------------------EDDSY------------------------KL--GIWVRD-------------------
R6Q618_9FIRM/187-394----------------------AQGCY------------------------KV--GLWVRD-------------------
R7K1G6_9CLOT/229-438----------------------QNGTY------------------------QI--GAWLRE-------------------
L0K691_HALHC/214-426----------------------QDGYY------------------------MI--GLYVDD-------------------
R5FFJ0_9FIRM/179-381----------------------.....------------------------TL--GLRVKE-------------------
R7G6U2_9FIRM/123-330----------------------.SNSY------------------------KT--GLYVKD-------------------
R5G573_9FIRM/136-341----------------------LKGEC------------------------SL--GLYVKD-------------------
K0IY14_AMPXN/201-413----------------------KTDSY------------------------KI--GLYIRD-------------------
R6USZ2_9FIRM/119-327----------------------STRSF------------------------KS--GLYVKD-------------------
R6PFE8_9FIRM/188-396----------------------QNDEY------------------------KL--GLWVRD-------------------
F0T085_SYNGF/157-367----------------------.TNRN------------------------RI--GLFIRD-------------------
R7HK64_9FIRM/121-328----------------------EDNVY------------------------KT--GLYVKD-------------------
R6AWH8_9CLOT/114-319----------------------DGDNY------------------------RT--GLYVKD-------------------
R6FWG8_9CLOT/174-386----------------------EDNEY------------------------KI--GLWVRD-------------------
R4KDG0_CLOPA/189-401----------------------VDNGY------------------------KL--GLWVRD-------------------
R5QW36_9FIRM/143-354----------------------ETGEY------------------------RL--GIWVRD-------------------
R6CRQ2_9CLOT/223-434----------------------TAGEY------------------------KI--GIWVRD-------------------
R7KGU6_9CLOT/123-329----------------------SESVC------------------------KT--GLYVKD-------------------
R6U8G2_9CLOT/143-350----------------------VSETY------------------------KL--EMWVKD-------------------
R5A3A4_9CLOT/111-319----------------------EDNLL------------------------KT--GLYVKD-------------------
R5J0Y5_9FIRM/119-326----------------------ENNIY------------------------KT--GLYVKD-------------------
D4MXQ8_9FIRM/196-401----------------------TDHMY------------------------KI--GTWIRD-------------------
Q8EQ48_OCEIH/174-386----------------------KEKQF------------------------KI--GLYIRD-------------------
R5YPZ4_9MOLU/72-278----------------------SNNVY------------------------KT--GLYVKD-------------------
SP4B_BACSU/201-413----------------------GEGKY------------------------RI--GLYIRD-------------------

PF03761

Q9U2W2_CAEEL/6-282IGVLVFIGIVNCLISSQKLTVKENEERLKSCGNTFLPIPSINQTGKGFGFFND--KTYTYN-------------------
Q21628_CAEEL/5-298SLTYIFVIINIGLVVGLNFTDAEVANLRASCKNKTLPPNNQQNG.....HTGV--SLHGQN-------------------
O45371_CAEEL/3-276FLTLFIWIIACGFNNTQPLSYEENIQRLESCG.KILPEES...........SN--SITKSK-------------------
O76649_CAEEL/2-297NIGILISLLFLGFSSSRIIGEKENQVLQSYCG.RTPFLQRRI.........IN--GKPLEA-------------------
A8XIB1_CAEBR/15-285ILIGIFSILIGSSEPFRKLSPDENQSRLKSCGNFKLPQHSQD.........AN--GVIITK-------------------
A8WNY9_CAEBR/3-296LLHLLPLVVFVVGVGAGKISEQENEQTQLICGKKADGYSRKV.........IN--GEYVKK-------------------
Q9XWZ8_CAEEL/4-272QSIITISTFIIIVVSYNELTAEENDKRLETCGNEHIGKPSKN...........--...SII-------------------
O62223_CAEEL/7-278IIFYFIFVIAIIPIVTEKLSLKENKERLNTCG..................KDK--DIYNGI-------------------
O62231_CAEEL/5-272VIVIFFALTGCIGCDFYKLTADENKDRASTCGKEVLERKG...........NE--TTPANV-------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y083_MYCPN/328-467--------------------------------------------------------------------------------
Y084_MYCPN/296-431--------------------------------------------------------------------------------
Y592_MYCPN/334-455--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
POLG_YEFV1/1503-1655--------------------------------------------------------------------------------
POLG_DEN1W/1493-1642--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844----------------------GPDME------------------------FA--KSIMRS-------------------
POLG_HRV8A/1522-1687----------------------GPEEE------------------------FG--RSLLKH-------------------
Q66776_ERBV1/1905-2095----------------------STGLT------------------------VN--SLSLLN-------------------
POLG_HPE2W/1517-1692----------------------APYDG------------------------QL--EHIISQ-------------------
POLG_POL1M/1566-1731----------------------GPGFD------------------------YA--VAMAKR-------------------
Q9DLK1_FMDVP/1643-1826----------------------.PPTD------------------------L.--QKMVMG-------------------

PF13365

B0EDS2_ENTDS/219-353---------------------------------------------------GSCCGIKH..-------------------
A9VAG6_MONBE/28-203---------------------------------------------------GL..G.FY..-------------------
B9S6M7_RICCO/99-269---------------------------------------------------GS..G.TV..-------------------
C2FHG0_LACPA/165-321---------------------------------------------------GT..G.FS..-------------------
A9FFZ4_SORC5/137-265---------------------------------------------------GD..G.....-------------------
D0N1Z1_PHYIT/130-271---------------------------------------------------GM..G.VF..-------------------
A1VVN7_POLNA/138-318---------------------------------------------------GT..G.FL..-------------------
D4LWF1_9FIRM/167-311---------------------------------------------------EE..GFVF..-------------------
C6JD09_9FIRM/146-290---------------------------------------------------TE..GLVF..-------------------
C0CMS9_9FIRM/152-296---------------------------------------------------AM..G.II..-------------------
C4ZI06_EUBR3/149-289---------------------------------------------------GV..G.VI..-------------------
C0FTN1_9FIRM/149-293---------------------------------------------------GS..G.II..-------------------
C9L519_BLAHA/148-292---------------------------------------------------IS..G.LL..-------------------
C0B801_9FIRM/151-295---------------------------------------------------VS..GVIF..-------------------
B0G1M9_9FIRM/149-293---------------------------------------------------IS..G.MI..-------------------
B0NI56_CLOSV/167-311---------------------------------------------------TA..G.LI..-------------------
A7B169_RUMGN/176-320---------------------------------------------------CT..G.LI..-------------------
A5KN66_9FIRM/147-291---------------------------------------------------VT..G.VI..-------------------
B6FP33_9CLOT/144-288---------------------------------------------------VS..G.VI..-------------------
D4M0U9_9FIRM/159-303---------------------------------------------------VS..G.VI..-------------------
B5CQ59_9FIRM/147-291---------------------------------------------------VS..G.VI..-------------------
C5ELW4_9FIRM/172-316---------------------------------------------------FS..G.II..-------------------
B7AVI8_9FIRM/172-316---------------------------------------------------VS..GVIF..-------------------
D4N037_9FIRM/379-516---------------------------------------------------GT..G.FL..-------------------
B8AM75_ORYSI/89-258---------------------------------------------------AS..G.FI..-------------------
C5WUT2_SORBI/32-182---------------------------------------------------GN..G.FV..-------------------
Q1GZ24_METFK/25-167---------------------------------------------------GT..G.FF..-------------------
A8TSL0_9PROT/61-191---------------------------------------------------GS..G.IV..-------------------
Q126C2_POLSJ/74-216---------------------------------------------------GS..G.VV..-------------------
A2SEV1_METPP/84-217---------------------------------------------------GS..G.VV..-------------------
D3NU60_AZOS1/54-191---------------------------------------------------GS..G.IV..-------------------
B0T7U9_CAUSK/55-188---------------------------------------------------GN..G.VV..-------------------
A9VXT6_METEP/54-187---------------------------------------------------GN..G.VV..-------------------
B9JA65_AGRRK/33-164---------------------------------------------------GS..G.VV..-------------------
D5SQ02_PLAL2/103-278---------------------------------------------------AS..G.IL..-------------------
A0L9W3_MAGSM/126-265---------------------------------------------------GS..G.VL..-------------------
C5JBN6_9BACT/99-238---------------------------------------------------GS..G.AL..-------------------
C4RAG7_9PROT/100-239---------------------------------------------------AT..G.AL..-------------------
C5JAK2_9BACT/101-240---------------------------------------------------AS..GAIV..-------------------
Q75HK9_ORYSJ/40-213---------------------------------------------------GT..G.FC..-------------------
B7FUE8_PHATC/1283-1490---------------------------------------------------GS..G.FI..-------------------
A8KF66_BURPE/83-236---------------------------------------------------GS..GFVF..-------------------
B6B9E4_9RHOB/398-528---------------------------------------------------RS..G.FF..-------------------
D0D6Q7_9RHOB/389-519---------------------------------------------------VS..G.FF..-------------------
A9F8J5_SORC5/19-173---------------------------------------------------GT..G.FL..-------------------
B8H010_CAUCN/64-248---------------------------------------------------GT..G.WV..-------------------
Q00YL5_OSTTA/68-221---------------------------------------------------RS..G.FV..-------------------
Q1PY07_9BACT/57-189---------------------------------------------------GG..G.FI..-------------------
D2R6U2_PIRSD/68-213---------------------------------------------------AS..G.II..-------------------
Q7UNU5_RHOBA/96-240---------------------------------------------------QS..G.FL..-------------------
A4A0T0_9PLAN/66-211---------------------------------------------------QS..G.FV..-------------------
D5SYB2_PLAL2/75-226---------------------------------------------------NT..G.FL..-------------------
A6C5I0_9PLAN/58-206---------------------------------------------------ST..G.FL..-------------------
B4V7A8_9ACTO/24-181---------------------------------------------------GS..G.YR..-------------------
C3QH30_9BACE/51-184---------------------------------------------------GS..G.FF..-------------------
D5ST85_PLAL2/188-324---------------------------------------------------AT..A.WV..-------------------
B8EPM5_METSB/283-415---------------------------------------------------GM..G.FS..-------------------
A6CCJ8_9PLAN/216-356---------------------------------------------------GS..G.TVIH-------------------
A3ZSU8_9PLAN/169-309---------------------------------------------------GT..G.TIVH-------------------
Q7URA6_RHOBA/240-384---------------------------------------------------GT..G.TI..-------------------
D2R0U2_PIRSD/218-358---------------------------------------------------GT..G.TI..-------------------
D1CC35_THET1/99-237---------------------------------------------------GN..G.VV..-------------------
A4S513_OSTLU/76-226---------------------------------------------------GS..G.VV..-------------------
A4S4E4_OSTLU/26-173---------------------------------------------------GS..G.VV..-------------------
Q3IXI9_RHOS4/47-206---------------------------------------------------GA..G.MV..-------------------
Q08MN7_STIAD/50-171---------------------------------------------------GP..G.VI..-------------------
Q7UNU4_RHOBA/89-223---------------------------------------------------TS..G.VV..-------------------
B8BSP4_THAPS/582-769---------------------------------------------------GS..G.FV..-------------------
A9F4P7_SORC5/37-166---------------------------------------------------TT..G.WV..-------------------
Q67SY9_SYMTH/37-178---------------------------------------------------GT..G.VI..-------------------
Q1IY94_DEIGD/67-198---------------------------------------------------GG..G.PVSG-------------------
A4A0S9_9PLAN/71-202---------------------------------------------------CS..A.LV..-------------------
D5SYB3_PLAL2/92-222---------------------------------------------------TT..G.VI..-------------------
D2R6U3_PIRSD/90-221---------------------------------------------------TT..G.LI..-------------------
C8N8L7_9GAMM/65-197---------------------------------------------------GS..G.FV..-------------------
Q21G29_SACD2/103-235---------------------------------------------------GS..G.FY..-------------------
Q08Q29_STIAD/85-219---------------------------------------------------GS..A.FF..-------------------
A4YVG9_BRASO/68-206---------------------------------------------------GS..G.FL..-------------------
A2SCU5_METPP/86-236---------------------------------------------------GS..G.FF..-------------------
B4WI21_9SYNE/33-173---------------------------------------------------GT..G.IH..-------------------
Q0RIR2_FRAAA/55-221---------------------------------------------------GS..G.IV..-------------------
A2SLK2_METPP/110-244---------------------------------------------------GA..G.FV..-------------------
D1CHW8_THET1/35-167---------------------------------------------------GS..G.II..-------------------
A7NIM6_ROSCS/38-173---------------------------------------------------GT..G.VV..-------------------
B2IZX6_NOSP7/35-159---------------------------------------------------GS..G.VI..-------------------
Q01SP4_SOLUE/26-150---------------------------------------------------GS..G.IV..-------------------
Q98IG3_RHILO/78-212---------------------------------------------------AS..A.FH..-------------------
B0U7I8_METS4/36-169---------------------------------------------------AS..G.FV..-------------------
Q89E13_BRADU/35-167---------------------------------------------------AT..G.FV..-------------------
A7H8S6_ANADF/35-169---------------------------------------------------AS..G.VA..-------------------
B4UF27_ANASK/45-180---------------------------------------------------AS..G.VV..-------------------
Q1DFJ7_MYXXD/51-186---------------------------------------------------TT..G.IV..-------------------
Q3M8K4_ANAVT/33-168---------------------------------------------------SS..G.IH..-------------------
D1CHW7_THET1/37-171---------------------------------------------------AS..G.IV..-------------------
D1C9X4_SPHTD/41-176---------------------------------------------------AT..G.II..-------------------
D5WKU5_BURSC/40-175---------------------------------------------------SS..G.VI..-------------------
Q7NEY6_GLOVI/37-172---------------------------------------------------PS..G.VL..-------------------
Q01SP5_SOLUE/107-240---------------------------------------------------SS..G.VF..-------------------
C4Z416_EUBE2/141-284---------------------------------------------------VA..G.LV..-------------------
B9FMK5_ORYSJ/181-321---------------------------------------------------RT..G.FV..-------------------
Q7EYD8_ORYSJ/206-349---------------------------------------------------CT..G.VV..-------------------
Q6ATB3_ORYSJ/64-208---------------------------------------------------FS..G.IV..-------------------
C5Y9X9_SORBI/128-269---------------------------------------------------CT..G.IF..-------------------
C5XIJ1_SORBI/75-220---------------------------------------------------CS..G.IA..-------------------
B9G3S8_ORYSJ/109-256---------------------------------------------------CT..GTIM..-------------------
C5WUT6_SORBI/430-572---------------------------------------------------CT..G.IF..-------------------
C5YNZ0_SORBI/297-442---------------------------------------------------CT..G.FF..-------------------
C5YX14_SORBI/284-426---------------------------------------------------CT..G.FF..-------------------
Q0JIU9_ORYSJ/149-291---------------------------------------------------CT..G.FF..-------------------
D3W785_9VIRU/161-295---------------------------------------------------GA..GCRV..-------------------
Q82G14_STRAW/89-242---------------------------------------------------GN..H.FCTA-------------------
C7QED1_CATAD/56-225---------------------------------------------------CSASL.VRYP-------------------
C9Z823_STRSW/62-228---------------------------------------------------CS..GSII..-------------------
C9ZGQ1_STRSW/72-240---------------------------------------------------CS..GSVVRM-------------------
Q93JK9_STRCO/54-222---------------------------------------------------CS..GSVVRL-------------------
B8AXY3_ORYSI/1277-1457---------------------------------------------------GYATC.FV..-------------------
D2QDD9_SPILD/31-236---------------------------------------------------GTATL.FF..-------------------
C5Y9N3_SORBI/149-346---------------------------------------------------AT..G.FV..-------------------
Q92JT1_RHIME/45-189---------------------------------------------------GS..G.VV..-------------------
B0C7H5_ACAM1/63-201---------------------------------------------------GS..G.TL..-------------------
Q15T30_PSEA6/50-191---------------------------------------------------GF..A.WV..-------------------
A5E551_LODEL/303-457---------------------------------------------------GS..T.IL..-------------------
A3LV17_PICST/282-443---------------------------------------------------GT..C.IY..-------------------
Q6BLK4_DEBHA/295-454---------------------------------------------------GS..C.VY..-------------------
A5DCA5_PICGU/274-427---------------------------------------------------GT..C.TY..-------------------
D0N2P9_PHYIT/200-360---------------------------------------------------CT..G.WL..-------------------
Q846R2_MYXXA/58-225---------------------------------------------------CT..G.WL..-------------------
D3QBE9_STANL/212-368---------------------------------------------------CT..A.FR..-------------------
D3PTY7_STANL/202-361---------------------------------------------------CT..A.WR..-------------------
A0CQA0_PARTE/272-415---------------------------------------------------GS..G.IL..-------------------
A3WZP2_9BRAD/25-182---------------------------------------------------GT..A.FT..-------------------
B5JQS5_9BACT/61-197---------------------------------------------------LS..G.FY..-------------------
A1DKZ3_NEOFI/106-274---------------------------------------------------GT..A.VC..-------------------
C9SS84_VERA1/110-286---------------------------------------------------GT..A.IC..-------------------
B2ACI3_PODAN/114-282---------------------------------------------------GT..A.VC..-------------------
B1XYW2_LEPCP/349-527---------------------------------------------------GT..G.FL..-------------------
C0DWH2_EIKCO/92-250---------------------------------------------------GS..G.YL..-------------------
C1N754_MICPC/393-574---------------------------------------------------AS..GIVL..-------------------
C1EFA7_MICSR/414-629---------------------------------------------------AS..GVVIGV-------------------
C0PL31_MAIZE/403-612---------------------------------------------------AS..G.IV..-------------------
A9TAV2_PHYPA/699-919---------------------------------------------------AS..G.VI..-------------------
DEG15_ARATH/376-594---------------------------------------------------AS..G.II..-------------------
Q0PY37_SOLLC/412-632---------------------------------------------------AS..G.VL..-------------------
B9H2S3_POPTR/409-631---------------------------------------------------AS..G.VL..-------------------
A5BEH1_VITVI/502-717---------------------------------------------------AS..G.VV..-------------------
A8I3D5_CHLRE/134-313---------------------------------------------------GS..G.IV..-------------------
C1N5V8_MICPC/175-398---------------------------------------------------GV..G.VL..-------------------
D3LKZ9_MICLU/283-419---------------------------------------------------GS..G.VA..-------------------
D2S688_GEOOG/217-353---------------------------------------------------GS..G.FV..-------------------
D3QA66_STANL/219-357---------------------------------------------------GS..S.FV..-------------------
B4V9A1_9ACTO/51-211---------------------------------------------------GS..G.FF..-------------------
Q10YA2_TRIEI/28-156---------------------------------------------------GT..G.FW..-------------------
B4W048_9CYAN/24-160---------------------------------------------------GT..G.FF..-------------------
B7KID8_CYAP7/23-153---------------------------------------------------GT..G.FF..-------------------
B1ZW96_OPITP/85-238---------------------------------------------------GS..G.VV..-------------------
C4RBC6_9ACTO/39-187---------------------------------------------------GT..G.FL..-------------------
C6AVQ8_RHILS/33-192---------------------------------------------------GS..A.FH..-------------------
C1MYV6_MICPC/213-422---------------------------------------------------GS..G.VH..-------------------
B6BL05_SULGG/72-191---------------------------------------------------GS..A.VI..-------------------
D2QY05_PIRSD/202-373---------------------------------------------------GS..S.VV..-------------------
A4YLF4_BRASO/29-179---------------------------------------------------GS..G.VQ..-------------------
Q08Z65_STIAD/79-228---------------------------------------------------AS..G.VV..-------------------
Q2II41_ANADE/64-213---------------------------------------------------AS..G.IA..-------------------
B3S5U4_TRIAD/329-491---------------------------------------------------GS..G.VV..-------------------
A0LWM1_ACIC1/250-384---------------------------------------------------GT..A.FALA-------------------
B4D4S9_9BACT/50-179---------------------------------------------------GS..G.FV..-------------------
B4CWZ7_9BACT/330-461---------------------------------------------------GN..G.FI..-------------------
B4D163_9BACT/76-206---------------------------------------------------GS..G.FI..-------------------
B4CWZ6_9BACT/327-458---------------------------------------------------GS..G.FLC.-------------------
Q2YD45_NITMU/56-221---------------------------------------------------GS..G.VA..-------------------
B4UTS4_BP163/66-193---------------------------------------------------GT..G.FH..-------------------
D5UDV9_CELFN/76-207---------------------------------------------------GS..G.FA..-------------------
Q11LS4_CHESB/40-170---------------------------------------------------GS..G.VH..-------------------
C6XD83_METGS/47-175---------------------------------------------------GS..G.VI..-------------------
C6WVZ4_METML/47-174---------------------------------------------------GS..G.VV..-------------------
B6BVZ4_9PROT/47-175---------------------------------------------------GS..G.VV..-------------------
B6BWJ8_9PROT/54-182---------------------------------------------------GS..G.VV..-------------------
B9TJ43_RICCO/62-190---------------------------------------------------GS..G.VV..-------------------
C6WXC4_METML/54-182---------------------------------------------------GS..G.VV..-------------------
B9TFS6_RICCO/49-177---------------------------------------------------GS..G.VV..-------------------
C6XBL7_METGS/51-179---------------------------------------------------GS..G.VV..-------------------
A9ZKZ5_COXBE/58-186---------------------------------------------------GS..A.IA..-------------------
A2SLB0_METPP/51-178---------------------------------------------------GS..G.VI..-------------------
C7RR92_ACCPU/56-182---------------------------------------------------LS..A.VT..-------------------
C7RR91_ACCPU/52-180---------------------------------------------------GS..G.VV..-------------------
Q2W2I3_MAGSA/355-483---------------------------------------------------GS..A.VA..-------------------
C6BGJ0_RALP1/55-184---------------------------------------------------GS..A.VV..-------------------
Q3B4M2_PELLD/76-203---------------------------------------------------GS..G.VV..-------------------
B3QPC6_CHLP8/57-184---------------------------------------------------GS..G.VV..-------------------
Q0YS38_9CHLB/89-216---------------------------------------------------GS..G.IV..-------------------
D1W141_9BACT/221-392---------------------------------------------------GS..G.YTCT-------------------
C9BDM8_ENTFC/121-272---------------------------------------------------GT..A.WM..-------------------
A3XNG0_LEEBM/39-192---------------------------------------------------ST..G.FF..-------------------
C7PQR9_CHIPD/410-553---------------------------------------------------GT..A.FH..-------------------
A3SCU7_9RHOB/196-330---------------------------------------------------GT..A.FF..-------------------
D2R620_PIRSD/144-326---------------------------------------------------GT..G.FI..-------------------
Q211I3_RHOPB/126-305---------------------------------------------------GT..G.WI..-------------------
C7PQU4_CHIPD/127-299---------------------------------------------------GT..G.WM..-------------------
A3JWZ9_9RHOB/120-292---------------------------------------------------GT..G.WL..-------------------
A6LC71_PARD8/50-181---------------------------------------------------GT..G.FF..-------------------
A5ZI03_9BACE/49-181---------------------------------------------------GN..G.FF..-------------------
B5CVV9_BACPM/52-183---------------------------------------------------GN..G.FY..-------------------
C3Y9V9_BRAFL/396-567---------------------------------------------------GS..G.FL..-------------------
C3Y7C8_BRAFL/939-1107---------------------------------------------------GT..G.FL..-------------------
C3YHU1_BRAFL/637-805---------------------------------------------------GT..G.FL..-------------------
B9G3S5_ORYSJ/55-216---------------------------------------------------GT..G.YI..-------------------
B3EEJ2_CHLL2/96-337---------------------------------------------------GT..G.FL..-------------------
Q1D137_MYXXD/39-183---------------------------------------------------GT..G.FL..-------------------
B5HRW8_9ACTO/52-200---------------------------------------------------GA..G.FL..-------------------
B8M3P5_TALSN/58-198---------------------------------------------------AS..A.FL..-------------------
NM111_PICGU/100-246---------------------------------------------------AT..G.FV..-------------------
D0MZM5_PHYIT/91-230---------------------------------------------------AT..G.FV..-------------------
YH05_SCHPO/99-245---------------------------------------------------AT..G.FV..-------------------
C1EGI7_MICSR/60-206---------------------------------------------------AT..G.FV..-------------------
A9RQ61_PHYPA/48-194---------------------------------------------------AT..G.FV..-------------------
B9IN99_POPTR/46-189---------------------------------------------------GS..G.VI..-------------------
A9AU45_BURM1/75-243---------------------------------------------------GT..G.FF..-------------------
Q10V37_TRIEI/25-170---------------------------------------------------GT..GFAF..-------------------
B6SLW3_MAIZE/46-198---------------------------------------------------GT..S.FA..-------------------
B9YD37_9FIRM/27-200---------------------------------------------------GT..G.FFVV-------------------
B8BM04_ORYSI/29-174---------------------------------------------------GT..G.FI..-------------------
B4CXG1_9BACT/84-257---------------------------------------------------AS..G.FF..-------------------
D1W398_9BACT/21-163---------------------------------------------------GT..A.FF..-------------------
A6L245_BACV8/25-170---------------------------------------------------GT..A.FY..-------------------
I8UI46_PORGN/27-170---------------------------------------------------GT..A.FF..-------------------
Q7Q9T3_ANOGA/284-425---------------------------------------------------GT..G.CA..-------------------
B3NQY9_DROER/305-445---------------------------------------------------GT..GTFI..-------------------
F111B_HUMAN/475-664---------------------------------------------------AT..C.FV..-------------------
D4A8N0_RAT/367-556---------------------------------------------------AT..C.FV..-------------------
B3DXV6_METI4/79-214---------------------------------------------------CS..G.FF..-------------------
B4VL88_9CYAN/23-161---------------------------------------------------GT..G.FF..-------------------
A8ZQB3_ACAM1/33-191---------------------------------------------------GT..G.FY..-------------------
B0JTN4_MICAN/27-184---------------------------------------------------GA..G.FL..-------------------
B8HMX0_CYAP4/25-181---------------------------------------------------GA..G.FL..-------------------
Q9Z529_STRCO/60-203---------------------------------------------------GT..G.FL..-------------------
A8YNP5_MICAE/435-587---------------------------------------------------GT..G.YV..-------------------
A7BUM9_9GAMM/28-164---------------------------------------------------GT..G.FF..-------------------
A8FZT0_SHESH/365-519---------------------------------------------------GT..G.FV..-------------------
A8TZT7_9PROT/75-215---------------------------------------------------GT..A.FP..-------------------
C6XKV2_HIRBI/68-210---------------------------------------------------GT..A.FS..-------------------
B0T391_CAUSK/70-212---------------------------------------------------GT..A.FS..-------------------
Q0C5Y2_HYPNA/27-169---------------------------------------------------GT..A.FA..-------------------
B4D8F4_9BACT/72-317---------------------------------------------------GT..G.FV..-------------------
D2R618_PIRSD/120-277---------------------------------------------------GS..G.FL..-------------------
Q1DE46_MYXXD/139-306---------------------------------------------------GT..G.FL..-------------------
B8ICT9_METNO/161-326---------------------------------------------------GT..G.FL..-------------------
B4VV96_9CYAN/140-327---------------------------------------------------GT..G.FL..-------------------
B3PHV0_CELJU/204-337---------------------------------------------------GT..G.FY..-------------------
B4VT06_9CYAN/299-436---------------------------------------------------GT..G.VL..-------------------
Q2P9Y4_9ACTO/162-308---------------------------------------------------GT..A.FR..-------------------
D4GHS4_PANAM/109-260---------------------------------------------------GS..G.FL..-------------------
A3VZZ0_9RHOB/114-264---------------------------------------------------GS..G.FA..-------------------
A9ERE8_SORC5/153-297---------------------------------------------------GT..G.FL..-------------------
B2J8D1_NOSP7/164-308---------------------------------------------------GT..G.FL..-------------------
B6R9Y4_9RHOB/91-243---------------------------------------------------GS..G.FL..-------------------
C6X4V5_FLAB3/104-266---------------------------------------------------GT..G.FL..-------------------
B6QXD8_9RHOB/76-232---------------------------------------------------GT..G.FL..-------------------
Y4FB_RHISN/90-251---------------------------------------------------GT..G.FL..-------------------
A9GTT3_SORC5/149-297---------------------------------------------------GT..G.FL..-------------------
B8END1_METSB/102-257---------------------------------------------------AT..G.FL..-------------------
D3CTM8_9ACTO/100-254---------------------------------------------------GT..G.FL..-------------------
Q467S2_METBF/103-254---------------------------------------------------GT..G.FL..-------------------
C3HBL0_BACTU/109-260---------------------------------------------------GT..G.FL..-------------------
D2BAE5_STRRD/123-274---------------------------------------------------GT..G.FL..-------------------
D2R623_PIRSD/145-303---------------------------------------------------GT..G.SM..-------------------
G2TE04_RHORU/145-306---------------------------------------------------GT..G.FL..-------------------
Q9RTZ8_DEIRA/130-275---------------------------------------------------GT..G.WL..-------------------
D0LEN3_GORB4/141-289---------------------------------------------------GT..G.FL..-------------------
E3IWP0_FRASU/134-282---------------------------------------------------GT..G.SL..-------------------
A1WX57_HALHL/64-228---------------------------------------------------GT..G.FV..-------------------
Q3SMJ5_THIDA/81-243---------------------------------------------------GT..GFAV..-------------------
Q15WK4_PSEA6/58-219---------------------------------------------------GS..G.FV..-------------------
A4BT63_9GAMM/57-219---------------------------------------------------GT..G.FA..-------------------
A4A524_9GAMM/61-225---------------------------------------------------GT..G.FV..-------------------
B4VWK9_9CYAN/26-185---------------------------------------------------GS..G.FI..-------------------
D0LGQ1_HALO1/668-816---------------------------------------------------GS..G.VI..-------------------
Q0AUX9_SYNWW/105-235---------------------------------------------------GT..G.IN..-------------------
B9M1H9_GEODF/322-480---------------------------------------------------GS..G.FL..-------------------
D3PR00_MEIRD/62-196---------------------------------------------------GS..G.FF..-------------------
Q72KS5_THET2/61-193---------------------------------------------------GT..G.FF..-------------------
B7A6E3_THEAQ/62-195---------------------------------------------------GT..G.FF..-------------------
D3FST1_BACPE/122-248---------------------------------------------------GT..G.FI..-------------------
C0GIE8_9FIRM/109-240---------------------------------------------------GT..G.FN..-------------------
A6CKL8_9BACI/105-229---------------------------------------------------GT..G.FN..-------------------
Q1D8L6_MYXXD/88-220---------------------------------------------------CT..G.TL..-------------------
B0CAU9_ACAM1/85-242---------------------------------------------------GT..A.FV..-------------------
D3B2A3_POLPA/90-296---------------------------------------------------GT..G.FC..-------------------
D2R1J4_PIRSD/67-236---------------------------------------------------GT..A.FL..-------------------
E0U9M4_CYAP2/69-211---------------------------------------------------QS..G.IL..-------------------
B7KH20_CYAP7/52-196---------------------------------------------------QS..G.VL..-------------------
B2XS89_9VIRU/586-711---------------------------------------------------GV..G.FR..-------------------
D2Q0V1_KRIFD/123-243---------------------------------------------------AT..G.VL..-------------------
B3QZR5_PHYMT/297-472---------------------------------------------------GS..GIIFKY-------------------
NS1A_OASV1/438-558---------------------------------------------------GT..C.FR..-------------------
Q84SQ1_ORYSJ/91-253---------------------------------------------------GS..G.FI..-------------------
NS1AB_HASV1/447-565---------------------------------------------------GT..G.FF..-------------------
A8YFS3_MICAE/52-220---------------------------------------------------GT..GAIVQK-------------------
B8HSI3_CYAP4/55-201---------------------------------------------------GT..G.VI..-------------------
Q4C9U0_CROWT/64-213---------------------------------------------------SS..G.VI..-------------------
B7KEX9_CYAP7/49-192---------------------------------------------------GT..G.FF..-------------------
Q11A08_TRIEI/47-187---------------------------------------------------GT..GFFV..-------------------
Q111L2_TRIEI/52-195---------------------------------------------------GT..G.FF..-------------------
B4VKH5_9CYAN/399-535---------------------------------------------------GS..G.VI..-------------------
A0YM55_LYNSP/62-208---------------------------------------------------GS..G.VI..-------------------
Q113N3_TRIEI/93-237---------------------------------------------------GS..G.VI..-------------------
B0C4I5_ACAM1/51-195---------------------------------------------------GS..G.VL..-------------------
Q060L2_9SYNE/66-212---------------------------------------------------GS..G.VI..-------------------
A2CDP2_PROM3/91-233---------------------------------------------------GS..G.VL..-------------------
B0C7H5_ACAM1/295-465---------------------------------------------------GS..G.VI..-------------------
A0ZIJ6_NODSP/50-187---------------------------------------------------GS..G.VI..-------------------
B5W7L6_ARTMA/53-196---------------------------------------------------GS..G.VI..-------------------
B0JV48_MICAN/59-215---------------------------------------------------GS..G.SI..-------------------

PF01732

A5IYK2_MYCAP/279-649VNQKVW...............................................................VDEFVES....
D9QW46_MYCMG/258-617INVKQW...............................................................VIDQDEK....
Q2SR25_MYCCT/264-622INVKQW...............................................................VIERDEK....
D3VQF5_MYCA6/359-733IGTVEF...............................................................RRDP.......
Q4A635_MYCS5/147-497FNYSTQ..........................................................................
Q4A5A2_MYCS5/91-491VGMPNP...............................................................QA.........
C7LM95_MYCML/189-571FLTKLN...............................................................NG.........
A5IYA1_MYCAP/186-569YLTKLS...............................................................NG.........
Q4A798_MYCH7/125-523FGITLA...............................................................KG.........
Q4A5G2_MYCS5/337-740YGFNEY...............................................................DPK........
D3FFM3_MYCGH/244-661PGTFTS...............................................................DN.........
C5J6P1_MYCCR/115-482FNSIDR...............................................................T..........
D3FH76_MYCGH/221-623FYTRYT...............................................................RKN........
D3FHN8_MYCGH/203-712FFNHNS...............................................................ELE........
D3FHQ1_MYCGH/203-710FSNFNE...............................................................EMA........
Q4A5P6_MYCS5/166-643YVNEIK...............................................................GDYVNEVKG..
D1J8A8_MYCHP/334-723FLTPIE...............................................................GE.........
B1RXG0_UREUR/379-750SLTLKD...............................................................GK.........
A0A024FAH6_UREPR/376-752ILNNDS...............................................................HK.........
B1AI32_UREP2/413-786IQTPNG...............................................................KP.........
D9QXV8_MYCMG/283-769FTAHKDYAAEIEEAEDNIKLFESWDDKQIENYIDIQLKQLKLNFEDESGQIDKQIATTNRENTGIIDNLQKQKNELESKY
C7LKT8_MYCML/288-775FKGWKDYAQEIAEAEYYIKLFEKWTDEQIKQYIARQLWQLEQNLKYDLNLVEKDIATTRPDLTGVIAEHNKKKARIQSEF
Q98Q64_MYCPU/350-715VFNPKK...............................................................NA.........
Q98QS3_MYCPU/339-702FTSKKV..........................................................................
D3FJ19_MYCGF/216-600YSNILS...............................................................DPVKSRESEKL
D3FHK1_MYCGH/204-545ITNELS...............................................................DSPIKQDNSN.
Q4A7B5_MYCH7/323-738IVNGDF...............................................................LK.........
Q98PH9_MYCPU/101-415IPVVGA...............................................................ID.........
Q8EWB5_MYCPE/130-442FIRGKG...............................................................MG.........
Q8EW95_MYCPE/145-484FHNGTE...............................................................TI.........
Y068_MYCGE/48-383FASNKR...............................................................N..........
H0PPR7_MYCPM/45-410FATSSK...............................................................D..........
M1GCC9_MYCPM/75-444FTNKSN...............................................................D..........
J3UDP5_MYCGT/89-428FTSFSN...............................................................D..........
M1GHC3_MYCPM/104-443FGTSWK...............................................................E..........
Y083_MYCPN/52-447FVNNQA...............................................................Q..........
M1GE88_MYCPM/44-388FFNRIE...............................................................K..........
Q4A8M7_MYCH7/557-908IKFSQK...............................................................TESKNIIADFG
Q8EWN7_MYCPE/57-397FELKNK...............................................................STNKAVY....
B1RXU5_UREUR/59-344FTIPLN...............................................................NN.........

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q76VQ5_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF00944

POLS_SFV/112-268--------------------------------------------------------------------------------
POLS_SINDV/107-265--------------------------------------------------------------------------------

PF10459

A1SA55_SHEAM/18-726IPAEQL------------------------------------ADLSRYP..MNAVVG.LGYCTASFVSPQGLAVTNHHCA
E0THX8_PARBH/23-721LDPAAL------------------------------------TDLTGFP..MGAVIS.LGGCTASFVSDEGLVVTNHHCA
F2GAE2_ALTMD/22-719IPASSI------------------------------------NNLTAFP..MGAIVS.LGGCSASFVSDKGLAVTNHHCA
A5FMW8_FLAJ1/19-712LTAEEI------------------------------------YSINHHS.LKDAIVQFNGGCTAEIVSKEGLVLTNHHCG
A6GWM2_FLAPJ/17-707ISADDI------------------------------------YSVNHSS.LKDAVPHFNGGCTSEVISPKGLILTNHHCG
A6KZW8_BACV8/17-706LSSEQL------------------------------------YNPGGKA.LANAVVSFGGFCSGVVVSPDGLVFTNHHCG
A6L2J7_BACV8/19-726ISIDKV------------------------------------YCPDSIS.LKDAVVHFGGGCTGEIISAEGLVLTNHHCG
A6L2J8_BACV8/21-719LEADDI------------------------------------YNPNRVS.LKDAVGIFGGGCTGEIISPDGLILTNHHCG
A6LID5_PARD8/19-717LSDQEV------------------------------------YSAEAPS.LKDAVVRFGGGCTGEMISPDGLVLTNHHCG
A7HA06_ANADF/20-725GDARQF------------------------------------ADLTGQP..MGAIVS.LGGCSASFVSPDGLVATNHHCV
A7HFU9_ANADF/37-699PSDAWL------------------------------------ENARLSS......ARLAGGCSASFVSEDGLVMTNHHCA
Q024G1_SOLUE/22-694LPVSRL------------------------------------WDPARGTGLLAATIS.TGGCSAGFVTSTGLFLTNHHCL
Q029T1_SOLUE/24-727GDAKAF------------------------------------ADLSGQP..MGAIVS.LGGCTASFVSPDGLIVTNHHCV
Q07XT1_SHEFN/18-727IPASQL------------------------------------ADLGQYP..MNAVVS.LGYCTASFVSPQGLVVTNHHCA
Q08VC9_STIAD/18-714LPPQRL------------------------------------WDPKRGTGLLAGTVN.VGGCSGAFISSSGLVITNHHCV
Q11SC7_CYTH3/21-702ITPEQI------------------------------------YSVNNSS.LKDAVVNFGNFCTGEIISQDGLILTNHHCG
Q12RW4_SHEDO/18-728IPAKQL------------------------------------ADLSQYP..MNAVVS.LGYCTASFVSPQGLVVTNHHCA
Q1D5W7_MYXXD/35-700PSQQWL------------------------------------DNVRLSS......ARLAGGCSASFVSANGLVMTNHHCA
Q1D9F6_MYXXD/17-714VSPKKL------------------------------------WDPKRGTGLLAGAVN.VGGCSGAFIAASGLVITNHHCA
Q1DDZ2_MYXXD/18-682PTQAWL------------------------------------DHVRLGS......VRLAGGCSASFVSPEGLVMTNHHCI
Q1GVV7_SPHAL/23-684PDQKWL------------------------------------DHTRAAA......VRLTGGCSASFVSNEGLILTNHHCV
Q1IPC2_KORVE/27-692ITQEWL------------------------------------DHLRLSS......SR.APGGSSEFVSPDGLLMTNHHVA
Q2G546_NOVAD/56-713PDGRWL------------------------------------DRVQAAA......VRLTGGCSASFVSPDGLILTNHHCV
Q2IEV3_ANADE/18-687PSRAWL------------------------------------DRARLAS......ARLARGCSASFVSDGGLVMTNHHCV
Q2S133_SALRD/5-639VDSAWA------------------------------------AHLRRSV......LR.LPGCTGALVSADGLALTTARCV
Q2S134_SALRD/69-734PDDEWR------------------------------------TKARRGA......LRFGSGCSASFVSSRGLVMTNHHCA
Q488S2_COLP3/26-729LNPNDL------------------------------------TDLTGFP..MGAIVS.LGGCTASFVSDQGLVATNHHCV
Q5LIW7_BACFN/34-723MPADQL------------------------------------YSTRHPS.LKDAVVSFGGFCSGVVVSEDGLVFTNHHCG
Q5QV86_IDILO/17-717IDPNDI------------------------------------SKLTEFP..AAAIVS.LGGCSASFVSPEGLVATNHHCA
Q7MV25_PORGI/21-718MKEYDL------------------------------------YNPNGTS.LKDAVVLFDGGCTGEVVSDRGLVLTNHHCG
Q7MWU6_PORGI/24-711LPLDSL------------------------------------YSFDKPS.IANAVVIFGGGCTGITVSDQGLIFTNHHCG
Q7NHA9_GLOVI/34-698PDAAWL------------------------------------ERVRLAS......LRLAGGCSGSFVSPNGLVMTNHHCA
Q7UKL5_RHOBA/28-688PSEEWL------------------------------------KHLQLSS......VRFNSGGSGSFVSSNGLVLTNHHVA
Q8A2L6_BACTN/20-711MPVNKL------------------------------------YNPKKPA.LANAVVSFGGFCSGVVVSEDGLVFTNHHCG
B2FQN5_STRMK/22-717LSPEQL------------------------------------SNLTGDP..MGAVVA.LGGCTASFVSPQGLVVTNHHCA
E3FSI6_STIAD/18-681PTAQWL------------------------------------DKVRLSS......ARIAGGCSASFVSANGLVMTNHHCT
Q5LB16_BACFN/20-719IPIEEV------------------------------------YNPDGIA.LKDAVVHFGGGCTGEIISAEGLVLTNHHCG
Q8EAI4_SHEON/18-728IPADKL------------------------------------ADLTSYP..MNAVVG.LGYCTASFVSPQGLVVTNHHCA
Q8EHX9_SHEON/18-716IDAKSI------------------------------------SKLTEFP..MNAVIS.LGGCTASFVSPKGLVVTNHHCA
Q9PC94_XYLFA/22-713LSPEQL------------------------------------SNLTGDP..MGAVVS.LGNCTASLVSPEGLVITNHHCA
R5U6M0_9BACE/21-717LEAQDL------------------------------------YNPNGVS.LKDAVGIFGGGCTGEIISPEGLILTNHHCG
R6WQY4_9PORP/22-710PSYEQL------------------------------------YSETDPC.VANAVVIFGGGCSGITVSNEGLIFTNHHCG
R6Y7C6_9PORP/19-717LQDYDI------------------------------------YSPDSAS.LKDAVVIFGGGCTGEIVSPEGLLLTNHHCG
R7EE18_9BACE/20-708MSVNKL------------------------------------YNTKRPS.LKDAVVSFGGFCSGVVVSGDGLVFTNHHCG
R7EGG9_9BACE/23-719LEADDL------------------------------------YNPNGVS.LKDAVGIFGGGCTGEIISPEGLILTNHHCG

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF05409

R1A_CVH22/2994-3281YDHEYS--------------------------------------------------------------------------
R1A_IBVB/2808-3096WNDVLN--------------------------------------------------------------------------
B6VDX7_THCOV/2516-2804WQHIAS--------------------------------------------------------------------------
R1AB_FIPV/2932-3219YENELS--------------------------------------------------------------------------
R1A_CVHSA/3269-3559YEDLLI--------------------------------------------------------------------------
R1A_CVMA5/3362-3648YPNLLC--------------------------------------------------------------------------

PF09342

Q7QJ48_ANOGA/1774-1887--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1523-1637--------------------------------------------------------------------------------
NUDEL_DROME/2041-2158--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569--------------------------------------------------------------------------------
SP24D_ANOGA/50-264--------------------------------------------------------------------------------
TRY5_AEDAE/40-260--------------------------------------------------------------------------------
A0A024QZM9_HUMAN/179-419--------------------------------------------------------------------------------
MASP1_MOUSE/454-696--------------------------------------------------------------------------------
CTR1_ANOGA/33-250--------------------------------------------------------------------------------
CFAD_HUMAN/26-248--------------------------------------------------------------------------------
ACRO_RAT/43-286--------------------------------------------------------------------------------
HPT_HUMAN/162-399--------------------------------------------------------------------------------
CASP_MESAU/445-682--------------------------------------------------------------------------------
A8JQZ2_DROME/186-427--------------------------------------------------------------------------------
PCE_TACTR/128-370--------------------------------------------------------------------------------
STUB_DROME/544-782--------------------------------------------------------------------------------
TRYU_DROME/28-254--------------------------------------------------------------------------------
TRYI_DROME/28-245--------------------------------------------------------------------------------
TRYB_MANSE/25-252--------------------------------------------------------------------------------
TRYP_FUSOX/25-244--------------------------------------------------------------------------------
B1VV86_STRGG/37-252--------------------------------------------------------------------------------
TRY1_HUMAN/24-239--------------------------------------------------------------------------------
TRYP_PIG/9-224--------------------------------------------------------------------------------
TRY1_SALSA/21-235--------------------------------------------------------------------------------
TRYP_PLEPL/23-242--------------------------------------------------------------------------------
DEGP3_ARATH/99-287--------------------------------------------------------------------------------
DEGP2_ARATH/121-308--------------------------------------------------------------------------------
A0A017I371_ECOLX/62-244--------------------------------------------------------------------------------
DEGS_HAEIN/37-240--------------------------------------------------------------------------------
J7JYL9_BACIU/99-283--------------------------------------------------------------------------------
A0A017R133_SALET/97-278--------------------------------------------------------------------------------
Q44596_BRUAO/85-261--------------------------------------------------------------------------------
A0A024EQG8_BRUCA/125-298--------------------------------------------------------------------------------
O06439_RHOCA/59-235--------------------------------------------------------------------------------
F7UK65_SYNYG/95-274--------------------------------------------------------------------------------
M1LZP5_9SYNC/156-334--------------------------------------------------------------------------------
O42417_CHICK/87-286--------------------------------------------------------------------------------
A0A028WZQ9_STAAU/70-274--------------------------------------------------------------------------------
ETB_STAAU/59-251--------------------------------------------------------------------------------
A0A008AS15_STAAU/37-234--------------------------------------------------------------------------------
A0A008ARX4_STAAU/38-233--------------------------------------------------------------------------------
J7JN12_BACIU/95-311--------------------------------------------------------------------------------
PRTC_STRGR/205-383--------------------------------------------------------------------------------
Q55353_STRSQ/198-372--------------------------------------------------------------------------------
Q55352_STRSQ/202-378--------------------------------------------------------------------------------
Q54395_STRLI/158-342--------------------------------------------------------------------------------
SP1_RARFA/205-391--------------------------------------------------------------------------------
CERC_SCHMA/28-256--------------------------------------------------------------------------------
Q54344_STRLI/47-254--------------------------------------------------------------------------------
CFAB_HUMAN/481-752--------------------------------------------------------------------------------
PROZ_BOVIN/143-352--------------------------------------------------------------------------------
CAC3_BOVIN/12-246--------------------------------------------------------------------------------
CELA1_PIG/27-259--------------------------------------------------------------------------------
CTRA_BOVIN/16-238--------------------------------------------------------------------------------
CTRL_HALRU/24-251--------------------------------------------------------------------------------
COGS_HYPLI/31-252--------------------------------------------------------------------------------
CTRB1_LITVA/46-263--------------------------------------------------------------------------------
CATG_MOUSE/21-238--------------------------------------------------------------------------------
MCPT2_RAT/21-239--------------------------------------------------------------------------------
ELNE_HUMAN/30-242--------------------------------------------------------------------------------
PRTN3_HUMAN/28-243--------------------------------------------------------------------------------
GRAK_RAT/26-248--------------------------------------------------------------------------------
GRAM_RAT/21-245--------------------------------------------------------------------------------
KLK1_MOUSE/25-253--------------------------------------------------------------------------------
KLK2_RAT/25-251--------------------------------------------------------------------------------
VSPCA_AGKCO/1-217--------------------------------------------------------------------------------
HGF_RAT/496-719--------------------------------------------------------------------------------
ENTK_PIG/800-1029--------------------------------------------------------------------------------
PRSS8_HUMAN/45-281--------------------------------------------------------------------------------
HGFA_HUMAN/408-641--------------------------------------------------------------------------------
TPA_HUMAN/311-556--------------------------------------------------------------------------------
H2Q7T9_PANTR/235-462--------------------------------------------------------------------------------
THRB_BOVIN/367-616--------------------------------------------------------------------------------
PROC_HUMAN/212-445--------------------------------------------------------------------------------

PF12380

Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF00863

POLG_SPMMV/2424-2646--------------------------------------------------------------------------------
POLG_RGMVD/1998-2230--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782VGDQYI-------------------------------------VSVAHNG.GYNDVDFGAEGRNPD...........QHR
IGA0_HAEIN/17-865INPQYV-------------------------------------VGVKHVSNGVSELHFGNLNGNMNNGNAKSHRDVSSEE
Q5F9W2_NEIG1/19-848VDPQYA-------------------------------------VSVKHAKAEVHTFYYGQYNGHNDV.........ADKE

PF05578

POLG_BVDVN/1680-1890APVRFP-------------------------------------TSLLKVRRGLET-------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMV0/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268--------------------------------------------------------------------------------
Q9YQ23_VESV/628-1162--------------------------------------------------------------------------------
Q80J95_9CALI/650-1163--------------------------------------------------------------------------------
Q8JJL0_9CALI/645-1175--------------------------------------------------------------------------------
Q80RD7_9CALI/641-1177--------------------------------------------------------------------------------

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF05580

B2A522_NATTJ/220-429--------------------------------------------------------------------------------
R6EU85_9FIRM/238-449--------------------------------------------------------------------------------
R5R857_9FIRM/207-436--------------------------------------------------------------------------------
D5DLD9_BACMD/199-411--------------------------------------------------------------------------------
R5E7E8_9CLOT/152-361--------------------------------------------------------------------------------
H6NL93_9BACL/215-426--------------------------------------------------------------------------------
D9QRU2_ACEAZ/225-437--------------------------------------------------------------------------------
R5C627_9FIRM/188-399--------------------------------------------------------------------------------
R7M5P2_9CLOT/113-319--------------------------------------------------------------------------------
R5H148_9FIRM/296-509--------------------------------------------------------------------------------
R6AIL9_9CLOT/309-520--------------------------------------------------------------------------------
R7FQ12_9CLOT/118-324--------------------------------------------------------------------------------
F6DU87_DESRL/208-419--------------------------------------------------------------------------------
R6R0T0_9FIRM/202-413--------------------------------------------------------------------------------
D4J425_9FIRM/143-352--------------------------------------------------------------------------------
R5YSC4_9FIRM/171-381--------------------------------------------------------------------------------
R5J4I1_9FIRM/116-322--------------------------------------------------------------------------------
R6Y3R6_9FIRM/105-308--------------------------------------------------------------------------------
I4D8U8_DESAJ/207-417--------------------------------------------------------------------------------
R5A2Q9_9CLOT/166-372--------------------------------------------------------------------------------
A4XKP9_CALS8/197-406--------------------------------------------------------------------------------
R7HFV6_9MOLU/114-315--------------------------------------------------------------------------------
R5MBH1_9MOLU/114-320--------------------------------------------------------------------------------
B0TEK3_HELMI/213-425--------------------------------------------------------------------------------
R7K6P1_9FIRM/157-363--------------------------------------------------------------------------------
R6WI32_9FIRM/142-352--------------------------------------------------------------------------------
C4ZCY0_EUBR3/231-444--------------------------------------------------------------------------------
R7FE29_9FIRM/73-281--------------------------------------------------------------------------------
R7KE68_9FIRM/124-327--------------------------------------------------------------------------------
Q8XJE5_CLOPE/169-381--------------------------------------------------------------------------------
D4LFB6_RUMC1/186-392--------------------------------------------------------------------------------
R6RRV8_9FIRM/196-402--------------------------------------------------------------------------------
R7B468_9CLOT/223-433--------------------------------------------------------------------------------
G7M128_9CLOT/178-390--------------------------------------------------------------------------------
U5S0W6_9CLOT/58-269--------------------------------------------------------------------------------
R5KFR6_9CLOT/194-405--------------------------------------------------------------------------------
R7QW48_9FIRM/195-406--------------------------------------------------------------------------------
R6BUQ9_9FIRM/200-411--------------------------------------------------------------------------------
R7MCE1_9CLOT/112-319--------------------------------------------------------------------------------
A5D302_PELTS/202-414--------------------------------------------------------------------------------
E6UBW1_RUMA7/185-391--------------------------------------------------------------------------------
R5PM12_9CLOT/191-403--------------------------------------------------------------------------------
R5CZB6_9FIRM/131-339--------------------------------------------------------------------------------
R6SMI2_9CLOT/136-344--------------------------------------------------------------------------------
A4J3G7_DESRM/208-419--------------------------------------------------------------------------------
E6U2J4_ETHHY/187-393--------------------------------------------------------------------------------
R5SUE4_9CLOT/120-327--------------------------------------------------------------------------------
R6XJ65_9FIRM/122-326--------------------------------------------------------------------------------
R6QNQ2_9CLOT/190-396--------------------------------------------------------------------------------
R6KNJ0_9CLOT/213-424--------------------------------------------------------------------------------
R6T3R8_9FIRM/186-393--------------------------------------------------------------------------------
R7HTV5_9CLOT/212-419--------------------------------------------------------------------------------
R5VVX1_9FIRM/189-398--------------------------------------------------------------------------------
R5TNP7_9FIRM/195-404--------------------------------------------------------------------------------
Q18B75_PEPD6/136-351--------------------------------------------------------------------------------
G2T3Q8_ROSHA/201-410--------------------------------------------------------------------------------
R6GHR5_9CLOT/188-396--------------------------------------------------------------------------------
E6TXR0_BACCJ/199-411--------------------------------------------------------------------------------
R6KEA9_9FIRM/205-413--------------------------------------------------------------------------------
R7IWD1_9CLOT/190-401--------------------------------------------------------------------------------
R5VVV3_9DELT/151-357--------------------------------------------------------------------------------
R6I8W6_9FIRM/179-383--------------------------------------------------------------------------------
R7GGP8_9CLOT/115-317--------------------------------------------------------------------------------
R5J7S8_9CLOT/120-326--------------------------------------------------------------------------------
R6FK23_9FIRM/136-347--------------------------------------------------------------------------------
R7P923_9CLOT/113-319--------------------------------------------------------------------------------
R5KUR7_9CLOT/195-402--------------------------------------------------------------------------------
I3VWM7_THESW/212-422--------------------------------------------------------------------------------
R6B2V6_9CLOT/191-403--------------------------------------------------------------------------------
R7DMS2_9FIRM/121-329--------------------------------------------------------------------------------
R5KNW9_9FIRM/195-404--------------------------------------------------------------------------------
R7NI61_9MOLU/99-305--------------------------------------------------------------------------------
F2JMG1_CELLD/211-424--------------------------------------------------------------------------------
K4L254_9FIRM/156-367--------------------------------------------------------------------------------
R6GNM4_9FIRM/129-330--------------------------------------------------------------------------------
R6Q3J2_9FIRM/196-400--------------------------------------------------------------------------------
R6N1E9_9FIRM/116-321--------------------------------------------------------------------------------
R5SZK8_9CLOT/118-324--------------------------------------------------------------------------------
R5YCX5_9FIRM/208-421--------------------------------------------------------------------------------
D5HI76_9FIRM/160-369--------------------------------------------------------------------------------
E3E859_PAEPS/137-349--------------------------------------------------------------------------------
R7C759_9CLOT/197-406--------------------------------------------------------------------------------
W0E9D2_9FIRM/202-413--------------------------------------------------------------------------------
Q894H5_CLOTE/184-395--------------------------------------------------------------------------------
C9R866_AMMDK/202-413--------------------------------------------------------------------------------
R7HB69_9FIRM/196-404--------------------------------------------------------------------------------
A6TR47_ALKMQ/210-422--------------------------------------------------------------------------------
R7ESB8_9FIRM/148-356--------------------------------------------------------------------------------
R6PKG4_9CLOT/140-351--------------------------------------------------------------------------------
R7M6Q4_9CLOT/187-399--------------------------------------------------------------------------------
Q0AZD6_SYNWW/215-424--------------------------------------------------------------------------------
R7N4W4_9FIRM/231-442--------------------------------------------------------------------------------
R6YA95_9FIRM/168-374--------------------------------------------------------------------------------
D5WV97_KYRT2/201-413--------------------------------------------------------------------------------
R5LXL5_9FIRM/206-416--------------------------------------------------------------------------------
R5DF89_9FIRM/133-343--------------------------------------------------------------------------------
R6TFF4_9STAP/121-325--------------------------------------------------------------------------------
A5I2Z7_CLOBH/188-400--------------------------------------------------------------------------------
R6H4Q6_9CLOT/91-303--------------------------------------------------------------------------------
R6R368_9FIRM/120-325--------------------------------------------------------------------------------
A3DDL9_CLOTH/218-430--------------------------------------------------------------------------------
D3E6N1_GEOS4/214-426--------------------------------------------------------------------------------
F9VK25_ARTSS/179-388--------------------------------------------------------------------------------
R5QQG0_9FIRM/118-320--------------------------------------------------------------------------------
G8LW28_CLOCD/213-425--------------------------------------------------------------------------------
R7L0T4_9FIRM/126-334--------------------------------------------------------------------------------
L7VQQ3_CLOSH/209-420--------------------------------------------------------------------------------
C8WXF9_ALIAD/189-397--------------------------------------------------------------------------------
Q2RIC4_MOOTA/202-411--------------------------------------------------------------------------------
R4KQW9_9FIRM/232-442--------------------------------------------------------------------------------
A9KMA5_CLOPH/225-441--------------------------------------------------------------------------------
E6SKR3_THEM7/211-421--------------------------------------------------------------------------------
L0F7L5_DESDL/200-410--------------------------------------------------------------------------------
I0JNU1_HALH3/188-400--------------------------------------------------------------------------------
R7EZR7_9BACI/117-324--------------------------------------------------------------------------------
R6J055_9CLOT/186-394--------------------------------------------------------------------------------
R5NUG0_9CLOT/148-357--------------------------------------------------------------------------------
G2TKW2_BACCO/200-411--------------------------------------------------------------------------------
R5N690_9FIRM/193-400--------------------------------------------------------------------------------
R5VHC6_9FIRM/114-320--------------------------------------------------------------------------------
R5NBK1_9CLOT/138-351--------------------------------------------------------------------------------
R5XPM2_9FIRM/140-351--------------------------------------------------------------------------------
D5X7G9_THEPJ/213-424--------------------------------------------------------------------------------
F4A1F9_MAHA5/214-428--------------------------------------------------------------------------------
R7ITE0_9FIRM/151-366--------------------------------------------------------------------------------
F6CL40_DESK7/195-404--------------------------------------------------------------------------------
L0EG06_THECK/213-424--------------------------------------------------------------------------------
R5IDG3_9CLOT/213-423--------------------------------------------------------------------------------
R6CTL1_9CLOT/118-325--------------------------------------------------------------------------------
K0B195_CLOA9/212-423--------------------------------------------------------------------------------
B8D2I8_HALOH/210-421--------------------------------------------------------------------------------
R6NNU0_9FIRM/213-424--------------------------------------------------------------------------------
R6VE05_9FIRM/188-399--------------------------------------------------------------------------------
R6CN52_9FIRM/193-397--------------------------------------------------------------------------------
R5H2U4_9FIRM/159-365--------------------------------------------------------------------------------
R5V409_9FIRM/40-247--------------------------------------------------------------------------------
R6GW98_9FIRM/110-315--------------------------------------------------------------------------------
R7ICH4_9FIRM/200-411--------------------------------------------------------------------------------
R7BI76_9FIRM/223-434--------------------------------------------------------------------------------
C4Z0G6_EUBE2/202-409--------------------------------------------------------------------------------
R6NHB7_9CLOT/186-391--------------------------------------------------------------------------------
R7R973_9FIRM/207-417--------------------------------------------------------------------------------
R5HM74_9FIRM/192-403--------------------------------------------------------------------------------
R6NAF9_9FIRM/129-336--------------------------------------------------------------------------------
D9SLV5_CLOC7/150-362--------------------------------------------------------------------------------
R5RSY4_9FIRM/189-400--------------------------------------------------------------------------------
R6HAH9_9FIRM/113-319--------------------------------------------------------------------------------
R5XRH8_9CLOT/128-335--------------------------------------------------------------------------------
R7FZ38_9FIRM/122-328--------------------------------------------------------------------------------
R5I6P6_9FIRM/188-403--------------------------------------------------------------------------------
B8I3A0_CLOCE/214-425--------------------------------------------------------------------------------
R6DXQ1_9FIRM/186-391--------------------------------------------------------------------------------
R5E160_9FIRM/209-416--------------------------------------------------------------------------------
Q97HE0_CLOAB/178-390--------------------------------------------------------------------------------
R6M2Z6_9CLOT/204-415--------------------------------------------------------------------------------
D6DLB6_CLOSC/284-503--------------------------------------------------------------------------------
R6RY05_9CLOT/213-424--------------------------------------------------------------------------------
F4LV06_TEPAE/231-437--------------------------------------------------------------------------------
R6UED3_9CLOT/180-388--------------------------------------------------------------------------------
R5AES8_9CLOT/40-251--------------------------------------------------------------------------------
B2TRL9_CLOBB/178-390--------------------------------------------------------------------------------
R5D6V9_9FIRM/120-320--------------------------------------------------------------------------------
D7CKI9_SYNLT/217-427--------------------------------------------------------------------------------
R5TH80_9CLOT/131-336--------------------------------------------------------------------------------
R5MT91_9FIRM/109-314--------------------------------------------------------------------------------
R6YLB5_9CLOT/116-322--------------------------------------------------------------------------------
R6MJ71_9FIRM/140-351--------------------------------------------------------------------------------
D4M5K6_9FIRM/147-358--------------------------------------------------------------------------------
D9S3S9_THEOJ/212-423--------------------------------------------------------------------------------
F6B9N5_DESCC/208-419--------------------------------------------------------------------------------
R6TLY4_9FIRM/135-345--------------------------------------------------------------------------------
R5ZMQ1_9CLOT/197-409--------------------------------------------------------------------------------
Q67NC5_SYMTH/205-417--------------------------------------------------------------------------------
R6TRP0_9CLOT/118-324--------------------------------------------------------------------------------
R7L6Y3_9CLOT/231-443--------------------------------------------------------------------------------
R6BNR4_9CLOT/112-320--------------------------------------------------------------------------------
Q9K975_BACHD/210-423--------------------------------------------------------------------------------
D4KCM7_9FIRM/190-395--------------------------------------------------------------------------------
R5QDI6_9FIRM/143-350--------------------------------------------------------------------------------
B1I568_DESAP/210-421--------------------------------------------------------------------------------
R5NSK8_9FIRM/197-408--------------------------------------------------------------------------------
R6ZZF6_9FIRM/206-414--------------------------------------------------------------------------------
R6L493_9FIRM/188-398--------------------------------------------------------------------------------
A8MFI3_ALKOO/211-423--------------------------------------------------------------------------------
Q8RAC0_THETN/202-413--------------------------------------------------------------------------------
R6G9J9_9FIRM/189-399--------------------------------------------------------------------------------
R5HAQ1_9FIRM/143-351--------------------------------------------------------------------------------
K4LFQ1_THEPS/205-416--------------------------------------------------------------------------------
W6RY93_9CLOT/147-358--------------------------------------------------------------------------------
R5UHP5_9FIRM/210-422--------------------------------------------------------------------------------
R7G2H0_9FIRM/141-351--------------------------------------------------------------------------------
R6WHU5_9CLOT/129-336--------------------------------------------------------------------------------
R6S308_9FIRM/140-351--------------------------------------------------------------------------------
R5B250_9CLOT/199-410--------------------------------------------------------------------------------
R5SFB7_9FIRM/135-345--------------------------------------------------------------------------------
R6GC90_9FIRM/148-359--------------------------------------------------------------------------------
D9R8M8_CLOSW/212-423--------------------------------------------------------------------------------
R5RQY0_9FIRM/119-326--------------------------------------------------------------------------------
R5LJL6_9MOLU/116-322--------------------------------------------------------------------------------
R7AQT1_9BACE/223-435--------------------------------------------------------------------------------
X4ZLT8_9BACL/97-309--------------------------------------------------------------------------------
F8I8Y9_SULAT/218-427--------------------------------------------------------------------------------
R6MC60_9CLOT/120-327--------------------------------------------------------------------------------
R6TCX6_9FIRM/133-340--------------------------------------------------------------------------------
R6R1J4_9FIRM/210-418--------------------------------------------------------------------------------
R6YL37_9CLOT/137-348--------------------------------------------------------------------------------
R5XPM6_9FIRM/188-398--------------------------------------------------------------------------------
A0Q0A9_CLONN/185-397--------------------------------------------------------------------------------
D4LPR1_9FIRM/188-397--------------------------------------------------------------------------------
R7DAB6_9FIRM/188-398--------------------------------------------------------------------------------
C0ZC15_BREBN/212-424--------------------------------------------------------------------------------
R6QE36_9FIRM/192-401--------------------------------------------------------------------------------
R5K6N9_9CLOT/165-374--------------------------------------------------------------------------------
R6ZCY0_9FIRM/219-430--------------------------------------------------------------------------------
R5HLI4_9MOLU/113-318--------------------------------------------------------------------------------
R6NKY3_9CLOT/192-404--------------------------------------------------------------------------------
R5JXE7_9FIRM/154-361--------------------------------------------------------------------------------
R5AF90_9FIRM/131-337--------------------------------------------------------------------------------
R5TU24_9FIRM/138-348--------------------------------------------------------------------------------
R6P0Q8_9CLOT/192-399--------------------------------------------------------------------------------
R6DUC4_9FIRM/125-334--------------------------------------------------------------------------------
R7F4Z6_9CLOT/190-402--------------------------------------------------------------------------------
R6X4M8_9FIRM/134-340--------------------------------------------------------------------------------
R6EKK3_9FIRM/141-352--------------------------------------------------------------------------------
Q5WF67_BACSK/196-410--------------------------------------------------------------------------------
R7JU02_9FIRM/195-406--------------------------------------------------------------------------------
G4KYV3_OSCVS/183-394--------------------------------------------------------------------------------
Q3AAN6_CARHZ/161-371--------------------------------------------------------------------------------
R5VSI3_9CLOT/188-396--------------------------------------------------------------------------------
R7MHL3_9FIRM/191-401--------------------------------------------------------------------------------
R6RU79_9FIRM/209-417--------------------------------------------------------------------------------
R6Q618_9FIRM/187-394--------------------------------------------------------------------------------
R7K1G6_9CLOT/229-438--------------------------------------------------------------------------------
L0K691_HALHC/214-426--------------------------------------------------------------------------------
R5FFJ0_9FIRM/179-381--------------------------------------------------------------------------------
R7G6U2_9FIRM/123-330--------------------------------------------------------------------------------
R5G573_9FIRM/136-341--------------------------------------------------------------------------------
K0IY14_AMPXN/201-413--------------------------------------------------------------------------------
R6USZ2_9FIRM/119-327--------------------------------------------------------------------------------
R6PFE8_9FIRM/188-396--------------------------------------------------------------------------------
F0T085_SYNGF/157-367--------------------------------------------------------------------------------
R7HK64_9FIRM/121-328--------------------------------------------------------------------------------
R6AWH8_9CLOT/114-319--------------------------------------------------------------------------------
R6FWG8_9CLOT/174-386--------------------------------------------------------------------------------
R4KDG0_CLOPA/189-401--------------------------------------------------------------------------------
R5QW36_9FIRM/143-354--------------------------------------------------------------------------------
R6CRQ2_9CLOT/223-434--------------------------------------------------------------------------------
R7KGU6_9CLOT/123-329--------------------------------------------------------------------------------
R6U8G2_9CLOT/143-350--------------------------------------------------------------------------------
R5A3A4_9CLOT/111-319--------------------------------------------------------------------------------
R5J0Y5_9FIRM/119-326--------------------------------------------------------------------------------
D4MXQ8_9FIRM/196-401--------------------------------------------------------------------------------
Q8EQ48_OCEIH/174-386--------------------------------------------------------------------------------
R5YPZ4_9MOLU/72-278--------------------------------------------------------------------------------
SP4B_BACSU/201-413--------------------------------------------------------------------------------

PF03761

Q9U2W2_CAEEL/6-282--------------------------------------------------------------------------------
Q21628_CAEEL/5-298--------------------------------------------------------------------------------
O45371_CAEEL/3-276--------------------------------------------------------------------------------
O76649_CAEEL/2-297--------------------------------------------------------------------------------
A8XIB1_CAEBR/15-285--------------------------------------------------------------------------------
A8WNY9_CAEBR/3-296--------------------------------------------------------------------------------
Q9XWZ8_CAEEL/4-272--------------------------------------------------------------------------------
O62223_CAEEL/7-278--------------------------------------------------------------------------------
O62231_CAEEL/5-272--------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y083_MYCPN/328-467--------------------------------------------------------------------------------
Y084_MYCPN/296-431--------------------------------------------------------------------------------
Y592_MYCPN/334-455--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
POLG_YEFV1/1503-1655--------------------------------------------------------------------------------
POLG_DEN1W/1493-1642--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
POLG_POL1M/1566-1731--------------------------------------------------------------------------------
Q9DLK1_FMDVP/1643-1826--------------------------------------------------------------------------------

PF13365

B0EDS2_ENTDS/219-353--------------------------------------------------------------------------------
A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
C2FHG0_LACPA/165-321--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C6JD09_9FIRM/146-290--------------------------------------------------------------------------------
C0CMS9_9FIRM/152-296--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
C0FTN1_9FIRM/149-293--------------------------------------------------------------------------------
C9L519_BLAHA/148-292--------------------------------------------------------------------------------
C0B801_9FIRM/151-295--------------------------------------------------------------------------------
B0G1M9_9FIRM/149-293--------------------------------------------------------------------------------
B0NI56_CLOSV/167-311--------------------------------------------------------------------------------
A7B169_RUMGN/176-320--------------------------------------------------------------------------------
A5KN66_9FIRM/147-291--------------------------------------------------------------------------------
B6FP33_9CLOT/144-288--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
B5CQ59_9FIRM/147-291--------------------------------------------------------------------------------
C5ELW4_9FIRM/172-316--------------------------------------------------------------------------------
B7AVI8_9FIRM/172-316--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
B8AM75_ORYSI/89-258--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
A8TSL0_9PROT/61-191--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
D3NU60_AZOS1/54-191--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
A9VXT6_METEP/54-187--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
A0L9W3_MAGSM/126-265--------------------------------------------------------------------------------
C5JBN6_9BACT/99-238--------------------------------------------------------------------------------
C4RAG7_9PROT/100-239--------------------------------------------------------------------------------
C5JAK2_9BACT/101-240--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
A8KF66_BURPE/83-236--------------------------------------------------------------------------------
B6B9E4_9RHOB/398-528--------------------------------------------------------------------------------
D0D6Q7_9RHOB/389-519--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
B8H010_CAUCN/64-248--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
Q1PY07_9BACT/57-189--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
A4A0T0_9PLAN/66-211--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
A6C5I0_9PLAN/58-206--------------------------------------------------------------------------------
B4V7A8_9ACTO/24-181--------------------------------------------------------------------------------
C3QH30_9BACE/51-184--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
A6CCJ8_9PLAN/216-356--------------------------------------------------------------------------------
A3ZSU8_9PLAN/169-309--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
A4A0S9_9PLAN/71-202--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
C8N8L7_9GAMM/65-197--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
B4WI21_9SYNE/33-173--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
A7NIM6_ROSCS/38-173--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRADU/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
B4UF27_ANASK/45-180--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
Q3M8K4_ANAVT/33-168--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
D5WKU5_BURSC/40-175--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
B9FMK5_ORYSJ/181-321--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
B9G3S8_ORYSJ/109-256--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
D3W785_9VIRU/161-295--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
B8AXY3_ORYSI/1277-1457--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
Q846R2_MYXXA/58-225--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
A3WZP2_9BRAD/25-182--------------------------------------------------------------------------------
B5JQS5_9BACT/61-197--------------------------------------------------------------------------------
A1DKZ3_NEOFI/106-274--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C0DWH2_EIKCO/92-250--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
DEG15_ARATH/376-594--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A5BEH1_VITVI/502-717--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
D3LKZ9_MICLU/283-419--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
B4V9A1_9ACTO/51-211--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
B4W048_9CYAN/24-160--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
C4RBC6_9ACTO/39-187--------------------------------------------------------------------------------
C6AVQ8_RHILS/33-192--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
B6BL05_SULGG/72-191--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
B4D4S9_9BACT/50-179--------------------------------------------------------------------------------
B4CWZ7_9BACT/330-461--------------------------------------------------------------------------------
B4D163_9BACT/76-206--------------------------------------------------------------------------------
B4CWZ6_9BACT/327-458--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
B4UTS4_BP163/66-193--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
Q11LS4_CHESB/40-170--------------------------------------------------------------------------------
C6XD83_METGS/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
B6BVZ4_9PROT/47-175--------------------------------------------------------------------------------
B6BWJ8_9PROT/54-182--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6XBL7_METGS/51-179--------------------------------------------------------------------------------
A9ZKZ5_COXBE/58-186--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
C6BGJ0_RALP1/55-184--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
B3QPC6_CHLP8/57-184--------------------------------------------------------------------------------
Q0YS38_9CHLB/89-216--------------------------------------------------------------------------------
D1W141_9BACT/221-392--------------------------------------------------------------------------------
C9BDM8_ENTFC/121-272--------------------------------------------------------------------------------
A3XNG0_LEEBM/39-192--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
A3SCU7_9RHOB/196-330--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A3JWZ9_9RHOB/120-292--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
A5ZI03_9BACE/49-181--------------------------------------------------------------------------------
B5CVV9_BACPM/52-183--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
B9G3S5_ORYSJ/55-216--------------------------------------------------------------------------------
B3EEJ2_CHLL2/96-337--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
B5HRW8_9ACTO/52-200--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
B9IN99_POPTR/46-189--------------------------------------------------------------------------------
A9AU45_BURM1/75-243--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
B6SLW3_MAIZE/46-198--------------------------------------------------------------------------------
B9YD37_9FIRM/27-200--------------------------------------------------------------------------------
B8BM04_ORYSI/29-174--------------------------------------------------------------------------------
B4CXG1_9BACT/84-257--------------------------------------------------------------------------------
D1W398_9BACT/21-163--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
I8UI46_PORGN/27-170--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
B3NQY9_DROER/305-445--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
B3DXV6_METI4/79-214--------------------------------------------------------------------------------
B4VL88_9CYAN/23-161--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
A8YNP5_MICAE/435-587--------------------------------------------------------------------------------
A7BUM9_9GAMM/28-164--------------------------------------------------------------------------------
A8FZT0_SHESH/365-519--------------------------------------------------------------------------------
A8TZT7_9PROT/75-215--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
B4D8F4_9BACT/72-317--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
B4VV96_9CYAN/140-327--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
B4VT06_9CYAN/299-436--------------------------------------------------------------------------------
Q2P9Y4_9ACTO/162-308--------------------------------------------------------------------------------
D4GHS4_PANAM/109-260--------------------------------------------------------------------------------
A3VZZ0_9RHOB/114-264--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
B6R9Y4_9RHOB/91-243--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
B6QXD8_9RHOB/76-232--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D3CTM8_9ACTO/100-254--------------------------------------------------------------------------------
Q467S2_METBF/103-254--------------------------------------------------------------------------------
C3HBL0_BACTU/109-260--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
G2TE04_RHORU/145-306--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
A4BT63_9GAMM/57-219--------------------------------------------------------------------------------
A4A524_9GAMM/61-225--------------------------------------------------------------------------------
B4VWK9_9CYAN/26-185--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
B9M1H9_GEODF/322-480--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
Q72KS5_THET2/61-193--------------------------------------------------------------------------------
B7A6E3_THEAQ/62-195--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
C0GIE8_9FIRM/109-240--------------------------------------------------------------------------------
A6CKL8_9BACI/105-229--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
B2XS89_9VIRU/586-711--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
NS1A_OASV1/438-558--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
A8YFS3_MICAE/52-220--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
Q4C9U0_CROWT/64-213--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
B4VKH5_9CYAN/399-535--------------------------------------------------------------------------------
A0YM55_LYNSP/62-208--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
Q060L2_9SYNE/66-212--------------------------------------------------------------------------------
A2CDP2_PROM3/91-233--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
A0ZIJ6_NODSP/50-187--------------------------------------------------------------------------------
B5W7L6_ARTMA/53-196--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------

PF01732

A5IYK2_MYCAP/279-649..........................TRQWSKRLNFARHSGTAWVIDRVKT..........................-TN
D9QW46_MYCMG/258-617..........................TLQEIPRLNFANASGTAWVIDRIDNK.........................-ED
Q2SR25_MYCCT/264-622..........................TFEEIKRLNFANASGTAWIIDRIKN..........................-DD
D3VQF5_MYCA6/359-733..........................YRSTPDHLATSQTVGTVWVMDRIISPEA.......................-EK
Q4A635_MYCS5/147-497.....................................TIAGTAWVLDYHYDK.........................-NN
Q4A5A2_MYCS5/91-491.....................................SYVGTMWLLDYQK...........................-IS
C7LM95_MYCML/189-571.................................GSLSNGTGTGWLLDYHKY..........................-NN
A5IYA1_MYCAP/186-569.................................DLLSDGTGTAWLLDYHKYT.........................-NS
Q4A798_MYCH7/125-523.......................VKLYGEPEENKFLATENGTIWLLDYHK...........................-KD
Q4A5G2_MYCS5/337-740..........................AENGGNKDWVGTLGGTAWLLDYHKNT.........................-QN
D3FFM3_MYCGH/244-661...............................GTAHPIVDQGTGWVLDYAKNS.........................-SN
C5J6P1_MYCCR/115-482..........................DENDVNDIVPYEPTGTGWLLDAAYN..........................-QN
D3FH76_MYCGH/221-623..........................SSNSNIEQLYYLNNGTGWLLDYQVSP.........................-QN
D3FHN8_MYCGH/203-712..........................KIPKGSSKAYLTYRGTAWILDYELD..........................-SN
D3FHQ1_MYCGH/203-710..........................KVQGGQNYSSLTYKGTAWILDYELD..........................-DS
Q4A5P6_MYCS5/166-643..........................DIEDTGVNTVKTNKGTAWILDYVKPN.........................-DS
D1J8A8_MYCHP/334-723................................ERKFTNTAGTTWIMDYQQRS.........................-DG
B1RXG0_UREUR/379-750................................KDTWDKSSGTTWILDYQKTN.........................-DD
A0A024FAH6_UREPR/376-752................................NNTYNKTAGTTWILDYQKTS.........................-DN
B1AI32_UREP2/413-786.................................RESDVVAGTMWIMDYQKRN.........................-DN
D9QXV8_MYCMG/283-769KKDKDEISKLGKDGLVKWQQKQIQEYKEKKELKQFQASESGTMWIMDYLTEN.........................-DG
C7LKT8_MYCML/288-775EQEKKKISALNRNKLVQWQKEEIEKYKKKKEEKIFQTSESGTMWIMDYINEN.........................-NN
Q98Q64_MYCPU/350-715..........................NGEIEDAKVSTKDIGTMWILDYEKTN.........................-NG
Q98QS3_MYCPU/339-702................................GNLANTNSGTMWILDYVKEP.........................-NK
D3FJ19_MYCGF/216-600..........................TDEQKIDQKLQSYLGTTWILDYKLAE.........................-NG
D3FHK1_MYCGH/204-545..........................HVSENAGDNVGNWSGTAWLLDYDLTS.........................-DN
Q4A7B5_MYCH7/323-738..............FRPDGGQGEPEYLDPKEIVHFSKGFHGTMNILDYKKED.........................-GQ
Q98PH9_MYCPU/101-415...............................QDGKPAKASGTTWILDYQLTE.........................-DG
Q8EWB5_MYCPE/130-442.....................................INSGTGWILDYKLTQD........................-SS
Q8EW95_MYCPE/145-484........................................GTAWILDYKLTS.........................-DN
Y068_MYCGE/48-383......................................TYGTGWLIDWKGDENNP......................-EK
H0PPR7_MYCPM/45-410......................................SYGTGWLIDWKGDENKP......................-SN
M1GCC9_MYCPM/75-444......................................IYGTGWLFDWKGDEKALGIDGSFVPSITSNIDNSL....-LK
J3UDP5_MYCGT/89-428......................................SYGTGWLIDWKGDENTT......................-QK
M1GHC3_MYCPM/104-443......................................AYGTGWLIDWKDV..........................-KQ
Y083_MYCPN/52-447......................................EFGTGWLIDWKGDENKNLSKNKEGQTASQTRSSSEQTTD-QD
M1GE88_MYCPM/44-388..........................TEKDKSQIDFGSIHGTGWLIDWKEVDKKD......................-KK
Q4A8M7_MYCH7/557-908AKVLEKDSINSSLRARSLVIQLRSNEYDRQTKTNTSKITSGTAWVFDRKLKK.........................-DP
Q8EWN7_MYCPE/57-397......................................EFGTAWIYAKEAN..........................-QG
B1RXU5_UREUR/59-344..................................QAINIFGTGWIFDFQEDP.........................-IT

PF02122

P1_TYYVF/206-408--------------------------------------IDGFKSFT--------------------------------IP
P1_PLRV1/207-407--------------------------------------VEGYKGFS--------------------------------VP
Q17S70_9LUTE/218-418--------------------------------------TKGFGSYD--------------------------------MI
Q2L3H9_9LUTE/218-419--------------------------------------VQGFKSFA--------------------------------VP
P1_PNLV/224-424--------------------------------------VEGYKPFI--------------------------------IP
Q65968_9LUTE/202-403--------------------------------------VEGYLSFK--------------------------------IP
Q670I3_9LUTE/214-415--------------------------------------CEGYTTFS--------------------------------IP
Q70AF6_9LUTE/441-642--------------------------------------ASGKYWWE--------------------------------MA
Q83737_9LUTE/202-414--------------------------------------VKGFLTFT--------------------------------IK
P1_PEMVW/318-522--------------------------------------IPGVQIKK--------------------------------LR
Q76VQ5_9LUTE/210-411--------------------------------------VSGYDSYS--------------------------------IP
Q8JZ11_9LUTE/202-403--------------------------------------VEGFLSFK--------------------------------IP
Q91AV6_9LUTE/212-414--------------------------------------VRGFTTWA--------------------------------VP
Q9EB08_9VIRU/363-572--------------------------------------KREFAWIP--------------------------------ES
Q9IZF6_9LUTE/208-408--------------------------------------VAGFDSYS--------------------------------IP

PF00944

POLS_SFV/112-268--------------------------------------------------------------------------------
POLS_SINDV/107-265--------------------------------------------------------------------------------

PF10459

A1SA55_SHEAM/18-726FRAIQYNSSKEKNYLADGFLATSMDKEPSAGPNERLYVTEAVTDVSAQIRDALP...EEPLARVEAIENRQKALIKE.CE
E0THX8_PARBH/23-721RGSVQYNSTEENNYLADGFLAAANTDELPAAPGTRVYVTVQVDDVTDQIRSGID.GEMSGEEVFAAIDAAEKALVAA.CE
F2GAE2_ALTMD/22-719RGSVQYNSTPENNYLKDGFLAKEIGDELPAAPGTRMFVTVDFSDVTDKVVGGIN.DDVQGRERYDLIEANRKALIAE.CE
A5FMW8_FLAJ1/19-712YNAIAELSTAEQNYLKDGFWAKQKSAEMKP.KSLYVRFFVRMDDVSKRILSKVN.DQMTETERNKIIQQEISLIEKE.NS
A6GWM2_FLAPJ/17-707FDAIQNHSSVDHDYLTNGFWAMKMEDELPN.ENLVVTFIVSINDVTAQVLDGVA.SITSETEKQNKIQENITKVTAS.FA
A6KZW8_BACV8/17-706YDAIQQHSSVEHDYLRDGFVADSLSKELPN.PDLFVSFLIRTEDVTERVLQAIP.VGTKENDRALIVDSISTLLAQE.AV
A6L2J7_BACV8/19-726YSYIQQHSSVEHDYLTDGFWAMSRKEELPC.KGLTVTFIDRILDVTPYVKEQLA.KDEDPEGLNYLSPSYLSKVAKR.FA
A6L2J8_BACV8/21-719YGAIQQHSSVEHDYLTDGFWAKSRKEELPT.PGLKFKFVERIVDVTDKVNNKVK..SGEVKEEETFEYDFLKKLADE.EL
A6LID5_PARD8/19-717YSSIQRHSTLEHDYLTDGFWAMSRDKELPN.PGLTVTFIDKIDDVTDYVRTELK.KITDPNSMEFLSAKYLNGLAKA.KV
A7HA06_ANADF/20-725IGTLQFNSTPERNLLEDGFVARARAEELWSGPGARVFVTVSVKEVTAEIAGGID.ARVGDAERGKLLERRVKARTAR.CE
A7HFU9_ANADF/37-699HECIEQLSTAQKDFVKSGFYAKTLPDEVKC.PTVEVNQLVQITDVTQRIRAATK..GLEGEAYHKALQGEMAKAEKE.CQ
Q024G1_SOLUE/22-694FGIVQEHSSPARDLITNGFIAGSREEELRG.KVARITVPHRFTDVTKEVNAAVA.AGANDLARSKAIEARQKSLIAA.CE
Q029T1_SOLUE/24-727TGGLQFNSTPARNLLKDGYLAKTRSEELPNGPGSRVFVTSAVTEVTSAITGNID.AKATDRERYELIERRVKERIAA.CE
Q07XT1_SHEFN/18-727YRGIQYNSKKEHNYLADGFLANTQAEEPSAGPNERLYITQEVTNVTDSVMANLS...TEPLVRFEDIQANKKALIKV.CE
Q08VC9_STIAD/18-714FSIVQEHSSPQRDLISQGFLAQNREAELPG.KGARILVPRAFTDVTKEVRAAVP.AGADDLVRFKAIERQQKELVAG.CE
Q11SC7_CYTH3/21-702FDAIQSHSSVEHDYITDGFWAMDRSQELSN.PGLTVTFLIRMEDVTSRFTGKTE..........EEQTALVKELTKE.YG
Q12RW4_SHEDO/18-728YRAIQYNSKSEHNYLENGFLAKTKADEPSAGPNERLYITEAVTDVTKQVMANLS...ADPLARYEDIQTNSKALVKD.CE
Q1D5W7_MYXXD/35-700RGCIDQLSTAKKDYIANGFYAKAQGEETQC.PAMEINQLVKITDVTETLNKATQ..GLTGKKYADTLKAKMSELEQA.CS
Q1D9F6_MYXXD/17-714FGVIQEHSTPQRDLITQGFLASKREDELPG.KGSRVQVPRSFTDVTKTVLAAVP.ADADDITRYKAIERKQKELVAE.CE
Q1DDZ2_MYXXD/18-682RGCIEDLSSPKKDLLAKGFYASSAAQELRC.PKVEANQLVEMTDVTAKMNAATK..GLTGAAFNTALKKETAAVEAA.CA
Q1GVV7_SPHAL/23-684VGCLQNLSSADSDLVAGGFNAADRARELKC.PGQQAEVVTAITDVTGSIRAAIG..SLTGEALVKARDARIAEIESAECP
Q1IPC2_KORVE/27-692QSCIHDLSSGGKDYMKDGFYAATREQEPKC.PGIEFLVLTDIKDVSEQIHSAVK.ARMASAESGKATRQAMSAAEKA.CS
Q2G546_NOVAD/56-713VECAQDNSTDENDLLKLGFVPVRREEELKC.PGQQAEVVTAIGDVTARVRAAIG..TATGEALVKARDAEAARIEKEGCR
Q2IEV3_ANADE/18-687HECVEELSSAGRDLVASGYLARSGAEELRC.PAMQVDQLLRITDVTKRVHGALA..GLEGARFNAALQAQKAAIEKE.CQ
Q2S133_SALRD/5-639RRHLNSQGDT.......AIVAARPADERAV.PALHADRLVRTSDVTAAVRTARQ..DTAKAAAISAVQGRLQTEAES...
Q2S134_SALRD/69-734REHITDVRRDGEALLKNGFYAAARSDERRA.PDLHVDQLVEAENVTGTVYDGLR...EGREAGAQAREQRVQSLQEQLTA
Q488S2_COLP3/26-729YGSVQYNSTAENNLLKNGFLAKNFAEELPATPGSRIYVTEEITEVTKLVKSGVT.EKMSGSDRYKAVDTNSKKLVAE.CE
Q5LIW7_BACFN/34-723FSSIQQHSSVDHDYLKDGFTAHSREEELPN.PELYVRFLLRTENVTRRVLKATT.PGMTESERSLAIDSMMVLLGDE.VT
Q5QV86_IDILO/17-717YNSIAHNSTPENDLLANGFLAKGLDAEVPAAPGSRIFVTKAVDDVTNKVIDAKV.TELTGKARLDAIEDNQKALVAE.CE
Q7MV25_PORGI/21-718YDMIQAHSTLEHNYLENGFWAMREADELPN.KDISVVFIDKIEDVTDYVKKDLK.AIKDPNSMDYLSPKYLQKLADK.KA
Q7MWU6_PORGI/24-711YGAIQSQSTVDHDYLRDGFVSRTMGEELPI.PGLSVKYLRKIVKVTDKVEGQLK.GITDEMERLRKAQEVCQELAKK.EN
Q7NHA9_GLOVI/34-698ATCIEELSTAQQNYIESGFLARRPEAELKC.PDVELNQLTAIEDVTERVKKATA..NLSGQQFSDAQKAEFARIEKA.CA
Q7UKL5_RHOBA/28-688SDTLAKLSSKERNLIDDGFLAKSFDEELKA.PDLELNQLISIEDVTDRINQQIT.NADDAEEAAKERRAAIATIEKE.SL
Q8A2L6_BACTN/20-711FSSIQQHSSVEHDYLKDGFVARNLGEELPN.PELYVRFLLRTEDVTKRVLSAAK.HAHTESERRVVVDSVMNVIGME.VS
B2FQN5_STRMK/22-717YGAIQLNSTAQKNLIKDGFNAPTLKDELSAGPNARVFVLDQITDVTTQAKAAIAAAGNDPLARSRALDAFDKAQVAA.CE
E3FSI6_STIAD/18-681RGCIEQLSTADKDYIANGFYAKAPTDELKC.PAMEINQLAEITDVTDRLNTATQ..GRTGKEYSDTLKAEMAKIEKE.CA
Q5LB16_BACFN/20-719YGAIQQHSSVDHDYLTNGFWAMNRNEELPC.KGLTVTFIDRILDVTTYVNEQLK.KDDDPNGINYLSPKYLATVADR.FA
Q8EAI4_SHEON/18-728YKAIQYNTKKEHNYLEQGFLATSMDKEPSAGPNERLYITEAVTDVTSDVTKDLS...QDPLKRYEEIENHSKALIKS.CE
Q8EHX9_SHEON/18-716YGSIQYNSTPEKNLLQDGFLAKTFADELPAAPGSRVYVTEDVTNVTERVKAGLE..NKTGREFYQGVENQEKALVAE.CE
Q9PC94_XYLFA/22-713YGAIQLNSTPKKNLIKEGFNALTQADEVSAGPNARIYVLEQITDVTAQAKAALAAAGNDPFKRTTALETFSKQEIAK.CE
R5U6M0_9BACE/21-717YASIQQHSSVEHDYLTDGFWATSRDKELPT.PGLKFTFIERIEDITDIVNAKIA..TKEITESESFSSAFLQKLANE.LY
R6WQY4_9PORP/22-710FGSIQQLSSVEHDYLKDGFVSQSKEEELPV.PGLTVRYLRETVDVSDRINSQIA.SIKEEHLRLAAADSIGQAMADS.VG
R6Y7C6_9PORP/19-717YGCIQRHSTLEHDYLTDGFWAMSRDQELPN.PGMTVTFIDKIEDVTDYVKKELK.KDTDPNSMNFLSPKFLNGLAKA.KV
R7EE18_9BACE/20-708FSSIQQHSSVEHDYLKDGFVARNLSEELPN.PELYVRFLLHQQDVTRRVLGAVK.PDMNESERTSVVDSVMLVIGEE.VS
R7EGG9_9BACE/23-719YGAIQQHSSVEHDYLTDGFWAMNRSEELPT.PGLKFRFVHRIVDITDLVNAKIK..AGEVTEIDALTSPFLNKLAKE.EL

PF02907

POLG_HCVJL/1060-1208---------------------------------------AGEIQILS-------------------------------TA
POLG_HCVNZ/1062-1210---------------------------------------TGEVQVLS-------------------------------TA
POLG_HCVEV/1057-1205---------------------------------------EGEVQFLS-------------------------------TA
O56074_9FLAV/1007-1154---------------------------------------EGSIVVLG-------------------------------TS
Q96898_9FLAV/992-1139---------------------------------------HGNVVVLG-------------------------------TS
Q9WM98_9FLAV/924-1071---------------------------------------.GNVMVLG-------------------------------TA
POLG_GBVB/970-1118---------------------------------------TGTIFRLG-------------------------------SL
Q9Q9A7_9HEPC/1060-1208---------------------------------------AGEIQVLS-------------------------------TV
Q9QIX6_9HEPC/1056-1204---------------------------------------EGEVQVVS-------------------------------TA

PF05409

R1A_CVH22/2994-3281--------------IMRLHNFSII..SGTAFLGVVGATMHGVTLKIKVSQTNMH------------------------TP
R1A_IBVB/2808-3096--------------LANNHEFEVTT.QHGVTLNVVSRRLKGAVLILQTAVANAE------------------------TP
B6VDX7_THCOV/2516-2804--------------IADCRDFCVVCPTQGIQLTVQSVKMVGAILQLTVHTNNTA------------------------TP
R1AB_FIPV/2932-3219--------------SVRLHNFSIA..KNNAFLGVVSAKYKGVNLVLKVNQVNPN------------------------TP
R1A_CVHSA/3269-3559--------------RKSNHSFLVQ..AGNVQLRVIGHSMQNCLLRLKVDTSNPK------------------------TP
R1A_CVMA5/3362-3648--------------RVTSSDFCVM..SGRMSLTVMSYQMQGCQLVLTVTLQNPN------------------------TP

PF09342

Q7QJ48_ANOGA/1774-1887-----------------------------------------WPWN-----------------------------------
Q8WSJ2_BOMMO/1523-1637-----------------------------------------CPWI-----------------------------------
NUDEL_DROME/2041-2158-----------------------------------------WPWL-----------------------------------

PF00089

CFAI_HUMAN/340-569------------------------------------------------------------------------------KR
SP24D_ANOGA/50-264------------------------------------------------------------------------------SV
TRY5_AEDAE/40-260------------------------------------------------------------------------------FE
A0A024QZM9_HUMAN/179-419------------------------------------------------------------------------------EF
MASP1_MOUSE/454-696------------------------------------------------------------------------------RP
CTR1_ANOGA/33-250------------------------------------------------------------------------------EV
CFAD_HUMAN/26-248------------------------------------------------------------------------------RE
ACRO_RAT/43-286------------------------------------------------------------------------------QT
HPT_HUMAN/162-399------------------------------------------------------------------------------HL
CASP_MESAU/445-682------------------------------------------------------------------------------FP
A8JQZ2_DROME/186-427------------------------------------------------------------------------------TP
PCE_TACTR/128-370------------------------------------------------------------------------------RE
STUB_DROME/544-782------------------------------------------------------------------------------KS
TRYU_DROME/28-254------------------------------------------------------------------------------AD
TRYI_DROME/28-245------------------------------------------------------------------------------SD
TRYB_MANSE/25-252------------------------------------------------------------------------------ST
TRYP_FUSOX/25-244------------------------------------------------------------------------------TS
B1VV86_STRGG/37-252------------------------------------------------------------------------------TR
TRY1_HUMAN/24-239------------------------------------------------------------------------------YN
TRYP_PIG/9-224------------------------------------------------------------------------------YT
TRY1_SALSA/21-235------------------------------------------------------------------------------YE
TRYP_PLEPL/23-242------------------------------------------------------------------------------HE
DEGP3_ARATH/99-287------------------------------------------------------------------------------VS
DEGP2_ARATH/121-308------------------------------------------------------------------------------HT
A0A017I371_ECOLX/62-244------------------------------------------------------------------------------LN
DEGS_HAEIN/37-240------------------------------------------------------------------------------KN
J7JYL9_BACIU/99-283------------------------------------------------------------------------------ES
A0A017R133_SALET/97-278------------------------------------------------------------------------------NG
Q44596_BRUAO/85-261------------------------------------------------------------------------------AS
A0A024EQG8_BRUCA/125-298------------------------------------------------------------------------------HE
O06439_RHOCA/59-235------------------------------------------------------------------------------PQ
F7UK65_SYNYG/95-274------------------------------------------------------------------------------FP
M1LZP5_9SYNC/156-334------------------------------------------------------------------------------MP
O42417_CHICK/87-286------------------------------------------------------------------------------HP
A0A028WZQ9_STAAU/70-274------------------------------------------------------------------------------KD
ETB_STAAU/59-251------------------------------------------------------------------------------AR
A0A008AS15_STAAU/37-234------------------------------------------------------------------------------TK
A0A008ARX4_STAAU/38-233------------------------------------------------------------------------------QV
J7JN12_BACIU/95-311------------------------------------------------------------------------------DE
PRTC_STRGR/205-383------------------------------------------------------------------------------DA
Q55353_STRSQ/198-372------------------------------------------------------------------------------DA
Q55352_STRSQ/202-378------------------------------------------------------------------------------DA
Q54395_STRLI/158-342------------------------------------------------------------------------------DA
SP1_RARFA/205-391------------------------------------------------------------------------------VP
CERC_SCHMA/28-256------------------------------------------------------------------------------EP
Q54344_STRLI/47-254------------------------------------------------------------------------------EP
CFAB_HUMAN/481-752------------------------------------------------------------------------------RK
PROZ_BOVIN/143-352------------------------------------------------------------------------------SQ
CAC3_BOVIN/12-246------------------------------------------------------------------------------ED
CELA1_PIG/27-259------------------------------------------------------------------------------TE
CTRA_BOVIN/16-238------------------------------------------------------------------------------EE
CTRL_HALRU/24-251------------------------------------------------------------------------------SN
COGS_HYPLI/31-252------------------------------------------------------------------------------YE
CTRB1_LITVA/46-263------------------------------------------------------------------------------VE
CATG_MOUSE/21-238------------------------------------------------------------------------------RE
MCPT2_RAT/21-239------------------------------------------------------------------------------VE
ELNE_HUMAN/30-242------------------------------------------------------------------------------RR
PRTN3_HUMAN/28-243------------------------------------------------------------------------------HE
GRAK_RAT/26-248------------------------------------------------------------------------------RE
GRAM_RAT/21-245------------------------------------------------------------------------------RE
KLK1_MOUSE/25-253------------------------------------------------------------------------------FN
KLK2_RAT/25-251------------------------------------------------------------------------------YK
VSPCA_AGKCO/1-217------------------------------------------------------------------------------DE
HGF_RAT/496-719------------------------------------------------------------------------------IP
ENTK_PIG/800-1029------------------------------------------------------------------------------ND
PRSS8_HUMAN/45-281------------------------------------------------------------------------------SS
HGFA_HUMAN/408-641------------------------------------------------------------------------------SS
TPA_HUMAN/311-556------------------------------------------------------------------------------LF
H2Q7T9_PANTR/235-462------------------------------------------------------------------------------QE
THRB_BOVIN/367-616------------------------------------------------------------------------------QD
PROC_HUMAN/212-445------------------------------------------------------------------------------KM

PF12380

Q9IHZ8_GAVAU/2823-3106----------------------------------LVTHEVRTGNATTVED----------------------------LN

PF12381

Q6EEL1_9SECO/2617-2847---------------------------------------RLIGT---------------------------------IVV
O11979_9SECO/2603-2833---------------------------------------RLCGT---------------------------------FVV
Q1MNG4_9SECO/2627-2857---------------------------------------RLCGT---------------------------------YVC

PF00863

POLG_SPMMV/2424-2646------------------------------------------GD---------------------------------KLI
POLG_RGMVD/1998-2230------------------------------------------GP---------------------------------YIL

PF02395

HAP1_HAEIN/17-782FTYQIVKRNNYQAWERK.........HPYDGDYHMPRLHKFVTEAEPVGMTTN.MDGKVYADRENYPERVRIGSGRQYWR
IGA0_HAEIN/17-865NRYFSVEKNEYPTKLNGKAVTTEDQTQKRREDYYMPRLDKFVTEVAPIEASTASSDAGTYNDQNKYPAFVRLGSGSQFIY
Q5F9W2_NEIG1/19-848NEYRVVEQNNYEPHKAWSA.....SNLGRLEDYNMARFNKFVTEVAPIAPTDAGGGLDTYKDKNRFSSFVRIGAGRQLVY

PF05578

POLG_BVDVN/1680-1890---------------AW-----------------------------------------AYTHQGGISSVDHVTAGKDLLV

PF01577

POLG_PEMVM/73-321---------------------------------------LHVARVLEKQRLQDI--------------------------
POLG_TUMVJ/107-361---------------------------------------KIVPRSSGAMKQKRA--------------------------
Q85074_9POTV/144-397---------------------------------------NTNVKTESDGGWIQA--------------------------
POLG_ZYMVR/71-312---------------------------------------QRVLERISFEKIEKG--------------------------
P90213_9POTV/300-546---------------------------------------IVVCDKRGTLKWEKC--------------------------
POLG_PEMVC/44-286---------------------------------------AKRARKLRKKQREEE--------------------------
POLG_TVMV/30-273---------------------------------------TKVEKINAAAKKLAD--------------------------
POLG_RGMVD/13-255---------------------------------------NPFAEFDEMHQRGNP--------------------------
POLG_LMV0/179-436---------------------------------------CLVYKTKPSWSQRRR--------------------------
POLG_PVMA/45-297---------------------------------------QMADEVAEKEAFMAA--------------------------
POLG_PSBMV/143-396---------------------------------------GIVIKTRKGLEWREA--------------------------
Q82933_9POTV/2-236---------------------------------------HQVYDAQRALLHNSR--------------------------
POLG_PVYN/41-283---------------------------------------AQIMRIQKKLERKDR--------------------------
Q65892_BYMV/40-283---------------------------------------DYIKT.REKEQREEE--------------------------
POLG_BCMNN/77-316---------------------------------------KQAEERHAKYLKLQE--------------------------
POLG_ZYMVC/70-309---------------------------------------QRVFARIEQDEAARK--------------------------
Q65852_BYMV/40-283---------------------------------------DHVKA.IEKQRFEEE--------------------------
POLG_SBMVG/69-307---------------------------------------RAGSSKEAAIARRKQ--------------------------
O73463_MDMV/2-232---------------------------------------GQVYDEKRALEHNSK--------------------------
POLG_PVYHU/41-283---------------------------------------AQIARIQKKREERER--------------------------
POLG_PPVD/59-307---------------------------------------KFIEKKLRKQYQEER--------------------------
Q85057_9POTV/204-442---------------------------------------EQAKERAQLARKRQE--------------------------
O39734_9POTV/410-663---------------------------------------RLVKKTRKDNQRQRR--------------------------
POLG_ZYMVS/71-312---------------------------------------RHVFERINLEKSEKE--------------------------
POLG_PRSVH/300-546---------------------------------------AVVCDKRGTLKWETQ--------------------------
POLG_TEV/53-303---------------------------------------GKRRKVSVNNKRNRR--------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268---------------------------------------ALTMERQDEFQLQGK...MYDFDDDRVSAFTTMARDNGLGI
Q9YQ23_VESV/628-1162---------------------------------------ALALERLEDFQLQAP...EYDFDKNRVTAFTRMASDNGLGV
Q80J95_9CALI/650-1163---------------------------------------ALVHERHDDFGLQNK...VYDFDAGKVTAFKAMAADAGIPW
Q8JJL0_9CALI/645-1175---------------------------------------GLVHERKDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGI
Q80RD7_9CALI/641-1177---------------------------------------GLLHERLDEFELQGPNLTTFNFDRNKIQAFRQLAAENKYGL

PF03510

POLG_SVSAP/1069-1175--------------------------------------------------------------------------------
POLG_VESVA/1207-1311--------------------------------------------------------------------------------
POLG_BECN1/1010-1109--------------------------------------------------------------------------------
POLG_FCVUR/1095-1199--------------------------------------------------------------------------------
POLG_RHDVF/1120-1218--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713---------------------------------------RATSSLG----LITPYDVHMITATPRGA.....SSLASAPE
RPOA_PRRSL/1601-1897---------------------------------------RFTQVAG----IITPYDIHQYTSGPRGA.....AAVATAPE
RPOA_LDVP/1420-1715---------------------------------------RATSSTG----LVTPYDVHLVTSTPRGA.....SSLASAPE
RPOA_SHFV/1368-1665---------------------------------------RYTGIGG----FVTPYDIHDVVKSQRDG.....VAVANAPP
Q99AV6_PRRSV/1716-2013---------------------------------------RYTNVAG----LVTPYDIHHYTSGPRGV.....AALATAPD
RPOA_EAVBU/963-1269---------------------------------------K.VNVPM----CVTPAHFLLLARSAGQSREQMLRVSAAAPT

PF05580

B2A522_NATTJ/220-429---------------------------------------SSLGV-G----TLTYKD----------------------FE
R6EU85_9FIRM/238-449---------------------------------------NAQGV-G----TMTYID----------------------.E
R5R857_9FIRM/207-436---------------------------------------SAQGI-G----TMTYET----------------------.A
D5DLD9_BACMD/199-411---------------------------------------SAAGI-G----TMTFYD----------------------PK
R5E7E8_9CLOT/152-361---------------------------------------DLQGL-G----TITYAY----------------------GD
H6NL93_9BACL/215-426---------------------------------------SAAGV-G----TLTFYA----------------------PD
D9QRU2_ACEAZ/225-437---------------------------------------GATGV-G----TMTFYD----------------------PQ
R5C627_9FIRM/188-399---------------------------------------NTQGI-G----TLTYVR----------------------.E
R7M5P2_9CLOT/113-319---------------------------------------NIKGV-G----TLTFID----------------------PE
R5H148_9FIRM/296-509---------------------------------------NAQGV-G----TMTYLD----------------------.E
R6AIL9_9CLOT/309-520---------------------------------------STVGI-G----TLSFVT----------------------EK
R7FQ12_9CLOT/118-324---------------------------------------RVLGI-G----TLTYYD----------------------PD
F6DU87_DESRL/208-419---------------------------------------STAGV-G----TMTFFH----------------------PE
R6R0T0_9FIRM/202-413---------------------------------------DCQGL-G----TLTYVD----------------------.E
D4J425_9FIRM/143-352---------------------------------------DTQGI-G----TITYID----------------------.A
R5YSC4_9FIRM/171-381---------------------------------------DTQGL-G----TITFVT----------------------.S
R5J4I1_9FIRM/116-322---------------------------------------HIAGI-G----TVTYYD----------------------PE
R6Y3R6_9FIRM/105-308---------------------------------------ELLGV-G----TVTFYK----------------------EE
I4D8U8_DESAJ/207-417---------------------------------------EAAGV-G----TLSFID----------------------PV
R5A2Q9_9CLOT/166-372---------------------------------------SAAGI-G----TLTFYD----------------------PS
A4XKP9_CALS8/197-406---------------------------------------GTSGI-G----TLTFVD----------------------KK
R7HFV6_9MOLU/114-315---------------------------------------SIMGI-G----TLSYID----------------------PN
R5MBH1_9MOLU/114-320---------------------------------------NLLGN-G----TLTYID----------------------PE
B0TEK3_HELMI/213-425---------------------------------------RASGV-G----TLTFFE----------------------PK
R7K6P1_9FIRM/157-363---------------------------------------SSSGV-G----TMTFVR----------------------.A
R6WI32_9FIRM/142-352---------------------------------------NTQGL-G----TVTYLD----------------------.A
C4ZCY0_EUBR3/231-444---------------------------------------DLAGI-G----TITYYT----------------------.K
R7FE29_9FIRM/73-281---------------------------------------SSAGI-G----TITFYE----------------------PE
R7KE68_9FIRM/124-327---------------------------------------EVSGI-G----TISFVK----------------------.K
Q8XJE5_CLOPE/169-381---------------------------------------STAGV-G----TLTFYD----------------------KE
D4LFB6_RUMC1/186-392---------------------------------------STAGI-G----TVTYYM----------------------PN
R6RRV8_9FIRM/196-402---------------------------------------NTQGI-G----TMTYVA----------------------..
R7B468_9CLOT/223-433---------------------------------------DTQGI-G----TMTYVC----------------------.A
G7M128_9CLOT/178-390---------------------------------------STAGV-G----TMTFYD----------------------DK
U5S0W6_9CLOT/58-269---------------------------------------STAGI-G----TLTFYD----------------------EK
R5KFR6_9CLOT/194-405---------------------------------------DLQGI-G----TLTYIM----------------------..
R7QW48_9FIRM/195-406---------------------------------------DLAGI-G----TMTYLT----------------------.D
R6BUQ9_9FIRM/200-411---------------------------------------DTQGL-G----TMTYVD----------------------.G
R7MCE1_9CLOT/112-319---------------------------------------KITGI-G----TLSYID----------------------PS
A5D302_PELTS/202-414---------------------------------------STAGI-G----TLTFYD----------------------PE
E6UBW1_RUMA7/185-391---------------------------------------SSAGI-G----TLTFFD----------------------DD
R5PM12_9CLOT/191-403---------------------------------------AAAGV-G----TLTFYE----------------------PS
R5CZB6_9FIRM/131-339---------------------------------------SMAGV-G----TLTYYD----------------------PA
R6SMI2_9CLOT/136-344---------------------------------------SGAGI-G----TVTFIR----------------------QN
A4J3G7_DESRM/208-419---------------------------------------STAGV-G----TMTFYH----------------------PE
E6U2J4_ETHHY/187-393---------------------------------------STAGI-G----TVTYFD----------------------PQ
R5SUE4_9CLOT/120-327---------------------------------------SVTGI-G----TLTYID----------------------PN
R6XJ65_9FIRM/122-326---------------------------------------QILGI-G----TLTFIT----------------------EN
R6QNQ2_9CLOT/190-396---------------------------------------SSAGI-G----TMTFYD----------------------ND
R6KNJ0_9CLOT/213-424---------------------------------------DTQGI-G----TITYVD----------------------.M
R6T3R8_9FIRM/186-393---------------------------------------SSAGI-G----TLTFYD----------------------PE
R7HTV5_9CLOT/212-419---------------------------------------DTQGI-G----TLTYVT----------------------.K
R5VVX1_9FIRM/189-398---------------------------------------STAGV-G----TFTFYE----------------------PE
R5TNP7_9FIRM/195-404---------------------------------------DLAGI-G----TLTYID----------------------.G
Q18B75_PEPD6/136-351---------------------------------------KISGI-G----TMTFYD----------------------PS
G2T3Q8_ROSHA/201-410---------------------------------------DLAGV-G----TLTYYR----------------------.Q
R6GHR5_9CLOT/188-396---------------------------------------SSAGI-G----TVTFWD----------------------EK
E6TXR0_BACCJ/199-411---------------------------------------SAAGV-G----TLTFYE----------------------PN
R6KEA9_9FIRM/205-413---------------------------------------DAQGI-G----TLTYID----------------------.Q
R7IWD1_9CLOT/190-401---------------------------------------SAAGV-G----TVTFYN----------------------ED
R5VVV3_9DELT/151-357---------------------------------------SSSGI-G----TLTYVR----------------------.K
R6I8W6_9FIRM/179-383---------------------------------------SSAGI-G----TVTFYD----------------------RK
R7GGP8_9CLOT/115-317---------------------------------------CDLGI-G----TLTFCN----------------------.E
R5J7S8_9CLOT/120-326---------------------------------------TISGI-G----TLTYID----------------------PG
R6FK23_9FIRM/136-347---------------------------------------KIAGI-G----TLSFYD----------------------PD
R7P923_9CLOT/113-319---------------------------------------SITGI-G----TLSYID----------------------PE
R5KUR7_9CLOT/195-402---------------------------------------STAGI-G----TVTFYN----------------------PS
I3VWM7_THESW/212-422---------------------------------------HTAGI-G----TLTFYT----------------------ED
R6B2V6_9CLOT/191-403---------------------------------------AAAGV-G----TLTFYE----------------------PS
R7DMS2_9FIRM/121-329---------------------------------------RLIGI-G----TVSFYD----------------------PD
R5KNW9_9FIRM/195-404---------------------------------------DSQGI-G----TITYVT----------------------.D
R7NI61_9MOLU/99-305---------------------------------------GVTGI-G----TLTFID----------------------PS
F2JMG1_CELLD/211-424---------------------------------------STQGI-G----TITYIH----------------------PK
K4L254_9FIRM/156-367---------------------------------------EAAGV-G----TLTFTE----------------------PD
R6GNM4_9FIRM/129-330---------------------------------------KISGA-G----MTTFTR----------------------.D
R6Q3J2_9FIRM/196-400---------------------------------------SSAGV-G----TLTFAD----------------------EE
R6N1E9_9FIRM/116-321---------------------------------------STAGI-G----TVTYYN----------------------PQ
R5SZK8_9CLOT/118-324---------------------------------------SITGI-G----TLTYID----------------------PE
R5YCX5_9FIRM/208-421---------------------------------------DMAGI-G----TLTYYD----------------------.K
D5HI76_9FIRM/160-369---------------------------------------DVSGI-G----TVTFVD----------------------GT
E3E859_PAEPS/137-349---------------------------------------SAAGV-G----TLTFYA----------------------PD
R7C759_9CLOT/197-406---------------------------------------DTQGI-G----TLTYVT----------------------.K
W0E9D2_9FIRM/202-413---------------------------------------EAAGV-G----TLTFYE----------------------PQ
Q894H5_CLOTE/184-395---------------------------------------STTGV-G----TLTFYD----------------------DK
C9R866_AMMDK/202-413---------------------------------------ATAGV-G----TLTFYE----------------------PK
R7HB69_9FIRM/196-404---------------------------------------DAQGI-G----TMTYID----------------------.S
A6TR47_ALKMQ/210-422---------------------------------------KTAGV-G----TLTFYD----------------------PV
R7ESB8_9FIRM/148-356---------------------------------------SGAGI-G----TVTFIV----------------------PS
R6PKG4_9CLOT/140-351---------------------------------------NAQGL-G----TITFLT----------------------.G
R7M6Q4_9CLOT/187-399---------------------------------------AAAGV-G----TLTFYE----------------------PS
Q0AZD6_SYNWW/215-424---------------------------------------GVVGV-G----TLTFWE----------------------PD
R7N4W4_9FIRM/231-442---------------------------------------NAQGV-G----TMTYVD----------------------.E
R6YA95_9FIRM/168-374---------------------------------------SAAGI-G----TLTFYD----------------------PA
D5WV97_KYRT2/201-413---------------------------------------SAAGV-G----TLTFYD----------------------PV
R5LXL5_9FIRM/206-416---------------------------------------DCQGL-G----TLTYVD----------------------.D
R5DF89_9FIRM/133-343---------------------------------------NAQGL-G----TITYLD----------------------.A
R6TFF4_9STAP/121-325---------------------------------------QILGI-G----TMTFIT----------------------LD
A5I2Z7_CLOBH/188-400---------------------------------------STAGV-G----TLTFYH----------------------DK
R6H4Q6_9CLOT/91-303---------------------------------------SAAGV-G----TVSFYE----------------------PS
R6R368_9FIRM/120-325---------------------------------------RILGV-G----TISFYD----------------------PI
A3DDL9_CLOTH/218-430---------------------------------------STAGI-G----TLTFYD----------------------PV
D3E6N1_GEOS4/214-426---------------------------------------SAAGV-G----TLTFYA----------------------PH
F9VK25_ARTSS/179-388---------------------------------------STAGI-G----TVTFID----------------------PV
R5QQG0_9FIRM/118-320---------------------------------------CAKGI-G----TVTYYQ----------------------LN
G8LW28_CLOCD/213-425---------------------------------------STAGI-G----TLTFYD----------------------PK
R7L0T4_9FIRM/126-334---------------------------------------SSAGI-G----TVTFYD----------------------PS
L7VQQ3_CLOSH/209-420---------------------------------------STAGI-G----TLTYIE----------------------EE
C8WXF9_ALIAD/189-397---------------------------------------KAVGV-G----TLTFYD----------------------PA
Q2RIC4_MOOTA/202-411---------------------------------------STAGV-G----TLTFYD----------------------QN
R4KQW9_9FIRM/232-442---------------------------------------STAGV-G----TLTFYE----------------------PQ
A9KMA5_CLOPH/225-441---------------------------------------DTQGI-G----TLTFVT----------------------.T
E6SKR3_THEM7/211-421---------------------------------------RVAGV-G----TLTFYH----------------------PD
L0F7L5_DESDL/200-410---------------------------------------EAAGV-G----TLTFYE----------------------PK
I0JNU1_HALH3/188-400---------------------------------------SAAGI-G----TMTFYH----------------------PD
R7EZR7_9BACI/117-324---------------------------------------SILGI-G----SITYID----------------------TS
R6J055_9CLOT/186-394---------------------------------------STAGI-G----TVTYYD----------------------PQ
R5NUG0_9CLOT/148-357---------------------------------------DISGI-G----TITYTD----------------------..
G2TKW2_BACCO/200-411---------------------------------------SAAGI-G----TMTFID----------------------PK
R5N690_9FIRM/193-400---------------------------------------SMAGV-G----TITFVD----------------------SA
R5VHC6_9FIRM/114-320---------------------------------------NLLGN-G----TLTYID----------------------PK
R5NBK1_9CLOT/138-351---------------------------------------AAAGI-G----TLTYYE----------------------EA
R5XPM2_9FIRM/140-351---------------------------------------NVQGL-G----TITFLT----------------------.K
D5X7G9_THEPJ/213-424---------------------------------------TAAGV-G----TITFYD----------------------PK
F4A1F9_MAHA5/214-428---------------------------------------STAGV-G----TMTFYE----------------------PN
R7ITE0_9FIRM/151-366---------------------------------------DTQGI-G----TMTCLT----------------------.R
F6CL40_DESK7/195-404---------------------------------------SAAGV-G----TLTFYE----------------------PR
L0EG06_THECK/213-424---------------------------------------SAAGV-G----TLTFYA----------------------PE
R5IDG3_9CLOT/213-423---------------------------------------DTQGI-G----TVTYMD----------------------.L
R6CTL1_9CLOT/118-325---------------------------------------MISGI-G----TLTYID----------------------PE
K0B195_CLOA9/212-423---------------------------------------KTAGI-G----TLTFYD----------------------EE
B8D2I8_HALOH/210-421---------------------------------------GVAGV-G----TLTFFD----------------------PK
R6NNU0_9FIRM/213-424---------------------------------------DLAGI-G----TLTYIS----------------------.Q
R6VE05_9FIRM/188-399---------------------------------------NTQGI-G----TLTFLT----------------------.K
R6CN52_9FIRM/193-397---------------------------------------SSAGI-G----TMTFFD----------------------PE
R5H2U4_9FIRM/159-365---------------------------------------SAAGI-G----TLTYFD----------------------PA
R5V409_9FIRM/40-247---------------------------------------RILGI-G----TVTIYD----------------------PE
R6GW98_9FIRM/110-315---------------------------------------SISGI-G----TLTYVD----------------------PE
R7ICH4_9FIRM/200-411---------------------------------------STAGI-G----TLSFYD----------------------PD
R7BI76_9FIRM/223-434---------------------------------------DCQGL-G----TLTYID----------------------.K
C4Z0G6_EUBE2/202-409---------------------------------------DTQGV-G----TVTYVC----------------------.E
R6NHB7_9CLOT/186-391---------------------------------------SSAGI-G----TVTFYD----------------------DD
R7R973_9FIRM/207-417---------------------------------------SAQGI-G----TMTFLD----------------------.E
R5HM74_9FIRM/192-403---------------------------------------DLAGI-G----TLTYYK----------------------.E
R6NAF9_9FIRM/129-336---------------------------------------SSAGI-G----TVTYYD----------------------KS
D9SLV5_CLOC7/150-362---------------------------------------SMAGV-G----TLTFYE----------------------PE
R5RSY4_9FIRM/189-400---------------------------------------NIQGI-G----TLTYVD----------------------.Q
R6HAH9_9FIRM/113-319---------------------------------------GIAGV-G----TVTYYD----------------------PE
R5XRH8_9CLOT/128-335---------------------------------------KITGI-G----TMTCYD----------------------PE
R7FZ38_9FIRM/122-328---------------------------------------SASGI-G----TITFID----------------------PS
R5I6P6_9FIRM/188-403---------------------------------------DTQGI-G----TLTFVT----------------------.E
B8I3A0_CLOCE/214-425---------------------------------------STAGI-G----TMTFYD----------------------PQ
R6DXQ1_9FIRM/186-391---------------------------------------STAGI-G----TVTWYD----------------------RT
R5E160_9FIRM/209-416---------------------------------------DAQGI-G----TLTYID----------------------.S
Q97HE0_CLOAB/178-390---------------------------------------STAGI-G----TLTFYS----------------------DK
R6M2Z6_9CLOT/204-415---------------------------------------DTEGI-G----TITYIS----------------------.P
D6DLB6_CLOSC/284-503---------------------------------------DTQGI-G----TMTYVT----------------------.Q
R6RY05_9CLOT/213-424---------------------------------------DTQGI-G----TVTYVD----------------------.M
F4LV06_TEPAE/231-437---------------------------------------ITAGV-G----TLTFYD----------------------PQ
R6UED3_9CLOT/180-388---------------------------------------SSAGI-G----TMTFYH----------------------PK
R5AES8_9CLOT/40-251---------------------------------------STAGV-G----TLSFCS----------------------AQ
B2TRL9_CLOBB/178-390---------------------------------------STAGV-G----TMTFID----------------------SE
R5D6V9_9FIRM/120-320---------------------------------------GISGV-G----TLTFYD----------------------PA
D7CKI9_SYNLT/217-427---------------------------------------GVAGV-G----TLSFWD----------------------PL
R5TH80_9CLOT/131-336---------------------------------------SSAGV-G----TVTFYE----------------------EN
R5MT91_9FIRM/109-314---------------------------------------SITGI-G----TLTYID----------------------PQ
R6YLB5_9CLOT/116-322---------------------------------------TINGV-G----TLTFID----------------------PN
R6MJ71_9FIRM/140-351---------------------------------------NAQGL-G----TITFLN----------------------.A
D4M5K6_9FIRM/147-358---------------------------------------NVQGL-G----TITFLT----------------------.K
D9S3S9_THEOJ/212-423---------------------------------------IAAGV-G----TLTFYD----------------------PE
F6B9N5_DESCC/208-419---------------------------------------STAGV-G----TMTFFD----------------------PK
R6TLY4_9FIRM/135-345---------------------------------------SMAGI-G----TMTYYD----------------------PD
R5ZMQ1_9CLOT/197-409---------------------------------------AAAGV-G----TLTFYE----------------------PS
Q67NC5_SYMTH/205-417---------------------------------------GASGV-G----TLTFYH----------------------PP
R6TRP0_9CLOT/118-324---------------------------------------SILGI-G----TLTFVD----------------------PN
R7L6Y3_9CLOT/231-443---------------------------------------AAAGV-G----TLTFYN----------------------PE
R6BNR4_9CLOT/112-320---------------------------------------SVVGL-G----TLTYID----------------------PI
Q9K975_BACHD/210-423---------------------------------------SAAGV-G----TLTFYD----------------------PV
D4KCM7_9FIRM/190-395---------------------------------------SSAGV-G----TLTFVD----------------------VQ
R5QDI6_9FIRM/143-350---------------------------------------SAAGI-G----TVTFID----------------------PK
B1I568_DESAP/210-421---------------------------------------SAAGV-G----TLTFHD----------------------PK
R5NSK8_9FIRM/197-408---------------------------------------DSQGI-G----TLTFIT----------------------.K
R6ZZF6_9FIRM/206-414---------------------------------------DTQGI-G----TMTYIT----------------------.K
R6L493_9FIRM/188-398---------------------------------------NTQGI-G----TITFVD----------------------.E
A8MFI3_ALKOO/211-423---------------------------------------KTAGV-G----TLSFFH----------------------ME
Q8RAC0_THETN/202-413---------------------------------------HTAGI-G----TLTFYY----------------------PS
R6G9J9_9FIRM/189-399---------------------------------------NIQGI-G----TLTYVE----------------------.P
R5HAQ1_9FIRM/143-351---------------------------------------SMAGI-G----TLTFVD----------------------PE
K4LFQ1_THEPS/205-416---------------------------------------GAAGV-G----TLTFYE----------------------AQ
W6RY93_9CLOT/147-358---------------------------------------STAGV-G----TLTFYD----------------------KK
R5UHP5_9FIRM/210-422---------------------------------------DMAGI-G----TLTYFD----------------------.Q
R7G2H0_9FIRM/141-351---------------------------------------NAQGL-G----TVTFLN----------------------.S
R6WHU5_9CLOT/129-336---------------------------------------KITGI-G----TLTYVT----------------------.T
R6S308_9FIRM/140-351---------------------------------------NAQGL-G----TITYLD----------------------.S
R5B250_9CLOT/199-410---------------------------------------STAGI-G----TLTFYT----------------------MS
R5SFB7_9FIRM/135-345---------------------------------------SMAGI-G----TVTFYD----------------------PQ
R6GC90_9FIRM/148-359---------------------------------------DTQGI-G----TITFIR----------------------.E
D9R8M8_CLOSW/212-423---------------------------------------DTQGI-G----TMTYVD----------------------.M
R5RQY0_9FIRM/119-326---------------------------------------AISGV-G----TLTFYN----------------------PA
R5LJL6_9MOLU/116-322---------------------------------------KINGI-G----TLTYID----------------------PE
R7AQT1_9BACE/223-435---------------------------------------DSQGI-G----TLTYIA----------------------.P
X4ZLT8_9BACL/97-309---------------------------------------SAAGV-G----TLTFYA----------------------PN
F8I8Y9_SULAT/218-427---------------------------------------RTSGV-G----TLSFYN----------------------PR
R6MC60_9CLOT/120-327---------------------------------------SITGV-G----TLTYID----------------------PN
R6TCX6_9FIRM/133-340---------------------------------------TTAGI-G----TVTFID----------------------PD
R6R1J4_9FIRM/210-418---------------------------------------SIQGI-G----TVTFFD----------------------ET
R6YL37_9CLOT/137-348---------------------------------------SAAGV-G----TLTFYC----------------------EQ
R5XPM6_9FIRM/188-398---------------------------------------NTQGI-G----TLTFVD----------------------.E
A0Q0A9_CLONN/185-397---------------------------------------STSGV-G----TLTFYD----------------------SK
D4LPR1_9FIRM/188-397---------------------------------------DTQGI-G----TLTYVD----------------------.E
R7DAB6_9FIRM/188-398---------------------------------------NTQGI-G----TLTFVD----------------------.Q
C0ZC15_BREBN/212-424---------------------------------------SAAGV-G----TLTFYD----------------------PN
R6QE36_9FIRM/192-401---------------------------------------STQGV-G----TLTYFD----------------------KD
R5K6N9_9CLOT/165-374---------------------------------------DISGI-G----TVTFLC----------------------GN
R6ZCY0_9FIRM/219-430---------------------------------------NAQGV-G----TMTYID----------------------.E
R5HLI4_9MOLU/113-318---------------------------------------SVSGI-G----TLTFID----------------------PN
R6NKY3_9CLOT/192-404---------------------------------------SAAGV-G----TVTFYE----------------------PS
R5JXE7_9FIRM/154-361---------------------------------------DISGI-G----TMTYID----------------------ED
R5AF90_9FIRM/131-337---------------------------------------SIQGI-G----TVTYYD----------------------AE
R5TU24_9FIRM/138-348---------------------------------------NVQGL-G----TITFMT----------------------.R
R6P0Q8_9CLOT/192-399---------------------------------------SSAGI-G----TLTFYN----------------------PE
R6DUC4_9FIRM/125-334---------------------------------------SMAGI-G----TLTYYD----------------------PA
R7F4Z6_9CLOT/190-402---------------------------------------AASGV-G----TISFYD----------------------PN
R6X4M8_9FIRM/134-340---------------------------------------STAGI-G----TLTYID----------------------PA
R6EKK3_9FIRM/141-352---------------------------------------KIAGI-G----TMTFYD----------------------PK
Q5WF67_BACSK/196-410---------------------------------------SAAGV-G----TMTFYE----------------------PQ
R7JU02_9FIRM/195-406---------------------------------------NMQGI-G----TLTFVE----------------------.P
G4KYV3_OSCVS/183-394---------------------------------------SMAGI-G----TMTFYD----------------------PE
Q3AAN6_CARHZ/161-371---------------------------------------NIAGL-G----TLSYYN----------------------PQ
R5VSI3_9CLOT/188-396---------------------------------------DTQGI-G----TMTYIT----------------------.E
R7MHL3_9FIRM/191-401---------------------------------------STAGI-G----TITFID----------------------KS
R6RU79_9FIRM/209-417---------------------------------------NTQGI-G----TMTYME----------------------.E
R6Q618_9FIRM/187-394---------------------------------------STAGV-G----TVTFYD----------------------KS
R7K1G6_9CLOT/229-438---------------------------------------DTEGI-G----TLTFVT----------------------.E
L0K691_HALHC/214-426---------------------------------------GAAGV-G----TMSFYM----------------------PN
R5FFJ0_9FIRM/179-381---------------------------------------QVDGI-G----TLTFVN----------------------.T
R7G6U2_9FIRM/123-330---------------------------------------KLTGV-G----TLTYYD----------------------PS
R5G573_9FIRM/136-341---------------------------------------NILGV-G----TMTYYD----------------------LK
K0IY14_AMPXN/201-413---------------------------------------SAAGI-G----TMTFLD----------------------PQ
R6USZ2_9FIRM/119-327---------------------------------------KIVGV-G----TLTYYD----------------------PS
R6PFE8_9FIRM/188-396---------------------------------------NTQGI-G----TMTYID----------------------.E
F0T085_SYNGF/157-367---------------------------------------EAAGV-G----TLTFIE----------------------PK
R7HK64_9FIRM/121-328---------------------------------------SITGV-G----TLTFID----------------------PN
R6AWH8_9CLOT/114-319---------------------------------------GISGI-G----TLTYID----------------------PE
R6FWG8_9CLOT/174-386---------------------------------------STAGI-G----TLTFYD----------------------KD
R4KDG0_CLOPA/189-401---------------------------------------STAGV-G----TLTFYH----------------------EK
R5QW36_9FIRM/143-354---------------------------------------NVQGL-G----TVTFLT----------------------.D
R6CRQ2_9CLOT/223-434---------------------------------------NAQGI-G----TMTFID----------------------.S
R7KGU6_9CLOT/123-329---------------------------------------EITGI-G----TLTYID----------------------PD
R6U8G2_9CLOT/143-350---------------------------------------SSAGV-G----TITFYD----------------------KK
R5A3A4_9CLOT/111-319---------------------------------------NVVGL-G----TLTYID----------------------PV
R5J0Y5_9FIRM/119-326---------------------------------------SVTGI-G----TLTFID----------------------PN
D4MXQ8_9FIRM/196-401---------------------------------------NTQGI-G----TMTYVK----------------------GT
Q8EQ48_OCEIH/174-386---------------------------------------SAAGI-G----TMTFYD----------------------PV
R5YPZ4_9MOLU/72-278---------------------------------------KIIGI-G----TLTFID----------------------PN
SP4B_BACSU/201-413---------------------------------------SAAGI-G----TMTFYE----------------------PK

PF03761

Q9U2W2_CAEEL/6-282---------------------------------------SKSGWLL----LAGHKN----------------------RS
Q21628_CAEEL/5-298---------------------------------------ESYQWLV----RVRLKD----------------------GT
O45371_CAEEL/3-276---------------------------------------YFKNWFG----IAAFQN----------------------GN
O76649_CAEEL/2-297---------------------------------------FENPWAV----AAQFQY----------------------YV
A8XIB1_CAEBR/15-285---------------------------------------EPYELNN----VVTFTA----------------------CT
A8WNY9_CAEBR/3-296---------------------------------------GEHPWAV----SVYTRY----------------------YD
Q9XWZ8_CAEEL/4-272---------------------------------------SPVSWLT----KLTRSE----------------------IS
O62223_CAEEL/7-278---------------------------------------KNNRWHI----LAAFEN----------------------GN
O62231_CAEEL/5-272---------------------------------------SQTDWTL----KMHNID----------------------HN

PF00949

Y298_MYCGA/335-468------------------------------------------------------WP------------------------
Y577_MYCPN/197-333------------------------------------------------------VE------------------------
Y083_MYCPN/328-467------------------------------------------------------ND------------------------
Y084_MYCPN/296-431------------------------------------------------------VK------------------------
Y592_MYCPN/334-455------------------------------------------------------WN------------------------
Y589_MYCPN/14-134------------------------------------------------------FE------------------------
Y591_MYCPN/171-291------------------------------------------------------WE------------------------
Y586_MYCPN/154-286------------------------------------------------------YL------------------------
POLG_YEFV1/1503-1655------------------------------------------------------.H------------------------
POLG_DEN1W/1493-1642------------------------------------------------------..------------------------

PF00548

Q8JJT0_PSV13/1680-1844---------------------------------------NLCQV-T----T.....-----------------......S
POLG_HRV8A/1522-1687---------------------------------------NCCVV-T----T.....-----------------......D
Q66776_ERBV1/1905-2095---------------------------------------NVVPV-T----VSTVIE-----------------TENGPLS
POLG_HPE2W/1517-1692---------------------------------------MAYIT-G----S.....-----------------......T
POLG_POL1M/1566-1731---------------------------------------NIVTA-T----T.....-----------------......S
Q9DLK1_FMDVP/1643-1826---------------------------------------NTKPV-E----LI....-----------------....LDG

PF13365

B0EDS2_ENTDS/219-353---------------------------------------..WGE-K....T..........................MFV
A9VAG6_MONBE/28-203---------------------------------------..LGN-G....A...........................VA
B9S6M7_RICCO/99-269---------------------------------------..IES-DD.TGG..........................IIL
C2FHG0_LACPA/165-321---------------------------------------..IGV-D....R...........................IG
A9FFZ4_SORC5/137-265---------------------------------------.....-.....R...........................IL
D0N1Z1_PHYIT/130-271---------------------------------------..FSS-T....L...........................AV
A1VVN7_POLNA/138-318---------------------------------------..VGP-Q....T...........................VI
D4LWF1_9FIRM/167-311---------------------------------------..LKN-D....EA........................FYIM
C6JD09_9FIRM/146-290---------------------------------------..LET-E..................................
C0CMS9_9FIRM/152-296---------------------------------------..ILE-DY..RDY.........................YIL
C4ZI06_EUBR3/149-289---------------------------------------..LRD-N....GKQ.......................LIIL
C0FTN1_9FIRM/149-293---------------------------------------..IAN-S....GQE.......................LLIL
C9L519_BLAHA/148-292---------------------------------------..VAE-S....GQE.......................LFVL
C0B801_9FIRM/151-295---------------------------------------..WDN-GA..DL...........................LI
B0G1M9_9FIRM/149-293---------------------------------------..VAD-NGQELL...........................IL
B0NI56_CLOSV/167-311---------------------------------------..IAD-NGQELL...........................VF
A7B169_RUMGN/176-320---------------------------------------..AAD-N....GQE.......................LLIL
A5KN66_9FIRM/147-291---------------------------------------..AGD-N....GRE.......................FLII
B6FP33_9CLOT/144-288---------------------------------------..VAD-N....GQE.......................LLIL
D4M0U9_9FIRM/159-303---------------------------------------..VAD-N....GQE.......................ILIL
B5CQ59_9FIRM/147-291---------------------------------------..TAD-N....GQE.......................LLIF
C5ELW4_9FIRM/172-316---------------------------------------..IAR-TR.SEI..........................LIL
B7AVI8_9FIRM/172-316---------------------------------------..AEV-DA.EYF...........................VI
D4N037_9FIRM/379-516---------------------------------------..LKG-I....G...........................LI
B8AM75_ORYSI/89-258---------------------------------------..IDF-D....KS.........................SMI
C5WUT2_SORBI/32-182---------------------------------------..VYN-D....NNT.......................CLIL
Q1GZ24_METFK/25-167---------------------------------------..YNR-N....G..........................DFF
A8TSL0_9PROT/61-191---------------------------------------..IDK-G....G..........................LIL
Q126C2_POLSJ/74-216---------------------------------------..IGA-D....G..........................LVL
A2SEV1_METPP/84-217---------------------------------------..IAS-D...GL...........................VL
D3NU60_AZOS1/54-191---------------------------------------..IDG-S....G..........................LIL
B0T7U9_CAUSK/55-188---------------------------------------..ISE-N....G..........................LVL
A9VXT6_METEP/54-187---------------------------------------..IRE-D....G..........................LVL
B9JA65_AGRRK/33-164---------------------------------------..IRN-N....G..........................LVL
D5SQ02_PLAL2/103-278---------------------------------------..IRG-AN.PQEP.........................VVL
A0L9W3_MAGSM/126-265---------------------------------------..ISS-K....G..........................YVA
C5JBN6_9BACT/99-238---------------------------------------..VGA-N....G..........................YVL
C4RAG7_9PROT/100-239---------------------------------------..VSP-N....G..........................HVI
C5JAK2_9BACT/101-240---------------------------------------..SSH-G....H...........................VL
Q75HK9_ORYSJ/40-213---------------------------------------..IDQ-R....G..........................LIM
B7FUE8_PHATC/1283-1490---------------------------------------..VDK-R....LG.........................LVV
A8KF66_BURPE/83-236---------------------------------------..QKP-N....Q...........................IV
B6B9E4_9RHOB/398-528---------------------------------------..VDG-N....G..........................SVL
D0D6Q7_9RHOB/389-519---------------------------------------..VDA-G....G..........................AVA
A9F8J5_SORC5/19-173---------------------------------------..VGP-G....L...........................VL
B8H010_CAUCN/64-248---------------------------------------..VDS-G....ADS.......................ALVV
Q00YL5_OSTTA/68-221---------------------------------------..WYV-D....AND.......................CWIA
Q1PY07_9BACT/57-189---------------------------------------..INE-R....G..........................DII
D2R6U2_PIRSD/68-213---------------------------------------..VSS-E....G..........................EIV
Q7UNU5_RHOBA/96-240---------------------------------------..VSP-A....G..........................HIA
A4A0T0_9PLAN/66-211---------------------------------------..ISP-E....G..........................HIL
D5SYB2_PLAL2/75-226---------------------------------------..ISS-E....G..........................HIA
A6C5I0_9PLAN/58-206---------------------------------------..VSP-E...GH...........................IA
B4V7A8_9ACTO/24-181---------------------------------------..VGN-T....V...........................VL
C3QH30_9BACE/51-184---------------------------------------..ISA-Q....G..........................VGI
D5ST85_PLAL2/188-324---------------------------------------..LAA-D....G..........................VIV
B8EPM5_METSB/283-415---------------------------------------..VND-E....G..........................FVV
A6CCJ8_9PLAN/216-356---------------------------------------SAVGR-T....L...........................IM
A3ZSU8_9PLAN/169-309---------------------------------------SHHGE-A....L...........................VL
Q7URA6_RHOBA/240-384---------------------------------------..IDT-N....GDE.......................ALVL
D2R0U2_PIRSD/218-358---------------------------------------..IDT-H....DDE.......................ALVV
D1CC35_THET1/99-237---------------------------------------..MNL-D....G..........................YIL
A4S513_OSTLU/76-226---------------------------------------..WYI-D....DAY.......................AYIA
A4S4E4_OSTLU/26-173---------------------------------------..VRH-R....GV........................ACVL
Q3IXI9_RHOS4/47-206---------------------------------------..FGQ-GA.GGRL.........................LYL
Q08MN7_STIAD/50-171---------------------------------------..VGS-Q....G..........................QVL
Q7UNU4_RHOBA/89-223---------------------------------------..IDE-Q....G..........................HVL
B8BSP4_THAPS/582-769---------------------------------------..VGF-D....D..........................SII
A9F4P7_SORC5/37-166---------------------------------------.....-.................................AL
Q67SY9_SYMTH/37-178---------------------------------------..LDH-Y....H...........................II
Q1IY94_DEIGD/67-198---------------------------------------TVIGE-E....Q...........................VL
A4A0S9_9PLAN/71-202---------------------------------------..VSA-D....GY.........................LLS
D5SYB3_PLAL2/92-222---------------------------------------..VGS-D....G..........................WIV
D2R6U3_PIRSD/90-221---------------------------------------..ISS-D....G..........................YII
C8N8L7_9GAMM/65-197---------------------------------------..IGD-G....K..........................MIA
Q21G29_SACD2/103-235---------------------------------------..IGD-G....G..........................LIA
Q08Q29_STIAD/85-219---------------------------------------..VSA-Q....G..........................HAI
A4YVG9_BRASO/68-206---------------------------------------..VSA-D....G..........................LAI
A2SCU5_METPP/86-236---------------------------------------..VSD-D....G..........................LIV
B4WI21_9SYNE/33-173---------------------------------------..WKR-G....L...........................IV
Q0RIR2_FRAAA/55-221---------------------------------------..YRS-N....G..........................VIV
A2SLK2_METPP/110-244---------------------------------------..ISG-AE..GL...........................IV
D1CHW8_THET1/35-167---------------------------------------..WAP-S....G..........................LVV
A7NIM6_ROSCS/38-173---------------------------------------..WQI-G....G..........................VVL
B2IZX6_NOSP7/35-159---------------------------------------..WQT-D....G..........................LII
Q01SP4_SOLUE/26-150---------------------------------------..WKP-D....G..........................LIL
Q98IG3_RHILO/78-212---------------------------------------..WSD-G....Y...........................FV
B0U7I8_METS4/36-169---------------------------------------..WKP-G....L...........................VV
Q89E13_BRADU/35-167---------------------------------------..WKP-G....L...........................IV
A7H8S6_ANADF/35-169---------------------------------------..WSA-D....G..........................IVV
B4UF27_ANASK/45-180---------------------------------------..WSA-D....G..........................VVV
Q1DFJ7_MYXXD/51-186---------------------------------------..WDA-E....G..........................HIL
Q3M8K4_ANAVT/33-168---------------------------------------..WRN-G....I...........................II
D1CHW7_THET1/37-171---------------------------------------..WSA-D....G..........................RIV
D1C9X4_SPHTD/41-176---------------------------------------..WRA-D....G..........................LIV
D5WKU5_BURSC/40-175---------------------------------------..WRR-G....V...........................VV
Q7NEY6_GLOVI/37-172---------------------------------------..WRE-G....V...........................VV
Q01SP5_SOLUE/107-240---------------------------------------..WRP-G....V...........................IV
C4Z416_EUBE2/141-284---------------------------------------..VAN-V....NST.......................YLVL
B9FMK5_ORYSJ/181-321---------------------------------------..VSW-D....GATK.....................RAMIV
Q7EYD8_ORYSJ/206-349---------------------------------------..IGW-D....GANK.....................RAKIL
Q6ATB3_ORYSJ/64-208---------------------------------------..VSW-NE..TTRS.......................ATIV
C5Y9X9_SORBI/128-269---------------------------------------..VGW-NE..TTKC.......................ARIL
C5XIJ1_SORBI/75-220---------------------------------------..IGC-Q....GCV.......................TRIL
B9G3S8_ORYSJ/109-256---------------------------------------.EYGP-SK..MS...........................IL
C5WUT6_SORBI/430-572---------------------------------------..VGN-Q....SD........................TRIL
C5YNZ0_SORBI/297-442---------------------------------------..INY-DG.CPT...........................IL
C5YX14_SORBI/284-426---------------------------------------..IGW-N....GS........................TKIL
Q0JIU9_ORYSJ/149-291---------------------------------------..IEW-N....GC........................TSIL
D3W785_9VIRU/161-295---------------------------------------..IYD-G....GD.........................YLL
Q82G14_STRAW/89-242---------------------------------------SVVRS-T....AH........................DLIV
C7QED1_CATAD/56-225---------------------------------------TSLSS-DR..AL...........................ML
C9Z823_STRSW/62-228---------------------------------------..RFP-DS..LDTD......................PALVL
C9ZGQ1_STRSW/72-240---------------------------------------PASED-ND..PA..........................LVM
Q93JK9_STRCO/54-222---------------------------------------PASED-D....DP........................ALVM
B8AXY3_ORYSI/1277-1457---------------------------------------..VAE-N....GNS.......................LYLL
D2QDD9_SPILD/31-236---------------------------------------..INE-E....G..........................CAI
C5Y9N3_SORBI/149-346---------------------------------------..VAA-N....DTT.......................LRVL
Q92JT1_RHIME/45-189---------------------------------------..VSV-E....G..........................HVL
B0C7H5_ACAM1/63-201---------------------------------------..ISK-Q....NNT.......................YLVL
Q15T30_PSEA6/50-191---------------------------------------..IGE-RD.EYL..........................YLV
A5E551_LODEL/303-457---------------------------------------..YKP-N....V...........................FI
A3LV17_PICST/282-443---------------------------------------..YNE-T....T...........................LV
Q6BLK4_DEBHA/295-454---------------------------------------..YNH-T....T...........................LV
A5DCA5_PICGU/274-427---------------------------------------..VSS-V................................LV
D0N2P9_PHYIT/200-360---------------------------------------..IGS-E....G..........................HLL
Q846R2_MYXXA/58-225---------------------------------------..VGS-Q....G..........................HLM
D3QBE9_STANL/212-368---------------------------------------..VGN-T...NR...........................LL
D3PTY7_STANL/202-361---------------------------------------..VGS-K....N..........................RLL
A0CQA0_PARTE/272-415---------------------------------------..VND-Q....LNK......................QSYIL
A3WZP2_9BRAD/25-182---------------------------------------..IDV-D....DR........................HYLI
B5JQS5_9BACT/61-197---------------------------------------..IDE-K....G..........................TVL
A1DKZ3_NEOFI/106-274---------------------------------------..IHP-D....G..........................WLL
C9SS84_VERA1/110-286---------------------------------------..VDS-S....G..........................ILM
B2ACI3_PODAN/114-282---------------------------------------..IHP-S....G..........................LLL
B1XYW2_LEPCP/349-527---------------------------------------..VRA-A....DFGLTP.................GEELLVL
C0DWH2_EIKCO/92-250---------------------------------------..VST-E....G..........................HIV
C1N754_MICPC/393-574---------------------------------------..TAG-D....GARG....................HPALIL
C1EFA7_MICSR/414-629---------------------------------------HGSGG-E....GEEGGGGIGGVGGVEWGGGGGGRPVRALVL
C0PL31_MAIZE/403-612---------------------------------------..LNK-R....G..........................LVL
A9TAV2_PHYPA/699-919---------------------------------------..LNK-T....G..........................LIL
DEG15_ARATH/376-594---------------------------------------..LNE-H....G..........................LIL
Q0PY37_SOLLC/412-632---------------------------------------..LNK-Q....G..........................LLL
B9H2S3_POPTR/409-631---------------------------------------..LND-Q....G..........................LIL
A5BEH1_VITVI/502-717---------------------------------------..LNS-Q....G..........................LIL
A8I3D5_CHLRE/134-313---------------------------------------..WDT-A....GP.........................HVV
C1N5V8_MICPC/175-398---------------------------------------..WSD-R....G..........................YVV
D3LKZ9_MICLU/283-419---------------------------------------..VAP-D....R...........................VL
D2S688_GEOOG/217-353---------------------------------------..YAP-E....R...........................VM
D3QA66_STANL/219-357---------------------------------------..YDA-D....RD.........................LVL
B4V9A1_9ACTO/51-211---------------------------------------..IAP-G....W...........................VL
Q10YA2_TRIEI/28-156---------------------------------------..VTP-G....H...........................IL
B4W048_9CYAN/24-160---------------------------------------..VAP-E....W...........................IL
B7KID8_CYAP7/23-153---------------------------------------..VSP-R....L...........................IL
B1ZW96_OPITP/85-238---------------------------------------..IAV-E....G..........................RVL
C4RBC6_9ACTO/39-187---------------------------------------..VAP-A....T...........................VA
C6AVQ8_RHILS/33-192---------------------------------------..IGE-G....V...........................FV
C1MYV6_MICPC/213-422---------------------------------------..IGG-G....W...........................IL
B6BL05_SULGG/72-191---------------------------------------..VSN-N....G..........................DLV
D2QY05_PIRSD/202-373---------------------------------------..TEN-T....GGK.......................LRLF
A4YLF4_BRASO/29-179---------------------------------------..VDA-L....H...........................VI
Q08Z65_STIAD/79-228---------------------------------------..IGT-E....HTEEG...................RFSYVI
Q2II41_ANADE/64-213---------------------------------------..FAH-E....GGR.......................SYVL
B3S5U4_TRIAD/329-491---------------------------------------..IDR-YK..GL...........................II
A0LWM1_ACIC1/250-384---------------------------------------LPQAS-GS.QTT...........................LV
B4D4S9_9BACT/50-179---------------------------------------..LKM-GN..QT..........................FLI
B4CWZ7_9BACT/330-461---------------------------------------..CRM-GN..QT..........................WLF
B4D163_9BACT/76-206---------------------------------------..ARL-G....GV........................NFLF
B4CWZ6_9BACT/327-458---------------------------------------.RLGD-K....A..........................WLF
Q2YD45_NITMU/56-221---------------------------------------..LGA-D....Q...........................VI
B4UTS4_BP163/66-193---------------------------------------..IGG-G....R...........................II
D5UDV9_CELFN/76-207---------------------------------------..LDE-H....T...........................LV
Q11LS4_CHESB/40-170---------------------------------------..IGD-G....Y...........................II
C6XD83_METGS/47-175---------------------------------------..VAP-N....K...........................VL
C6WVZ4_METML/47-174---------------------------------------..VEQ-N....K...........................VI
B6BVZ4_9PROT/47-175---------------------------------------..VAK-D....H...........................VV
B6BWJ8_9PROT/54-182---------------------------------------..IKK-N....H...........................VA
B9TJ43_RICCO/62-190---------------------------------------..VSP-E....Y...........................VA
C6WXC4_METML/54-182---------------------------------------..VAK-D....Q...........................VV
B9TFS6_RICCO/49-177---------------------------------------..VAP-D....Y...........................VA
C6XBL7_METGS/51-179---------------------------------------..VAE-N....L...........................VA
A9ZKZ5_COXBE/58-186---------------------------------------..TSK-T....T...........................LV
A2SLB0_METPP/51-178---------------------------------------..VGP-G....R...........................VV
C7RR92_ACCPU/56-182---------------------------------------..IGE-A....Q...........................VV
C7RR91_ACCPU/52-180---------------------------------------..VHA-G....R...........................VV
Q2W2I3_MAGSA/355-483---------------------------------------..MDE-R....T...........................VV
C6BGJ0_RALP1/55-184---------------------------------------..IAD-G....V...........................AI
Q3B4M2_PELLD/76-203---------------------------------------..LPG-G....T...........................VA
B3QPC6_CHLP8/57-184---------------------------------------..MPD-G....K...........................VA
Q0YS38_9CHLB/89-216---------------------------------------..ISS-G....H...........................VI
D1W141_9BACT/221-392---------------------------------------KTLQA-S....GSVGFRA..............KLNGKKGFV
C9BDM8_ENTFC/121-272---------------------------------------..YGN-K....V...........................AV
A3XNG0_LEEBM/39-192---------------------------------------..FES-G....K..........................QII
C7PQR9_CHIPD/410-553---------------------------------------..LKG-V....G...........................LV
A3SCU7_9RHOB/196-330---------------------------------------..LDG-V....G...........................LV
D2R620_PIRSD/144-326---------------------------------------..VGP-N....L...........................MM
Q211I3_RHOPB/126-305---------------------------------------..VGS-D....LGS.......................DIIV
C7PQU4_CHIPD/127-299---------------------------------------..VAP-D....I...........................VV
A3JWZ9_9RHOB/120-292---------------------------------------..VAE-H....I...........................VV
A6LC71_PARD8/50-181---------------------------------------..ITE-T....G..........................EAL
A5ZI03_9BACE/49-181---------------------------------------..VSE-D....G..........................LAL
B5CVV9_BACPM/52-183---------------------------------------..IDE-N....G..........................TAV
C3Y9V9_BRAFL/396-567---------------------------------------..IGR-K....K...........................ML
C3Y7C8_BRAFL/939-1107---------------------------------------..LSK-G....K...........................VL
C3YHU1_BRAFL/637-805---------------------------------------..LNK-G....K...........................VL
B9G3S5_ORYSJ/55-216---------------------------------------..VYN-A....GRK.......................FLIL
B3EEJ2_CHLL2/96-337---------------------------------------..VGR-D....G..........................KIA
Q1D137_MYXXD/39-183---------------------------------------..VTE-R....L...........................VV
B5HRW8_9ACTO/52-200---------------------------------------..VAE-G....V...........................VV
B8M3P5_TALSN/58-198---------------------------------------..VNK-Q....FG.........................LFF
NM111_PICGU/100-246---------------------------------------..VDS-E....RG.........................YIL
D0MZM5_PHYIT/91-230---------------------------------------..VDA-E....KG.........................IIL
YH05_SCHPO/99-245---------------------------------------..VNK-TL..GL...........................IL
C1EGI7_MICSR/60-206---------------------------------------..VDA-A....RG.........................LIL
A9RQ61_PHYPA/48-194---------------------------------------..VDK-Q....RG.........................IIL
B9IN99_POPTR/46-189---------------------------------------..IDE-G....R..........................HII
A9AU45_BURM1/75-243---------------------------------------..VAP-G....V...........................LI
Q10V37_TRIEI/25-170---------------------------------------..YRK-D....NY........................TYLL
B6SLW3_MAIZE/46-198---------------------------------------..IKK-R....LDG......................RCVLC
B9YD37_9FIRM/27-200---------------------------------------KIIDD-D....KYQ.......................PFMV
B8BM04_ORYSI/29-174---------------------------------------..IGK-T....RKS.......................YVAM
B4CXG1_9BACT/84-257---------------------------------------..VEH-Q....GH........................YLFV
D1W398_9BACT/21-163---------------------------------------..VDD-N....R...........................LL
A6L245_BACV8/25-170---------------------------------------..IGN-G....Y...........................LL
I8UI46_PORGN/27-170---------------------------------------..IKD-D....T...........................LL
Q7Q9T3_ANOGA/284-425---------------------------------------..FEL-N....GK........................RYII
B3NQY9_DROER/305-445---------------------------------------.RVHN-K....R..........................FIL
F111B_HUMAN/475-664---------------------------------------..FNG-G....Y...........................IF
D4A8N0_RAT/367-556---------------------------------------..FKG-L....Y...........................IL
B3DXV6_METI4/79-214---------------------------------------..IDP-K....G..........................IVI
B4VL88_9CYAN/23-161---------------------------------------..VSS-D....G..........................YLL
A8ZQB3_ACAM1/33-191---------------------------------------..LSG-R....Y...........................II
B0JTN4_MICAN/27-184---------------------------------------..ISS-E....Y...........................LI
B8HMX0_CYAP4/25-181---------------------------------------..VSD-R....Y...........................LL
Q9Z529_STRCO/60-203---------------------------------------..ADH-H....G..........................TVL
A8YNP5_MICAE/435-587---------------------------------------..VKR-Q....GTT.......................VWII
A7BUM9_9GAMM/28-164---------------------------------------..ISF-E....G..........................HIL
A8FZT0_SHESH/365-519---------------------------------------..VKG-KE..LHASFG...................DKTVLL
A8TZT7_9PROT/75-215---------------------------------------..VGV-G....V...........................WM
C6XKV2_HIRBI/68-210---------------------------------------..IDQ-K....G..........................LWM
B0T391_CAUSK/70-212---------------------------------------..VDD-G....G..........................SWL
Q0C5Y2_HYPNA/27-169---------------------------------------..VNS-R....G..........................DWL
B4D8F4_9BACT/72-317---------------------------------------..INK-D....G..........................YIV
D2R618_PIRSD/120-277---------------------------------------..VGS-D....L...........................II
Q1DE46_MYXXD/139-306---------------------------------------..VSP-S....V...........................VL
B8ICT9_METNO/161-326---------------------------------------..VGS-G....L...........................VL
B4VV96_9CYAN/140-327---------------------------------------..LGP-S....V...........................VM
B3PHV0_CELJU/204-337---------------------------------------..FNS-I....G..........................QLL
B4VT06_9CYAN/299-436---------------------------------------..IGK-N....L...........................LL
Q2P9Y4_9ACTO/162-308---------------------------------------..ITD-D....L...........................LL
D4GHS4_PANAM/109-260---------------------------------------..TYG-N....L...........................FV
A3VZZ0_9RHOB/114-264---------------------------------------..VAP-G....L...........................IL
A9ERE8_SORC5/153-297---------------------------------------..VTG-D....F...........................LV
B2J8D1_NOSP7/164-308---------------------------------------..VAE-D....L...........................LL
B6R9Y4_9RHOB/91-243---------------------------------------..VGP-N....L...........................LL
C6X4V5_FLAB3/104-266---------------------------------------..LAP-G....I...........................LI
B6QXD8_9RHOB/76-232---------------------------------------..VGH-G....L...........................MM
Y4FB_RHISN/90-251---------------------------------------..IGP-R....L...........................LL
A9GTT3_SORC5/149-297---------------------------------------..IEG-R....L...........................LL
B8END1_METSB/102-257---------------------------------------..ISA-D....L...........................FL
D3CTM8_9ACTO/100-254---------------------------------------..VSP-W....L...........................LL
Q467S2_METBF/103-254---------------------------------------..VGP-N....L...........................LL
C3HBL0_BACTU/109-260---------------------------------------..VSP-S....L...........................LL
D2BAE5_STRRD/123-274---------------------------------------..VSP-R....L...........................LL
D2R623_PIRSD/145-303---------------------------------------..ISP-S....L...........................FM
G2TE04_RHORU/145-306---------------------------------------..VAP-D....V...........................VL
Q9RTZ8_DEIRA/130-275---------------------------------------..CSP-Q....V...........................MV
D0LEN3_GORB4/141-289---------------------------------------..VSP-T....L...........................LL
E3IWP0_FRASU/134-282---------------------------------------..VSP-E....L...........................LL
A1WX57_HALHL/64-228---------------------------------------..IAD-G....N..........................AVL
Q3SMJ5_THIDA/81-243---------------------------------------..LDG-R....H...........................VV
Q15WK4_PSEA6/58-219---------------------------------------..FGD-G....T..........................LIA
A4BT63_9GAMM/57-219---------------------------------------..VDN-G....R..........................RII
A4A524_9GAMM/61-225---------------------------------------..VES-E....GK........................SYVV
B4VWK9_9CYAN/26-185---------------------------------------..IRA-D....G..........................YLI
D0LGQ1_HALO1/668-816---------------------------------------..VAR-D....GNE.......................LAIL
Q0AUX9_SYNWW/105-235---------------------------------------..LEA-E....G..........................MII
B9M1H9_GEODF/322-480---------------------------------------..VRG-SE.LCLGWG....................DAPVFV
D3PR00_MEIRD/62-196---------------------------------------..ISA-D....G..........................LVM
Q72KS5_THET2/61-193---------------------------------------..VGK-D....E...........................AL
B7A6E3_THEAQ/62-195---------------------------------------..YAP-G....L...........................VL
D3FST1_BACPE/122-248---------------------------------------..VSS-E....G..........................LIV
C0GIE8_9FIRM/109-240---------------------------------------..VEQ-D....G..........................RII
A6CKL8_9BACI/105-229---------------------------------------..IAE-D....G..........................TIV
Q1D8L6_MYXXD/88-220---------------------------------------..IQA-SA.GPV...........................VL
B0CAU9_ACAM1/85-242---------------------------------------..VSQ-D....NA........................VFLL
D3B2A3_POLPA/90-296---------------------------------------..VKK-D....I...........................II
D2R1J4_PIRSD/67-236---------------------------------------..VGD-G....I...........................AL
E0U9M4_CYAP2/69-211---------------------------------------..ITE-D....KNT.......................YWIM
B7KH20_CYAP7/52-196---------------------------------------..LSQ-D...ENQ........................YWVL
B2XS89_9VIRU/586-711---------------------------------------..FMN-Y................................IL
D2Q0V1_KRIFD/123-243---------------------------------------..LPD-G....I...........................VL
B3QZR5_PHYMT/297-472---------------------------------------HKIKD-T...EYE........................YYVL
NS1A_OASV1/438-558---------------------------------------..VKN-N................................LV
Q84SQ1_ORYSJ/91-253---------------------------------------..ISS-T....ADG......................KCIVL
NS1AB_HASV1/447-565---------------------------------------..SGN-D................................IV
A8YFS3_MICAE/52-220---------------------------------------QKYIF-K....GQEG....................YLYTVL
B8HSI3_CYAP4/55-201---------------------------------------..INR-S....ADL.......................YTVL
Q4C9U0_CROWT/64-213---------------------------------------..ISK-K....SNI.......................YTVL
B7KEX9_CYAP7/49-192---------------------------------------..IEV-EG.ICA...........................VL
Q11A08_TRIEI/47-187---------------------------------------..PGE-T....GV........................CKVL
Q111L2_TRIEI/52-195---------------------------------------..VEV-E....GKSE.....................VCSVL
B4VKH5_9CYAN/399-535---------------------------------------..IAK-H....KET.......................YYVL
A0YM55_LYNSP/62-208---------------------------------------..VAK-L....GQK.......................YTVL
Q113N3_TRIEI/93-237---------------------------------------..IGR-K....DSV.......................YYVL
B0C4I5_ACAM1/51-195---------------------------------------..IKR-N....DNI.......................YTVL
Q060L2_9SYNE/66-212---------------------------------------..VKK-D....GNT.......................YTVL
A2CDP2_PROM3/91-233---------------------------------------..VKQ-E....GNR.......................YTVL
B0C7H5_ACAM1/295-465---------------------------------------..IAR-Q....GQT.......................YTVL
A0ZIJ6_NODSP/50-187---------------------------------------..VAR-K....GNT.......................YTVL
B5W7L6_ARTMA/53-196---------------------------------------..IAR-E....GDL.......................YYVL
B0JV48_MICAN/59-215---------------------------------------..IAK-E....GKV.......................YTVL

PF01732

A5IYK2_MYCAP/279-649TDY------......YELLI--------------------------------ATNIHVFS.LRNTFDKSLHMKDLKDT..
D9QW46_MYCMG/258-617KNN------......YKLLL--------------------------------ATNIHVFS.LRKTFDKSIFNNK......
Q2SR25_MYCCT/264-622KDN------......YELLL--------------------------------ATNIHVFN.LRNTFDKSIFNNK......
D3VQF5_MYCA6/359-733DDS------......YELLL--------------------------------ATNVHVFN.LRNAFDRSLYFDS......
Q4A635_MYCS5/147-497PKE------......ITLYL--------------------------------ATNFHVATNLRTANDYEFYVQNS.....
Q4A5A2_MYCS5/91-491DTQ------......YKMFF--------------------------------GTNFHVAAGIVTAQNVNENVAQNDV...
C7LM95_MYCML/189-571ENK------......YKLFL--------------------------------ATNLHVLSEFSNSLTEEQNKEFNYYD..
A5IYA1_MYCAP/186-569DNK------......YKLFL--------------------------------GTNLHVLARFSNSLEKEKQEKLNYYD..
Q4A798_MYCH7/125-523ENN------......YKLFF--------------------------------ATNLHVASHLSNTLDENLGKKLNYED..
Q4A5G2_MYCS5/337-740PNK------......YKLFL--------------------------------ATNLHVIGYLSNTLTEEQDKHLNYFD..
D3FFM3_MYCGH/244-661NNQ------......LKLFI--------------------------------ATNLHVIGNYGNTNSKELDDLLSYSD..
C5J6P1_MYCCR/115-482KTE------......VMLYI--------------------------------ATNAHVFARSFNTLDAKYKQTFPEYFTD
D3FH76_MYCGH/221-623PDL------......YRLFL--------------------------------ATNLHVAQTLWNKNDFDRPVTDL.....
D3FHN8_MYCGH/203-712GYP------......TKWYL--------------------------------ATNAHVAAGFMKAKSDGSRFTNIVDLNA
D3FHQ1_MYCGH/203-710GYP------......TKWYL--------------------------------ATNAHVAAALMKKESDGSRFTNIVDEKA
Q4A5P6_MYCS5/166-643SYP------......TKWYI--------------------------------ATNIHVIGDLTFTKSQTDSFGSDFTSIY
D1J8A8_MYCHP/334-723KYP------......TKWYF--------------------------------ATNLHVAD....................
B1RXG0_UREUR/379-750KYP------......TKWYF--------------------------------ATNLHVAD....................
A0A024FAH6_UREPR/376-752KYP------......TKWYF--------------------------------ATNLHVAD....................
B1AI32_UREP2/413-786KYP------......TKWYF--------------------------------GTNLHVAE....................
D9QXV8_MYCMG/283-769KNP------......TKFYF--------------------------------GTNSHVAK....................
C7LKT8_MYCML/288-775KTP------......TKFYF--------------------------------GTNSHVAK....................
Q98Q64_MYCPU/350-715KYP------......TKWYF--------------------------------GTNVHVID....................
Q98QS3_MYCPU/339-702AYP------......TKWLF--------------------------------ATNVHVSS....................
D3FJ19_MYCGF/216-600KYP------......TTWYF--------------------------------ASNMHVLENLLLPDIAGTSNDFRDFEHR
D3FHK1_MYCGH/204-545SYP------......TTWYF--------------------------------ASNFHVLQHLQLAGDSQALIR.......
Q4A7B5_MYCH7/323-738KYP------......LTWYF--------------------------------ITNAHVLNRLLVANDYHPDSIYGRDEDA
Q98PH9_MYCPU/101-415SYP------......LTWYF--------------------------------ATNAHVATYFSSRDFPESTK........
Q8EWB5_MYCPE/130-442SYP------......LTWYF--------------------------------ATNAHVIQNLRVKNDIITPERYENIE..
Q8EW95_MYCPE/145-484SYP------......LTWYF--------------------------------GTNAHVIDDLKVKDDKLYPEKFGTWDPS
Y068_MYCGE/48-383NDP------......FKVYL--------------------------------ATNLHVIDALRNNND...YEPY.NKDSN
H0PPR7_MYCPM/45-410TDP------......FLIYL--------------------------------ATNLHVVDALRNPQD...YEPY.NKDSN
M1GCC9_MYCPM/75-444DDQ------......FTVYL--------------------------------ATNLHVADALRNDQD...YEPY.KKDQN
J3UDP5_MYCGT/89-428QGS------......FFAYI--------------------------------ATNLHVADGLRNIGD...HWPY.SKTDD
M1GHC3_MYCPM/104-443DNK------......FTAYL--------------------------------ATNLHVADSLRNKDD...YKPY.NKDGN
Y083_MYCPN/52-447ANL------......FTAYI--------------------------------ATNLHVADGLKNDQD...YAPY.NKDGW
M1GE88_MYCPM/44-388ANK------......FTVYL--------------------------------ATNLHVIQALKNRED...HPPYNQFD..
Q4A8M7_MYCH7/557-908KNP------GKFLPTNTYYL--------------------------------ATNLHVIADLLNKPDQVYSFSY......
Q8EWN7_MYCPE/57-397SND------......FSYYL--------------------------------ATNMHVLSNLNSLNNTTTRY........
B1RXU5_UREUR/59-344ENI------......KTYYL--------------------------------ATNIHVINLI..................

PF02122

P1_TYYVF/206-408QSP------------PKSCV--------------------------------IPITHASGN-------------------
P1_PLRV1/207-407QKP------------PKSAV--------------------------------IELQHENGS-------------------
Q17S70_9LUTE/218-418MSP------------PKSCV--------------------------------LEMLHDDEQ-------------------
Q2L3H9_9LUTE/218-419MSP------------PGHSV--------------------------------LEIVHPDDS-------------------
P1_PNLV/224-424QKS------------PKKSV--------------------------------IELSFSNGS-------------------
Q65968_9LUTE/202-403QNP------------PKNSV--------------------------------LQVQYKDGS-------------------
Q670I3_9LUTE/214-415QNP------------PKHSV--------------------------------VEIIHPDGS-------------------
Q70AF6_9LUTE/441-642EEE------------DDFVV--------------------------------EANSPLPDK-------------------
Q83737_9LUTE/202-414QSP------------PRNCI--------------------------------LQIQHADGS-------------------
P1_PEMVW/318-522EDP------------PKGVI--------------------------------LRCTDQFGD-------------------
Q76VQ5_9LUTE/210-411STP------------PKRSV--------------------------------IMMRRQNKE-------------------
Q8JZ11_9LUTE/202-403QSP------------PKNSV--------------------------------LQVQHPDGS-------------------
Q91AV6_9LUTE/212-414MKP------------PKNSI--------------------------------LLISHDDGS-------------------
Q9EB08_9VIRU/363-572GKY------------WADED--------------------------------EDELPPPPK-------------------
Q9IZF6_9LUTE/208-408QSP------------PKKSV--------------------------------ITLRRADKT-------------------

PF00944

POLS_SFV/112-268---------------CMKIE--------------------------------NDCIFEVK--------------------
POLS_SINDV/107-265---------------ALKLE--------------------------------ADRLFDVK--------------------

PF10459

A1SA55_SHEAM/18-726SDD......NYRCSVRSFHN--------------------------------GLEYYLIKQLMIRDVRLVYAPPESVG--
E0THX8_PARBH/23-721EQA......GHRCQVASFYG--------------------------------GLQYKLIDRLEIRDVRIVYAPGDNIG--
F2GAE2_ALTMD/22-719SEA......GFRCSVPSFFQ--------------------------------GLEYKLIKQMEIRDVRIAYAPADSIG--
A5FMW8_FLAJ1/19-712ENG......KYTVSVRPFFQ--------------------------------GNEYYYFVYQDYTDVRLVGTPPESVG--
A6GWM2_FLAPJ/17-707KEA......WQENKVRTFFE--------------------------------GNQYILFVTEVFKDVRLVGAPPSLIG--
A6KZW8_BACV8/17-706AND.....TLLRAEITPFYG--------------------------------GNEFYLSVYKDYYDVRLVFAPPSSVG--
A6L2J7_BACV8/19-726EQENIEITPFTALELKPFYG--------------------------------ANRYYLFIKTIYKDVRMVGAPPSSIG--
A6L2J8_BACV8/21-719KASDLNGKAGISAQALPFYA--------------------------------GNKFYLIYLKTYSDVRMVAAPPSSIG--
A6LID5_PARD8/19-717GEKFLQDNPGTEVEIKAFYG--------------------------------GNKYYMFTKKIYSDVRLVGAPPSSIG--
A7HA06_ANADF/20-725KP.......GLRCTVASFFE--------------------------------GARWFEIGQLEIQDVRLVFAPPGNVG--
A7HFU9_ANADF/37-699TSD......ELRCDVVTLYQ--------------------------------GGVYDLYKYRRFQDVRLVFAPEFAIA--
Q024G1_SOLUE/22-694KSD......GMHCSVATFDG--------------------------------GLQYVLITTIELSDIRLVYAPPRAIG--
Q029T1_SOLUE/24-727KG.......GQRCNVASFFA--------------------------------GLKYFEIAQMEIKDVRLVYAPAEGIG--
Q07XT1_SHEFN/18-727SDD......NYRCSVNSFHH--------------------------------GLEYYLTKQLIIRDVRLVYAPPKSVG--
Q08VC9_STIAD/18-714KRP......ATRCQVASFDG--------------------------------GSQYVLVDSVELADVRLVYAPPRAVG--
Q11SC7_CYTH3/21-702EED......AYTVEVEDFFE--------------------------------GNQKILFVYQIFTDIRLVGAPPSAVG--
Q12RW4_SHEDO/18-728ADD......NYRCEVNSFHN--------------------------------GLEFYLTKQLIIRDVRLVYAPPESVG--
Q1D5W7_MYXXD/35-700AGN.....AKARCDVVTLYQ--------------------------------GGQYNLYEYKRFQDVRLVMAPEHAIA--
Q1D9F6_MYXXD/17-714KRP......ATRCQVATFDG--------------------------------GVNYTLVDAVELTDVRLVYAPPRAVG--
Q1DDZ2_MYXXD/18-682TSG......DVRCDVVTLFN--------------------------------GGKYHLYKYRRFQDVRLVFAPEFSMA--
Q1GVV7_SPHAL/23-684DRD......TTRCQVVTLFG--------------------------------GGQYKLYKYRKYSDVRIAWAPEFQAA--
Q1IPC2_KORVE/27-692TE.......GFKCDVVTLYA--------------------------------GAMYHLYKYKKYTDVRLVFAPEFQMA--
Q2G546_NOVAD/56-713DAA......TTRCEVVTLFG--------------------------------GGQYKLYTYRKYADVRLAWAPQFQAA--
Q2IEV3_ANADE/18-687GGD.....AGLRCELVELYH--------------------------------GGVYSLYQYRRYDDVRLVFAPEFAIA--
Q2S133_SALRD/5-639.........GRHVEVAADGE--------------------------------GA.YTAYTYRRHEDVRVALLPDRRIS--
Q2S134_SALRD/69-734EASTR..DSSLRVEVKALYQ--------------------------------GARYTAYTYRRYEDVRLVMAPELQLG--
Q488S2_COLP3/26-729NDD......RYRCSVVNFHG--------------------------------GLEYYLFKQLTIRDVRLVHAPASSIG--
Q5LIW7_BACFN/34-723KKD.....STLVGIVDAYYG--------------------------------GNEFWLSVYRDFNDVRLVFAPPSSIG--
Q5QV86_IDILO/17-717EDE......GHRCTVAAYYG--------------------------------SLEYYLIKQLEIKDVRLVHAPASGVG--
Q7MV25_PORGI/21-718GKNFSAKNPGLSVEIKAFYG--------------------------------GNLYLMFTKKTYTDVRLVGAPPTSIG--
Q7MWU6_PORGI/24-711ADE......NQLCIVEPFYS--------------------------------NNEYFLIVYDVFKDVRMVFAPPSSVG--
Q7NHA9_GLOVI/34-698DAT......GLRCDVVNLYQ--------------------------------GGLYNLYKYKRYQDVRLVFAPEFRIA--
Q7UKL5_RHOBA/28-688DET......GLRSDVVTLFG--------------------------------GAKYHLYRYKKYTDVRLVWAPETAAA--
Q8A2L6_BACTN/20-711EKD.....STLTGIVDAYYA--------------------------------GNEFWLSVYRDYNDVRLVFAPPSSVG--
B2FQN5_STRMK/22-717ADA......GFRCRLYSFSG--------------------------------GNTYRLFRNMEIKDVRLVYAPPGSVG--
E3FSI6_STIAD/18-681TSD......QVRCDVVTLYQ--------------------------------GGKYNLYKYRRFQDVRLVFAPEHAIA--
Q5LB16_BACFN/20-719KAENIQITPATRLELKPFYG--------------------------------GNKYYLFVKTVYNDIRMVGAPPSSIG--
Q8EAI4_SHEON/18-728ADD......NYRCNVRSFHN--------------------------------GLEYYLIKQLMIRDVRLVYAPPESVG--
Q8EHX9_SHEON/18-716KDE......GYRCQVYSFHG--------------------------------GLEYYLVKQLEIRDVRLVYNPAGSVG--
Q9PC94_XYLFA/22-713EEQ......GYRCQFFSFAG--------------------------------GNTYRVFKNLEIKDVRLVYAPQGSVG--
R5U6M0_9BACE/21-717NKSDLKDKKGIVPQALPFYA--------------------------------GNKFYLFYKKIYPDVRMVAAPPSSIG--
R6WQY4_9PORP/22-710NTE......FQAADVVPFYN--------------------------------NNKYFLIVYDVFNDVRMVFAPPSSVG--
R6Y7C6_9PORP/19-717GEKFLQDNPGTEVEIKAFYG--------------------------------GNQYFMFTKKIYSDIRLVGAPPSSIG--
R7EE18_9BACE/20-708RKD.....STLIGIVDAYYG--------------------------------GNEFWLSVYRDYNDVRLVFAPPSSVG--
R7EGG9_9BACE/23-719EKSDLKGKPGIEVRALPFYA--------------------------------GNKFYMFYYKVYSDVRMVAAPPSSVG--

PF02907

POLG_HCVJL/1060-1208TQT-----------------------------------------------------------------------------
POLG_HCVNZ/1062-1210TQT-----------------------------------------------------------------------------
POLG_HCVEV/1057-1205TQT-----------------------------------------------------------------------------
O56074_9FLAV/1007-1154TTR-----------------------------------------------------------------------------
Q96898_9FLAV/992-1139TTR-----------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071TSR-----------------------------------------------------------------------------
POLG_GBVB/970-1118ATS-----------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208TQS-----------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204TQS-----------------------------------------------------------------------------

PF05409

R1A_CVH22/2994-3281RHSFRTLKSGEGFNILACYD--------------------------------GCAQGVFGVNMRTNWTIRGS--------
R1A_IBVB/2808-3096KYKFIKANCGDSFTIACAYG--------------------------------GTVVGLYPVTMRSNGTIRAS--------
B6VDX7_THCOV/2516-2804DYEFVRLTPGSSMTIACAYD--------------------------------GVVRNVYHVVLQTNNLIYAS--------
R1AB_FIPV/2932-3219EHKFKSVRPGESFNILACYE--------------------------------GCPGSVYGVNMRSQGTIKGS--------
R1A_CVHSA/3269-3559KYKFVRIQPGQTFSVLACYN--------------------------------GSPSGVYQCAMRPNHTIKGS--------
R1A_CVMA5/3362-3648KYSFGVVKPGETFTVLAAYN--------------------------------GRPQGAFHVTLRSSHTIKGS--------

PF09342

Q7QJ48_ANOGA/1774-1887---------------TNIYL--------------------------------DGVM------------------------
Q8WSJ2_BOMMO/1523-1637---------------AKVYV--------------------------------EGNY------------------------
NUDEL_DROME/2041-2158---------------ADVYM--------------------------------NGDL------------------------

PF00089

CFAI_HUMAN/340-569AQL------------GDL..--------------------------------..PWQVAIKDAS.........GI-----
SP24D_ANOGA/50-264ASE------------GQF..--------------------------------..PHQVALLRGNA.........L-----
TRY5_AEDAE/40-260VPV------------EEV..--------------------------------..PFQVSLSGVGS........SH-----
A0A024QZM9_HUMAN/179-419TTI------------ENQ..--------------------------------..PWFAAIYRRHRGG....SVTY-----
MASP1_MOUSE/454-696AQK------------GTM..--------------------------------..PWIAMLSHLNG........QP-----
CTR1_ANOGA/33-250AKN------------GSA..--------------------------------..PYQVSLQVPG........WGH-----
CFAD_HUMAN/26-248AEA------------HAR..--------------------------------..PYMASVQLNG.........AH-----
ACRO_RAT/43-286SSP------------GAW..--------------------------------..PWMVSLQIFTSHN...SRRYH-----
HPT_HUMAN/162-399DAK------------GSF..--------------------------------..PWQAKMVSHHN.........L-----
CASP_MESAU/445-682AKI------------QSF..--------------------------------..PWQVFFEFPR...........-----
A8JQZ2_DROME/186-427TRH------------GLF..--------------------------------..PHMAALGWTQGSGSKDQDIKW-----
PCE_TACTR/128-370API------------GAW..--------------------------------..PWMTAVYIKQGG.....IRSV-----
STUB_DROME/544-782AAF------------GRW..--------------------------------..PWQVSVRRTSFFG...FSSTH-----
TRYU_DROME/28-254TSS------------YYT..--------------------------------..KYVVQLRRRSSSS...SSYAQ-----
TRYI_DROME/28-245QLI------------RNA..--------------------------------..PWQVSIQISAR.........H-----
TRYB_MANSE/25-252TTI------------QQY..--------------------------------..PTIVALLFSRNGN....TFFQ-----
TRYP_FUSOX/25-244ASA------------GDF..--------------------------------..PFIVSISRNGG.........P-----
B1VV86_STRGG/37-252AAQ------------GEF..--------------------------------..PFMVRLSM.G...........-----
TRY1_HUMAN/24-239CEE------------NSV..--------------------------------..PYQVSLNS.G.........YH-----
TRYP_PIG/9-224CAA------------NSI..--------------------------------..PYQVSLNS.G.........SH-----
TRY1_SALSA/21-235CKA------------YSQ..--------------------------------..THQVSLNS.G.........YH-----
TRYP_PLEPL/23-242CAA------------HSR..--------------------------------..PFMASLNY.G.........YH-----
DEGP3_ARATH/99-287SKP------------RLF..--------------------------------.QPWQITMQSEST.......GS.-----
DEGP2_ARATH/121-308APD------------YSL..--------------------------------..PWQKQRQFTST.......GS.-----
A0A017I371_ECOLX/62-244TNS------------HNQ..--------------------------------.......LEIRTL.......GS.-----
DEGS_HAEIN/37-240AVR------------IAS..--------------------------------..PAVVNVYNRS...........-----
J7JYL9_BACIU/99-283GEA------------GSG..--------------------------------....SGVIYKKN...........-----
A0A017R133_SALET/97-278GNG------------GQQ..--------------------------------....QKFMALGS...........-----
Q44596_BRUAO/85-261KPR------------IQQ..--------------------------------........SLGS...........-----
A0A024EQG8_BRUCA/125-298RPV------------AQG..--------------------------------...........S...........-----
O06439_RHOCA/59-235RQH------------HAD..--------------------------------........ALGS...........-----
F7UK65_SYNYG/95-274VPP------------RER..--------------------------------....RIAGQGSG...........-----
M1LZP5_9SYNC/156-334PMP------------NER..--------------------------------.......VQRGTG.......SG.-----
O42417_CHICK/87-286FSG------------REV..--------------------------------......PISNGS...........-----
A0A028WZQ9_STAAU/70-274RQK------------YPY..--------------------------------..NTIGNVFVKG.........QT-----
ETB_STAAU/59-251SPY------------NSV..--------------------------------.G..TVFVKGST...........-----
A0A008AS15_STAAU/37-234IQD------------TNI..--------------------------------.FPYTGVVAFKS...........-----
A0A008ARX4_STAAU/38-233KDT------------NNF..--------------------------------..PYNGVVSFKD...........-----
J7JN12_BACIU/95-311RTR------------ISSTT--------------------------------SFPYRATVQLSIKYPN..TSSTY-----
PRTC_STRGR/205-383YYM------------NGS..--------------------------------.GRCSVGFSVTRG..........-----
Q55353_STRSQ/198-372YYM------------GGG..--------------------------------..RCSVGFSVTQ...........-----
Q55352_STRSQ/202-378YYI------------GNG..--------------------------------..RCSIGFSVRQ...........-----
Q54395_STRLI/158-342IFG------------GGA..--------------------------------..RCSLGFNVTAG.......DG.-----
SP1_RARFA/205-391VR.------------.....--------------------------------..DYWGGDALSG...........-----
CERC_SCHMA/28-256VQH------------PAE..--------------------------------.FPFIAFLTTER..........T-----
Q54344_STRLI/47-254PAA------------TDH..--------------------------------..AFTARLHIGEGDT....LRG.-----
CFAB_HUMAN/481-752GTD------------YHK..--------------------------------.QPWQAKISVIRPS.....KGHE-----
PROZ_BOVIN/143-352QNL------------LPF..--------------------------------..PWQVKLTNSEG........KD-----
CAC3_BOVIN/12-246AVP------------YSW..--------------------------------..SWQVSLQYEKDG.....AFHH-----
CELA1_PIG/27-259AQR------------NSW..--------------------------------..PSQISLQYRSGS.....SWAH-----
CTRA_BOVIN/16-238AVP------------GSW..--------------------------------..PWQVSLQDKTG........FH-----
CTRL_HALRU/24-251AAA------------GEF..--------------------------------..PWQGSLQVRSGT.....SWFH-----
COGS_HYPLI/31-252AYT------------GLF..--------------------------------..PYQAGLDI.TLQD....QRRV-----
CTRB1_LITVA/46-263ATP------------HSW..--------------------------------..PHQAALFIDD.........MY-----
CATG_MOUSE/21-238ARP------------HSY..--------------------------------..PYMAFLLIQSPE......GLS-----
MCPT2_RAT/21-239SIP------------HSR..--------------------------------..PYMAHLDIVTEK.....GLRV-----
ELNE_HUMAN/30-242ARP------------HAW..--------------------------------..PFMVSLQLRGG.........H-----
PRTN3_HUMAN/28-243AQP------------HSR..--------------------------------..PYMASLQMRGNP......GSH-----
GRAK_RAT/26-248VQP------------HSR..--------------------------------..PFMASIQYRG.........KH-----
GRAM_RAT/21-245AVP------------HSR..--------------------------------..PYMVSLQNTKS.........H-----
KLK1_MOUSE/25-253CEK------------NSQ..--------------------------------..PWQVAVYRFT.........KY-----
KLK2_RAT/25-251CEK------------NSQ..--------------------------------..PWQVAVIN...........EY-----
VSPCA_AGKCO/1-217CNI------------NEH..--------------------------------..RFLALVYANGS..........-----
HGF_RAT/496-719TQT------------TVG..--------------------------------...WMVSLKYRN.........KH-----
ENTK_PIG/800-1029SRE------------GAW..--------------------------------..PWVVALYYNG.........QL-----
PRSS8_HUMAN/45-281AVA------------GQW..--------------------------------..PWQVSITYEG.........VH-----
HGFA_HUMAN/408-641SLP------------GSH..--------------------------------..PWLAAIYIGDS..........-----
TPA_HUMAN/311-556ADI------------ASH..--------------------------------..PWQAAIFAKHRRS...PGERF-----
H2Q7T9_PANTR/235-462CKD------------GEC..--------------------------------..PWQALLINEEN.......EG.-----
THRB_BOVIN/367-616AEV------------GLS..--------------------------------..PWQVMLFRKSP.......QEL-----
PROC_HUMAN/212-445TRR------------GDS..--------------------------------..PWQVVLLDSKK........KL-----

PF12380

Q9IHZ8_GAVAU/2823-3106KHP------------YNKYR--------------------------------KNIVRVYGERG-----------------

PF12381

Q6EEL1_9SECO/2617-2847CP--------------AHYL--------------------------------EALEEGDELYFICFSLVIK---------
O11979_9SECO/2603-2833CP--------------AHYL--------------------------------EALEEDDTIYFISFSVCIK---------
Q1MNG4_9SECO/2627-2857MP--------------AHYL--------------------------------DEITSEHTLYFVCPSKITQ---------

PF00863

POLG_SPMMV/2424-2646TP--------------FHTF--------------------------------KNACGNDTLTVQSLRGLYD---------
POLG_RGMVD/1998-2230TT--------------AHLI--------------------------------KEKGGW..LKIRTKHGLFK---------

PF02395

HAP1_HAEIN/17-782TDKDEE.......TNV.HSSYYVSGAYRYLTAGNTHT............QSGNGNGTVNLSG.NVVSPNHY---------
IGA0_HAEIN/17-865KKGDNYSLILNNHEVGGNNLKLVGDAYTYGIAGTPYKVNH.....ENNGLIGFGNSKEEHS..DPKGILSQ---------
Q5F9W2_NEIG1/19-848EKGVYHQ....EGNEKGYDLRDLSQAYRYAIAGTPYKDINIDQTMNTEGLIGFGNHNKQYSAEELKQALSQ---------

PF05578

POLG_BVDVN/1680-1890CDSMGR-------------TRVVCQSNNRLTDET----------------------------------------------

PF01577

POLG_PEMVM/73-321-----EDEK...AFLQYRDA--------------------------------GVHVAGSVKFTDTRSRGQT---------
POLG_TUMVJ/107-361-----RERRRAQQPIILKWE--------------------------------PKLSGISIGGGLSASAIEV---------
Q85074_9POTV/144-397-----TPKHC.VKVKQNSSI--------------------------------TTAEKTVLIPHIAHCKTAP---------
POLG_ZYMVR/71-312-----AERQ....VLPWRVY--------------------------------ATVTSIINTFTDERNGIAN---------
P90213_9POTV/300-546-----QQRK....KSKVVAQ--------------------------------VSDSVVTKIHGNFECETRD---------
POLG_PEMVC/44-286-----EVRL.....FMNAAP--------------------------------YIVSNITIGGGEVPSKMEE---------
POLG_TVMV/30-273-----DKAA.....FLKAQP--------------------------------TIVDKIIVNEKIQVVEAEE---------
POLG_RGMVD/13-255-----FAGR....VRKCETR--------------------------------EPKSAQKPIVTVDTVPVAI---------
POLG_LMV0/179-436-----AKKTLKVDTLACENP--------------------------------YIPAIVDKISIAGGSSASV---------
POLG_PVMA/45-297-----PTQL....VTSIIFA--------------------------------GTTPPSMMETETIVKKIHT---------
POLG_PSBMV/143-396-----TPNQQ.RGKLQSTSF--------------------------------DASGGKTLTPHTIYCKTKS---------
Q82933_9POTV/2-236-----ILKR....NFELTNA--------------------------------IEKPKNDPKPIKKVFKQVW---------
POLG_PVYN/41-283-----EEYH.....FQMAAP--------------------------------SIVSKITIAGGDPPSKSEP---------
Q65892_BYMV/40-283-----LNFQ....NSEHVLS--------------------------------SIGTTCTPEHYSSRNNGMQ---------
POLG_BCMNN/77-316-----EEHQ....FLSGAYG--------------------------------DKAYVGSVQGTLDRKVAEK---------
POLG_ZYMVC/70-309-----EEAV....FLEGNYD--------------------------------DSITNLARVLPPAVTHNVD---------
Q65852_BYMV/40-283-----LNFQ....NNEHILN--------------------------------SLVSDYTPKQYLTGGKGLQ---------
POLG_SBMVG/69-307-----EEED....FLNGKYE--------------------------------QQFYAGVSATKSMKFEGGS---------
O73463_MDMV/2-232-----LLRR.....AQVVDV--------------------------------EPMITVQPKKCAQIWKEVV---------
POLG_PVYHU/41-283-----EEYN.....FQMAAS--------------------------------SVVSKITIAGGEPPSKLES---------
POLG_PPVD/59-307-----ERFQ.....FVNGPD--------------------------------AIVNQISVDKCEASVWVPF---------
Q85057_9POTV/204-442-----EEEA....FLQGKYQ--------------------------------QREYIGKVLEPISLQKGGS---------
O39734_9POTV/410-663-----QRRME..KEQQLLMA--------------------------------MPPQALTGISIAGGPSASL---------
POLG_ZYMVS/71-312-----QKGK....FFNGEYD--------------------------------TTVTSIKGVTTSKENDLGA---------
POLG_PRSVH/300-546-----RGHK....KSKLMQQ--------------------------------ASDFVVTQIHCDFGCKTQY---------
POLG_TEV/53-303-----RKVAK...TYVGRDS--------------------------------IVEKIVVPHTERKVDTTAA---------

PF00947

POLG_HE701/883-1009--------------------------------------------------------NYHLATDEEKERSVY---------
POLG_POL1M/899-1025--------------------------------------------------------NYHLATQDDLQNAVN---------
POLG_PEV9U/854-980--------------------------------------------------------NRHLATHEDWENVEW---------
POLG_CXB1J/867-993--------------------------------------------------------NRHLATREDWQRCVW---------
POLG_HRV1B/873-998--------------------------------------------------------NLHLFN.SEMHDSIL---------
POLG_BOVEV/859-985--------------------------------------------------------NRHLATYADWENEVW---------
POLG_CX16G/881-1007--------------------------------------------------------NRHLATHNDWANLVW---------
POLG_CXA21/897-1023--------------------------------------------------------NYHLATPSDHLNAIS---------
POLG_HRV14/874-1000--------------------------------------------------------NYHLMTPEDHHNLIA---------

PF13611

A8QWY6_9POTV/120-263----------------------------------------------------PYIIT.EINNAWHCNIKAC---------
C4N217_9POTY/195-312----------------------------------------------------EKVVD.RMLLLEDREIRV.---------
C7C6C1_9POTY/195-312----------------------------------------------------EAVVD.RLVSTERKDIV..---------
C7C6C2_9POTY/191-308----------------------------------------------------EVVVD.KLITTDEKNIV..---------
D2SLL9_9POTY/584-708----------------------------------------------------ESICEGEVNIAKVFDGK..---------
POLG_BSTV1/239-359----------------------------------------------------PAIIT.TTPVLRRQCIE..---------

PF05416

POLG_SOUV3/707-1268LSMAGLGKKLRGVTTMEGLK--------------------------------NALKGYKISACTIKWQAKV---------
Q9YQ23_VESV/628-1162MAAMRLGNRLKNVTTITELE--------------------------------SALFGHTIAPCQIVWRGAR---------
Q80J95_9CALI/650-1163YKMAAIGCKAMGCTCVEEAM--------------------------------HLLKDYEVAPCQVIYNGAT---------
Q8JJL0_9CALI/645-1175VETMRVGAALKNVKTLEDLK--------------------------------VALRDVKFNECEIIYRNSK---------
Q80RD7_9CALI/641-1177VDTMRVGGQLKGVRTIPELK--------------------------------QALKNILIKRCQIVYGGST---------

PF03510

POLG_SVSAP/1069-1175-----------------GYG--------------------------------VHIGNGNVITVTHVASTSD---------
POLG_VESVA/1207-1311-----------------GYA--------------------------------IHIGHGVYISLKHVLTGNA---------
POLG_BECN1/1010-1109-----------------GYY--------------------------------VHIGNGVGITLKHVASGED---------
POLG_FCVUR/1095-1199-----------------GYC--------------------------------VHMGHGVYATVAHVAKGDS---------
POLG_RHDVF/1120-1218-----------------GWM--------------------------------IHIGNGLYISNTHTARSSC---------

PF05579

RPOA_LDVC/1418-1713GTY--LAA-------VRRSA---------------------------------LTG-RCCMFVPTNFGSVL---------
RPOA_PRRSL/1601-1897GTY--MAA-------VRRAA---------------------------------LTG-RTLIFTPSAVGSLL---------
RPOA_LDVP/1420-1715GTY--LAA-------VRRSA---------------------------------LTG-RCCMFVPTNFGSVL---------
RPOA_SHFV/1368-1665NTY--LGA-------VRRAA---------------------------------LTG-KPAFFVANNTGIVL---------
Q99AV6_PRRSV/1716-2013GTY--LAA-------VRRAA---------------------------------LTG-RTMLFTPSQLGSLL---------
RPOA_EAVBU/963-1269NSL--LGV-------ARDCY---------------------------------VTG-TTRLYIPKEGGMVF---------

PF05580

B2A522_NATTJ/220-429NKE..YGA-------LGHSI--------------------------------.STW.DSA.PASLKDGRIV---------
R6EU85_9FIRM/238-449NGN..FGA-------LGHGI--------------------------------.NDV.DTSTLMEMNDGTLY---------
R5R857_9FIRM/207-436DGH..FGA-------LGHGI--------------------------------.ADA.DIGELLALSKGSVY---------
D5DLD9_BACMD/199-411SKK..YGA-------LGHVI--------------------------------.SDM.DTKKPIVVEDGQIV---------
R5E7E8_9CLOT/152-361Q....YGA-------LGHSI--------------------------------.TDV.DTGELLQVSGGEIY---------
H6NL93_9BACL/215-426QGV..YGA-------LGHVI--------------------------------.TDM.DTQTPIKVGNGEIV---------
D9QRU2_ACEAZ/225-437TKM..YGA-------LGHMI--------------------------------.TEP.NSRSRMPISEGKIV---------
R5C627_9FIRM/188-399NGD..FGA-------LGHGI--------------------------------.SDV.DTGELLHIQDGALY---------
R7M5P2_9CLOT/113-319TKI..FGA-------LGHEI--------------------------------.LEK.TTKSKFDIDSGVIY---------
R5H148_9FIRM/296-509KNG..FGA-------LGHGI--------------------------------.NDT.DTADLMEVQSGSLY---------
R6AIL9_9CLOT/309-520EKA..SAA-------LGHAV--------------------------------.LDA.DTGSLLNVRKGEMV---------
R7FQ12_9CLOT/118-324TKT..YGA-------LGHEV--------------------------------.KET.YGTSPLKIESGNIY---------
F6DU87_DESRL/208-419SKS..YGA-------LGHVI--------------------------------.SDI.DTGQPIDLAKGKIV---------
R6R0T0_9FIRM/202-413DND..FGT-------LGHSI--------------------------------.SDS.TSGKAVEIKSGRLY---------
D4J425_9FIRM/143-352DQN..FAA-------LGHGI--------------------------------.TDV.DTGILMDISHGMVY---------
R5YSC4_9FIRM/171-381NGI..FGA-------LGHGI--------------------------------.SDL.DTGDMVTSFSGNLY---------
R5J4I1_9FIRM/116-322TGS..YGA-------LGHGV--------------------------------.SSL.DGTQLLMMQSGYLV---------
R6Y3R6_9FIRM/105-308TGT..YFA-------LGHQ.--------------------------------...A.RGGEDTCYQNGTLY---------
I4D8U8_DESAJ/207-417TKQ..YGA-------LGHVI--------------------------------.TDA.DTNQKLEVYNGKIM---------
R5A2Q9_9CLOT/166-372TGM..FAG-------LGHGI--------------------------------.CDM.DTNGVMALKSGEPA---------
A4XKP9_CALS8/197-406RGT..FGA-------LGHGI--------------------------------.SDI.DTNILLDLKEGQVY---------
R7HFV6_9MOLU/114-315TLI..YGA-------LGHEI--------------------------------.VES.NTNEKVEIKEGTIF---------
R5MBH1_9MOLU/114-320TKI..YGA-------LGHYI--------------------------------.IDS.NTNEAIKINDGSIF---------
B0TEK3_HELMI/213-425SKS..YGA-------LGHVI--------------------------------.NDA.DTNQRIDVAEGRII---------
R7K6P1_9FIRM/157-363NGA..FAS-------LGHPV--------------------------------.TDS.KTGRIVTVTGGTVY---------
R6WI32_9FIRM/142-352NSR..FGA-------LGHGI--------------------------------.HDV.DTSKLLEIEGGTVY---------
C4ZCY0_EUBR3/231-444DGR..FGA-------LGHGI--------------------------------.GDGTQSGNLLYANSGDLY---------
R7FE29_9FIRM/73-281SGS..FGG-------LGHPV--------------------------------.CDA.DTGGILPLGSGEAG---------
R7KE68_9FIRM/124-327DGT..YGA-------LGHRI--------------------------------.SDP.ETGLTFEYQSGYIY---------
Q8XJE5_CLOPE/169-381SGK..YGA-------IGHPI--------------------------------.TDS.ETEKILSIKNGDLL---------
D4LFB6_RUMC1/186-392SGR..FAG-------LGHPV--------------------------------.CDV.DTGEIIPLSSGEVV---------
R6RRV8_9FIRM/196-402GTE..FGG-------LGHGI--------------------------------.CDM.DTGKLMDIKGGYLL---------
R7B468_9CLOT/223-433NGA..FGA-------LGHGI--------------------------------.SDG.DTGLLVQTSGGELY---------
G7M128_9CLOT/178-390TKT..FGA-------LGHPI--------------------------------.TDC.DTNEPFLIKKGDML---------
U5S0W6_9CLOT/58-269SGM..FAA-------LGHPI--------------------------------.TDI.DTGTKLNINSGEIV---------
R5KFR6_9CLOT/194-405GTR..FGA-------LGHGV--------------------------------.NDV.DTGELIRLEHGELR---------
R7QW48_9FIRM/195-406ELF..YGA-------LGHGV--------------------------------.NDA.DTSSLLTMRAGSLY---------
R6BUQ9_9FIRM/200-411QKQ..YGA-------LGHGI--------------------------------.SDV.DTGLLMQIRDGKLY---------
R7MCE1_9CLOT/112-319TRI..FGS-------LGHEI--------------------------------.AIR.ETNNKIEIKKGEIY---------
A5D302_PELTS/202-414KMI..YGA-------LGHVI--------------------------------.TDL.KTNQPVDLSGGKVT---------
E6UBW1_RUMA7/185-391SGI..FGG-------LGHPV--------------------------------.CDS.DTGGILPLSEGAVG---------
R5PM12_9CLOT/191-403TNL..FMA-------LGHGI--------------------------------.SDI.DTEEIVNIANGELV---------
R5CZB6_9FIRM/131-339TGS..YGA-------LGHGI--------------------------------.TDV.DTAELMPLASGSIM---------
R6SMI2_9CLOT/136-344DHA..FGG-------LGHGI--------------------------------.CDG.ESGKLIPMRRGTVT---------
A4J3G7_DESRM/208-419SRS..YGA-------LGHII--------------------------------.TDI.DTCQPINLNSGKVV---------
E6U2J4_ETHHY/187-393NGV..YAG-------LGHPV--------------------------------.CDA.DTGKVLPLLEGEAV---------
R5SUE4_9CLOT/120-327TMI..YGA-------LGHEI--------------------------------.IEK.NTLQKLEIKDGKIY---------
R6XJ65_9FIRM/122-326NQ...FAS-------LGHGV--------------------------------.YDN...QVLLSVASGDLY---------
R6QNQ2_9CLOT/190-396IGC..FAG-------LGHGI--------------------------------.CDS.EAGTILPLLSGDIV---------
R6KNJ0_9CLOT/213-424NGR..FGA-------LGHGI--------------------------------.SDS.DTGDLVESSEGALY---------
R6T3R8_9FIRM/186-393NGT..FGG-------LGHPV--------------------------------.CDA.DTKEPLPLSAGTVG---------
R7HTV5_9CLOT/212-419DGK..FGA-------LGHGI--------------------------------.NDI.DTGSLMEIKDGYVC---------
R5VVX1_9FIRM/189-398SGA..FGG-------LGHPI--------------------------------.CDT.DTGTCIPISEGEAC---------
R5TNP7_9FIRM/195-404EGT..FGA-------LGHGI--------------------------------.TDT.DVEHLISVLDGTVY---------
Q18B75_PEPD6/136-351MEK..FKA-------IGHAI--------------------------------.KDS.DTNELLKIKQGYIY---------
G2T3Q8_ROSHA/201-410DGS..FGA-------LGHAV--------------------------------.SDG.DTGVQMSLSEGYIY---------
R6GHR5_9CLOT/188-396TKV..FGG-------LGHGI--------------------------------.CDV.DTGELLPLSHGDII---------
E6TXR0_BACCJ/199-411SKK..YGA-------LGHVI--------------------------------.SDM.DTRQPIEVNEGEIV---------
R6KEA9_9FIRM/205-413SEH..FGA-------LGHGI--------------------------------.TDN.STGTIMNISGGQIY---------
R7IWD1_9CLOT/190-401TKC..FSA-------LGHAI--------------------------------.TDI.DTGEVLTTSSGEID---------
R5VVV3_9DELT/151-357NLN..FGS-------LGHPI--------------------------------.CDA...GGIVTCKNGGVF---------
R6I8W6_9FIRM/179-383NGI..FAG-------LGHAV--------------------------------.CDV.DTGEELPISGGDAV---------
R7GGP8_9CLOT/115-317DGH..FAS-------LGHKM--------------------------------.VDK.......EIKGGQLY---------
R5J7S8_9CLOT/120-326ARM..YGA-------LGHEI--------------------------------.IDK.NTSLKVEVKNGKIF---------
R6FK23_9FIRM/136-347TNV..FAA-------LGHGI--------------------------------.YES.KTETLLEAGDGKLL---------
R7P923_9CLOT/113-319TKI..YGA-------LGHEI--------------------------------.IES.NTNSIVEIKSGEIF---------
R5KUR7_9CLOT/195-402SGN..MAA-------LGHPI--------------------------------.TDV.DTGEIIPILDGQAV---------
I3VWM7_THESW/212-422KKY..YAA-------LGHAI--------------------------------.TDI.DTGDILSVNNGQIM---------
R6B2V6_9CLOT/191-403TNT..FMA-------LGHGI--------------------------------.SDI.DTEKIVDISSGELI---------
R7DMS2_9FIRM/121-329TKI..YGA-------LGHAI--------------------------------.IDN.DSGTMVEVKSGAIY---------
R5KNW9_9FIRM/195-404DGK..YRA-------LGHGI--------------------------------.SDI.DTGKLLSSHNGTIY---------
R7NI61_9MOLU/99-305TNI..YGA-------LGHEV--------------------------------.LES.NTSKIIEVKTGSIF---------
F2JMG1_CELLD/211-424TGA..FGA-------LGHGI--------------------------------.TDA.DTHRLIPVKNGEVM---------
K4L254_9FIRM/156-367TKI..FGA-------LGHVI--------------------------------.TDI.DTNDQIELSDGKIV---------
R6GNM4_9FIRM/129-330NGF..FAA-------LGHKV--------------------------------.IDS..VAGNVPISGGEVF---------
R6Q3J2_9FIRM/196-400KGV..FAG-------LGHPI--------------------------------.SDS.DTGESIALRSGEIV---------
R6N1E9_9FIRM/116-321NNS..FAA-------LGHGI--------------------------------.NDI.DTGNILSVKSGNIL---------
R5SZK8_9CLOT/118-324TKI..FGA-------LGHEI--------------------------------.IEA.NSNIKMEIKDGKIF---------
R5YCX5_9FIRM/208-421DGN..FGA-------LGHGI--------------------------------.GDG.ETGELLRISKGNLY---------
D5HI76_9FIRM/160-369N....FMA-------LGHSV--------------------------------.SDI.DTGVMMRCSTGGVY---------
E3E859_PAEPS/137-349QGV..YGA-------LGHVI--------------------------------.TDM.NTQTPIVVGSGEIV---------
R7C759_9CLOT/197-406TGE..FGT-------LGHGI--------------------------------.TDV.DTGTLLNLHGGELF---------
W0E9D2_9FIRM/202-413TRK..YGA-------LGHVI--------------------------------.NDA.DTNQKIEVANGSVI---------
Q894H5_CLOTE/184-395TKN..FAA-------LGHPI--------------------------------.TDI.DTGVTLNVDTGEIV---------
C9R866_AMMDK/202-413TRL..YGA-------LGHAV--------------------------------DLGG.IAARPMELAEGKIV---------
R7HB69_9FIRM/196-404SGG..FGA-------LGHGI--------------------------------.SDE.TTAGLLTIHDGRLY---------
A6TR47_ALKMQ/210-422SYK..FGA-------LGHGI--------------------------------.TDI.DTGNLVAIRDGDMM---------
R7ESB8_9FIRM/148-356TGG..FGG-------LGHGI--------------------------------.CDA.DTGKPVPLGRGSVV---------
R6PKG4_9CLOT/140-351NSE..FGA-------LGHGI--------------------------------.HDV.DTNELLDITDGTLY---------
R7M6Q4_9CLOT/187-399SGM..FGT-------LGHGI--------------------------------.LDV.DTSELIKIANGELV---------
Q0AZD6_SYNWW/215-424SKI..FAA-------LGHVI--------------------------------.IDA.DTKQQIDVLQGKIV---------
R7N4W4_9FIRM/231-442QGH..FGA-------LGHGI--------------------------------.NDV.DTSTLMDLGEGKLY---------
R6YA95_9FIRM/168-374TGV..FAG-------LGHGI--------------------------------.CDM.DTNGVMALKSGEPA---------
D5WV97_KYRT2/201-413NHV..YGA-------LGHVI--------------------------------.TDV.DTGQPIEVGEGQVL---------
R5LXL5_9FIRM/206-416NNR..FGA-------LGHAI--------------------------------.CEE.NTGCNVSIKNGYLY---------
R5DF89_9FIRM/133-343DSH..FGA-------LGHGI--------------------------------.HDV.DTNKLLSISEGRVY---------
R6TFF4_9STAP/121-325NY...FGS-------LGHGI--------------------------------.YEN...KILVENSGGSLY---------
A5I2Z7_CLOBH/188-400SKK..FAA-------LGHPI--------------------------------.TDV.DTGTILTIDSGEIV---------
R6H4Q6_9CLOT/91-303SKT..FGA-------LGHGI--------------------------------.TDI.DTEQLIDIASGEFV---------
R6R368_9FIRM/120-325NKS..YGA-------LAHEV--------------------------------.YDN.DSEQILDVRVGNIY---------
A3DDL9_CLOTH/218-430TKG..FGA-------LGHGI--------------------------------.TDI.DTGAIMPVQRGELV---------
D3E6N1_GEOS4/214-426QKV..YGA-------LGHVI--------------------------------.TDM.NTQTPIDVGSGQIV---------
F9VK25_ARTSS/179-388TGI..YGA-------LGHPI--------------------------------.TDV.DTGDIIKISKGNIV---------
R5QQG0_9FIRM/118-320TGK..FAC-------LGHNM--------------------------------.VDD.....DLDISDGSLY---------
G8LW28_CLOCD/213-425NNA..FGA-------LGHGI--------------------------------.TDV.DTGALMPVENGEIV---------
R7L0T4_9FIRM/126-334TGI..FAG-------LGHPV--------------------------------.CDT.DTGEMLTMSCGEAA---------
L7VQQ3_CLOSH/209-420TGK..FGA-------LGHGI--------------------------------.TDI.DTGIMMPVKTGELL---------
C8WXF9_ALIAD/189-397TGR..FAA-------LGHLV--------------------------------.TDA.DTGQPIQ.GRGSVY---------
Q2RIC4_MOOTA/202-411KGV..FGA-------LGHVV--------------------------------.TGS.DGQTAMDISGGRIV---------
R4KQW9_9FIRM/232-442TKT..YGA-------LGHII--------------------------------.ADF.ESGHKLNPVGGKIV---------
A9KMA5_CLOPH/225-441TGD..YGA-------LGHGI--------------------------------.TDV.DTGLLMSVKTGGVY---------
E6SKR3_THEM7/211-421SGR..YAA-------LGHVV--------------------------------.ADP.ETQVPLPVGEGRIL---------
L0F7L5_DESDL/200-410TSQ..YGA-------LGHVI--------------------------------.NDV.DTNQKIEIVNGNVV---------
I0JNU1_HALH3/188-400SKK..YGA-------LGHVI--------------------------------.SDM.DTKKPIEIHEGTIV---------
R7EZR7_9BACI/117-324SGIATYGA-------LGHEI--------------------------------.DEK.NTAYKIEVKEGKIF---------
R6J055_9CLOT/186-394TGV..MAA-------LGHPI--------------------------------.TDV.DTGEIMPILRGEAV---------
R5NUG0_9CLOT/148-357GER..FAA-------LGHSI--------------------------------.NDN.DTGIMFRVSDGAVY---------
G2TKW2_BACCO/200-411TKK..YGA-------LGHVI--------------------------------.SDM.DTKKPIVVEKGRIV---------
R5N690_9FIRM/193-400SKV..FGG-------LGHAV--------------------------------.CDV.DTGIVMPLADGDAV---------
R5VHC6_9FIRM/114-320TKI..YGA-------LGHNV--------------------------------.IES.NTKSRVEIKDGSIF---------
R5NBK1_9CLOT/138-351TNT..FAA-------LGHGI--------------------------------.NDV.DTLKLLNISNGELV---------
R5XPM2_9FIRM/140-351NSE..FGA-------LGHGI--------------------------------.HDM.DTSVLMKIANGRIY---------
D5X7G9_THEPJ/213-424TGR..YGA-------LGHII--------------------------------.TDV.DTKKPIDIANGKVV---------
F4A1F9_MAHA5/214-428NRI..YGA-------LGHPI--------------------------------.TDM.DTGTLLSIKNGEIV---------
R7ITE0_9FIRM/151-366EGN..YAA-------LGHGI--------------------------------.SDI.DTGELLNSEGGILY---------
F6CL40_DESK7/195-404SKK..YGA-------LGHVI--------------------------------.TDI.ETNRKIELGDGQIV---------
L0EG06_THECK/213-424QGV..YGA-------LGHII--------------------------------.TDM.DTQAPIRVGEGQIV---------
R5IDG3_9CLOT/213-423NGK..FGA-------LGHGI--------------------------------.SDS.DTGELVETSGGNLY---------
R6CTL1_9CLOT/118-325SKI..YGA-------LGHEV--------------------------------.LEQ.TTGTMINVRDGKIY---------
K0B195_CLOA9/212-423SEK..FGA-------LGHSI--------------------------------.TDA.DTGTLMNAENGEIM---------
B8D2I8_HALOH/210-421SGE..YGA-------LGHVI--------------------------------.TET.NSQVKIDIRQGKII---------
R6NNU0_9FIRM/213-424DGS..YGA-------LGHAV--------------------------------.TDM.DTGSMLEVGTGKLY---------
R6VE05_9FIRM/188-399EGA..YGA-------LGHGI--------------------------------.SDT.DTGALLKISQGELY---------
R6CN52_9FIRM/193-397TLA..FAG-------LGHAI--------------------------------.CDS.DTHEPLPLSEGSIS---------
R5H2U4_9FIRM/159-365TGS..FGG-------LGHPV--------------------------------.SDV.TTGELMPISSGEIT---------
R5V409_9FIRM/40-247TNT..YAA-------LGHQF--------------------------------.SDG.DFSDILDLTSGNIY---------
R6GW98_9FIRM/110-315TKI..YGA-------LGHEI--------------------------------.IES.NSKNVVDIEDGFIF---------
R7ICH4_9FIRM/200-411SGQ..YAA-------LGHAI--------------------------------.TDG.DTGSILTVREGRVL---------
R7BI76_9FIRM/223-434NGR..FGA-------LGHGI--------------------------------.SDI.DTGKLVNSEGGRLY---------
C4Z0G6_EUBE2/202-409DGT..FAA-------LGHGI--------------------------------.SDN.ETGNVLDIRDGMIY---------
R6NHB7_9CLOT/186-391GMY..FAG-------LGHGV--------------------------------.CDV.DTGTIMPLSGGEAV---------
R7R973_9FIRM/207-417ELH..FGA-------LGHGI--------------------------------.NDT.DTGELLQLGSGLLY---------
R5HM74_9FIRM/192-403DGT..YGA-------LGHAV--------------------------------.SDG.DVGERIQMREGYVY---------
R6NAF9_9FIRM/129-336ENY..FAG-------LGHGI--------------------------------.CDC.DTYTLMPLASGEAV---------
D9SLV5_CLOC7/150-362SDL..FAA-------LGHAV--------------------------------.TDS.DTNEIFKISTGRIV---------
R5RSY4_9FIRM/189-400KGT..FAA-------LGHGI--------------------------------.SDV.DTGERLDISQGDLY---------
R6HAH9_9FIRM/113-319SGA..FGA-------LGHGV--------------------------------.SDP..RGNLLPLEAGTAL---------
R5XRH8_9CLOT/128-335KNQ..FYA-------IGHPI--------------------------------.YDV.DTQQVLKIKEGNIY---------
R7FZ38_9FIRM/122-328GST..FAG-------LGHGI--------------------------------.CDP.ESGALLPMAEGTVE---------
R5I6P6_9FIRM/188-403NGK..FGA-------LGHGI--------------------------------.SDV.DTGNLLSIKGGKLY---------
B8I3A0_CLOCE/214-425THG..FGA-------LGHGI--------------------------------.TDA.DTGTLMPVISGEIM---------
R6DXQ1_9FIRM/186-391NGI..FAG-------LGHAV--------------------------------.CDT.DTGEIMPLSGGDAV---------
R5E160_9FIRM/209-416DNN..FAA-------LGHGI--------------------------------.SAN.QSQQTLSINSGSLY---------
Q97HE0_CLOAB/178-390TKV..FGA-------LGHPI--------------------------------.TDV.DTGDIINISRGSLI---------
R6M2Z6_9CLOT/204-415DNT..YAA-------LGHGI--------------------------------.ADA.DTGLLVDISAGGLY---------
D6DLB6_CLOSC/284-503SGE..YGA-------LGHGI--------------------------------.SDS.DTGLLVSTNGGELY---------
R6RY05_9CLOT/213-424NGS..FGA-------LGHGI--------------------------------.SDS.DTGKLVDIRGGELY---------
F4LV06_TEPAE/231-437TGF..YGA-------LGHII--------------------------------.SDA.DTGKIIEVGEGEII---------
R6UED3_9CLOT/180-388SSA..FGG-------LGHGI--------------------------------.CDV.DTGNLLPMSQGEVT---------
R5AES8_9CLOT/40-251GDR..FAA-------LGHAV--------------------------------.SDV.DTQSTLTVGSGRLL---------
B2TRL9_CLOBB/178-390SKK..FGA-------LGHPI--------------------------------.TDC.DTNEAFLIKKGDLL---------
R5D6V9_9FIRM/120-320TGI..YGA-------LGHSI--------------------------------.SDS.ETGMTLPLGDGSIY---------
D7CKI9_SYNLT/217-427TGR..YAA-------LGHII--------------------------------.ADV.DTRKGIDVRQGKIV---------
R5TH80_9CLOT/131-336SKR..FAA-------LGHGV--------------------------------.TET.KENYILPITSGAIT---------
R5MT91_9FIRM/109-314TRL..FGA-------LGHEI--------------------------------.IEK.TTGKLFNSNSGSIF---------
R6YLB5_9CLOT/116-322TKI..FGA-------LGHEI--------------------------------.ADK.NTESILNIDDGSIY---------
R6MJ71_9FIRM/140-351DSE..YGA-------LGHGI--------------------------------.HDV.DTGKLIEMSTGRLY---------
D4M5K6_9FIRM/147-358NNR..FAA-------LGHGI--------------------------------.HDI.DTSTLLTIKRGTLY---------
D9S3S9_THEOJ/212-423SGY..YGA-------LGHII--------------------------------.SDS.DTGRIVEVGQGEII---------
F6B9N5_DESCC/208-419TKA..YGA-------LGHII--------------------------------.SDI.DTGQPINLARGKII---------
R6TLY4_9FIRM/135-345SGA..FGA-------LGHGI--------------------------------.TDS.DTALLMPFSSGSIL---------
R5ZMQ1_9CLOT/197-409TGK..FAA-------LGHGI--------------------------------.VDV.DTGDIINIANGELV---------
Q67NC5_SYMTH/205-417TRK..FGA-------LGHVI--------------------------------.AEG.ESRRPFQFAHGQIT---------
R6TRP0_9CLOT/118-324TKK..FGA-------LGHEI--------------------------------.LEK.TTAKKFEIKDGKIF---------
R7L6Y3_9CLOT/231-443DNK..CVA-------LGHGI--------------------------------.TDI.DTSKLINIASGELV---------
R6BNR4_9CLOT/112-320SKI..YGA-------LGHEI--------------------------------.ILN.ETKSIVEVKNGNIL---------
Q9K975_BACHD/210-423SKK..YGA-------LGHVI--------------------------------.SDV.DTKKPIVVHDGQII---------
D4KCM7_9FIRM/190-395AGV..FAG-------LGHPI--------------------------------.SDS.DTGERVALRSGEIV---------
R5QDI6_9FIRM/143-350TLI..FGG-------LGHGI--------------------------------.CEA.SSGELLPISYGSVE---------
B1I568_DESAP/210-421TGS..YGA-------LGHVI--------------------------------.TDG.RSPQRLELTDGRIV---------
R5NSK8_9FIRM/197-408DGK..FGA-------LGHGI--------------------------------.SDV.DTGKLLGSINGILY---------
R6ZZF6_9FIRM/206-414NGK..FGA-------LGHGI--------------------------------.TDA.DTGTLMDLRGGELY---------
R6L493_9FIRM/188-398NGS..YGA-------LGHGI--------------------------------.SDV.DTGDLLKIEKGALY---------
A8MFI3_ALKOO/211-423SGK..FGA-------LGHAI--------------------------------.TDV.DTGALLSVKNGEII---------
Q8RAC0_THETN/202-413QKV..YAA-------LGHAI--------------------------------.TDI.DTGHVLSVENGEIM---------
R6G9J9_9FIRM/189-399NGT..FGA-------LGHGI--------------------------------.SDA.DTGERLEISDGDLY---------
R5HAQ1_9FIRM/143-351TGL..FGT-------LGHGI--------------------------------.NDV.DTAVLMKLQSGAIT---------
K4LFQ1_THEPS/205-416TKK..FGA-------LGHEI--------------------------------.TDS.ESGRALDLSDGKIV---------
W6RY93_9CLOT/147-358SNI..FGA-------LGHGI--------------------------------.IDS.DTNIIMPIEKGDIL---------
R5UHP5_9FIRM/210-422DGN..FGA-------LGHGI--------------------------------.GNG.QTKDLLRLSDGRLY---------
R7G2H0_9FIRM/141-351DSR..FGA-------LGHGI--------------------------------.HDT.DTNALMEIRNGRVY---------
R6WHU5_9CLOT/129-336DGN..FGA-------LGHHI--------------------------------.ADS.ETGIISALTSGSIF---------
R6S308_9FIRM/140-351DSH..FGA-------LGHGI--------------------------------.HDI.DTGELLNISDGTLY---------
R5B250_9CLOT/199-410SMR..FGA-------LGHAV--------------------------------.TDP.DAGTMIEAKRGELS---------
R5SFB7_9FIRM/135-345TGV..FAA-------LGHGI--------------------------------.TDV.DTGKLMPLSRGSVM---------
R6GC90_9FIRM/148-359DGT..FAA-------LGHGI--------------------------------.NDG.DIGVRFLIEGGSAY---------
D9R8M8_CLOSW/212-423NGQ..FGA-------LGHGI--------------------------------.SDS.DTGNVVQITDGSLY---------
R5RQY0_9FIRM/119-326TST..FGA-------LGHAM--------------------------------.SDS.KLDSEELIQNGNIF---------
R5LJL6_9MOLU/116-322SRV..FGA-------LGHEI--------------------------------.LES.NTISKFEIKDGKIY---------
R7AQT1_9BACE/223-435DSS..FGA-------LGHPI--------------------------------.SDP.DSGCMLAIRSGALY---------
X4ZLT8_9BACL/97-309QGV..YGA-------LGHVI--------------------------------.TDM.NTGTPIVVGSGHIV---------
F8I8Y9_SULAT/218-427TLQ..YFA-------LGHSM--------------------------------.TDG.LSRRPVSV.SGHIL---------
R6MC60_9CLOT/120-327TKL..FGA-------LGHEI--------------------------------.IEK.NTGQKLEIKDGKIY---------
R6TCX6_9FIRM/133-340TGE..FGG-------LGHGI--------------------------------.CDI.DTGELMPLKRGTAM---------
R6R1J4_9FIRM/210-418TDR..FGA-------LGHGI--------------------------------.YDV.DTGGLMSLKQGHIT---------
R6YL37_9CLOT/137-348LKT..FAA-------LGHAI--------------------------------.TDI.DTGEILQTSSGEID---------
R5XPM6_9FIRM/188-398KGR..YGA-------LGHGI--------------------------------.SDV.DTGELLHISKGALY---------
A0Q0A9_CLONN/185-397SNK..FAA-------LGHPI--------------------------------.TDV.DTGNVLKINKGEIV---------
D4LPR1_9FIRM/188-397NGG..FGA-------LGHGI--------------------------------.SDV.DTGELLSIADGNLY---------
R7DAB6_9FIRM/188-398NGN..YGA-------LGHGI--------------------------------.SDV.DTGELLHIDDGDLY---------
C0ZC15_BREBN/212-424SKA..YGA-------LGHVI--------------------------------.SDV.DTGQAIVVGDGQIV---------
R6QE36_9FIRM/192-401TKN..YGA-------LGHPI--------------------------------.VDV.DTGQMMSISSGELL---------
R5K6N9_9CLOT/165-374Q....FMA-------LGHSV--------------------------------.SDN.DTGLKISSTGGGIY---------
R6ZCY0_9FIRM/219-430QGN..FGA-------LGHGI--------------------------------.NDM.DTSTLMSLEKGTLY---------
R5HLI4_9MOLU/113-318TKL..FGA-------LGHEI--------------------------------.TDK.STGKVLEISDGKIY---------
R6NKY3_9CLOT/192-404TKT..FGA-------LGHGI--------------------------------.TDI.DTNELINIASGEFI---------
R5JXE7_9FIRM/154-361S....FAA-------LGHSV--------------------------------.SDY.DTGLEMNSVSGGVY---------
R5AF90_9FIRM/131-337NGT..FGA-------LGHGV--------------------------------.YDV.DTDELMVIHGGSVV---------
R5TU24_9FIRM/138-348DGA..FGA-------LGHGI--------------------------------.HDM.DTSALLSIRQGTLY---------
R6P0Q8_9CLOT/192-399EHS..FAG-------LGHGI--------------------------------.CDI.DTGDLMPLLSGDIV---------
R6DUC4_9FIRM/125-334TGQ..YGA-------LGHGI--------------------------------.TDV.DTAQLMPLASGAIM---------
R7F4Z6_9CLOT/190-402TGE..FGA-------LGHGI--------------------------------.LDI.DTEELIDIARGDIV---------
R6X4M8_9FIRM/134-340NDS..FGG-------LGHGI--------------------------------.CDG.GTGELLPLKRGVVV---------
R6EKK3_9FIRM/141-352TNA..IAS-------LGHGI--------------------------------.YES.RTGTLLEAGNGELL---------
Q5WF67_BACSK/196-410SMK..YGA-------LGHVI--------------------------------.SDV.DTRKPISVHDGQIM---------
R7JU02_9FIRM/195-406DGT..FAA-------LGHGI--------------------------------.SDI.DTGKMLQLNGGELY---------
G4KYV3_OSCVS/183-394SNT..FGA-------LGHGI--------------------------------.TDV.DTAALMPFSSGSIL---------
Q3AAN6_CARHZ/161-371DKT..FGA-------LGHTI--------------------------------.IDP.DTGKVFPVQQGKIV---------
R5VSI3_9CLOT/188-396NGR..FGT-------LGHGI--------------------------------.TDM.DTGTLLNLKGGEVY---------
R7MHL3_9FIRM/191-401SGR..FAG-------LGHPI--------------------------------.CDA.DTGEIVPLSSGQAV---------
R6RU79_9FIRM/209-417NGK..FGA-------LGHGI--------------------------------.SDT.DTGELLDVSGGELY---------
R6Q618_9FIRM/187-394TNC..VAA-------LGHPI--------------------------------.TDV.DTNEIMPILDGEAV---------
R7K1G6_9CLOT/229-438ENE..FAA-------LGHGI--------------------------------.TDA.DTELLIRLQNGGLY---------
L0K691_HALHC/214-426SGY..YGA-------LGHMI--------------------------------.TEA.NTQQKIDVGQGEIV---------
R5FFJ0_9FIRM/179-381DGS..FGA-------LGHMI--------------------------------.YDV.ESGLNTELNSGNIY---------
R7G6U2_9FIRM/123-330NQS..YGA-------LGHEI--------------------------------.YDV.EIKQLAQASQGSIY---------
R5G573_9FIRM/136-341TKK..FAS-------LGHGA--------------------------------.IDG.......SVRNGILT---------
K0IY14_AMPXN/201-413TNM..YGA-------LGHVI--------------------------------.ADI.DTKEPIEIKSGTIV---------
R6USZ2_9FIRM/119-327NNT..YGA-------LGHEI--------------------------------.MDS.DLKQIAEVPSGSLY---------
R6PFE8_9FIRM/188-396NGK..FGA-------LGHGI--------------------------------.SDT.DTGELLDISEGELY---------
F0T085_SYNGF/157-367QQI..FGA-------LGHVI--------------------------------.TDM.DTNEKIELKDGKVI---------
R7HK64_9FIRM/121-328TKL..FGA-------LGHEI--------------------------------.IEK.NTGQRLEIKDGKIY---------
R6AWH8_9CLOT/114-319TKI..YGA-------LGHEI--------------------------------.VES.ASMKRIEVKKGTIF---------
R6FWG8_9CLOT/174-386SKT..FGA-------LGHPI--------------------------------.TDG.DTNVSFNIKSGTLL---------
R4KDG0_CLOPA/189-401SGK..FAA-------LGHPI--------------------------------.TDV.DTGTMLTVKDGNII---------
R5QW36_9FIRM/143-354QSR..FGA-------LGHGI--------------------------------.HDV.DTSVLMSIAEGNVY---------
R6CRQ2_9CLOT/223-434EGN..FGA-------LGHGI--------------------------------.SDV.DAGITMEVKSGTLY---------
R7KGU6_9CLOT/123-329TKI..FGA-------LGHEI--------------------------------.LEK.TTGERFEIKDGKIF---------
R6U8G2_9CLOT/143-350SGK..FGA-------LGHAV--------------------------------.TET.KENYILPITTGGIT---------
R5A3A4_9CLOT/111-319TKI..WGA-------LGHEI--------------------------------.LLS.ETNSRIEVKNGNIL---------
R5J0Y5_9FIRM/119-326TKI..FGA-------LGHEI--------------------------------.QEQ.TTGEIFEIDDGTIF---------
D4MXQ8_9FIRM/196-401S....FGG-------LGHGI--------------------------------.YDM.DTGTLLKIKGGLLL---------
Q8EQ48_OCEIH/174-386SGK..YGA-------LGHVI--------------------------------.SDM.DTKKPIEIEDGSIV---------
R5YPZ4_9MOLU/72-278TKM..YGA-------LGHEI--------------------------------.MEK.TTGTKFEIKDGTIF---------
SP4B_BACSU/201-413TKK..YGA-------LGHVI--------------------------------.SDM.DTKKPIVVENGEIV---------

PF03761

Q9U2W2_CAEEL/6-282TRV--YA........TAFPI-------------------------------------SEYHILISSRVMLT---------
Q21628_CAEEL/5-298EGK--DLYD.....SGGSFI-------------------------------------STRHVMANSQSIST---------
O45371_CAEEL/3-276QYN--FRT.......VGTFI-------------------------------------SKRHFLTLAYALMN---------
O76649_CAEEL/2-297QKD--GKPKRLVMVFPGTVI-------------------------------------SPYHILTYNLVRSY---------
A8XIB1_CAEBR/15-285IQQ--AFA.......TATAI-------------------------------------SSRHILTSSHVFID---------
A8WNY9_CAEBR/3-296EKN--ESQFI...YGPGTMI-------------------------------------SSRHIIKFNSLFYS---------
Q9XWZ8_CAEEL/4-272A..--..........PAVII-------------------------------------SPRHLITSSRLFL.---------
O62223_CAEEL/7-278NIE--YIS.......SASLI-------------------------------------SNRHFITSAFSILN---------
O62231_CAEEL/5-272PDR--YY........LATMI-------------------------------------STRHVLTSARLVR.---------

PF00949

Y298_MYCGA/335-468---------------TTPQY---------------------------------TKF-SVPSLS..RRQ...---------
Y577_MYCPN/197-333---------------SNIAA---------------------------------LNL-NQTEVKPTRPE...---------
Y083_MYCPN/328-467---------------ESNTT---------------------------------NTI-TKASLTQQPHKEQS---------
Y084_MYCPN/296-431---------------KNYVL---------------------------------QTI-TKEQHTLDITR...---------
Y592_MYCPN/334-455---------------LPQKG---------------------------------Y..-..SSPLYENSN...---------
Y589_MYCPN/14-134---------------WTKTE---------------------------------QRF-NHDDFY.GSMP...---------
Y591_MYCPN/171-291---------------CKQGA---------------------------------ER.-FSYGYFYSNMA...---------
Y586_MYCPN/154-286---------------LGYPF---------------------------------LRN-KAASLFLNQTEQRK---------
POLG_YEFV1/1503-1655---------------LEDGI---------------------------------YGI-FQSTFL.GASQ...---------
POLG_DEN1W/1493-1642---------------LDDGI---------------------------------YRI-LQRGLL.GRSQ...---------

PF00548

Q8JJT0_PSV13/1680-1844VGP--FTG-------L..GI---------------------------------YDN-IIV.....LPRH..---------
POLG_HRV8A/1522-1687KGK--FTG-------L..GI---------------------------------YDQ-VMV.....LPTH..---------
Q66776_ERBV1/1905-2095QIV--SEC-------CGTYL---------------------------------YNK-VMI.....MPRHIL---------
POLG_HPE2W/1517-1692TGH--ITH-------CAGYQ---------------------------------HDE-IILHGHSIKYLE..---------
POLG_POL1M/1566-1731KGE--FTM-------L..GV---------------------------------HDN-VAI.....LPTH..---------
Q9DLK1_FMDVP/1643-1826KTV--AIC-------CATGV---------------------------------FGT-AYL.....VPRHLF---------

PF13365

B0EDS2_ENTDS/219-353TT......-------.SHLL................................ENRYSPVE...........---------
A9VAG6_MONBE/28-203TA......-------.AHVV...............................YTAADAKAAVFN..FPLLSQ---------
B9S6M7_RICCO/99-269TS......-------.ADLI................................RSPLSGNS........IAD---------
C2FHG0_LACPA/165-321TA......-------.AHMLYDG.........................HYISGGIINFGDSQA..NHQGVG---------
A9FFZ4_SORC5/137-265TA......-------.LSPL................................GAGNDLTA...........---------
D0N1Z1_PHYIT/130-271TC......-------.DHNL................................TEQHTVGS...........---------
A1VVN7_POLNA/138-318TS......-------.YHVVRPLLDAQDMPLQD......SRDRLKITFDAVNGMSTGTVIQPQ..EAWLVE---------
D4LWF1_9FIRM/167-311TY......-------.SDNM................................NDAGKFQV...........---------
C6JD09_9FIRM/146-290TQ......-------.FYIL................................TYEEELEN...........---------
C0CMS9_9FIRM/152-296TQ......-------.QTAV................................KKAENIQV...........---------
C4ZI06_EUBR3/149-289TE......-------.KNVV................................DKADKLSV...........---------
C0FTN1_9FIRM/149-293TE......-------.RKVI................................AEASSVYV...........---------
C9L519_BLAHA/148-292TE......-------.YRIV................................ENVDRIQV...........---------
C0B801_9FIRM/151-295AA......-------PARIV................................KDAEALKV...........---------
B0G1M9_9FIRM/149-293AG......-------.ELPV................................KDAKIIRV...........---------
B0NI56_CLOSV/167-311GK......-------.TSIM................................KEAGDIHI...........---------
A7B169_RUMGN/176-320SN......-------.NSVC................................GESTVWNV...........---------
A5KN66_9FIRM/147-291AD......-------.SSIC................................TGASAWRV...........---------
B6FP33_9CLOT/144-288TE......-------.MDAL................................SDVSELQV...........---------
D4M0U9_9FIRM/159-303SY......-------.ASIC................................EDAKEWCV...........---------
B5CQ59_9FIRM/147-291AS......-------.ESVC................................KDAEEWQV...........---------
C5ELW4_9FIRM/172-316TP......-------.EKAV................................EAADSIEV...........---------
B7AVI8_9FIRM/172-316TG......-------.YDEV................................ADASRIIV...........---------
D4N037_9FIRM/379-516TN......-------.YHVT................................EDDDFYDV...........---------
B8AM75_ORYSI/89-258........-------.GTII................................SSATVNIHD.....PAFPD---------
C5WUT2_SORBI/32-182TC......-------.QHVL................................PKDNNGNV........V.V---------
Q1GZ24_METFK/25-167TN......-------.RHVI................................SECRDGSI...........---------
A8TSL0_9PROT/61-191TI......-------.GYLV................................LEADRVQV...........---------
Q126C2_POLSJ/74-216TI......-------.GYLM................................LEAQRIEV...........---------
A2SEV1_METPP/84-217TI......-------.GYLI................................LEAEEVEL...........---------
D3NU60_AZOS1/54-191TI......-------.GYTV................................MEASQIQV...........---------
B0T7U9_CAUSK/55-188TM......-------.GYLI................................TEASQVVL...........---------
A9VXT6_METEP/54-187TI......-------.GYLV................................LEAESVWL...........---------
B9JA65_AGRRK/33-164TI......-------.GYLI................................TEAEEVWL...........---------
D5SQ02_PLAL2/103-278TC......-------.YHAV................................RNGQRYGQP......VKGD---------
A0L9W3_MAGSM/126-265TA......-------.AHLV................................NGSVALQV...........---------
C5JBN6_9BACT/99-238TT......-------.LHTV................................ANLPQIEI...........---------
C4RAG7_9PROT/100-239TA......-------.LHPL................................KDLGEIAV...........---------
C5JAK2_9BACT/101-240TA......-------.LHSV................................ANLPAIDV...........---------
Q75HK9_ORYSJ/40-213TC......-------.AHCV................................SGKTCFVA...........---------
B7FUE8_PHATC/1283-1490TA......-------.AHVL...............................YDMEEGPRFGVP..FFGLPD---------
A8KF66_BURPE/83-236SD......-------.YHVV................................QGCGAFRV...........---------
B6B9E4_9RHOB/398-528TT......-------.SDVV................................AGCTRITL...........---------
D0D6Q7_9RHOB/389-519TS......-------.AEAV................................ASCGRITL...........---------
A9F8J5_SORC5/19-173TA......-------.LHVV................................ADRSHDPL........HFY---------
B8H010_CAUCN/64-248TN......-------.RHVAKL...........................VAKRSADGRGVFLR..SPYSGA---------
Q00YL5_OSTTA/68-221TS......-------.SSGA................................SKGTLKSL...........---------
Q1PY07_9BACT/57-189TH......-------.SKVF................................MDAHSIRV...........---------
D2R6U2_PIRSD/68-213TA......-------.SGAL................................LAADSLRV...........---------
Q7UNU5_RHOBA/96-240TA......-------.WSYV................................LDVDPVVI...........---------
A4A0T0_9PLAN/66-211TV......-------.WSYV................................LDSSVITI...........---------
D5SYB2_PLAL2/75-226TI......-------.WNHV................................LDQNTVTV...........---------
A6C5I0_9PLAN/58-206TI......-------.WSPV................................LDTDRLSV...........---------
B4V7A8_9ACTO/24-181TA......-------.FHVV................................SGAAGVQV...........---------
C3QH30_9BACE/51-184TN......-------.YHVL................................DGAHSGYI...........---------
D5ST85_PLAL2/188-324TN......-------.YHVF................................DTTELECF...........---------
B8EPM5_METSB/283-415TS......-------.AQIV................................ASCSNIAV...........---------
A6CCJ8_9PLAN/216-356TC......-------.SHIF................................SELKSDSV...........---------
A3ZSU8_9PLAN/169-309TC......-------.GHLF................................RDSQGRGE...........---------
Q7URA6_RHOBA/240-384TC......-------.GHLF................................RDGEGKDR...........---------
D2R0U2_PIRSD/218-358TC......-------.GHLF................................RESQGKGT...........---------
D1CC35_THET1/99-237TT......-------.SQVL................................QRYDQVQV........V..---------
A4S513_OSTLU/76-226TN......-------.AHCV................................VKGNENEK........L..---------
A4S4E4_OSTLU/26-173TA......-------.AHVA................................SFAGAKNA...........---------
Q3IXI9_RHOS4/47-206TN......-------.FHVV................................QNGGDIAV...........---------
Q08MN7_STIAD/50-171TS......-------VEHVS................................LEAAEVEF...........---------
Q7UNU4_RHOBA/89-223TS......-------.SWVT................................GGDSASII........V..---------
B8BSP4_THAPS/582-769DDIDDMKD-------RCHIL................................TSAHVAPP.........GW---------
A9F4P7_SORC5/37-166GN......-------.GVVV................................ASRRGLGY........P..---------
Q67SY9_SYMTH/37-178ST......-------.AQIV................................APEDEITI...........---------
Q1IY94_DEIGD/67-198TV......-------.AHVL................................HSDEVSVW........A..---------
A4A0S9_9PLAN/71-202SS......-------.YNFV................................HEPTSILA...........---------
D5SYB3_PLAL2/92-222TS......-------AFNFI................................SKPTSILI...........---------
D2R6U3_PIRSD/90-221TS......-------TFNFL................................RKPPIITI...........---------
C8N8L7_9GAMM/65-197TN......-------.YHVI................................ADAVNKEK........H..---------
Q21G29_SACD2/103-235TN......-------.YHVI................................NSVLFEPE...........---------
Q08Q29_STIAD/85-219TN......-------.YHVV................................SDLVFHPE..........D---------
A4YVG9_BRASO/68-206TN......-------.YHVV................................SDAALEPK...........---------
A2SCU5_METPP/86-236TN......-------.YHVV................................SQVALQPD...........---------
B4WI21_9SYNE/33-173TS......-------.CEAL................................STEDSLKI...........---------
Q0RIR2_FRAAA/55-221TN......-------.QHVV................................ASAAGGAV...........---------
A2SLK2_METPP/110-244TA......-------.SHAV................................AGSQRIAV...........---------
D1CHW8_THET1/35-167TN......-------.SHVV................................PQQEAEVR...........---------
A7NIM6_ROSCS/38-173TN......-------.DHVV................................AGAGGMLR...........---------
B2IZX6_NOSP7/35-159TN......-------.AHVA................................TSNRATVE...........---------
Q01SP4_SOLUE/26-150TN......-------.AHVA................................RGSQAEIE...........---------
Q98IG3_RHILO/78-212TA......-------.EEAV................................EAGEEIEL...........---------
B0U7I8_METS4/36-169TA......-------.DEAL................................AEEGEIAV...........---------
Q89E13_BRADU/35-167TA......-------.DEAL................................ADEGEVEI...........---------
A7H8S6_ANADF/35-169TA......-------.HHVL................................DRDEEIDV...........---------
B4UF27_ANASK/45-180TA......-------.HHAL................................ERDEGVTV...........---------
Q1DFJ7_MYXXD/51-186TT......-------.SQAV................................EHEGRLPI........G..---------
Q3M8K4_ANAVT/33-168TS......-------.DESL................................PRYDEITI...........---------
D1CHW7_THET1/37-171AA......-------.DHTL................................EREEDIRV...........---------
D1C9X4_SPHTD/41-176TA......-------.DHVL................................EREDDITV...........---------
D5WKU5_BURSC/40-175TA......-------.AHTI................................RREEGIEV...........---------
Q7NEY6_GLOVI/37-172TA......-------.DHLL................................KRDDEITV...........---------
Q01SP5_SOLUE/107-240TA......-------.EHTI................................QREEEITV...........---------
C4Z416_EUBE2/141-284TS......-------.SSLL................................EPGMNYIV........R..---------
B9FMK5_ORYSJ/181-321TL......-------.STYF................................KKKPHEPQ...........---------
Q7EYD8_ORYSJ/206-349TA......-------.ASVV................................CDFHGELH.........NP---------
Q6ATB3_ORYSJ/64-208TC......-------.SEAV................................CDDGALID..........P---------
C5Y9X9_SORBI/128-269TT......-------.SDIV................................DGLDHKPK...........---------
C5XIJ1_SORBI/75-220TS......-------.ASLV................................RALNDKTK.........HP---------
B9G3S8_ORYSJ/109-256TS......-------.ASLV................................RCTKDENK........TDE---------
C5WUT6_SORBI/430-572TS......-------.ASLV................................RISDDENK........IND---------
C5YNZ0_SORBI/297-442TS......-------.ASLV................................RDPDGANE........IVS---------
C5YX14_SORBI/284-426TS......-------.ASLI................................RNSVDENN.......IVEN---------
Q0JIU9_ORYSJ/149-291TS......-------.ASLV................................RKSGDRSK........IVE---------
D3W785_9VIRU/161-295TA......-------.HHVW................................SQAPNHIA...........---------
Q82G14_STRAW/89-242TA......-------.AHCV................................DGGGKTWFVPG..YRDGQA---------
C7QED1_CATAD/56-225TA......-------.GHCF...............................EGGMPSAGEVLQNVASSRSG---------
C9Z823_STRSW/62-228SN......-------.GHCS................................SLLDPGVVITD..RSANRP---------
C9ZGQ1_STRSW/72-240TN......-------.GHCL...............................ETGFPAAGQVLVDRASSRSF---------
Q93JK9_STRCO/54-222SN......-------.GHCL...............................ETGFPAAGEVVVDQPSSRTF---------
B8AXY3_ORYSI/1277-1457TC......-------.AHTIDHV.........................YTATKEISVQDINRLFDTEVVCD---------
D2QDD9_SPILD/31-236TC......-------.KHVA................................ELIQQSEPIYH..KYREFQ---------
C5Y9N3_SORBI/149-346TC......-------.AHVIDDIF........................TVDNHNQFNLEEVNA..LFRFDV---------
Q92JT1_RHIME/45-189TA......-------.RHVL................................GLKPNDPM.......PGAI---------
B0C7H5_ACAM1/63-201TN......-------.QHIL................................QGAKTIQI........Q..---------
Q15T30_PSEA6/50-191TA......-------.NHVI................................EGANPGDK.........LK---------
A5E551_LODEL/303-457TN......-------.AHVV................................APYLNSAHTST..SNDSSI---------
A3LV17_PICST/282-443TN......-------.FHVL................................KPFVESDSA.....DARCD---------
Q6BLK4_DEBHA/295-454TN......-------.NHVI................................KQYIDRPVS......VDCK---------
A5DCA5_PICGU/274-427TN......-------.YHVL................................KPYIEAADSSATCTIYVHG---------
D0N2P9_PHYIT/200-360TN......-------.HHCIST...........................QAHASNTEFEFMAQGSSCSVNC---------
Q846R2_MYXXA/58-225TN......-------.QHCVG.............................TASEAQNTQYEFMAEGASCST---------
D3QBE9_STANL/212-368TN......-------.NHCM................................SDQGTVASSET..QFGYEC---------
D3PTY7_STANL/202-361TN......-------.NHCF................................ETSEQARDTEV..WFNYAC---------
A0CQA0_PARTE/272-415TA......-------.NHVL................................SNNLKGSK........L..---------
A3WZP2_9BRAD/25-182TA......-------.KHVI................................AALKEDTA........S..---------
B5JQS5_9BACT/61-197TN......-------.AVPL................................QEGPRIRI...........---------
A1DKZ3_NEOFI/106-274TC......-------.AHCF................................GETEAEWR..........S---------
C9SS84_VERA1/110-286TC......-------.AHCV................................AEVEDELD..........L---------
B2ACI3_PODAN/114-282TC......-------.AHCV................................AGDETELD..........L---------
B1XYW2_LEPCP/349-527TN......-------.FHVV................................NANGASPGI......KPAA---------
C0DWH2_EIKCO/92-250TN......-------.DHVA................................NADVGEMAQ.....LGKPE---------
C1N754_MICPC/393-574TN......-------.AHVV................................HPSARAAGGDG..RGPRVR---------
C1EFA7_MICSR/414-629TN......-------.AHVV................................HPSSTAAGGDG..KGPIVR---------
C0PL31_MAIZE/403-612TN......-------.AHLLEPWRFGRTSPSDL......QASFAGEHLNAGENKSLQPQQGKI..SNEDAV---------
A9TAV2_PHYPA/699-919TN......-------.AHLLEPWRFGKPRMVPS.....PVNGSIPKDSGFPLSCDESQEDLAL..NQLQEE---------
DEG15_ARATH/376-594TN......-------.AHLLEPWRYGKGGVYGEG....FKPYVLGAEEFSSTGSKFWEQKSQT..LPRKAP---------
Q0PY37_SOLLC/412-632TN......-------.AHLLEPWRFGKTSVNGYNT..KSDVVFTTSNQSEHPGDDKFTIHHRN..KYLLQK---------
B9H2S3_POPTR/409-631TN......-------.AHLLEPWRFGKTTVNGGEDGTKLQDPFIPPEEFPRYSEVDGHEKTQRLPPKTLNI---------
A5BEH1_VITVI/502-717TN......-------.AHLLEPWRFGKTVARGG.....RCGAEPEIPFIPSEESVYCRDEGTYSHQKSPGF---------
A8I3D5_CHLRE/134-313TN......-------.FHII................................PPLNSTNS........LLE---------
C1N5V8_MICPC/175-398TN......-------.FHLV................................KRHLNGAADAS..EPSKPQ---------
D3LKZ9_MICLU/283-419TN......-------.AHVV................................LGVDAPTV...........---------
D2S688_GEOOG/217-353TN......-------.AHVL................................AGVSDPVV...........---------
D3QA66_STANL/219-357TN......-------.AHVV................................AGTESVSV...........---------
B4V9A1_9ACTO/51-211TC......-------.AHVV................................GEGGAAVRL......VGRE---------
Q10YA2_TRIEI/28-156TC......-------.VHVI................................EGNDHDSI........E..---------
B4W048_9CYAN/24-160TC......-------.AHVV................................KKAEGEPV...........---------
B7KID8_CYAP7/23-153TC......-------.HHVI................................KSAKNSPV...........---------
B1ZW96_OPITP/85-238TN......-------.AHVT................................QDGDYFRC...........---------
C4RBC6_9ACTO/39-187TC......-------.AHVL................................ADDGQPVAG......TALG---------
C6AVQ8_RHILS/33-192TA......-------.RHVV................................DGVSIREVATT..KSVRLA---------
C1MYV6_MICPC/213-422TC......-------.AHCVCRDGDATDE..............EESDGDFGGDGDDGVVVVDLTTSPPTSP---------
B6BL05_SULGG/72-191TA......-------.YHVI................................NNAKNVEV...........---------
D2QY05_PIRSD/202-373TN......-------.AHVI...............................GLEDVAGRATKQRDRTANIT---------
A4YLF4_BRASO/29-179TC......-------.AHVF................................GEEGENFYASR..GPLANV---------
Q08Z65_STIAD/79-228TN......-------.AHAV................................DMDGLKAP..........R---------
Q2II41_ANADE/64-213TN......-------.AHVV................................EPAREWPE..........G---------
B3S5U4_TRIAD/329-491TC......-------.SHVV................................HPCNSNSDDDC.NHGESDR---------
A0LWM1_ACIC1/250-384TA......-------.EHVV................................DGCTDPNS...........---------
B4D4S9_9BACT/50-179TN......-------.SHVI................................RGNRNVKF...........---------
B4CWZ7_9BACT/330-461SN......-------.THLL................................GISRPPRF...........---------
B4D163_9BACT/76-206TN......-------.AHVA................................AGVRGAGF...........---------
B4CWZ6_9BACT/327-458SN......-------.IHVI................................SEVRQPVI...........---------
Q2YD45_NITMU/56-221TT......-------.CDVA................................RQAESARV...........---------
B4UTS4_BP163/66-193TA......