Sequence alignment for CL0124

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMVE/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF03510

POLG_RHDV3/1120-1218--------------------------------------------------------------------------------
O92368_VESV/1208-1312--------------------------------------------------------------------------------
POLG_SVM93/997-1103--------------------------------------------------------------------------------
Q9QRV9_9CALI/1095-1199--------------------------------------------------------------------------------
POLG_PESV/1063-1169--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268KLDFSHLKMELAPQGGFDNQGNTPFGKGTMKPTTINRLLIQAVALTMERQDEFQLQGK...MYDFDDDRVSAFTTMARDN
Q9YQ23_VESV/628-1162KKDFSHLQLQLAPQGGFDCMGNTPYGKGAMSKTSLSRLLASATALALERLEDFQLQAP...EYDFDKNRVTAFTRMASDN
Q80J95_9CALI/650-1163RPDYSHINFILAPQGGFDRQGNTPYGKGVTKIIGATALCARAVALVHERHDDFGLQNK...VYDFDAGKVTAFKAMAADA
Q8JJL0_9CALI/645-1175KQDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSLTARVAGLVHERKDEFQLQGNDLQTYNFDTNRVSAFRKLAADN
Q80RD7_9CALI/641-1177SPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARASGLLHERLDEFELQGPNLTTFNFDRNKIQAFRQLAAEN

PF01732

A5IYK2_MYCAP/279-649--------------------------------------------------------------------------------
Q6MUH9_MYCMS/258-617--------------------------------------------------------------------------------
Q2SR25_MYCCT/264-622--------------------------------------------------------------------------------
D3VQF5_MYCA6/359-733--------------------------------------------------------------------------------
Q4A635_MYCS5/147-497--------------------------------------------------------------------------------
Q4A5A2_MYCS5/91-491--------------------------------------------------------------------------------
C7LM95_MYCML/189-571--------------------------------------------------------------------------------
A5IYA1_MYCAP/186-569--------------------------------------------------------------------------------
Q4A798_MYCH7/125-523--------------------------------------------------------------------------------
Q4A5G2_MYCS5/337-740--------------------------------------------------------------------------------
D3FFM3_MYCGH/244-661--------------------------------------------------------------------------------
C5J6P1_MYCCR/115-482--------------------------------------------------------------------------------
Q7NAU7_MYCGA/221-623--------------------------------------------------------------------------------
Q7NAG1_MYCGA/203-712--------------------------------------------------------------------------------
D3FHQ1_MYCGH/203-710--------------------------------------------------------------------------------
Q4A5P6_MYCS5/166-643--------------------------------------------------------------------------------
D1J8A8_MYCHP/334-723--------------------------------------------------------------------------------
B3XS56_UREUR/379-750--------------------------------------------------------------------------------
B2D8H3_UREPR/376-752--------------------------------------------------------------------------------
Q9PR98_UREPA/413-786--------------------------------------------------------------------------------
Q6MSY9_MYCMS/283-769--------------------------------------------------------------------------------
C7LKT8_MYCML/288-775--------------------------------------------------------------------------------
Q98Q64_MYCPU/350-715--------------------------------------------------------------------------------
Q98QS3_MYCPU/339-702--------------------------------------------------------------------------------
D3FJ19_MYCGF/216-600--------------------------------------------------------------------------------
Q7NAJ2_MYCGA/204-545--------------------------------------------------------------------------------
Q4A7B5_MYCH7/323-738--------------------------------------------------------------------------------
Q98PH9_MYCPU/101-415--------------------------------------------------------------------------------
Q8EWB5_MYCPE/130-442--------------------------------------------------------------------------------
Q8EW95_MYCPE/145-484--------------------------------------------------------------------------------
Y068_MYCGE/48-383--------------------------------------------------------------------------------
Y084_MYCPN/45-410--------------------------------------------------------------------------------
Y588_MYCPN/75-444--------------------------------------------------------------------------------
Y395_MYCGE/89-428--------------------------------------------------------------------------------
Y592_MYCPN/104-443--------------------------------------------------------------------------------
Y083_MYCPN/52-447--------------------------------------------------------------------------------
Y582_MYCPN/44-388--------------------------------------------------------------------------------
Q4A8M7_MYCH7/557-908--------------------------------------------------------------------------------
Q8EWN7_MYCPE/57-397--------------------------------------------------------------------------------
B3XTP3_UREUR/59-344--------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Q4VIX4_9FLAV/1520-1672--------------------------------------------------------------------------------
O36765_9FLAV/1520-1672--------------------------------------------------------------------------------
Q3I100_WNV/1521-1673--------------------------------------------------------------------------------
Q32ZD1_9FLAV/1516-1668--------------------------------------------------------------------------------
Q32ZD7_9FLAV/1513-1665--------------------------------------------------------------------------------
Q32ZD2_9FLAV/1515-1667--------------------------------------------------------------------------------
Q32ZD5_9FLAV/1508-1660--------------------------------------------------------------------------------
Q98Y40_9FLAV/1491-1643--------------------------------------------------------------------------------
Q5DSL2_9FLAV/1489-1641--------------------------------------------------------------------------------
Q9J8E1_9FLAV/1491-1643--------------------------------------------------------------------------------
Q2YHE7_9FLAV/1490-1642--------------------------------------------------------------------------------
A0EKU1_9FLAV/1504-1656--------------------------------------------------------------------------------
A0EKU7_9FLAV/1506-1658--------------------------------------------------------------------------------
A0EKU5_9FLAV/1507-1659--------------------------------------------------------------------------------
Q91B85_9FLAV/1509-1661--------------------------------------------------------------------------------
POLG_LANVT/1507-1659--------------------------------------------------------------------------------
Q3Y6G7_9FLAV/1507-1659--------------------------------------------------------------------------------
Q6JJM0_9FLAV/1507-1659--------------------------------------------------------------------------------
Q8VBK7_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU2_9FLAV/1509-1661--------------------------------------------------------------------------------
Q5G264_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU6_9FLAV/1510-1662--------------------------------------------------------------------------------
A0EKU3_9FLAV/1496-1648--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y067_MYCGE/321-456--------------------------------------------------------------------------------
Y083_MYCPN/328-467--------------------------------------------------------------------------------
Y068_MYCGE/272-402--------------------------------------------------------------------------------
Y084_MYCPN/296-431--------------------------------------------------------------------------------
Y588_MYCPN/338-464--------------------------------------------------------------------------------
Y395_MYCGE/314-448--------------------------------------------------------------------------------
Y592_MYCPN/334-455--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
Q8QVE1_9FLAV/1495-1635--------------------------------------------------------------------------------
Q6A4R3_AEDAL/768-912--------------------------------------------------------------------------------
Q80DQ3_9FLAV/1484-1633--------------------------------------------------------------------------------
Q8JJZ3_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9JAD5_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9J9C2_9FLAV/1482-1633--------------------------------------------------------------------------------
Q8QL64_9FLAV/1478-1629--------------------------------------------------------------------------------
POLG_YEFVE/1501-1655--------------------------------------------------------------------------------
Q32ZD3_9FLAV/1496-1649--------------------------------------------------------------------------------
Q32ZD9_9FLAV/1506-1659--------------------------------------------------------------------------------
Q7T918_9FLAV/1515-1668--------------------------------------------------------------------------------
Q32ZD6_9FLAV/1505-1657--------------------------------------------------------------------------------
Q32ZD8_9FLAV/1507-1659--------------------------------------------------------------------------------
Q32ZE1_9FLAV/1514-1666--------------------------------------------------------------------------------
Q32ZE0_9FLAV/1519-1670--------------------------------------------------------------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

B4SLK2_STRM5/22-718--------------------------------------------------------------------------------
A1SA55_SHEAM/18-726--------------------------------------------------------------------------------
A3J218_9FLAO/21-713--------------------------------------------------------------------------------
A3J4B3_9FLAO/17-708--------------------------------------------------------------------------------
E0THX8_PARBH/23-721--------------------------------------------------------------------------------
A3WDJ5_9SPHN/23-720--------------------------------------------------------------------------------
F2GAE2_ALTMD/22-719--------------------------------------------------------------------------------
A4C924_9GAMM/18-739--------------------------------------------------------------------------------
A4CBH4_9GAMM/20-717--------------------------------------------------------------------------------
A5FMW8_FLAJ1/19-712--------------------------------------------------------------------------------
B8E9P0_SHEB2/18-729--------------------------------------------------------------------------------
A5PEK4_9SPHN/21-716--------------------------------------------------------------------------------
A5ZH65_9BACE/21-717--------------------------------------------------------------------------------
A6E8C7_9SPHI/24-720--------------------------------------------------------------------------------
A6EQ24_9BACT/17-690--------------------------------------------------------------------------------
A6ERE5_9BACT/20-712--------------------------------------------------------------------------------
A6GH08_9DELT/30-733--------------------------------------------------------------------------------
A6GI93_9DELT/51-752--------------------------------------------------------------------------------
A6GWM2_FLAPJ/17-707--------------------------------------------------------------------------------
A6KZW8_BACV8/17-706--------------------------------------------------------------------------------
A6L2J7_BACV8/19-726--------------------------------------------------------------------------------
A6L2J8_BACV8/21-719--------------------------------------------------------------------------------
A6LID5_PARD8/19-717--------------------------------------------------------------------------------
A6WS02_SHEB8/18-716--------------------------------------------------------------------------------
A7AAA4_9PORP/22-711--------------------------------------------------------------------------------
A7AHP4_9PORP/19-717--------------------------------------------------------------------------------
A7HA06_ANADF/20-725--------------------------------------------------------------------------------
A7HFU9_ANADF/37-699--------------------------------------------------------------------------------
A7V0H7_BACUN/20-709--------------------------------------------------------------------------------
A7V1I5_BACUN/23-719--------------------------------------------------------------------------------
A8FR99_SHESH/24-737--------------------------------------------------------------------------------
Q024G1_SOLUE/22-694--------------------------------------------------------------------------------
Q027J4_SOLUE/18-549--------------------------------------------------------------------------------
Q029T1_SOLUE/24-727--------------------------------------------------------------------------------
Q02D16_SOLUE/31-664--------------------------------------------------------------------------------
Q07XT1_SHEFN/18-727--------------------------------------------------------------------------------
Q08V25_STIAD/73-737--------------------------------------------------------------------------------
Q08VC9_STIAD/18-714--------------------------------------------------------------------------------
Q11SC7_CYTH3/21-702--------------------------------------------------------------------------------
Q12RW4_SHEDO/18-728--------------------------------------------------------------------------------
Q1D5W7_MYXXD/35-700--------------------------------------------------------------------------------
Q1D9F6_MYXXD/17-714--------------------------------------------------------------------------------
Q1DDZ2_MYXXD/18-682--------------------------------------------------------------------------------
Q1GVV7_SPHAL/23-684--------------------------------------------------------------------------------
Q1IPC2_KORVE/27-692--------------------------------------------------------------------------------
Q1NG15_9SPHN/26-683--------------------------------------------------------------------------------
Q2G546_NOVAD/56-713--------------------------------------------------------------------------------
Q2IEV3_ANADE/18-687--------------------------------------------------------------------------------
Q2NZP5_XANOM/22-715--------------------------------------------------------------------------------
Q2S133_SALRD/5-639--------------------------------------------------------------------------------
Q2S134_SALRD/69-734--------------------------------------------------------------------------------
Q3REP2_XYLFA/22-714--------------------------------------------------------------------------------
Q488S2_COLP3/26-729--------------------------------------------------------------------------------
Q5LIW7_BACFN/34-723--------------------------------------------------------------------------------
Q5QV86_IDILO/17-717--------------------------------------------------------------------------------
Q64RG4_BACFR/19-718--------------------------------------------------------------------------------
Q7MV25_PORGI/21-718--------------------------------------------------------------------------------
Q7MWU6_PORGI/24-711--------------------------------------------------------------------------------
Q7NHA9_GLOVI/34-698--------------------------------------------------------------------------------
Q7UKL5_RHOBA/28-688--------------------------------------------------------------------------------
Q8A2L6_BACTN/20-711--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
POLG_EC01F/1540-1705--------------------------------------------------------------------------------
POLG_HRV14/1538-1702--------------------------------------------------------------------------------
POLG_BOVEV/1532-1697--------------------------------------------------------------------------------
POLG_CX16G/1549-1714--------------------------------------------------------------------------------
POLG_HE701/1555-1720--------------------------------------------------------------------------------
POLG_PEV9U/1525-1690--------------------------------------------------------------------------------
Q04107_HRV1A/162-327--------------------------------------------------------------------------------
Q6TGL9_9ENTO/1563-1728--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
Q6TPI6_9PICO/1649-1833--------------------------------------------------------------------------------
Q7T7N7_9ENTO/1563-1728--------------------------------------------------------------------------------
Q8B552_9PICO/1782-1946--------------------------------------------------------------------------------
POLG_TMEVG/1636-1816--------------------------------------------------------------------------------
POL1_BBWVS/957-1123--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
Q80N16_9PICO/1589-1765--------------------------------------------------------------------------------
Q9IM09_9ENTO/1556-1721--------------------------------------------------------------------------------
O39818_9PICO/1580-1761--------------------------------------------------------------------------------

PF00863

POLG_PEMVM/2056-2290--------------------------------------------------------------------------------
Q98WK5_PRSVW/2281-2513--------------------------------------------------------------------------------
Q98810_9POTV/196-430--------------------------------------------------------------------------------
Q7T915_9POTV/2040-2274--------------------------------------------------------------------------------
Q89255_9POTY/427-646--------------------------------------------------------------------------------
Q82933_9POTV/1990-2223--------------------------------------------------------------------------------
Q9YZN8_9POTV/2078-2312--------------------------------------------------------------------------------
Q8QXL0_9POTV/1962-2196--------------------------------------------------------------------------------
O10243_CYVV/709-943--------------------------------------------------------------------------------
Q8QXN3_9POTV/1986-2220--------------------------------------------------------------------------------
POL1_BAYMJ/1361-1581--------------------------------------------------------------------------------
POLG_PPVNA/2048-2282--------------------------------------------------------------------------------
Q8QV60_9POTV/2016-2250--------------------------------------------------------------------------------
POLG_LMV0/2213-2447--------------------------------------------------------------------------------
Q8UZ37_9POTV/2108-2341--------------------------------------------------------------------------------
POLG_SPMMV/2424-2646--------------------------------------------------------------------------------
O89525_9POTY/1998-2231--------------------------------------------------------------------------------
Q7T4I3_TUMVJ/2115-2349--------------------------------------------------------------------------------
Q8QQA0_9POTV/2042-2276--------------------------------------------------------------------------------
Q8QY00_9POTV/2175-2409--------------------------------------------------------------------------------
Q9WAA3_9POTY/1259-1474--------------------------------------------------------------------------------
O39734_9POTV/2413-2647--------------------------------------------------------------------------------
Q65883_BYMV/335-569--------------------------------------------------------------------------------
Q9E160_9POTY/1951-2181--------------------------------------------------------------------------------
Q7T7N5_9POTV/2211-2445--------------------------------------------------------------------------------
Q8QXL1_9POTV/1986-2220--------------------------------------------------------------------------------
POLG_OMV/121-355--------------------------------------------------------------------------------
Q9QBT4_PVMA/2030-2264--------------------------------------------------------------------------------
Q80MX2_9POTY/190-375--------------------------------------------------------------------------------
Q80P26_9POTV/2027-2261--------------------------------------------------------------------------------
Q8UZ27_9POTY/1335-1554--------------------------------------------------------------------------------
Q9WID3_9POTV/2038-2271--------------------------------------------------------------------------------
Q88507_TEV/2036-2269--------------------------------------------------------------------------------
Q7T5A6_9POTV/2385-2619--------------------------------------------------------------------------------
Q912R2_9POTV/2117-2351--------------------------------------------------------------------------------
Q9YNB1_9POTY/405-628--------------------------------------------------------------------------------
Q9QBG1_9POTY/1362-1581--------------------------------------------------------------------------------
Q88925_TVMV/2000-2232--------------------------------------------------------------------------------
O73463_MDMV/1986-2220--------------------------------------------------------------------------------

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF12380

B3U1H5_YHV/2834-3117--------------------------------------------------------------------------------
Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF13365

DEG15_ARATH/376-594--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
Q2P9Y4_9ACTO/162-308--------------------------------------------------------------------------------
B6QXD8_9RHOB/76-232--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
C3HBL0_BACTU/109-260--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
Q2RS04_RHORT/145-306--------------------------------------------------------------------------------
Q467S2_METBF/103-254--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A3VZZ0_9RHOB/114-264--------------------------------------------------------------------------------
B6R9Y4_9RHOB/91-243--------------------------------------------------------------------------------
D3CTM8_9ACTO/100-254--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D4GHS4_PANAM/109-260--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
Q846R2_MYXXA/58-225--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B4VV96_9CYAN/140-327--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
A8FZT0_SHESH/365-519--------------------------------------------------------------------------------
B9M1H9_GEOSF/322-480--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
B4VT06_9CYAN/299-436--------------------------------------------------------------------------------
B8H010_CAUCN/64-248--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A3JWZ9_9RHOB/120-292--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
C6JD09_9FIRM/162-306--------------------------------------------------------------------------------
C0CMS9_9FIRM/152-296--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
C0FTN1_9FIRM/149-293--------------------------------------------------------------------------------
C9L519_RUMHA/148-292--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
B5CQ59_9FIRM/147-291--------------------------------------------------------------------------------
A5KN66_9FIRM/147-291--------------------------------------------------------------------------------
B6FP33_9CLOT/144-288--------------------------------------------------------------------------------
A7B169_RUMGN/176-320--------------------------------------------------------------------------------
B0NI56_EUBSP/167-311--------------------------------------------------------------------------------
C0B801_9FIRM/151-295--------------------------------------------------------------------------------
B0G1M9_9FIRM/149-293--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
B7AVI8_9FIRM/172-316--------------------------------------------------------------------------------
C5ELW4_9FIRM/172-316--------------------------------------------------------------------------------
C4G4N6_ABIDE/156-298--------------------------------------------------------------------------------
C1IAW0_9CLOT/114-253--------------------------------------------------------------------------------
B8AM75_ORYSI/89-258--------------------------------------------------------------------------------
B5JQS5_9BACT/61-197--------------------------------------------------------------------------------
B3DXV6_METI4/79-214--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
B9G3S8_ORYSJ/109-256--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
B9FMK5_ORYSJ/181-321--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
A7NIM6_ROSCS/38-173--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C6XBL7_METSD/51-179--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B6BWJ8_9PROT/54-182--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
B6BVZ4_9PROT/47-175--------------------------------------------------------------------------------
C6XD83_METSD/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
C6BGJ0_RALP1/55-184--------------------------------------------------------------------------------
B3QPC6_CHLP8/57-184--------------------------------------------------------------------------------
Q0YS38_9CHLB/89-216--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
Q3M8K4_ANAVT/33-168--------------------------------------------------------------------------------
D5WKU5_BURSC/40-175--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRAJA/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
B4UF27_ANASK/45-180--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
B4WI21_9SYNE/33-173--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
A6C5I0_9PLAN/58-206--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
A4A0T0_9PLAN/66-211--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
B6B9E4_9RHOB/398-528--------------------------------------------------------------------------------
D0D6Q7_9RHOB/389-519--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
A4A0S9_9PLAN/71-202--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
A9VXT6_METEP/54-187--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D3NU60_AZOS1/54-191--------------------------------------------------------------------------------
A8TSL0_9PROT/61-191--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
D0RMV8_9PROT/62-194--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
B4UTS4_BP163/66-193--------------------------------------------------------------------------------
Q11LS4_MESSB/40-170--------------------------------------------------------------------------------
C4RAG7_9PROT/100-239--------------------------------------------------------------------------------
C5JAK2_9BACT/101-240--------------------------------------------------------------------------------
C5JBN6_9BACT/99-238--------------------------------------------------------------------------------
A0L9W3_MAGSM/126-265--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A5BEH1_VITVI/502-717--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A9ZKZ5_COXBE/58-186--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
A1DKZ3_NEOFI/106-274--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
B4VWK9_9CYAN/26-185--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
A3ZSU8_9PLAN/169-309--------------------------------------------------------------------------------
A6CCJ8_9PLAN/216-356--------------------------------------------------------------------------------
B5W7L6_SPIMA/53-196--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------
A0ZIJ6_NODSP/50-187--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
A0YM55_LYNSP/62-208--------------------------------------------------------------------------------
Q060L2_9SYNE/66-212--------------------------------------------------------------------------------
A2CDP2_PROM3/91-233--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
A8YFS3_MICAE/52-220--------------------------------------------------------------------------------
B4VKH5_9CYAN/399-535--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q4C9U0_CROWT/64-213--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B6BL05_9PROT/72-191--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
C2FHG0_LACPA/165-321--------------------------------------------------------------------------------
B0EDS2_ENTDS/219-353--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
B9IN99_POPTR/16-159--------------------------------------------------------------------------------
D1W398_9BACT/21-163--------------------------------------------------------------------------------
Q7MW22_PORGI/27-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
A8YNP5_MICAE/435-587--------------------------------------------------------------------------------
B8BM04_ORYSI/29-174--------------------------------------------------------------------------------
A3WZP2_9BRAD/25-182--------------------------------------------------------------------------------
B6SLW3_MAIZE/46-198--------------------------------------------------------------------------------
B4W048_9CYAN/24-160--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
C4RBC6_9ACTO/39-187--------------------------------------------------------------------------------
B5HRW8_9ACTO/52-200--------------------------------------------------------------------------------
B4VL88_9CYAN/23-161--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
A3XNG0_LEEBM/39-192--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
D1W141_9BACT/221-392--------------------------------------------------------------------------------
Q72KS5_THET2/61-193--------------------------------------------------------------------------------
B7A6E3_THEAQ/62-195--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
B4D8F4_9BACT/72-317--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A7BUM9_9GAMM/28-164--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
B3NQY9_DROER/305-445--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
A3SCU7_9RHOB/196-330--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
A9AU45_BURM1/75-243--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
B4D163_9BACT/76-206--------------------------------------------------------------------------------
B4CWZ6_9BACT/327-458--------------------------------------------------------------------------------
B4CWZ7_9BACT/330-461--------------------------------------------------------------------------------
B4D4S9_9BACT/50-179--------------------------------------------------------------------------------
C0AF95_9BACT/54-190--------------------------------------------------------------------------------
B9YD37_9FIRM/27-200--------------------------------------------------------------------------------
B2ULX5_AKKM8/77-314--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
Q1PY07_9BACT/57-189--------------------------------------------------------------------------------
C3QH30_9BACE/51-184--------------------------------------------------------------------------------
A5ZI03_9BACE/49-181--------------------------------------------------------------------------------
B5CVV9_9BACE/52-183--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
C8N8L7_9GAMM/65-197--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
C0DWH2_EIKCO/92-250--------------------------------------------------------------------------------
D1NAH5_9BACT/62-195--------------------------------------------------------------------------------
A8KF66_BURPE/83-236--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C0GIE8_9FIRM/109-240--------------------------------------------------------------------------------
A6CKL8_9BACI/105-229--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
A4A524_9GAMM/61-225--------------------------------------------------------------------------------
A4BT63_9GAMM/57-219--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
C6AVQ8_RHILS/33-192--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
D3LKZ9_MICLU/283-419--------------------------------------------------------------------------------
B4V9A1_9ACTO/51-211--------------------------------------------------------------------------------
B4CXG1_9BACT/84-257--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
D3W785_9VIRU/161-295--------------------------------------------------------------------------------
B4V7A8_9ACTO/24-181--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
C9BDM8_ENTFC/121-272--------------------------------------------------------------------------------
B8AXY3_ORYSI/1277-1457--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
B9G3S5_ORYSJ/55-216--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
B2XS89_9VIRU/586-711--------------------------------------------------------------------------------
NS1A_OASV1/438-558--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B3EEJ2_CHLL2/96-337--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
A8TZT7_9PROT/75-215--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569--------------------------------------------------------------------------------
SP24D_ANOGA/50-264--------------------------------------------------------------------------------
TRY5_AEDAE/40-260--------------------------------------------------------------------------------
UROK_HUMAN/179-419--------------------------------------------------------------------------------
MASP1_MOUSE/454-696--------------------------------------------------------------------------------
CTR1_ANOGA/33-250--------------------------------------------------------------------------------
CFAD_HUMAN/26-248--------------------------------------------------------------------------------
ACRO_RAT/43-286--------------------------------------------------------------------------------
HPT_HUMAN/162-399--------------------------------------------------------------------------------
CASP_MESAU/445-682--------------------------------------------------------------------------------
SNAK_DROME/186-427--------------------------------------------------------------------------------
PCE_TACTR/128-370--------------------------------------------------------------------------------
STUB_DROME/544-782--------------------------------------------------------------------------------
TRYU_DROME/28-254--------------------------------------------------------------------------------
TRYI_DROME/28-245--------------------------------------------------------------------------------
TRYB_MANSE/25-252--------------------------------------------------------------------------------
TRYP_FUSOX/25-244--------------------------------------------------------------------------------
TRYP_STRGR/37-252--------------------------------------------------------------------------------
TRY1_HUMAN/24-239--------------------------------------------------------------------------------
TRYP_PIG/9-224--------------------------------------------------------------------------------
TRY1_SALSA/21-235--------------------------------------------------------------------------------
TRYP_PLEPL/23-242--------------------------------------------------------------------------------
DEGP3_ARATH/99-287--------------------------------------------------------------------------------
DEGP2_ARATH/121-308--------------------------------------------------------------------------------
DEGS_ECOLI/62-244--------------------------------------------------------------------------------
DEGS_HAEIN/37-240--------------------------------------------------------------------------------
YYXA_BACSU/99-283--------------------------------------------------------------------------------
DEGP_SALTY/97-278--------------------------------------------------------------------------------
Q44596_BRUAO/85-261--------------------------------------------------------------------------------
DEGPL_BRUSU/125-298--------------------------------------------------------------------------------
O06439_RHOCA/59-235--------------------------------------------------------------------------------
HHOA_SYNY3/95-274--------------------------------------------------------------------------------
HTRA_SYNY3/156-334--------------------------------------------------------------------------------
O42417_CHICK/87-286--------------------------------------------------------------------------------
ETA_STAAU/70-274--------------------------------------------------------------------------------
ETB_STAAU/59-251--------------------------------------------------------------------------------
SPLB_STAAU/37-234--------------------------------------------------------------------------------
SPLC_STAAU/38-233--------------------------------------------------------------------------------
MPR_BACSU/95-311--------------------------------------------------------------------------------
PRTC_STRGR/205-383--------------------------------------------------------------------------------
Q55353_STRSQ/198-372--------------------------------------------------------------------------------
Q55352_STRSQ/202-378--------------------------------------------------------------------------------
Q54395_STRLI/158-342--------------------------------------------------------------------------------
SP1_RARFA/205-391--------------------------------------------------------------------------------
CERC_SCHMA/28-256--------------------------------------------------------------------------------
Q54344_STRLI/47-254--------------------------------------------------------------------------------
CFAB_HUMAN/481-752--------------------------------------------------------------------------------
PROZ_BOVIN/143-352--------------------------------------------------------------------------------
CAC3_BOVIN/12-246--------------------------------------------------------------------------------
CELA1_PIG/27-259--------------------------------------------------------------------------------
CTRA_BOVIN/16-238--------------------------------------------------------------------------------
CTRL_HALRU/24-251--------------------------------------------------------------------------------
COGS_HYPLI/31-252--------------------------------------------------------------------------------
CTRB1_LITVA/46-263--------------------------------------------------------------------------------
CATG_MOUSE/21-238--------------------------------------------------------------------------------
MCPT2_RAT/21-239--------------------------------------------------------------------------------
ELNE_HUMAN/30-242--------------------------------------------------------------------------------
PRTN3_HUMAN/28-243--------------------------------------------------------------------------------
GRAK_RAT/26-248--------------------------------------------------------------------------------
GRAM_RAT/21-245--------------------------------------------------------------------------------
KLK1_MOUSE/25-253--------------------------------------------------------------------------------
KLK2_RAT/25-251--------------------------------------------------------------------------------
VSPCA_AGKCO/1-217--------------------------------------------------------------------------------
HGF_RAT/496-719--------------------------------------------------------------------------------
ENTK_PIG/800-1029--------------------------------------------------------------------------------
PRSS8_HUMAN/45-281--------------------------------------------------------------------------------
HGFA_HUMAN/408-641--------------------------------------------------------------------------------
TPA_HUMAN/311-556--------------------------------------------------------------------------------
FA10_HUMAN/235-462--------------------------------------------------------------------------------
THRB_BOVIN/367-616--------------------------------------------------------------------------------
PROC_HUMAN/212-445--------------------------------------------------------------------------------

PF09342

Q7QJ48_ANOGA/1759-1982--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1512-1777--------------------------------------------------------------------------------
NUDEL_DROME/2005-2298--------------------------------------------------------------------------------

PF03761

Q9U2W2_CAEEL/6-282--------------------------------------------------------------------------------
Q21628_CAEEL/5-298--------------------------------------------------------------------------------
O45371_CAEEL/3-276--------------------------------------------------------------------------------
O76649_CAEEL/2-297--------------------------------------------------------------------------------
A8XIB1_CAEBR/15-285--------------------------------------------------------------------------------
A8WNY9_CAEBR/3-296--------------------------------------------------------------------------------
Q9XWZ8_CAEEL/4-272--------------------------------------------------------------------------------
O62223_CAEEL/7-278--------------------------------------------------------------------------------
O62231_CAEEL/5-272--------------------------------------------------------------------------------

PF00944

POLS_AURAV/110-268--------------------------------------------------------------------------------
P89913_SINDV/109-267--------------------------------------------------------------------------------
POLS_BFV/98-255--------------------------------------------------------------------------------
POLS_EEEV/103-260--------------------------------------------------------------------------------
O41516_9VIRU/119-276--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF05580

Q46028_CLODI/132-352--------------------------------------------------------------------------------
Q97HE0_CLOAB/173-391--------------------------------------------------------------------------------
Q9K975_BACHD/206-424--------------------------------------------------------------------------------
P71028_BACIU/197-414--------------------------------------------------------------------------------
Q8XJE5_CLOPE/165-382--------------------------------------------------------------------------------
Q8RAC0_THETN/198-414--------------------------------------------------------------------------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

O09461_9FLAV/1588-1798--------------------------------------------------------------------------------
Q04232_BVDV/149-359--------------------------------------------------------------------------------
Q68287_9FLAV/2-212--------------------------------------------------------------------------------
O11993_BVDV/1590-1800--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782--------------------------------------------------------------------------------
PET_ECO44/46-729--------------------------------------------------------------------------------
IGA0_HAEIN/17-865--------------------------------------------------------------------------------
SEPA_SHIFL/46-800--------------------------------------------------------------------------------
PIC_SHIFL/49-802--------------------------------------------------------------------------------
HBP_ECOLX/44-811--------------------------------------------------------------------------------
HAP2_HAEIF/17-765--------------------------------------------------------------------------------
IGA_NEIGO/19-849--------------------------------------------------------------------------------
ESPP_ECO57/47-730--------------------------------------------------------------------------------

PF05409

R1AB_FIPV/2932-3214--------------------------------------------------------------------------------
R1AB_PEDV7/3026-3317--------------------------------------------------------------------------------
R1AB_IBVBC/2808-3109--------------------------------------------------------------------------------
R1AB_CVMJH/3365-3658--------------------------------------------------------------------------------
R1AB_CVH22/2994-3284--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMVE/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF03510

POLG_RHDV3/1120-1218--------------------------------------------------------------------------------
O92368_VESV/1208-1312--------------------------------------------------------------------------------
POLG_SVM93/997-1103--------------------------------------------------------------------------------
Q9QRV9_9CALI/1095-1199--------------------------------------------------------------------------------
POLG_PESV/1063-1169--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268GLGILSMAGLGKKLRGVTTMEGLKNALKGYKISACTIKWQAKVYSLESDGN.SVNIKEERNILTQQQQSVCTASVALTRL
Q9YQ23_VESV/628-1162GLGVMAAMRLGNRLKNVTTITELESALFGHTIAPCQIVWRGARYSMHTDGK.NMSIQQ.....VTTPAPVEEVNYALKRL
Q80J95_9CALI/650-1163GIPWYKMAAIGCKAMGCTCVEEAMHLLKDYEVAPCQVIYNGATYNVSCI.KGAPMVEK.....VKEPELPKTLVNCVRRI
Q8JJL0_9CALI/645-1175KYGIVETMRVGAALKNVKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDK...VEDHTSQTANEVSSALLRL
Q80RD7_9CALI/641-1177KYGLVDTMRVGGQLKGVRTIPELKQALKNILIKRCQIVYGGSTYTLESDGKGNVKVEK...VQNTNIQINNELAGALHHL

PF01732

A5IYK2_MYCAP/279-649--------------------------------------------------------------------------------
Q6MUH9_MYCMS/258-617--------------------------------------------------------------------------------
Q2SR25_MYCCT/264-622--------------------------------------------------------------------------------
D3VQF5_MYCA6/359-733--------------------------------------------------------------------------------
Q4A635_MYCS5/147-497--------------------------------------------------------------------------------
Q4A5A2_MYCS5/91-491--------------------------------------------------------------------------------
C7LM95_MYCML/189-571--------------------------------------------------------------------------------
A5IYA1_MYCAP/186-569--------------------------------------------------------------------------------
Q4A798_MYCH7/125-523--------------------------------------------------------------------------------
Q4A5G2_MYCS5/337-740--------------------------------------------------------------------------------
D3FFM3_MYCGH/244-661--------------------------------------------------------------------------------
C5J6P1_MYCCR/115-482--------------------------------------------------------------------------------
Q7NAU7_MYCGA/221-623--------------------------------------------------------------------------------
Q7NAG1_MYCGA/203-712--------------------------------------------------------------------------------
D3FHQ1_MYCGH/203-710--------------------------------------------------------------------------------
Q4A5P6_MYCS5/166-643--------------------------------------------------------------------------------
D1J8A8_MYCHP/334-723--------------------------------------------------------------------------------
B3XS56_UREUR/379-750--------------------------------------------------------------------------------
B2D8H3_UREPR/376-752--------------------------------------------------------------------------------
Q9PR98_UREPA/413-786--------------------------------------------------------------------------------
Q6MSY9_MYCMS/283-769--------------------------------------------------------------------------------
C7LKT8_MYCML/288-775--------------------------------------------------------------------------------
Q98Q64_MYCPU/350-715--------------------------------------------------------------------------------
Q98QS3_MYCPU/339-702--------------------------------------------------------------------------------
D3FJ19_MYCGF/216-600--------------------------------------------------------------------------------
Q7NAJ2_MYCGA/204-545--------------------------------------------------------------------------------
Q4A7B5_MYCH7/323-738--------------------------------------------------------------------------------
Q98PH9_MYCPU/101-415--------------------------------------------------------------------------------
Q8EWB5_MYCPE/130-442--------------------------------------------------------------------------------
Q8EW95_MYCPE/145-484--------------------------------------------------------------------------------
Y068_MYCGE/48-383--------------------------------------------------------------------------------
Y084_MYCPN/45-410--------------------------------------------------------------------------------
Y588_MYCPN/75-444--------------------------------------------------------------------------------
Y395_MYCGE/89-428--------------------------------------------------------------------------------
Y592_MYCPN/104-443--------------------------------------------------------------------------------
Y083_MYCPN/52-447--------------------------------------------------------------------------------
Y582_MYCPN/44-388--------------------------------------------------------------------------------
Q4A8M7_MYCH7/557-908--------------------------------------------------------------------------------
Q8EWN7_MYCPE/57-397--------------------------------------------------------------------------------
B3XTP3_UREUR/59-344--------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Q4VIX4_9FLAV/1520-1672--------------------------------------------------------------------------------
O36765_9FLAV/1520-1672--------------------------------------------------------------------------------
Q3I100_WNV/1521-1673--------------------------------------------------------------------------------
Q32ZD1_9FLAV/1516-1668--------------------------------------------------------------------------------
Q32ZD7_9FLAV/1513-1665--------------------------------------------------------------------------------
Q32ZD2_9FLAV/1515-1667--------------------------------------------------------------------------------
Q32ZD5_9FLAV/1508-1660--------------------------------------------------------------------------------
Q98Y40_9FLAV/1491-1643--------------------------------------------------------------------------------
Q5DSL2_9FLAV/1489-1641--------------------------------------------------------------------------------
Q9J8E1_9FLAV/1491-1643--------------------------------------------------------------------------------
Q2YHE7_9FLAV/1490-1642--------------------------------------------------------------------------------
A0EKU1_9FLAV/1504-1656--------------------------------------------------------------------------------
A0EKU7_9FLAV/1506-1658--------------------------------------------------------------------------------
A0EKU5_9FLAV/1507-1659--------------------------------------------------------------------------------
Q91B85_9FLAV/1509-1661--------------------------------------------------------------------------------
POLG_LANVT/1507-1659--------------------------------------------------------------------------------
Q3Y6G7_9FLAV/1507-1659--------------------------------------------------------------------------------
Q6JJM0_9FLAV/1507-1659--------------------------------------------------------------------------------
Q8VBK7_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU2_9FLAV/1509-1661--------------------------------------------------------------------------------
Q5G264_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU6_9FLAV/1510-1662--------------------------------------------------------------------------------
A0EKU3_9FLAV/1496-1648--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y067_MYCGE/321-456--------------------------------------------------------------------------------
Y083_MYCPN/328-467--------------------------------------------------------------------------------
Y068_MYCGE/272-402--------------------------------------------------------------------------------
Y084_MYCPN/296-431--------------------------------------------------------------------------------
Y588_MYCPN/338-464--------------------------------------------------------------------------------
Y395_MYCGE/314-448--------------------------------------------------------------------------------
Y592_MYCPN/334-455--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
Q8QVE1_9FLAV/1495-1635--------------------------------------------------------------------------------
Q6A4R3_AEDAL/768-912--------------------------------------------------------------------------------
Q80DQ3_9FLAV/1484-1633--------------------------------------------------------------------------------
Q8JJZ3_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9JAD5_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9J9C2_9FLAV/1482-1633--------------------------------------------------------------------------------
Q8QL64_9FLAV/1478-1629--------------------------------------------------------------------------------
POLG_YEFVE/1501-1655--------------------------------------------------------------------------------
Q32ZD3_9FLAV/1496-1649--------------------------------------------------------------------------------
Q32ZD9_9FLAV/1506-1659--------------------------------------------------------------------------------
Q7T918_9FLAV/1515-1668--------------------------------------------------------------------------------
Q32ZD6_9FLAV/1505-1657--------------------------------------------------------------------------------
Q32ZD8_9FLAV/1507-1659--------------------------------------------------------------------------------
Q32ZE1_9FLAV/1514-1666--------------------------------------------------------------------------------
Q32ZE0_9FLAV/1519-1670--------------------------------------------------------------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

B4SLK2_STRM5/22-718--------------------------------------------------------------------------------
A1SA55_SHEAM/18-726--------------------------------------------------------------------------------
A3J218_9FLAO/21-713--------------------------------------------------------------------------------
A3J4B3_9FLAO/17-708--------------------------------------------------------------------------------
E0THX8_PARBH/23-721--------------------------------------------------------------------------------
A3WDJ5_9SPHN/23-720--------------------------------------------------------------------------------
F2GAE2_ALTMD/22-719--------------------------------------------------------------------------------
A4C924_9GAMM/18-739--------------------------------------------------------------------------------
A4CBH4_9GAMM/20-717--------------------------------------------------------------------------------
A5FMW8_FLAJ1/19-712--------------------------------------------------------------------------------
B8E9P0_SHEB2/18-729--------------------------------------------------------------------------------
A5PEK4_9SPHN/21-716--------------------------------------------------------------------------------
A5ZH65_9BACE/21-717--------------------------------------------------------------------------------
A6E8C7_9SPHI/24-720--------------------------------------------------------------------------------
A6EQ24_9BACT/17-690--------------------------------------------------------------------------------
A6ERE5_9BACT/20-712--------------------------------------------------------------------------------
A6GH08_9DELT/30-733--------------------------------------------------------------------------------
A6GI93_9DELT/51-752--------------------------------------------------------------------------------
A6GWM2_FLAPJ/17-707--------------------------------------------------------------------------------
A6KZW8_BACV8/17-706--------------------------------------------------------------------------------
A6L2J7_BACV8/19-726--------------------------------------------------------------------------------
A6L2J8_BACV8/21-719--------------------------------------------------------------------------------
A6LID5_PARD8/19-717--------------------------------------------------------------------------------
A6WS02_SHEB8/18-716--------------------------------------------------------------------------------
A7AAA4_9PORP/22-711--------------------------------------------------------------------------------
A7AHP4_9PORP/19-717--------------------------------------------------------------------------------
A7HA06_ANADF/20-725--------------------------------------------------------------------------------
A7HFU9_ANADF/37-699--------------------------------------------------------------------------------
A7V0H7_BACUN/20-709--------------------------------------------------------------------------------
A7V1I5_BACUN/23-719--------------------------------------------------------------------------------
A8FR99_SHESH/24-737--------------------------------------------------------------------------------
Q024G1_SOLUE/22-694--------------------------------------------------------------------------------
Q027J4_SOLUE/18-549--------------------------------------------------------------------------------
Q029T1_SOLUE/24-727--------------------------------------------------------------------------------
Q02D16_SOLUE/31-664--------------------------------------------------------------------------------
Q07XT1_SHEFN/18-727--------------------------------------------------------------------------------
Q08V25_STIAD/73-737--------------------------------------------------------------------------------
Q08VC9_STIAD/18-714--------------------------------------------------------------------------------
Q11SC7_CYTH3/21-702--------------------------------------------------------------------------------
Q12RW4_SHEDO/18-728--------------------------------------------------------------------------------
Q1D5W7_MYXXD/35-700--------------------------------------------------------------------------------
Q1D9F6_MYXXD/17-714--------------------------------------------------------------------------------
Q1DDZ2_MYXXD/18-682--------------------------------------------------------------------------------
Q1GVV7_SPHAL/23-684--------------------------------------------------------------------------------
Q1IPC2_KORVE/27-692--------------------------------------------------------------------------------
Q1NG15_9SPHN/26-683--------------------------------------------------------------------------------
Q2G546_NOVAD/56-713--------------------------------------------------------------------------------
Q2IEV3_ANADE/18-687--------------------------------------------------------------------------------
Q2NZP5_XANOM/22-715--------------------------------------------------------------------------------
Q2S133_SALRD/5-639--------------------------------------------------------------------------------
Q2S134_SALRD/69-734--------------------------------------------------------------------------------
Q3REP2_XYLFA/22-714--------------------------------------------------------------------------------
Q488S2_COLP3/26-729--------------------------------------------------------------------------------
Q5LIW7_BACFN/34-723--------------------------------------------------------------------------------
Q5QV86_IDILO/17-717--------------------------------------------------------------------------------
Q64RG4_BACFR/19-718--------------------------------------------------------------------------------
Q7MV25_PORGI/21-718--------------------------------------------------------------------------------
Q7MWU6_PORGI/24-711--------------------------------------------------------------------------------
Q7NHA9_GLOVI/34-698--------------------------------------------------------------------------------
Q7UKL5_RHOBA/28-688--------------------------------------------------------------------------------
Q8A2L6_BACTN/20-711--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
POLG_EC01F/1540-1705--------------------------------------------------------------------------------
POLG_HRV14/1538-1702--------------------------------------------------------------------------------
POLG_BOVEV/1532-1697--------------------------------------------------------------------------------
POLG_CX16G/1549-1714--------------------------------------------------------------------------------
POLG_HE701/1555-1720--------------------------------------------------------------------------------
POLG_PEV9U/1525-1690--------------------------------------------------------------------------------
Q04107_HRV1A/162-327--------------------------------------------------------------------------------
Q6TGL9_9ENTO/1563-1728--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
Q6TPI6_9PICO/1649-1833--------------------------------------------------------------------------------
Q7T7N7_9ENTO/1563-1728--------------------------------------------------------------------------------
Q8B552_9PICO/1782-1946--------------------------------------------------------------------------------
POLG_TMEVG/1636-1816--------------------------------------------------------------------------------
POL1_BBWVS/957-1123--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
Q80N16_9PICO/1589-1765--------------------------------------------------------------------------------
Q9IM09_9ENTO/1556-1721--------------------------------------------------------------------------------
O39818_9PICO/1580-1761--------------------------------------------------------------------------------

PF00863

POLG_PEMVM/2056-2290--------------------------------------------------------------------------------
Q98WK5_PRSVW/2281-2513--------------------------------------------------------------------------------
Q98810_9POTV/196-430--------------------------------------------------------------------------------
Q7T915_9POTV/2040-2274--------------------------------------------------------------------------------
Q89255_9POTY/427-646--------------------------------------------------------------------------------
Q82933_9POTV/1990-2223--------------------------------------------------------------------------------
Q9YZN8_9POTV/2078-2312--------------------------------------------------------------------------------
Q8QXL0_9POTV/1962-2196--------------------------------------------------------------------------------
O10243_CYVV/709-943--------------------------------------------------------------------------------
Q8QXN3_9POTV/1986-2220--------------------------------------------------------------------------------
POL1_BAYMJ/1361-1581--------------------------------------------------------------------------------
POLG_PPVNA/2048-2282--------------------------------------------------------------------------------
Q8QV60_9POTV/2016-2250--------------------------------------------------------------------------------
POLG_LMV0/2213-2447--------------------------------------------------------------------------------
Q8UZ37_9POTV/2108-2341--------------------------------------------------------------------------------
POLG_SPMMV/2424-2646--------------------------------------------------------------------------------
O89525_9POTY/1998-2231--------------------------------------------------------------------------------
Q7T4I3_TUMVJ/2115-2349--------------------------------------------------------------------------------
Q8QQA0_9POTV/2042-2276--------------------------------------------------------------------------------
Q8QY00_9POTV/2175-2409--------------------------------------------------------------------------------
Q9WAA3_9POTY/1259-1474--------------------------------------------------------------------------------
O39734_9POTV/2413-2647--------------------------------------------------------------------------------
Q65883_BYMV/335-569--------------------------------------------------------------------------------
Q9E160_9POTY/1951-2181--------------------------------------------------------------------------------
Q7T7N5_9POTV/2211-2445--------------------------------------------------------------------------------
Q8QXL1_9POTV/1986-2220--------------------------------------------------------------------------------
POLG_OMV/121-355--------------------------------------------------------------------------------
Q9QBT4_PVMA/2030-2264--------------------------------------------------------------------------------
Q80MX2_9POTY/190-375--------------------------------------------------------------------------------
Q80P26_9POTV/2027-2261--------------------------------------------------------------------------------
Q8UZ27_9POTY/1335-1554--------------------------------------------------------------------------------
Q9WID3_9POTV/2038-2271--------------------------------------------------------------------------------
Q88507_TEV/2036-2269--------------------------------------------------------------------------------
Q7T5A6_9POTV/2385-2619--------------------------------------------------------------------------------
Q912R2_9POTV/2117-2351--------------------------------------------------------------------------------
Q9YNB1_9POTY/405-628--------------------------------------------------------------------------------
Q9QBG1_9POTY/1362-1581--------------------------------------------------------------------------------
Q88925_TVMV/2000-2232--------------------------------------------------------------------------------
O73463_MDMV/1986-2220--------------------------------------------------------------------------------

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF12380

B3U1H5_YHV/2834-3117--------------------------------------------------------------------------------
Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF13365

DEG15_ARATH/376-594--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
Q2P9Y4_9ACTO/162-308--------------------------------------------------------------------------------
B6QXD8_9RHOB/76-232--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
C3HBL0_BACTU/109-260--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
Q2RS04_RHORT/145-306--------------------------------------------------------------------------------
Q467S2_METBF/103-254--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A3VZZ0_9RHOB/114-264--------------------------------------------------------------------------------
B6R9Y4_9RHOB/91-243--------------------------------------------------------------------------------
D3CTM8_9ACTO/100-254--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D4GHS4_PANAM/109-260--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
Q846R2_MYXXA/58-225--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B4VV96_9CYAN/140-327--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
A8FZT0_SHESH/365-519--------------------------------------------------------------------------------
B9M1H9_GEOSF/322-480--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
B4VT06_9CYAN/299-436--------------------------------------------------------------------------------
B8H010_CAUCN/64-248--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A3JWZ9_9RHOB/120-292--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
C6JD09_9FIRM/162-306--------------------------------------------------------------------------------
C0CMS9_9FIRM/152-296--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
C0FTN1_9FIRM/149-293--------------------------------------------------------------------------------
C9L519_RUMHA/148-292--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
B5CQ59_9FIRM/147-291--------------------------------------------------------------------------------
A5KN66_9FIRM/147-291--------------------------------------------------------------------------------
B6FP33_9CLOT/144-288--------------------------------------------------------------------------------
A7B169_RUMGN/176-320--------------------------------------------------------------------------------
B0NI56_EUBSP/167-311--------------------------------------------------------------------------------
C0B801_9FIRM/151-295--------------------------------------------------------------------------------
B0G1M9_9FIRM/149-293--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
B7AVI8_9FIRM/172-316--------------------------------------------------------------------------------
C5ELW4_9FIRM/172-316--------------------------------------------------------------------------------
C4G4N6_ABIDE/156-298--------------------------------------------------------------------------------
C1IAW0_9CLOT/114-253--------------------------------------------------------------------------------
B8AM75_ORYSI/89-258--------------------------------------------------------------------------------
B5JQS5_9BACT/61-197--------------------------------------------------------------------------------
B3DXV6_METI4/79-214--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
B9G3S8_ORYSJ/109-256--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
B9FMK5_ORYSJ/181-321--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
A7NIM6_ROSCS/38-173--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C6XBL7_METSD/51-179--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B6BWJ8_9PROT/54-182--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
B6BVZ4_9PROT/47-175--------------------------------------------------------------------------------
C6XD83_METSD/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
C6BGJ0_RALP1/55-184--------------------------------------------------------------------------------
B3QPC6_CHLP8/57-184--------------------------------------------------------------------------------
Q0YS38_9CHLB/89-216--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
Q3M8K4_ANAVT/33-168--------------------------------------------------------------------------------
D5WKU5_BURSC/40-175--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRAJA/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
B4UF27_ANASK/45-180--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
B4WI21_9SYNE/33-173--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
A6C5I0_9PLAN/58-206--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
A4A0T0_9PLAN/66-211--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
B6B9E4_9RHOB/398-528--------------------------------------------------------------------------------
D0D6Q7_9RHOB/389-519--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
A4A0S9_9PLAN/71-202--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
A9VXT6_METEP/54-187--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D3NU60_AZOS1/54-191--------------------------------------------------------------------------------
A8TSL0_9PROT/61-191--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
D0RMV8_9PROT/62-194--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
B4UTS4_BP163/66-193--------------------------------------------------------------------------------
Q11LS4_MESSB/40-170--------------------------------------------------------------------------------
C4RAG7_9PROT/100-239--------------------------------------------------------------------------------
C5JAK2_9BACT/101-240--------------------------------------------------------------------------------
C5JBN6_9BACT/99-238--------------------------------------------------------------------------------
A0L9W3_MAGSM/126-265--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A5BEH1_VITVI/502-717--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A9ZKZ5_COXBE/58-186--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
A1DKZ3_NEOFI/106-274--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
B4VWK9_9CYAN/26-185--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
A3ZSU8_9PLAN/169-309--------------------------------------------------------------------------------
A6CCJ8_9PLAN/216-356--------------------------------------------------------------------------------
B5W7L6_SPIMA/53-196--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------
A0ZIJ6_NODSP/50-187--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
A0YM55_LYNSP/62-208--------------------------------------------------------------------------------
Q060L2_9SYNE/66-212--------------------------------------------------------------------------------
A2CDP2_PROM3/91-233--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
A8YFS3_MICAE/52-220--------------------------------------------------------------------------------
B4VKH5_9CYAN/399-535--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q4C9U0_CROWT/64-213--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B6BL05_9PROT/72-191--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
C2FHG0_LACPA/165-321--------------------------------------------------------------------------------
B0EDS2_ENTDS/219-353--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
B9IN99_POPTR/16-159--------------------------------------------------------------------------------
D1W398_9BACT/21-163--------------------------------------------------------------------------------
Q7MW22_PORGI/27-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
A8YNP5_MICAE/435-587--------------------------------------------------------------------------------
B8BM04_ORYSI/29-174--------------------------------------------------------------------------------
A3WZP2_9BRAD/25-182--------------------------------------------------------------------------------
B6SLW3_MAIZE/46-198--------------------------------------------------------------------------------
B4W048_9CYAN/24-160--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
C4RBC6_9ACTO/39-187--------------------------------------------------------------------------------
B5HRW8_9ACTO/52-200--------------------------------------------------------------------------------
B4VL88_9CYAN/23-161--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
A3XNG0_LEEBM/39-192--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
D1W141_9BACT/221-392--------------------------------------------------------------------------------
Q72KS5_THET2/61-193--------------------------------------------------------------------------------
B7A6E3_THEAQ/62-195--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
B4D8F4_9BACT/72-317--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A7BUM9_9GAMM/28-164--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
B3NQY9_DROER/305-445--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
A3SCU7_9RHOB/196-330--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
A9AU45_BURM1/75-243--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
B4D163_9BACT/76-206--------------------------------------------------------------------------------
B4CWZ6_9BACT/327-458--------------------------------------------------------------------------------
B4CWZ7_9BACT/330-461--------------------------------------------------------------------------------
B4D4S9_9BACT/50-179--------------------------------------------------------------------------------
C0AF95_9BACT/54-190--------------------------------------------------------------------------------
B9YD37_9FIRM/27-200--------------------------------------------------------------------------------
B2ULX5_AKKM8/77-314--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
Q1PY07_9BACT/57-189--------------------------------------------------------------------------------
C3QH30_9BACE/51-184--------------------------------------------------------------------------------
A5ZI03_9BACE/49-181--------------------------------------------------------------------------------
B5CVV9_9BACE/52-183--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
C8N8L7_9GAMM/65-197--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
C0DWH2_EIKCO/92-250--------------------------------------------------------------------------------
D1NAH5_9BACT/62-195--------------------------------------------------------------------------------
A8KF66_BURPE/83-236--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C0GIE8_9FIRM/109-240--------------------------------------------------------------------------------
A6CKL8_9BACI/105-229--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
A4A524_9GAMM/61-225--------------------------------------------------------------------------------
A4BT63_9GAMM/57-219--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
C6AVQ8_RHILS/33-192--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
D3LKZ9_MICLU/283-419--------------------------------------------------------------------------------
B4V9A1_9ACTO/51-211--------------------------------------------------------------------------------
B4CXG1_9BACT/84-257--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
D3W785_9VIRU/161-295--------------------------------------------------------------------------------
B4V7A8_9ACTO/24-181--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
C9BDM8_ENTFC/121-272--------------------------------------------------------------------------------
B8AXY3_ORYSI/1277-1457--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
B9G3S5_ORYSJ/55-216--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
B2XS89_9VIRU/586-711--------------------------------------------------------------------------------
NS1A_OASV1/438-558--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B3EEJ2_CHLL2/96-337--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
A8TZT7_9PROT/75-215--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569--------------------------------------------------------------------------------
SP24D_ANOGA/50-264--------------------------------------------------------------------------------
TRY5_AEDAE/40-260--------------------------------------------------------------------------------
UROK_HUMAN/179-419--------------------------------------------------------------------------------
MASP1_MOUSE/454-696--------------------------------------------------------------------------------
CTR1_ANOGA/33-250--------------------------------------------------------------------------------
CFAD_HUMAN/26-248--------------------------------------------------------------------------------
ACRO_RAT/43-286--------------------------------------------------------------------------------
HPT_HUMAN/162-399--------------------------------------------------------------------------------
CASP_MESAU/445-682--------------------------------------------------------------------------------
SNAK_DROME/186-427--------------------------------------------------------------------------------
PCE_TACTR/128-370--------------------------------------------------------------------------------
STUB_DROME/544-782--------------------------------------------------------------------------------
TRYU_DROME/28-254--------------------------------------------------------------------------------
TRYI_DROME/28-245--------------------------------------------------------------------------------
TRYB_MANSE/25-252--------------------------------------------------------------------------------
TRYP_FUSOX/25-244--------------------------------------------------------------------------------
TRYP_STRGR/37-252--------------------------------------------------------------------------------
TRY1_HUMAN/24-239--------------------------------------------------------------------------------
TRYP_PIG/9-224--------------------------------------------------------------------------------
TRY1_SALSA/21-235--------------------------------------------------------------------------------
TRYP_PLEPL/23-242--------------------------------------------------------------------------------
DEGP3_ARATH/99-287--------------------------------------------------------------------------------
DEGP2_ARATH/121-308--------------------------------------------------------------------------------
DEGS_ECOLI/62-244--------------------------------------------------------------------------------
DEGS_HAEIN/37-240--------------------------------------------------------------------------------
YYXA_BACSU/99-283--------------------------------------------------------------------------------
DEGP_SALTY/97-278--------------------------------------------------------------------------------
Q44596_BRUAO/85-261--------------------------------------------------------------------------------
DEGPL_BRUSU/125-298--------------------------------------------------------------------------------
O06439_RHOCA/59-235--------------------------------------------------------------------------------
HHOA_SYNY3/95-274--------------------------------------------------------------------------------
HTRA_SYNY3/156-334--------------------------------------------------------------------------------
O42417_CHICK/87-286--------------------------------------------------------------------------------
ETA_STAAU/70-274--------------------------------------------------------------------------------
ETB_STAAU/59-251--------------------------------------------------------------------------------
SPLB_STAAU/37-234--------------------------------------------------------------------------------
SPLC_STAAU/38-233--------------------------------------------------------------------------------
MPR_BACSU/95-311--------------------------------------------------------------------------------
PRTC_STRGR/205-383--------------------------------------------------------------------------------
Q55353_STRSQ/198-372--------------------------------------------------------------------------------
Q55352_STRSQ/202-378--------------------------------------------------------------------------------
Q54395_STRLI/158-342--------------------------------------------------------------------------------
SP1_RARFA/205-391--------------------------------------------------------------------------------
CERC_SCHMA/28-256--------------------------------------------------------------------------------
Q54344_STRLI/47-254--------------------------------------------------------------------------------
CFAB_HUMAN/481-752--------------------------------------------------------------------------------
PROZ_BOVIN/143-352--------------------------------------------------------------------------------
CAC3_BOVIN/12-246--------------------------------------------------------------------------------
CELA1_PIG/27-259--------------------------------------------------------------------------------
CTRA_BOVIN/16-238--------------------------------------------------------------------------------
CTRL_HALRU/24-251--------------------------------------------------------------------------------
COGS_HYPLI/31-252--------------------------------------------------------------------------------
CTRB1_LITVA/46-263--------------------------------------------------------------------------------
CATG_MOUSE/21-238--------------------------------------------------------------------------------
MCPT2_RAT/21-239--------------------------------------------------------------------------------
ELNE_HUMAN/30-242--------------------------------------------------------------------------------
PRTN3_HUMAN/28-243--------------------------------------------------------------------------------
GRAK_RAT/26-248--------------------------------------------------------------------------------
GRAM_RAT/21-245--------------------------------------------------------------------------------
KLK1_MOUSE/25-253--------------------------------------------------------------------------------
KLK2_RAT/25-251--------------------------------------------------------------------------------
VSPCA_AGKCO/1-217--------------------------------------------------------------------------------
HGF_RAT/496-719--------------------------------------------------------------------------------
ENTK_PIG/800-1029--------------------------------------------------------------------------------
PRSS8_HUMAN/45-281--------------------------------------------------------------------------------
HGFA_HUMAN/408-641--------------------------------------------------------------------------------
TPA_HUMAN/311-556--------------------------------------------------------------------------------
FA10_HUMAN/235-462--------------------------------------------------------------------------------
THRB_BOVIN/367-616--------------------------------------------------------------------------------
PROC_HUMAN/212-445--------------------------------------------------------------------------------

PF09342

Q7QJ48_ANOGA/1759-1982--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1512-1777--------------------------------------------------------------------------------
NUDEL_DROME/2005-2298--------------------------------------------------------------------------------

PF03761

Q9U2W2_CAEEL/6-282--------------------------------------------------------------------------------
Q21628_CAEEL/5-298--------------------------------------------------------------------------------
O45371_CAEEL/3-276--------------------------------------------------------------------------------
O76649_CAEEL/2-297--------------------------------------------------------------------------------
A8XIB1_CAEBR/15-285--------------------------------------------------------------------------------
A8WNY9_CAEBR/3-296--------------------------------------------------------------------------------
Q9XWZ8_CAEEL/4-272--------------------------------------------------------------------------------
O62223_CAEEL/7-278--------------------------------------------------------------------------------
O62231_CAEEL/5-272--------------------------------------------------------------------------------

PF00944

POLS_AURAV/110-268--------------------------------------------------------------------------------
P89913_SINDV/109-267--------------------------------------------------------------------------------
POLS_BFV/98-255--------------------------------------------------------------------------------
POLS_EEEV/103-260--------------------------------------------------------------------------------
O41516_9VIRU/119-276--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF05580

Q46028_CLODI/132-352--------------------------------------------------------------------------------
Q97HE0_CLOAB/173-391--------------------------------------------------------------------------------
Q9K975_BACHD/206-424--------------------------------------------------------------------------------
P71028_BACIU/197-414--------------------------------------------------------------------------------
Q8XJE5_CLOPE/165-382--------------------------------------------------------------------------------
Q8RAC0_THETN/198-414--------------------------------------------------------------------------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

O09461_9FLAV/1588-1798--------------------------------------------------------------------------------
Q04232_BVDV/149-359--------------------------------------------------------------------------------
Q68287_9FLAV/2-212--------------------------------------------------------------------------------
O11993_BVDV/1590-1800--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782--------------------------------------------------------------------------------
PET_ECO44/46-729--------------------------------------------------------------------------------
IGA0_HAEIN/17-865--------------------------------------------------------------------------------
SEPA_SHIFL/46-800--------------------------------------------------------------------------------
PIC_SHIFL/49-802--------------------------------------------------------------------------------
HBP_ECOLX/44-811--------------------------------------------------------------------------------
HAP2_HAEIF/17-765--------------------------------------------------------------------------------
IGA_NEIGO/19-849--------------------------------------------------------------------------------
ESPP_ECO57/47-730--------------------------------------------------------------------------------

PF05409

R1AB_FIPV/2932-3214--------------------------------------------------------------------------------
R1AB_PEDV7/3026-3317--------------------------------------------------------------------------------
R1AB_IBVBC/2808-3109--------------------------------------------------------------------------------
R1AB_CVMJH/3365-3658--------------------------------------------------------------------------------
R1AB_CVH22/2994-3284--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMVE/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF03510

POLG_RHDV3/1120-1218--------------------------------------------------------------------------------
O92368_VESV/1208-1312--------------------------------------------------------------------------------
POLG_SVM93/997-1103--------------------------------------------------------------------------------
Q9QRV9_9CALI/1095-1199--------------------------------------------------------------------------------
POLG_PESV/1063-1169--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268RAARAVAYASCIQSAITSILQIAGSALVVNRAVKRMFGTRTATLSLEGPPREHKCRVHMA.....KAAGKGPIGHDDVVE
Q9YQ23_VESV/628-1162AAARAVTYWSLAANLVTTTIQAAASALVVHRAVQRI.......RSSPTQLESHNCRYHRAERENREVDGAKVTGHLGMVD
Q80J95_9CALI/650-1163KEARLRCYCRMAADVITSILQAAGTAFSIYHQIEKR................................SRPSFYWDXGYT
Q8JJL0_9CALI/645-1175RQARARYYISCFQDLVYTLIQVAGASFVVNRISKRF...........................CWERWVKPT.....ETQ
Q80RD7_9CALI/641-1177RCARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRM..........................NIQNLWSRPPVGDAEEVT

PF01732

A5IYK2_MYCAP/279-649--------------------------------------------------------------------------------
Q6MUH9_MYCMS/258-617--------------------------------------------------------------------------------
Q2SR25_MYCCT/264-622--------------------------------------------------------------------------------
D3VQF5_MYCA6/359-733--------------------------------------------------------------------------------
Q4A635_MYCS5/147-497--------------------------------------------------------------------------------
Q4A5A2_MYCS5/91-491--------------------------------------------------------------------------------
C7LM95_MYCML/189-571--------------------------------------------------------------------------------
A5IYA1_MYCAP/186-569--------------------------------------------------------------------------------
Q4A798_MYCH7/125-523--------------------------------------------------------------------------------
Q4A5G2_MYCS5/337-740--------------------------------------------------------------------------------
D3FFM3_MYCGH/244-661--------------------------------------------------------------------------------
C5J6P1_MYCCR/115-482--------------------------------------------------------------------------------
Q7NAU7_MYCGA/221-623--------------------------------------------------------------------------------
Q7NAG1_MYCGA/203-712--------------------------------------------------------------------------------
D3FHQ1_MYCGH/203-710--------------------------------------------------------------------------------
Q4A5P6_MYCS5/166-643--------------------------------------------------------------------------------
D1J8A8_MYCHP/334-723--------------------------------------------------------------------------------
B3XS56_UREUR/379-750--------------------------------------------------------------------------------
B2D8H3_UREPR/376-752--------------------------------------------------------------------------------
Q9PR98_UREPA/413-786--------------------------------------------------------------------------------
Q6MSY9_MYCMS/283-769--------------------------------------------------------------------------------
C7LKT8_MYCML/288-775--------------------------------------------------------------------------------
Q98Q64_MYCPU/350-715--------------------------------------------------------------------------------
Q98QS3_MYCPU/339-702--------------------------------------------------------------------------------
D3FJ19_MYCGF/216-600--------------------------------------------------------------------------------
Q7NAJ2_MYCGA/204-545--------------------------------------------------------------------------------
Q4A7B5_MYCH7/323-738--------------------------------------------------------------------------------
Q98PH9_MYCPU/101-415--------------------------------------------------------------------------------
Q8EWB5_MYCPE/130-442--------------------------------------------------------------------------------
Q8EW95_MYCPE/145-484--------------------------------------------------------------------------------
Y068_MYCGE/48-383--------------------------------------------------------------------------------
Y084_MYCPN/45-410--------------------------------------------------------------------------------
Y588_MYCPN/75-444--------------------------------------------------------------------------------
Y395_MYCGE/89-428--------------------------------------------------------------------------------
Y592_MYCPN/104-443--------------------------------------------------------------------------------
Y083_MYCPN/52-447--------------------------------------------------------------------------------
Y582_MYCPN/44-388--------------------------------------------------------------------------------
Q4A8M7_MYCH7/557-908--------------------------------------------------------------------------------
Q8EWN7_MYCPE/57-397--------------------------------------------------------------------------------
B3XTP3_UREUR/59-344--------------------------------------------------------------------------------

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Q4VIX4_9FLAV/1520-1672--------------------------------------------------------------------------------
O36765_9FLAV/1520-1672--------------------------------------------------------------------------------
Q3I100_WNV/1521-1673--------------------------------------------------------------------------------
Q32ZD1_9FLAV/1516-1668--------------------------------------------------------------------------------
Q32ZD7_9FLAV/1513-1665--------------------------------------------------------------------------------
Q32ZD2_9FLAV/1515-1667--------------------------------------------------------------------------------
Q32ZD5_9FLAV/1508-1660--------------------------------------------------------------------------------
Q98Y40_9FLAV/1491-1643--------------------------------------------------------------------------------
Q5DSL2_9FLAV/1489-1641--------------------------------------------------------------------------------
Q9J8E1_9FLAV/1491-1643--------------------------------------------------------------------------------
Q2YHE7_9FLAV/1490-1642--------------------------------------------------------------------------------
A0EKU1_9FLAV/1504-1656--------------------------------------------------------------------------------
A0EKU7_9FLAV/1506-1658--------------------------------------------------------------------------------
A0EKU5_9FLAV/1507-1659--------------------------------------------------------------------------------
Q91B85_9FLAV/1509-1661--------------------------------------------------------------------------------
POLG_LANVT/1507-1659--------------------------------------------------------------------------------
Q3Y6G7_9FLAV/1507-1659--------------------------------------------------------------------------------
Q6JJM0_9FLAV/1507-1659--------------------------------------------------------------------------------
Q8VBK7_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU2_9FLAV/1509-1661--------------------------------------------------------------------------------
Q5G264_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU6_9FLAV/1510-1662--------------------------------------------------------------------------------
A0EKU3_9FLAV/1496-1648--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y067_MYCGE/321-456--------------------------------------------------------------------------------
Y083_MYCPN/328-467--------------------------------------------------------------------------------
Y068_MYCGE/272-402--------------------------------------------------------------------------------
Y084_MYCPN/296-431--------------------------------------------------------------------------------
Y588_MYCPN/338-464--------------------------------------------------------------------------------
Y395_MYCGE/314-448--------------------------------------------------------------------------------
Y592_MYCPN/334-455--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
Q8QVE1_9FLAV/1495-1635--------------------------------------------------------------------------------
Q6A4R3_AEDAL/768-912--------------------------------------------------------------------------------
Q80DQ3_9FLAV/1484-1633--------------------------------------------------------------------------------
Q8JJZ3_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9JAD5_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9J9C2_9FLAV/1482-1633--------------------------------------------------------------------------------
Q8QL64_9FLAV/1478-1629--------------------------------------------------------------------------------
POLG_YEFVE/1501-1655--------------------------------------------------------------------------------
Q32ZD3_9FLAV/1496-1649--------------------------------------------------------------------------------
Q32ZD9_9FLAV/1506-1659--------------------------------------------------------------------------------
Q7T918_9FLAV/1515-1668--------------------------------------------------------------------------------
Q32ZD6_9FLAV/1505-1657--------------------------------------------------------------------------------
Q32ZD8_9FLAV/1507-1659--------------------------------------------------------------------------------
Q32ZE1_9FLAV/1514-1666--------------------------------------------------------------------------------
Q32ZE0_9FLAV/1519-1670--------------------------------------------------------------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

B4SLK2_STRM5/22-718--------------------------------------------------------------------------------
A1SA55_SHEAM/18-726--------------------------------------------------------------------------------
A3J218_9FLAO/21-713--------------------------------------------------------------------------------
A3J4B3_9FLAO/17-708--------------------------------------------------------------------------------
E0THX8_PARBH/23-721--------------------------------------------------------------------------------
A3WDJ5_9SPHN/23-720--------------------------------------------------------------------------------
F2GAE2_ALTMD/22-719--------------------------------------------------------------------------------
A4C924_9GAMM/18-739--------------------------------------------------------------------------------
A4CBH4_9GAMM/20-717--------------------------------------------------------------------------------
A5FMW8_FLAJ1/19-712--------------------------------------------------------------------------------
B8E9P0_SHEB2/18-729--------------------------------------------------------------------------------
A5PEK4_9SPHN/21-716--------------------------------------------------------------------------------
A5ZH65_9BACE/21-717--------------------------------------------------------------------------------
A6E8C7_9SPHI/24-720--------------------------------------------------------------------------------
A6EQ24_9BACT/17-690--------------------------------------------------------------------------------
A6ERE5_9BACT/20-712--------------------------------------------------------------------------------
A6GH08_9DELT/30-733--------------------------------------------------------------------------------
A6GI93_9DELT/51-752--------------------------------------------------------------------------------
A6GWM2_FLAPJ/17-707--------------------------------------------------------------------------------
A6KZW8_BACV8/17-706--------------------------------------------------------------------------------
A6L2J7_BACV8/19-726--------------------------------------------------------------------------------
A6L2J8_BACV8/21-719--------------------------------------------------------------------------------
A6LID5_PARD8/19-717--------------------------------------------------------------------------------
A6WS02_SHEB8/18-716--------------------------------------------------------------------------------
A7AAA4_9PORP/22-711--------------------------------------------------------------------------------
A7AHP4_9PORP/19-717--------------------------------------------------------------------------------
A7HA06_ANADF/20-725--------------------------------------------------------------------------------
A7HFU9_ANADF/37-699--------------------------------------------------------------------------------
A7V0H7_BACUN/20-709--------------------------------------------------------------------------------
A7V1I5_BACUN/23-719--------------------------------------------------------------------------------
A8FR99_SHESH/24-737--------------------------------------------------------------------------------
Q024G1_SOLUE/22-694--------------------------------------------------------------------------------
Q027J4_SOLUE/18-549--------------------------------------------------------------------------------
Q029T1_SOLUE/24-727--------------------------------------------------------------------------------
Q02D16_SOLUE/31-664--------------------------------------------------------------------------------
Q07XT1_SHEFN/18-727--------------------------------------------------------------------------------
Q08V25_STIAD/73-737--------------------------------------------------------------------------------
Q08VC9_STIAD/18-714--------------------------------------------------------------------------------
Q11SC7_CYTH3/21-702--------------------------------------------------------------------------------
Q12RW4_SHEDO/18-728--------------------------------------------------------------------------------
Q1D5W7_MYXXD/35-700--------------------------------------------------------------------------------
Q1D9F6_MYXXD/17-714--------------------------------------------------------------------------------
Q1DDZ2_MYXXD/18-682--------------------------------------------------------------------------------
Q1GVV7_SPHAL/23-684--------------------------------------------------------------------------------
Q1IPC2_KORVE/27-692--------------------------------------------------------------------------------
Q1NG15_9SPHN/26-683--------------------------------------------------------------------------------
Q2G546_NOVAD/56-713--------------------------------------------------------------------------------
Q2IEV3_ANADE/18-687--------------------------------------------------------------------------------
Q2NZP5_XANOM/22-715--------------------------------------------------------------------------------
Q2S133_SALRD/5-639--------------------------------------------------------------------------------
Q2S134_SALRD/69-734--------------------------------------------------------------------------------
Q3REP2_XYLFA/22-714--------------------------------------------------------------------------------
Q488S2_COLP3/26-729--------------------------------------------------------------------------------
Q5LIW7_BACFN/34-723--------------------------------------------------------------------------------
Q5QV86_IDILO/17-717--------------------------------------------------------------------------------
Q64RG4_BACFR/19-718--------------------------------------------------------------------------------
Q7MV25_PORGI/21-718--------------------------------------------------------------------------------
Q7MWU6_PORGI/24-711--------------------------------------------------------------------------------
Q7NHA9_GLOVI/34-698--------------------------------------------------------------------------------
Q7UKL5_RHOBA/28-688--------------------------------------------------------------------------------
Q8A2L6_BACTN/20-711--------------------------------------------------------------------------------

PF00548

Q8JJT0_PSV13/1680-1844--------------------------------------------------------------------------------
POLG_HRV8A/1522-1687--------------------------------------------------------------------------------
POLG_EC01F/1540-1705--------------------------------------------------------------------------------
POLG_HRV14/1538-1702--------------------------------------------------------------------------------
POLG_BOVEV/1532-1697--------------------------------------------------------------------------------
POLG_CX16G/1549-1714--------------------------------------------------------------------------------
POLG_HE701/1555-1720--------------------------------------------------------------------------------
POLG_PEV9U/1525-1690--------------------------------------------------------------------------------
Q04107_HRV1A/162-327--------------------------------------------------------------------------------
Q6TGL9_9ENTO/1563-1728--------------------------------------------------------------------------------
Q66776_ERBV1/1905-2095--------------------------------------------------------------------------------
Q6TPI6_9PICO/1649-1833--------------------------------------------------------------------------------
Q7T7N7_9ENTO/1563-1728--------------------------------------------------------------------------------
Q8B552_9PICO/1782-1946--------------------------------------------------------------------------------
POLG_TMEVG/1636-1816--------------------------------------------------------------------------------
POL1_BBWVS/957-1123--------------------------------------------------------------------------------
POLG_HPE2W/1517-1692--------------------------------------------------------------------------------
Q80N16_9PICO/1589-1765--------------------------------------------------------------------------------
Q9IM09_9ENTO/1556-1721--------------------------------------------------------------------------------
O39818_9PICO/1580-1761--------------------------------------------------------------------------------

PF00863

POLG_PEMVM/2056-2290--------------------------------------------------------------------------------
Q98WK5_PRSVW/2281-2513--------------------------------------------------------------------------------
Q98810_9POTV/196-430--------------------------------------------------------------------------------
Q7T915_9POTV/2040-2274--------------------------------------------------------------------------------
Q89255_9POTY/427-646--------------------------------------------------------------------------------
Q82933_9POTV/1990-2223--------------------------------------------------------------------------------
Q9YZN8_9POTV/2078-2312--------------------------------------------------------------------------------
Q8QXL0_9POTV/1962-2196--------------------------------------------------------------------------------
O10243_CYVV/709-943--------------------------------------------------------------------------------
Q8QXN3_9POTV/1986-2220--------------------------------------------------------------------------------
POL1_BAYMJ/1361-1581--------------------------------------------------------------------------------
POLG_PPVNA/2048-2282--------------------------------------------------------------------------------
Q8QV60_9POTV/2016-2250--------------------------------------------------------------------------------
POLG_LMV0/2213-2447--------------------------------------------------------------------------------
Q8UZ37_9POTV/2108-2341--------------------------------------------------------------------------------
POLG_SPMMV/2424-2646--------------------------------------------------------------------------------
O89525_9POTY/1998-2231--------------------------------------------------------------------------------
Q7T4I3_TUMVJ/2115-2349--------------------------------------------------------------------------------
Q8QQA0_9POTV/2042-2276--------------------------------------------------------------------------------
Q8QY00_9POTV/2175-2409--------------------------------------------------------------------------------
Q9WAA3_9POTY/1259-1474--------------------------------------------------------------------------------
O39734_9POTV/2413-2647--------------------------------------------------------------------------------
Q65883_BYMV/335-569--------------------------------------------------------------------------------
Q9E160_9POTY/1951-2181--------------------------------------------------------------------------------
Q7T7N5_9POTV/2211-2445--------------------------------------------------------------------------------
Q8QXL1_9POTV/1986-2220--------------------------------------------------------------------------------
POLG_OMV/121-355--------------------------------------------------------------------------------
Q9QBT4_PVMA/2030-2264--------------------------------------------------------------------------------
Q80MX2_9POTY/190-375--------------------------------------------------------------------------------
Q80P26_9POTV/2027-2261--------------------------------------------------------------------------------
Q8UZ27_9POTY/1335-1554--------------------------------------------------------------------------------
Q9WID3_9POTV/2038-2271--------------------------------------------------------------------------------
Q88507_TEV/2036-2269--------------------------------------------------------------------------------
Q7T5A6_9POTV/2385-2619--------------------------------------------------------------------------------
Q912R2_9POTV/2117-2351--------------------------------------------------------------------------------
Q9YNB1_9POTY/405-628--------------------------------------------------------------------------------
Q9QBG1_9POTY/1362-1581--------------------------------------------------------------------------------
Q88925_TVMV/2000-2232--------------------------------------------------------------------------------
O73463_MDMV/1986-2220--------------------------------------------------------------------------------

PF12381

Q6EEL1_9SECO/2617-2847--------------------------------------------------------------------------------
O11979_9SECO/2603-2833--------------------------------------------------------------------------------
Q1MNG4_9SECO/2627-2857--------------------------------------------------------------------------------

PF12380

B3U1H5_YHV/2834-3117--------------------------------------------------------------------------------
Q9IHZ8_GAVAU/2823-3106--------------------------------------------------------------------------------

PF13365

DEG15_ARATH/376-594--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
Q2P9Y4_9ACTO/162-308--------------------------------------------------------------------------------
B6QXD8_9RHOB/76-232--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
C3HBL0_BACTU/109-260--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
Q2RS04_RHORT/145-306--------------------------------------------------------------------------------
Q467S2_METBF/103-254--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A3VZZ0_9RHOB/114-264--------------------------------------------------------------------------------
B6R9Y4_9RHOB/91-243--------------------------------------------------------------------------------
D3CTM8_9ACTO/100-254--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D4GHS4_PANAM/109-260--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
Q846R2_MYXXA/58-225--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B4VV96_9CYAN/140-327--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
A8FZT0_SHESH/365-519--------------------------------------------------------------------------------
B9M1H9_GEOSF/322-480--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
B4VT06_9CYAN/299-436--------------------------------------------------------------------------------
B8H010_CAUCN/64-248--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A3JWZ9_9RHOB/120-292--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
C6JD09_9FIRM/162-306--------------------------------------------------------------------------------
C0CMS9_9FIRM/152-296--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
C0FTN1_9FIRM/149-293--------------------------------------------------------------------------------
C9L519_RUMHA/148-292--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
B5CQ59_9FIRM/147-291--------------------------------------------------------------------------------
A5KN66_9FIRM/147-291--------------------------------------------------------------------------------
B6FP33_9CLOT/144-288--------------------------------------------------------------------------------
A7B169_RUMGN/176-320--------------------------------------------------------------------------------
B0NI56_EUBSP/167-311--------------------------------------------------------------------------------
C0B801_9FIRM/151-295--------------------------------------------------------------------------------
B0G1M9_9FIRM/149-293--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
B7AVI8_9FIRM/172-316--------------------------------------------------------------------------------
C5ELW4_9FIRM/172-316--------------------------------------------------------------------------------
C4G4N6_ABIDE/156-298--------------------------------------------------------------------------------
C1IAW0_9CLOT/114-253--------------------------------------------------------------------------------
B8AM75_ORYSI/89-258--------------------------------------------------------------------------------
B5JQS5_9BACT/61-197--------------------------------------------------------------------------------
B3DXV6_METI4/79-214--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
B9G3S8_ORYSJ/109-256--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
B9FMK5_ORYSJ/181-321--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
A7NIM6_ROSCS/38-173--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C6XBL7_METSD/51-179--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B6BWJ8_9PROT/54-182--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
B6BVZ4_9PROT/47-175--------------------------------------------------------------------------------
C6XD83_METSD/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
C6BGJ0_RALP1/55-184--------------------------------------------------------------------------------
B3QPC6_CHLP8/57-184--------------------------------------------------------------------------------
Q0YS38_9CHLB/89-216--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
Q3M8K4_ANAVT/33-168--------------------------------------------------------------------------------
D5WKU5_BURSC/40-175--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRAJA/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
B4UF27_ANASK/45-180--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
B4WI21_9SYNE/33-173--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
A6C5I0_9PLAN/58-206--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
A4A0T0_9PLAN/66-211--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
B6B9E4_9RHOB/398-528--------------------------------------------------------------------------------
D0D6Q7_9RHOB/389-519--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
A4A0S9_9PLAN/71-202--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
A9VXT6_METEP/54-187--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D3NU60_AZOS1/54-191--------------------------------------------------------------------------------
A8TSL0_9PROT/61-191--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
D0RMV8_9PROT/62-194--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
B4UTS4_BP163/66-193--------------------------------------------------------------------------------
Q11LS4_MESSB/40-170--------------------------------------------------------------------------------
C4RAG7_9PROT/100-239--------------------------------------------------------------------------------
C5JAK2_9BACT/101-240--------------------------------------------------------------------------------
C5JBN6_9BACT/99-238--------------------------------------------------------------------------------
A0L9W3_MAGSM/126-265--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A5BEH1_VITVI/502-717--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A9ZKZ5_COXBE/58-186--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
A1DKZ3_NEOFI/106-274--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
B4VWK9_9CYAN/26-185--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
A3ZSU8_9PLAN/169-309--------------------------------------------------------------------------------
A6CCJ8_9PLAN/216-356--------------------------------------------------------------------------------
B5W7L6_SPIMA/53-196--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------
A0ZIJ6_NODSP/50-187--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
A0YM55_LYNSP/62-208--------------------------------------------------------------------------------
Q060L2_9SYNE/66-212--------------------------------------------------------------------------------
A2CDP2_PROM3/91-233--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
A8YFS3_MICAE/52-220--------------------------------------------------------------------------------
B4VKH5_9CYAN/399-535--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q4C9U0_CROWT/64-213--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B6BL05_9PROT/72-191--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
C2FHG0_LACPA/165-321--------------------------------------------------------------------------------
B0EDS2_ENTDS/219-353--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
B9IN99_POPTR/16-159--------------------------------------------------------------------------------
D1W398_9BACT/21-163--------------------------------------------------------------------------------
Q7MW22_PORGI/27-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
A8YNP5_MICAE/435-587--------------------------------------------------------------------------------
B8BM04_ORYSI/29-174--------------------------------------------------------------------------------
A3WZP2_9BRAD/25-182--------------------------------------------------------------------------------
B6SLW3_MAIZE/46-198--------------------------------------------------------------------------------
B4W048_9CYAN/24-160--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
C4RBC6_9ACTO/39-187--------------------------------------------------------------------------------
B5HRW8_9ACTO/52-200--------------------------------------------------------------------------------
B4VL88_9CYAN/23-161--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
A3XNG0_LEEBM/39-192--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
D1W141_9BACT/221-392--------------------------------------------------------------------------------
Q72KS5_THET2/61-193--------------------------------------------------------------------------------
B7A6E3_THEAQ/62-195--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
B4D8F4_9BACT/72-317--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A7BUM9_9GAMM/28-164--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
B3NQY9_DROER/305-445--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
A3SCU7_9RHOB/196-330--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
A9AU45_BURM1/75-243--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
B4D163_9BACT/76-206--------------------------------------------------------------------------------
B4CWZ6_9BACT/327-458--------------------------------------------------------------------------------
B4CWZ7_9BACT/330-461--------------------------------------------------------------------------------
B4D4S9_9BACT/50-179--------------------------------------------------------------------------------
C0AF95_9BACT/54-190--------------------------------------------------------------------------------
B9YD37_9FIRM/27-200--------------------------------------------------------------------------------
B2ULX5_AKKM8/77-314--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
Q1PY07_9BACT/57-189--------------------------------------------------------------------------------
C3QH30_9BACE/51-184--------------------------------------------------------------------------------
A5ZI03_9BACE/49-181--------------------------------------------------------------------------------
B5CVV9_9BACE/52-183--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
C8N8L7_9GAMM/65-197--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
C0DWH2_EIKCO/92-250--------------------------------------------------------------------------------
D1NAH5_9BACT/62-195--------------------------------------------------------------------------------
A8KF66_BURPE/83-236--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C0GIE8_9FIRM/109-240--------------------------------------------------------------------------------
A6CKL8_9BACI/105-229--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
A4A524_9GAMM/61-225--------------------------------------------------------------------------------
A4BT63_9GAMM/57-219--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
C6AVQ8_RHILS/33-192--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
D3LKZ9_MICLU/283-419--------------------------------------------------------------------------------
B4V9A1_9ACTO/51-211--------------------------------------------------------------------------------
B4CXG1_9BACT/84-257--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
D3W785_9VIRU/161-295--------------------------------------------------------------------------------
B4V7A8_9ACTO/24-181--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
C9BDM8_ENTFC/121-272--------------------------------------------------------------------------------
B8AXY3_ORYSI/1277-1457--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
B9G3S5_ORYSJ/55-216--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
B2XS89_9VIRU/586-711--------------------------------------------------------------------------------
NS1A_OASV1/438-558--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B3EEJ2_CHLL2/96-337--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
A8TZT7_9PROT/75-215--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569--------------------------------------------------------------------------------
SP24D_ANOGA/50-264--------------------------------------------------------------------------------
TRY5_AEDAE/40-260--------------------------------------------------------------------------------
UROK_HUMAN/179-419--------------------------------------------------------------------------------
MASP1_MOUSE/454-696--------------------------------------------------------------------------------
CTR1_ANOGA/33-250--------------------------------------------------------------------------------
CFAD_HUMAN/26-248--------------------------------------------------------------------------------
ACRO_RAT/43-286--------------------------------------------------------------------------------
HPT_HUMAN/162-399--------------------------------------------------------------------------------
CASP_MESAU/445-682--------------------------------------------------------------------------------
SNAK_DROME/186-427--------------------------------------------------------------------------------
PCE_TACTR/128-370--------------------------------------------------------------------------------
STUB_DROME/544-782--------------------------------------------------------------------------------
TRYU_DROME/28-254--------------------------------------------------------------------------------
TRYI_DROME/28-245--------------------------------------------------------------------------------
TRYB_MANSE/25-252--------------------------------------------------------------------------------
TRYP_FUSOX/25-244--------------------------------------------------------------------------------
TRYP_STRGR/37-252--------------------------------------------------------------------------------
TRY1_HUMAN/24-239--------------------------------------------------------------------------------
TRYP_PIG/9-224--------------------------------------------------------------------------------
TRY1_SALSA/21-235--------------------------------------------------------------------------------
TRYP_PLEPL/23-242--------------------------------------------------------------------------------
DEGP3_ARATH/99-287--------------------------------------------------------------------------------
DEGP2_ARATH/121-308--------------------------------------------------------------------------------
DEGS_ECOLI/62-244--------------------------------------------------------------------------------
DEGS_HAEIN/37-240--------------------------------------------------------------------------------
YYXA_BACSU/99-283--------------------------------------------------------------------------------
DEGP_SALTY/97-278--------------------------------------------------------------------------------
Q44596_BRUAO/85-261--------------------------------------------------------------------------------
DEGPL_BRUSU/125-298--------------------------------------------------------------------------------
O06439_RHOCA/59-235--------------------------------------------------------------------------------
HHOA_SYNY3/95-274--------------------------------------------------------------------------------
HTRA_SYNY3/156-334--------------------------------------------------------------------------------
O42417_CHICK/87-286--------------------------------------------------------------------------------
ETA_STAAU/70-274--------------------------------------------------------------------------------
ETB_STAAU/59-251--------------------------------------------------------------------------------
SPLB_STAAU/37-234--------------------------------------------------------------------------------
SPLC_STAAU/38-233--------------------------------------------------------------------------------
MPR_BACSU/95-311--------------------------------------------------------------------------------
PRTC_STRGR/205-383--------------------------------------------------------------------------------
Q55353_STRSQ/198-372--------------------------------------------------------------------------------
Q55352_STRSQ/202-378--------------------------------------------------------------------------------
Q54395_STRLI/158-342--------------------------------------------------------------------------------
SP1_RARFA/205-391--------------------------------------------------------------------------------
CERC_SCHMA/28-256--------------------------------------------------------------------------------
Q54344_STRLI/47-254--------------------------------------------------------------------------------
CFAB_HUMAN/481-752--------------------------------------------------------------------------------
PROZ_BOVIN/143-352--------------------------------------------------------------------------------
CAC3_BOVIN/12-246--------------------------------------------------------------------------------
CELA1_PIG/27-259--------------------------------------------------------------------------------
CTRA_BOVIN/16-238--------------------------------------------------------------------------------
CTRL_HALRU/24-251--------------------------------------------------------------------------------
COGS_HYPLI/31-252--------------------------------------------------------------------------------
CTRB1_LITVA/46-263--------------------------------------------------------------------------------
CATG_MOUSE/21-238--------------------------------------------------------------------------------
MCPT2_RAT/21-239--------------------------------------------------------------------------------
ELNE_HUMAN/30-242--------------------------------------------------------------------------------
PRTN3_HUMAN/28-243--------------------------------------------------------------------------------
GRAK_RAT/26-248--------------------------------------------------------------------------------
GRAM_RAT/21-245--------------------------------------------------------------------------------
KLK1_MOUSE/25-253--------------------------------------------------------------------------------
KLK2_RAT/25-251--------------------------------------------------------------------------------
VSPCA_AGKCO/1-217--------------------------------------------------------------------------------
HGF_RAT/496-719--------------------------------------------------------------------------------
ENTK_PIG/800-1029--------------------------------------------------------------------------------
PRSS8_HUMAN/45-281--------------------------------------------------------------------------------
HGFA_HUMAN/408-641--------------------------------------------------------------------------------
TPA_HUMAN/311-556--------------------------------------------------------------------------------
FA10_HUMAN/235-462--------------------------------------------------------------------------------
THRB_BOVIN/367-616--------------------------------------------------------------------------------
PROC_HUMAN/212-445--------------------------------------------------------------------------------

PF09342

Q7QJ48_ANOGA/1759-1982--------------------------------------------------------------------------------
Q8WSJ2_BOMMO/1512-1777--------------------------------------------------------------------------------
NUDEL_DROME/2005-2298--------------------------------------------------------------------------------

PF03761

Q9U2W2_CAEEL/6-282--------------------------------------------------------------------------------
Q21628_CAEEL/5-298--------------------------------------------------------------------------------
O45371_CAEEL/3-276--------------------------------------------------------------------------------
O76649_CAEEL/2-297--------------------------------------------------------------------------------
A8XIB1_CAEBR/15-285--------------------------------------------------------------------------------
A8WNY9_CAEBR/3-296--------------------------------------------------------------------------------
Q9XWZ8_CAEEL/4-272--------------------------------------------------------------------------------
O62223_CAEEL/7-278--------------------------------------------------------------------------------
O62231_CAEEL/5-272--------------------------------------------------------------------------------

PF00944

POLS_AURAV/110-268--------------------------------------------------------------------------------
P89913_SINDV/109-267--------------------------------------------------------------------------------
POLS_BFV/98-255--------------------------------------------------------------------------------
POLS_EEEV/103-260--------------------------------------------------------------------------------
O41516_9VIRU/119-276--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF05580

Q46028_CLODI/132-352--------------------------------------------------------------------------------
Q97HE0_CLOAB/173-391--------------------------------------------------------------------------------
Q9K975_BACHD/206-424--------------------------------------------------------------------------------
P71028_BACIU/197-414--------------------------------------------------------------------------------
Q8XJE5_CLOPE/165-382--------------------------------------------------------------------------------
Q8RAC0_THETN/198-414--------------------------------------------------------------------------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

O09461_9FLAV/1588-1798--------------------------------------------------------------------------------
Q04232_BVDV/149-359--------------------------------------------------------------------------------
Q68287_9FLAV/2-212--------------------------------------------------------------------------------
O11993_BVDV/1590-1800--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782--------------------------------------------------------------------------------
PET_ECO44/46-729--------------------------------------------------------------------------------
IGA0_HAEIN/17-865--------------------------------------------------------------------------------
SEPA_SHIFL/46-800--------------------------------------------------------------------------------
PIC_SHIFL/49-802--------------------------------------------------------------------------------
HBP_ECOLX/44-811--------------------------------------------------------------------------------
HAP2_HAEIF/17-765--------------------------------------------------------------------------------
IGA_NEIGO/19-849--------------------------------------------------------------------------------
ESPP_ECO57/47-730--------------------------------------------------------------------------------

PF05409

R1AB_FIPV/2932-3214--------------------------------------------------------------------------------
R1AB_PEDV7/3026-3317--------------------------------------------------------------------------------
R1AB_IBVBC/2808-3109--------------------------------------------------------------------------------
R1AB_CVMJH/3365-3658--------------------------------------------------------------------------------
R1AB_CVH22/2994-3284--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321--------------------------------------------------------------------------------
POLG_TUMVJ/107-361--------------------------------------------------------------------------------
Q85074_9POTV/144-397--------------------------------------------------------------------------------
POLG_ZYMVR/71-312--------------------------------------------------------------------------------
P90213_9POTV/300-546--------------------------------------------------------------------------------
POLG_PEMVC/44-286--------------------------------------------------------------------------------
POLG_TVMV/30-273--------------------------------------------------------------------------------
POLG_RGMVD/13-255--------------------------------------------------------------------------------
POLG_LMVE/179-436--------------------------------------------------------------------------------
POLG_PVMA/45-297--------------------------------------------------------------------------------
POLG_PSBMV/143-396--------------------------------------------------------------------------------
Q82933_9POTV/2-236--------------------------------------------------------------------------------
POLG_PVYN/41-283--------------------------------------------------------------------------------
Q65892_BYMV/40-283--------------------------------------------------------------------------------
POLG_BCMNN/77-316--------------------------------------------------------------------------------
POLG_ZYMVC/70-309--------------------------------------------------------------------------------
Q65852_BYMV/40-283--------------------------------------------------------------------------------
POLG_SBMVG/69-307--------------------------------------------------------------------------------
O73463_MDMV/2-232--------------------------------------------------------------------------------
POLG_PVYHU/41-283--------------------------------------------------------------------------------
POLG_PPVD/59-307--------------------------------------------------------------------------------
Q85057_9POTV/204-442--------------------------------------------------------------------------------
O39734_9POTV/410-663--------------------------------------------------------------------------------
POLG_ZYMVS/71-312--------------------------------------------------------------------------------
POLG_PRSVH/300-546--------------------------------------------------------------------------------
POLG_TEV/53-303--------------------------------------------------------------------------------

PF03510

POLG_RHDV3/1120-1218--------------------------------------------------------------------------------
O92368_VESV/1208-1312--------------------------------------------------------------------------------
POLG_SVM93/997-1103--------------------------------------------------------------------------------
Q9QRV9_9CALI/1095-1199--------------------------------------------------------------------------------
POLG_PESV/1063-1169--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268KYGLCET....EEDEEVAHTEIPSATMEGKNKGKNKKGRGRRNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLED
Q9YQ23_VESV/628-1162RYGLCES....EEEEVTPTPPPQKKKAAPIMKTQLESKKGKKGKSNAFSRRGLSDEEYDEYKKIREDRGGNYSIQEYLED
Q80J95_9CALI/650-1163YRDGPGSFDIFEDDDDGWY......HSEG.KKGKNKKGRGRP...GVFRTRGLTDEEYDEFKKRRESRGGKYSIDDYLAD
Q8JJL0_9CALI/645-1175EASEPEK....EVAQGRWEIEPKDAEPEG.KKGKNKKGRGKK..HTAFSSKGLSDEEYDEFKRIREERNGKYSIEEYLQD
Q80RD7_9CALI/641-1177SQDGCPK....PKDDEEFVISSSDITPEG.KKGKNKTGRGKK..HTAFSSKGLSDEEYDEYKRIREERNGKYSIEEYLQD

PF01732

A5IYK2_MYCAP/279-649---------------------------ADFF-QYISD--RS-------------FELNVNQKVW................
Q6MUH9_MYCMS/258-617---------------------------EDYF-KYIHE--RS-------------FQLEINVKQW................
Q2SR25_MYCCT/264-622---------------------------EDFF-KYIHE--RS-------------FQLEINVKQW................
D3VQF5_MYCA6/359-733---------------------------LDFY-QYIYD--HS-------------FSLRIGTVEF................
Q4A635_MYCS5/147-497---------------------------EEYL-ESIFK--RT-------------FSINFNYSTQ................
Q4A5A2_MYCS5/91-491---------------------------FDAL-KAIAD--RS-------------FSLYVGMPNP................
C7LM95_MYCML/189-571---------------------------EEIY-KELYD--RT-------------FSIKFLTKLN................
A5IYA1_MYCAP/186-569---------------------------KILY-KELYD--RT-------------FSLKYLTKLS................
Q4A798_MYCH7/125-523---------------------------QILY-KELYD--RT-------------FSVKFGITLA................
Q4A5G2_MYCS5/337-740---------------------------ETLY-KEIYD--RT-------------FSLAYGFNEY................
D3FFM3_MYCGH/244-661---------------------------QLIY-KEIWD--RT-------------FSIRPGTFTS................
C5J6P1_MYCCR/115-482---------------------------EQAY-EKLKN--RT-------------FAIAFNSIDR................
Q7NAU7_MYCGA/221-623---------------------------QEIY-KKIYD--RT-------------FSLEFYTRYT................
Q7NAG1_MYCGA/203-712---------------------------NEIY-KKAAM--QT-------------YAIEFFNHNS................
D3FHQ1_MYCGH/203-710---------------------------NEIY-KKVAL--QT-------------FAIEFSNFNE................
Q4A5P6_MYCS5/166-643---------------------------NDLY-KNTAL--QT-------------YSISYVNEIK................
D1J8A8_MYCHP/334-723---------------------------NEHY-RDIAS--QT-------------FGIRFLTPIE................
B3XS56_UREUR/379-750---------------------------NEKY-RDEAL--QT-------------LGISSLTLKD................
B2D8H3_UREPR/376-752---------------------------NEKY-RQEAM--QT-------------FSLGILNNDS................
Q9PR98_UREPA/413-786---------------------------NDMY-KQIAL--QT-------------FGIQIQTPNG................
Q6MSY9_MYCMS/283-769---------------------------NETY-KTAAI--QT-------------FQVSFTAHKDYAAEIEEAEDNIKLFE
C7LKT8_MYCML/288-775---------------------------NKTY-KTAAI--QT-------------FQVSFKGWKDYAQEIAEAEYYIKLFE
Q98Q64_MYCPU/350-715---------------------------NEMY-KKIAL--QT-------------YSVDVFNPKK................
Q98QS3_MYCPU/339-702---------------------------NETY-KKIAE--QS-------------YSVQFTSKKV................
D3FJ19_MYCGF/216-600---------------------------NDHY-RDFSK--TV-------------YSLYYSNILS................
Q7NAJ2_MYCGA/204-545---------------------------NKKY-QQLSK--IT-------------YSIRITNELS................
Q4A7B5_MYCH7/323-738---------------------------NQEY-KNLTK--NS-------------IGVEIVNGDF................
Q98PH9_MYCPU/101-415---------------------------NKIY-QDNFK--TS-------------LSLSIPVVGA................
Q8EWB5_MYCPE/130-442---------------------------NETQ-VKQAK--RT-------------VGIGFIRGKG................
Q8EW95_MYCPE/145-484---------------------------TDKH-AQLAK--QV-------------YSVGFHNGTE................
Y068_MYCGE/48-383---------------------------SDPY-HINYD--LT-------------FSLNFASNKR................
Y084_MYCPN/45-410---------------------------GDVY-HDNYD--LT-------------FSLNFATSSK................
Y588_MYCPN/75-444---------------------------SDVF-KHNYD--LT-------------FSLNFTNKSN................
Y395_MYCGE/89-428---------------------------SDIY-RKGYD--LT-------------FTLNFTSFSN................
Y592_MYCPN/104-443---------------------------NTKY-RPGYD--LS-------------FALKFGTSWK................
Y083_MYCPN/52-447---------------------------DDIY-SKFYD--LT-------------FSLNFVNNQA................
Y582_MYCPN/44-388---------------------------AEID-HANYD--LT-------------FFLGFFNRIE................
Q4A8M7_MYCH7/557-908---------------------------SFYF-GNSLQ--DY-------------YQVKIKFSQK................
Q8EWN7_MYCPE/57-397---------------------------SNAL-KWISQ--RT-------------ISLAFELKNK................
B3XTP3_UREUR/59-344---------------------------NVST-AYLNK--RS-------------IALKFTIPLN................

PF00949

Y298_MYCGA/335-468---------------------------WP.T-TPQYT..KF-------------SVPSLS..RR----------------
Q4VIX4_9FLAV/1520-1672---------------------------GD.T-TPGVY..RI-------------MAKGLL.GRY----------------
O36765_9FLAV/1520-1672---------------------------GD.T-TTGVY..RI-------------MARGIL.GTY----------------
Q3I100_WNV/1521-1673---------------------------GD.T-TTGVY..RI-------------MTRGLL.GSY----------------
Q32ZD1_9FLAV/1516-1668---------------------------AE.L-STGVF..RI-------------MARGIL.GKY----------------
Q32ZD7_9FLAV/1513-1665---------------------------TE.L-KPGVY..RV-------------MTMGIL.GRY----------------
Q32ZD2_9FLAV/1515-1667---------------------------CE.T-KPGIY..RI-------------MTRGIL.GTF----------------
Q32ZD5_9FLAV/1508-1660---------------------------AK.V-EDGVY..RI-------------FSRKLF.GES----------------
Q98Y40_9FLAV/1491-1643---------------------------AV.L-DDGIY..RI-------------MQRGLL.GRS----------------
Q5DSL2_9FLAV/1489-1641---------------------------AE.L-EEGVY..RI-------------NQQGIF.GKT----------------
Q9J8E1_9FLAV/1491-1643---------------------------AE.L-EDGAY..RI-------------KQKGIL.GYS----------------
Q2YHE7_9FLAV/1490-1642---------------------------AT.L-SEGVY..RI-------------MQRGLF.GKT----------------
A0EKU1_9FLAV/1504-1656---------------------------FE.V-KNGVY..RI-------------YEPGLFGGRR----------------
A0EKU7_9FLAV/1506-1658---------------------------FE.V-KTGVY..RI-------------YEPGLFGGRR----------------
A0EKU5_9FLAV/1507-1659---------------------------FE.V-RTGAY..RI-------------YEPGILGGKR----------------
Q91B85_9FLAV/1509-1661---------------------------FE.I-KDGAY..RI-------------YSPGLLWGHR----------------
POLG_LANVT/1507-1659---------------------------LD.V-KNGVY..RI-------------YTPGLLWGQR----------------
Q3Y6G7_9FLAV/1507-1659---------------------------FE.V-KDGVY..RI-------------FSPGLFWGQN----------------
Q6JJM0_9FLAV/1507-1659---------------------------FE.V-RDGVY..RI-------------LSPGLLWGHR----------------
Q8VBK7_9FLAV/1507-1659---------------------------FD.I-KDGVY..RI-------------YAPGLVWGHR----------------
A0EKU2_9FLAV/1509-1661---------------------------WE.V-RDGVY..RI-------------YQPGLLWGQR----------------
Q5G264_9FLAV/1507-1659---------------------------FE.V-KDGVY..RI-------------FRPGLFWGAS----------------
A0EKU6_9FLAV/1510-1662---------------------------FE.V-KEGVY..RI-------------FRPGLLWGHN----------------
A0EKU3_9FLAV/1496-1648---------------------------FE.V-KAGVY..RI-------------YRPGILWGRQ----------------
Y577_MYCPN/197-333---------------------------VE.S-NIAAL..NL-------------NQTEVKPTRP----------------
Y067_MYCGE/321-456---------------------------FS.Q-QTSVL..KH-------------YQKQPLQQRT----------------
Y083_MYCPN/328-467---------------------------ND.E-SNTTN..TI-------------TKASLTQQPH----------------
Y068_MYCGE/272-402---------------------------RQ.Y-NNSYT..EK-------------YTPQTLTKDQ----------------
Y084_MYCPN/296-431---------------------------VK.K-NYVLQ..TI-------------TKEQHTLDIT----------------
Y588_MYCPN/338-464---------------------------WF.T-KDQSYINKL-------------DRIPVLTNNY----------------
Y395_MYCGE/314-448---------------------------TH.N-FNQKS..QL-------------WSKNTYLVST----------------
Y592_MYCPN/334-455---------------------------WN.L-PQKGY....-------------..SSPLYENS----------------
Y589_MYCPN/14-134---------------------------FE.W-TKTEQ..RF-------------NHDDFY.GSM----------------
Y591_MYCPN/171-291---------------------------WE.C-KQGAE..R.-------------FSYGYFYSNM----------------
Y586_MYCPN/154-286---------------------------YL.L-GYPFL..RN-------------KAASLFLNQT----------------
Q8QVE1_9FLAV/1495-1635---------------------------EK.L-KDGFY..SI-------------SVAGLCW.KY----------------
Q6A4R3_AEDAL/768-912---------------------------GD.L-PNGVY..RI-------------IVRSFM.ENR----------------
Q80DQ3_9FLAV/1484-1633---------------------------GE.L-PNGVY..RI-------------TVRSLF.GTR----------------
Q8JJZ3_9FLAV/1479-1630---------------------------QR.I-TDGVY..RI-------------KVSSLF.GKK----------------
Q9JAD5_9FLAV/1479-1630---------------------------VS.I-QDGVY..RI-------------MVSSLF.GKK----------------
Q9J9C2_9FLAV/1482-1633---------------------------ES.P-NEGIY..RI-------------FASGVL.GKK----------------
Q8QL64_9FLAV/1478-1629---------------------------GD.L-LEGVY..RI-------------TAASIF.GRK----------------
POLG_YEFVE/1501-1655---------------------------CEYL-EDGIY..GI-------------FQSTFL.GAS----------------
Q32ZD3_9FLAV/1496-1649---------------------------GY.L-EDGVY..TI-------------NQKNVL.GMA----------------
Q32ZD9_9FLAV/1506-1659---------------------------GQ.V-PDGVY..AI-------------NQKGLL.GSN----------------
Q7T918_9FLAV/1515-1668---------------------------EG.V-PDGVY..RI-------------MQKGVF.GPQ----------------
Q32ZD6_9FLAV/1505-1657---------------------------AV.L-GDGVY..RI-------------MSKKLL.GPS----------------
Q32ZD8_9FLAV/1507-1659---------------------------AS.T-EPGVY..RI-------------MAARLI.GSS----------------
Q32ZE1_9FLAV/1514-1666---------------------------GE.T-TDGVY..RV-------------MTRRLL.GST----------------
Q32ZE0_9FLAV/1519-1670---------------------------GS.T-ENGVY..RI-------------LANRLF.GKT----------------

PF02907

POLG_HCVJL/1060-1208---------------------------AG----------EI-------------QILSTATQTF----------------
POLG_HCVNZ/1062-1210---------------------------TG----------EV-------------QVLSTATQTF----------------
POLG_HCVEV/1057-1205---------------------------EG----------EV-------------QFLSTATQTF----------------
O56074_9FLAV/1007-1154---------------------------EG----------SI-------------VVLGTSTTRS----------------
Q96898_9FLAV/992-1139---------------------------HG----------NV-------------VVLGTSTTRS----------------
Q9WM98_9FLAV/924-1071---------------------------.G----------NV-------------MVLGTATSRS----------------
POLG_GBVB/970-1118---------------------------TG----------TI-------------FRLGSLATSY----------------
Q9Q9A7_9HEPC/1060-1208---------------------------AG----------EI-------------QVLSTVTQSF----------------
Q9QIX6_9HEPC/1056-1204---------------------------EG----------EV-------------QVVSTATQSF----------------

PF10459

B4SLK2_STRM5/22-718---------------------------AAEG.MWVPQ--QL..PEI.AGPLQK.AGLKLSPEQL----------------
A1SA55_SHEAM/18-726---------------------------ADEG.QWQPY--QM..PSI.ADKLKA.RGIDIPAEQL----------------
A3J218_9FLAO/21-713---------------------------ADEG.MWFLM--FI..ERLNHRDMQK.MGLQLTAEEI----------------
A3J4B3_9FLAO/17-708---------------------------AQQGGMWIPS--LL..KGTNEKEMKA.LGMKISADDI----------------
E0THX8_PARBH/23-721---------------------------ADEG.MWTPD--QL..PAI.ADDLRE.TGLELDPAAL----------------
A3WDJ5_9SPHN/23-720---------------------------AKEG.MFTPE--QL..PDI.SEALQE.AGLELDPETL----------------
F2GAE2_ALTMD/22-719---------------------------AKEG.MFTPE--QL..PSI.AGDLKE.TGLEIPASSI----------------
A4C924_9GAMM/18-739---------------------------ADEG.QWQPH--QL..ADL.QAEFTR.VGIELPAKQV----------------
A4CBH4_9GAMM/20-717---------------------------ADEG.MWQPH--QL..PEL.ESILKA.KGLEIDAKSI----------------
A5FMW8_FLAJ1/19-712---------------------------ADEG.MWFLM--FI..ERLNHRDMEK.MGLQLTAEEI----------------
B8E9P0_SHEB2/18-729---------------------------ADEG.QWQPY--QM..PSI.ADKLSE.RGINIPAEKL----------------
A5PEK4_9SPHN/21-716---------------------------AKEG.MFTPQ--QL..PEI.AEDLRA.TGLELDPEAL----------------
A5ZH65_9BACE/21-717---------------------------ADEG.MWLLQ--LM..QQQHSIDMMKKQGLKLEAQDL----------------
A6E8C7_9SPHI/24-720---------------------------WDEG.MFPLS--EI..HKL...DLKK.AGLKIDQNEI----------------
A6EQ24_9BACT/17-690---------------------------AQQGGMWIPS--LL..EGMNEAEMQS.LGSKLTAQDI----------------
A6ERE5_9BACT/20-712---------------------------ANEG.MWFLM--HI..DRLNQRDMEK.MGLQLTAEEI----------------
A6GH08_9DELT/30-733---------------------------ANEG.QWKPG--QL..EEI.IERAKQ.DGLELDADQL----------------
A6GI93_9DELT/51-752---------------------------ENPGGMWMPG--QLGAPDH.KQQLQA.LGLEYDPAAL----------------
A6GWM2_FLAPJ/17-707---------------------------AQQGGMWIPS--LL..SGMNETEMKN.LGMKISADDI----------------
A6KZW8_BACV8/17-706---------------------------GNEG.MWLPC--CL..SKQTQQVMKE.MGLELSSEQL----------------
A6L2J7_BACV8/19-726---------------------------ADEG.MWMLT--DL..KEQNAATMYD.MGLDISIDKV----------------
A6L2J8_BACV8/21-719---------------------------ADEG.MWLLQ--LM..QEQHLADRMKAQGLLLEADDI----------------
A6LID5_PARD8/19-717---------------------------ADEG.MWLLP--LL..KQQKFAEMQA.LGLRLSDQEV----------------
A6WS02_SHEB8/18-716---------------------------ADEG.MWQPH--QL..PAM.ADELKA.KGLEIDAKSI----------------
A7AAA4_9PORP/22-711---------------------------ADEG.MWVLK--EL..NKQNLERMKE.LGFTPSYEQL----------------
A7AHP4_9PORP/19-717---------------------------ADEG.MWLLP--LL..KGQRFPEMQA.LGLKLQDYDI----------------
A7HA06_ANADF/20-725---------------------------ADEG.MWMPQ--QI..PDL.APRLQQ.LGFDGDARQF----------------
A7HFU9_ANADF/37-699---------------------------ADEG.MWTYD--AF.....PADKVEKKYGFRPSDAWL----------------
A7V0H7_BACUN/20-709---------------------------ADEG.MWMLG--NL..NKQTRQTMKE.LGLQMSVNKL----------------
A7V1I5_BACUN/23-719---------------------------ADEG.MWLLQ--LM..KQQNSIDMMKKQGLKLEADDL----------------
A8FR99_SHESH/24-737---------------------------ADEG.QWQPY--QM..PSI.AEKLSE.RGIEIPAKQL----------------
Q024G1_SOLUE/22-694---------------------------GEEG.KWTPQ--QL..LQFDAAWLKK.QGLELPVSRL----------------
Q027J4_SOLUE/18-549---------------------------ADEG.MWLFN--QF.....PKAQVKEKYGVEVTDEFL----------------
Q029T1_SOLUE/24-727---------------------------AEEG.MWMPQ--QI..PEM.AAKLRA.LGFRGDAKAF----------------
Q02D16_SOLUE/31-664---------------------------AGEG.LWPYN--QV.....PTATIKQKHAFDVEPAFL----------------
Q07XT1_SHEFN/18-727---------------------------ADEG.QWQPY--QM..PSI.ADKLLQ.RGIDIPASQL----------------
Q08V25_STIAD/73-737---------------------------ADEG.MWTYN--NF.....PAAAVKAQYGFEPTAQWL----------------
Q08VC9_STIAD/18-714---------------------------AGEG.KWTPQ--QV..LELDPAWLKA.QGLKLPPQRL----------------
Q11SC7_CYTH3/21-702---------------------------ADEG.MWLPF--VL...GKNYDQMKK.LGLKITPEQI----------------
Q12RW4_SHEDO/18-728---------------------------GDEG.QWQPY--QM..PSI.ADKLEQ.HGIKIPAKQL----------------
Q1D5W7_MYXXD/35-700---------------------------ADEG.MWTYN--NF.....PSAKVKEKYGFEPSQQWL----------------
Q1D9F6_MYXXD/17-714---------------------------AGEG.KWTPQ--QV..LELDPAWLRA.QGLQVSPKKL----------------
Q1DDZ2_MYXXD/18-682---------------------------ADEG.MWTYD--AF.....PSDTVNKAYGFTPTQAWL----------------
Q1GVV7_SPHAL/23-684---------------------------AEEG.MWTFD--AV.....PTDAIKAAYGWAPDQKWL----------------
Q1IPC2_KORVE/27-692---------------------------ADEG.MWLFT--NP.....PTAAIQKKYGFAITQEWL----------------
Q1NG15_9SPHN/26-683---------------------------AEEG.MWTFD--AF.....PTQAMRDSYGWAPDQAWL----------------
Q2G546_NOVAD/56-713---------------------------ADEG.MWTFD--AF.....PSAKMQADYGWAPDGRWL----------------
Q2IEV3_ANADE/18-687---------------------------ADEG.MWTYD--AF.....PSDRVARKYGFDPSRAWL----------------
Q2NZP5_XANOM/22-715---------------------------AGEG.MWVPQ--QL..PEI.AGPLQQ.AGLRLSPQQL----------------
Q2S133_SALRD/5-639---------------------------SDAGRIWSLV--AP.....PADRLVRRYGMEVDSAWA----------------
Q2S134_SALRD/69-734---------------------------FDRGRMWTVE--NL.....PTSYFQEAHGVTPDDEWR----------------
Q3REP2_XYLFA/22-714---------------------------AGEG.MWVPQ--QL..PEI.AGPLKQ.AGLQLSPEQL----------------
Q488S2_COLP3/26-729---------------------------ADEG.MWQPN--QL..PTI.AKELTN.AGLKLNPNDL----------------
Q5LIW7_BACFN/34-723---------------------------ADEG.MWMLG--NL..NKETRKTMKE.LGLQMPADQL----------------
Q5QV86_IDILO/17-717---------------------------ADEG.MWMPK--QL..PEI.ADKLKA.AGLTIDPNDI----------------
Q64RG4_BACFR/19-718---------------------------ADEG.MWMLT--DL..KAQNEAAMMD.LGLQIPIEEV----------------
Q7MV25_PORGI/21-718---------------------------ADEG.MWLMQ--QL...GRKYAQMKE.RGLKMKEYDL----------------
Q7MWU6_PORGI/24-711---------------------------ADKG.MWLLN--EL..NQENLDRMRE.LGFTLPLDSL----------------
Q7NHA9_GLOVI/34-698---------------------------AEEG.MWTYD--NF.....PSEQVAKKYGFKPDAAWL----------------
Q7UKL5_RHOBA/28-688---------------------------ADEG.MYLFN--DV.....PRELLRDRHQFEPSEEWL----------------
Q8A2L6_BACTN/20-711---------------------------ADEG.MWLLG--NLRKNKQAERVMKE.LGLQMPVNKL----------------

PF00548

Q8JJT0_PSV13/1680-1844------------------------------------------------------GPDMEF....----------------
POLG_HRV8A/1522-1687------------------------------------------------------GPEEEF....----------------
POLG_EC01F/1540-1705------------------------------------------------------GPAFEF....----------------
POLG_HRV14/1538-1702------------------------------------------------------GPNTEF....----------------
POLG_BOVEV/1532-1697------------------------------------------------------GPLFDF....----------------
POLG_CX16G/1549-1714------------------------------------------------------GPSLDF....----------------
POLG_HE701/1555-1720------------------------------------------------------GPSLDF....----------------
POLG_PEV9U/1525-1690------------------------------------------------------GPLMDF....----------------
Q04107_HRV1A/162-327------------------------------------------------------GPEEEF....----------------
Q6TGL9_9ENTO/1563-1728------------------------------------------------------GPGFDY....----------------
Q66776_ERBV1/1905-2095------------------------------------------------------STGLTV....----------------
Q6TPI6_9PICO/1649-1833------------------------------------------------------APPTDL....----------------
Q7T7N7_9ENTO/1563-1728------------------------------------------------------GPVFDY....----------------
Q8B552_9PICO/1782-1946------------------------------------------------------GPDLEF....----------------
POLG_TMEVG/1636-1816------------------------------------------------------NPVMDF....----------------
POL1_BBWVS/957-1123------------------------------------------------------KDRVQVCMAP----------------
POLG_HPE2W/1517-1692------------------------------------------------------APYDGQ....----------------
Q80N16_9PICO/1589-1765------------------------------------------------------APYMQD....----------------
Q9IM09_9ENTO/1556-1721------------------------------------------------------GPSLDF....----------------
O39818_9PICO/1580-1761------------------------------------------------------VPATDL....----------------

PF00863

POLG_PEMVM/2056-2290----------------------------------------T-------------EGKSMCRGLR----------------
Q98WK5_PRSVW/2281-2513----------------------------------------H-------------EGKSLCQGMR----------------
Q98810_9POTV/196-430----------------------------------------H-------------EGKSMLAGLR----------------
Q7T915_9POTV/2040-2274----------------------------------------L-------------ESKSIYKGVR----------------
Q89255_9POTY/427-646----------------------------------------L-------------EAATGITISQ----------------
Q82933_9POTV/1990-2223----------------------------------------H-------------EGTSAIHGVA----------------
Q9YZN8_9POTV/2078-2312----------------------------------------H-------------ESALLHRGLR----------------
Q8QXL0_9POTV/1962-2196----------------------------------------H-------------ESTSLYKGLR----------------
O10243_CYVV/709-943----------------------------------------F-------------ESLNRISGLR----------------
Q8QXN3_9POTV/1986-2220----------------------------------------H-------------ESKSMMAGLG----------------
POL1_BAYMJ/1361-1581----------------------------------------L-------------EASTGILLSQ----------------
POLG_PPVNA/2048-2282----------------------------------------H-------------ESKSLFRGLR----------------
Q8QV60_9POTV/2016-2250----------------------------------------V-------------ESKSTYKGPR----------------
POLG_LMV0/2213-2447----------------------------------------H-------------ESKTLFRGLR----------------
Q8UZ37_9POTV/2108-2341----------------------------------------F-------------EGKSLLSGLR----------------
POLG_SPMMV/2424-2646----------------------------------------A-------------EDK.......----------------
O89525_9POTY/1998-2231----------------------------------------H-------------ESKSIAKGLR----------------
Q7T4I3_TUMVJ/2115-2349----------------------------------------H-------------ESNSMFRGLR----------------
Q8QQA0_9POTV/2042-2276----------------------------------------H-------------ETKSIVTGLR----------------
Q8QY00_9POTV/2175-2409----------------------------------------V-------------ESKSIYKGLR----------------
Q9WAA3_9POTY/1259-1474----------------------------------------L-------------EGMTM.....----------------
O39734_9POTV/2413-2647----------------------------------------H-------------ESKSLFRGLR----------------
Q65883_BYMV/335-569----------------------------------------F-------------ESLSKIGGLR----------------
Q9E160_9POTY/1951-2181----------------------------------------Y-------------ENKSLFEGAR----------------
Q7T7N5_9POTV/2211-2445----------------------------------------F-------------EGASSVKGLR----------------
Q8QXL1_9POTV/1986-2220----------------------------------------H-------------ESKSMMVGLS----------------
POLG_OMV/121-355----------------------------------------H-------------EGKNLNRGLR----------------
Q9QBT4_PVMA/2030-2264----------------------------------------F-------------ESTSMSRGVR----------------
Q80MX2_9POTY/190-375----------------------------------------L-------------E.........----------------
Q80P26_9POTV/2027-2261----------------------------------------H-------------EAASLLKGLR----------------
Q8UZ27_9POTY/1335-1554----------------------------------------L-------------EAATQITLSQ----------------
Q9WID3_9POTV/2038-2271----------------------------------------H-------------EARSLNRGLR----------------
Q88507_TEV/2036-2269----------------------------------------F-------------EGESLFKGPR----------------
Q7T5A6_9POTV/2385-2619----------------------------------------F-------------EAKSACCGPR----------------
Q912R2_9POTV/2117-2351----------------------------------------M-------------EGKSVYKGLR----------------
Q9YNB1_9POTY/405-628----------------------------------------H-------------.AQARI....----------------
Q9QBG1_9POTY/1362-1581----------------------------------------L-------------EASTGILLSQ----------------
Q88925_TVMV/2000-2232----------------------------------------F-------------ESKALLKGVR----------------
O73463_MDMV/1986-2220----------------------------------------H-------------EAKSMLTGLV----------------

PF12381

Q6EEL1_9SECO/2617-2847----------------------------------------D-------------KGLAKDPNMV----------------
O11979_9SECO/2603-2833----------------------------------------Y-------------KSLDKDPNMV----------------
Q1MNG4_9SECO/2627-2857----------------------------------------R-------------AGVDRDLSMT----------------

PF12380

B3U1H5_YHV/2834-3117---------------------------FLVGLVTHEV--NT-------------GNNTRVEDLN----------------
Q9IHZ8_GAVAU/2823-3106---------------------------FLVGLVTHEV--RT-------------GNATTVEDLN----------------

PF13365

DEG15_ARATH/376-594--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
Q2P9Y4_9ACTO/162-308--------------------------------------------------------------------------------
B6QXD8_9RHOB/76-232--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
C3HBL0_BACTU/109-260--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
Q2RS04_RHORT/145-306--------------------------------------------------------------------------------
Q467S2_METBF/103-254--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A3VZZ0_9RHOB/114-264--------------------------------------------------------------------------------
B6R9Y4_9RHOB/91-243--------------------------------------------------------------------------------
D3CTM8_9ACTO/100-254--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D4GHS4_PANAM/109-260--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
Q846R2_MYXXA/58-225--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B4VV96_9CYAN/140-327--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
A8FZT0_SHESH/365-519--------------------------------------------------------------------------------
B9M1H9_GEOSF/322-480--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
B4VT06_9CYAN/299-436--------------------------------------------------------------------------------
B8H010_CAUCN/64-248--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A3JWZ9_9RHOB/120-292--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
C6JD09_9FIRM/162-306--------------------------------------------------------------------------------
C0CMS9_9FIRM/152-296--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
C0FTN1_9FIRM/149-293--------------------------------------------------------------------------------
C9L519_RUMHA/148-292--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
B5CQ59_9FIRM/147-291--------------------------------------------------------------------------------
A5KN66_9FIRM/147-291--------------------------------------------------------------------------------
B6FP33_9CLOT/144-288--------------------------------------------------------------------------------
A7B169_RUMGN/176-320--------------------------------------------------------------------------------
B0NI56_EUBSP/167-311--------------------------------------------------------------------------------
C0B801_9FIRM/151-295--------------------------------------------------------------------------------
B0G1M9_9FIRM/149-293--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
B7AVI8_9FIRM/172-316--------------------------------------------------------------------------------
C5ELW4_9FIRM/172-316--------------------------------------------------------------------------------
C4G4N6_ABIDE/156-298--------------------------------------------------------------------------------
C1IAW0_9CLOT/114-253--------------------------------------------------------------------------------
B8AM75_ORYSI/89-258--------------------------------------------------------------------------------
B5JQS5_9BACT/61-197--------------------------------------------------------------------------------
B3DXV6_METI4/79-214--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
B9G3S8_ORYSJ/109-256--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
B9FMK5_ORYSJ/181-321--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
A7NIM6_ROSCS/38-173--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C6XBL7_METSD/51-179--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B6BWJ8_9PROT/54-182--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
B6BVZ4_9PROT/47-175--------------------------------------------------------------------------------
C6XD83_METSD/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
C6BGJ0_RALP1/55-184--------------------------------------------------------------------------------
B3QPC6_CHLP8/57-184--------------------------------------------------------------------------------
Q0YS38_9CHLB/89-216--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
Q3M8K4_ANAVT/33-168--------------------------------------------------------------------------------
D5WKU5_BURSC/40-175--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRAJA/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
B4UF27_ANASK/45-180--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
B4WI21_9SYNE/33-173--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
A6C5I0_9PLAN/58-206--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
A4A0T0_9PLAN/66-211--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
B6B9E4_9RHOB/398-528--------------------------------------------------------------------------------
D0D6Q7_9RHOB/389-519--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
A4A0S9_9PLAN/71-202--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
A9VXT6_METEP/54-187--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D3NU60_AZOS1/54-191--------------------------------------------------------------------------------
A8TSL0_9PROT/61-191--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
D0RMV8_9PROT/62-194--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
B4UTS4_BP163/66-193--------------------------------------------------------------------------------
Q11LS4_MESSB/40-170--------------------------------------------------------------------------------
C4RAG7_9PROT/100-239--------------------------------------------------------------------------------
C5JAK2_9BACT/101-240--------------------------------------------------------------------------------
C5JBN6_9BACT/99-238--------------------------------------------------------------------------------
A0L9W3_MAGSM/126-265--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A5BEH1_VITVI/502-717--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A9ZKZ5_COXBE/58-186--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
A1DKZ3_NEOFI/106-274--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
B4VWK9_9CYAN/26-185--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
A3ZSU8_9PLAN/169-309--------------------------------------------------------------------------------
A6CCJ8_9PLAN/216-356--------------------------------------------------------------------------------
B5W7L6_SPIMA/53-196--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------
A0ZIJ6_NODSP/50-187--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
A0YM55_LYNSP/62-208--------------------------------------------------------------------------------
Q060L2_9SYNE/66-212--------------------------------------------------------------------------------
A2CDP2_PROM3/91-233--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
A8YFS3_MICAE/52-220--------------------------------------------------------------------------------
B4VKH5_9CYAN/399-535--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q4C9U0_CROWT/64-213--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B6BL05_9PROT/72-191--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
C2FHG0_LACPA/165-321--------------------------------------------------------------------------------
B0EDS2_ENTDS/219-353--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
B9IN99_POPTR/16-159--------------------------------------------------------------------------------
D1W398_9BACT/21-163--------------------------------------------------------------------------------
Q7MW22_PORGI/27-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
A8YNP5_MICAE/435-587--------------------------------------------------------------------------------
B8BM04_ORYSI/29-174--------------------------------------------------------------------------------
A3WZP2_9BRAD/25-182--------------------------------------------------------------------------------
B6SLW3_MAIZE/46-198--------------------------------------------------------------------------------
B4W048_9CYAN/24-160--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
C4RBC6_9ACTO/39-187--------------------------------------------------------------------------------
B5HRW8_9ACTO/52-200--------------------------------------------------------------------------------
B4VL88_9CYAN/23-161--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
A3XNG0_LEEBM/39-192--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
D1W141_9BACT/221-392--------------------------------------------------------------------------------
Q72KS5_THET2/61-193--------------------------------------------------------------------------------
B7A6E3_THEAQ/62-195--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
B4D8F4_9BACT/72-317--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A7BUM9_9GAMM/28-164--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
B3NQY9_DROER/305-445--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
A3SCU7_9RHOB/196-330--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
A9AU45_BURM1/75-243--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
B4D163_9BACT/76-206--------------------------------------------------------------------------------
B4CWZ6_9BACT/327-458--------------------------------------------------------------------------------
B4CWZ7_9BACT/330-461--------------------------------------------------------------------------------
B4D4S9_9BACT/50-179--------------------------------------------------------------------------------
C0AF95_9BACT/54-190--------------------------------------------------------------------------------
B9YD37_9FIRM/27-200--------------------------------------------------------------------------------
B2ULX5_AKKM8/77-314--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
Q1PY07_9BACT/57-189--------------------------------------------------------------------------------
C3QH30_9BACE/51-184--------------------------------------------------------------------------------
A5ZI03_9BACE/49-181--------------------------------------------------------------------------------
B5CVV9_9BACE/52-183--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
C8N8L7_9GAMM/65-197--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
C0DWH2_EIKCO/92-250--------------------------------------------------------------------------------
D1NAH5_9BACT/62-195--------------------------------------------------------------------------------
A8KF66_BURPE/83-236--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C0GIE8_9FIRM/109-240--------------------------------------------------------------------------------
A6CKL8_9BACI/105-229--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
A4A524_9GAMM/61-225--------------------------------------------------------------------------------
A4BT63_9GAMM/57-219--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
C6AVQ8_RHILS/33-192--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
D3LKZ9_MICLU/283-419--------------------------------------------------------------------------------
B4V9A1_9ACTO/51-211--------------------------------------------------------------------------------
B4CXG1_9BACT/84-257--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
D3W785_9VIRU/161-295--------------------------------------------------------------------------------
B4V7A8_9ACTO/24-181--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
C9BDM8_ENTFC/121-272--------------------------------------------------------------------------------
B8AXY3_ORYSI/1277-1457--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
B9G3S5_ORYSJ/55-216--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
B2XS89_9VIRU/586-711--------------------------------------------------------------------------------
NS1A_OASV1/438-558--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B3EEJ2_CHLL2/96-337--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
A8TZT7_9PROT/75-215--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569---------------------------IVGGKRAQLG--D----------------------------------------
SP24D_ANOGA/50-264---------------------------IVGGSVASEG--Q----------------------------------------
TRY5_AEDAE/40-260---------------------------IVGGFEVPVE--E----------------------------------------
UROK_HUMAN/179-419---------------------------IIGGEFTTIE--N----------------------------------------
MASP1_MOUSE/454-696---------------------------IFNGRPAQKG--T----------------------------------------
CTR1_ANOGA/33-250---------------------------VVGGEVAKNG--S----------------------------------------
CFAD_HUMAN/26-248---------------------------ILGGREAEAH--A----------------------------------------
ACRO_RAT/43-286---------------------------IVGGQTSSPG--A----------------------------------------
HPT_HUMAN/162-399---------------------------ILGGHLDAKG--S----------------------------------------
CASP_MESAU/445-682---------------------------IFGGFPAKIQ--S----------------------------------------
SNAK_DROME/186-427---------------------------IVGGTPTRHG--L----------------------------------------
PCE_TACTR/128-370---------------------------IIGGREAPIG--A----------------------------------------
STUB_DROME/544-782---------------------------IVGGKSAAFG--R----------------------------------------
TRYU_DROME/28-254---------------------------IVGGADTSSY--Y----------------------------------------
TRYI_DROME/28-245---------------------------IIGGSDQLIR--N----------------------------------------
TRYB_MANSE/25-252---------------------------IVGGSTTTIQ--Q----------------------------------------
TRYP_FUSOX/25-244---------------------------IVGGTSASAG--D----------------------------------------
TRYP_STRGR/37-252---------------------------VVGGTRAAQG--E----------------------------------------
TRY1_HUMAN/24-239---------------------------IVGGYNCEEN--S----------------------------------------
TRYP_PIG/9-224---------------------------IVGGYTCAAN--S----------------------------------------
TRY1_SALSA/21-235---------------------------IVGGYECKAY--S----------------------------------------
TRYP_PLEPL/23-242---------------------------IIGGHECAAH--S----------------------------------------
DEGP3_ARATH/99-287---------------------------KVFTVSSKPR--L----------------------------------------
DEGP2_ARATH/121-308---------------------------VYCTHTAPDY--S----------------------------------------
DEGS_ECOLI/62-244---------------------------YNRGLNTNSH--N----------------------------------------
DEGS_HAEIN/37-240---------------------------IISFKNAVRI--A----------------------------------------
YYXA_BACSU/99-283---------------------------DIWGESGEAG--S----------------------------------------
DEGP_SALTY/97-278---------------------------QGGGNGGNGG--Q----------------------------------------
Q44596_BRUAO/85-261---------------------------SQFGASKPRI--Q----------------------------------------
DEGPL_BRUSU/125-298---------------------------PRPGHERPVA--Q----------------------------------------
O06439_RHOCA/59-235---------------------------PQGGPQRQHH--A----------------------------------------
HHOA_SYNY3/95-274---------------------------FGRSFPVPPR--E----------------------------------------
HTRA_SYNY3/156-334---------------------------FGSQMPPMPN--E----------------------------------------
O42417_CHICK/87-286---------------------------IVGRHPFSGR--E----------------------------------------
ETA_STAAU/70-274---------------------------KVDEKDRQKY--P----------------------------------------
ETB_STAAU/59-251---------------------------ITDNARSPYN--S----------------------------------------
SPLB_STAAU/37-234---------------------------ENNVTKIQDT--N----------------------------------------
SPLC_STAAU/38-233---------------------------KNVTQVKDTN--N----------------------------------------
MPR_BACSU/95-311---------------------------IIGTDERTRI--S----------------------------------------
PRTC_STRGR/205-383---------------------------IRGGDAYYMN--G----------------------------------------
Q55353_STRSQ/198-372---------------------------LVGGDAYYMG--G----------------------------------------
Q55352_STRSQ/202-378---------------------------LVGGDAYYIG--N----------------------------------------
Q54395_STRLI/158-342---------------------------ASGGDAIFGG--G----------------------------------------
SP1_RARFA/205-391---------------------------DDVIVPVR..--.----------------------------------------
CERC_SCHMA/28-256---------------------------IRSGEPVQHP--A----------------------------------------
Q54344_STRLI/47-254---------------------------AISGEPPAAT--D----------------------------------------
CFAB_HUMAN/481-752---------------------------VWEHRKGTDY--H----------------------------------------
PROZ_BOVIN/143-352---------------------------RPQGSQQNLL--P----------------------------------------
CAC3_BOVIN/12-246---------------------------VVNGEDAVPY--S----------------------------------------
CELA1_PIG/27-259---------------------------VVGGTEAQRN--S----------------------------------------
CTRA_BOVIN/16-238---------------------------IVNGEEAVPG--S----------------------------------------
CTRL_HALRU/24-251---------------------------IVGGSNAAAG--E----------------------------------------
COGS_HYPLI/31-252---------------------------IINGYEAYTG--L----------------------------------------
CTRB1_LITVA/46-263---------------------------IVGGVEATPH--S----------------------------------------
CATG_MOUSE/21-238---------------------------IIGGREARPH--S----------------------------------------
MCPT2_RAT/21-239---------------------------IIGGVESIPH--S----------------------------------------
ELNE_HUMAN/30-242---------------------------IVGGRRARPH--A----------------------------------------
PRTN3_HUMAN/28-243---------------------------IVGGHEAQPH--S----------------------------------------
GRAK_RAT/26-248---------------------------IIGGREVQPH--S----------------------------------------
GRAM_RAT/21-245---------------------------IIGGREAVPH--S----------------------------------------
KLK1_MOUSE/25-253---------------------------IVGGFNCEKN--S----------------------------------------
KLK2_RAT/25-251---------------------------IVGGYKCEKN--S----------------------------------------
VSPCA_AGKCO/1-217---------------------------VIGGDECNIN--E----------------------------------------
HGF_RAT/496-719---------------------------VVNGIPTQTT--V----------------------------------------
ENTK_PIG/800-1029---------------------------IVGGNDSREG--A----------------------------------------
PRSS8_HUMAN/45-281---------------------------ITGGSSAVAG--Q----------------------------------------
HGFA_HUMAN/408-641---------------------------IIGGSSSLPG--S----------------------------------------
TPA_HUMAN/311-556---------------------------IKGGLFADIA--S----------------------------------------
FA10_HUMAN/235-462---------------------------IVGGQECKDG--E----------------------------------------
THRB_BOVIN/367-616---------------------------IVEGQDAEVG--L----------------------------------------
PROC_HUMAN/212-445---------------------------LIDGKMTRRG--D----------------------------------------

PF09342

Q7QJ48_ANOGA/1759-1982---------------------------NAHIELVENF--G.-------------..........----------------
Q8WSJ2_BOMMO/1512-1777---------------------------LRETEVVQTF--K.-------------..........----------------
NUDEL_DROME/2005-2298---------------------------NKKDEILDRL--DK-------------LIKSKKNKTI----------------

PF03761

Q9U2W2_CAEEL/6-282---------------------------IGVLVFIGIV--NC-------------LISSQKLTVK----------------
Q21628_CAEEL/5-298---------------------------SLTYIFVIIN--IG-------------LVVGLNFTDA----------------
O45371_CAEEL/3-276---------------------------FLTLFIWIIA--CG-------------FNNTQPLSYE----------------
O76649_CAEEL/2-297---------------------------NIGILISLLF--LG-------------FSSSRIIGEK----------------
A8XIB1_CAEBR/15-285---------------------------ILIGIFSILI--GS-------------SEPFRKLSPD----------------
A8WNY9_CAEBR/3-296---------------------------LLHLLPLVVF--VV-------------GVGAGKISEQ----------------
Q9XWZ8_CAEEL/4-272---------------------------QSIITISTFI--II-------------VVSYNELTAE----------------
O62223_CAEEL/7-278---------------------------IIFYFIFVIA--II-------------PIVTEKLSLK----------------
O62231_CAEEL/5-272---------------------------VIVIFFALTG--CI-------------GCDFYKLTAD----------------

PF00944

POLS_AURAV/110-268--------------------------------------------------------------------------------
P89913_SINDV/109-267--------------------------------------------------------------------------------
POLS_BFV/98-255--------------------------------------------------------------------------------
POLS_EEEV/103-260--------------------------------------------------------------------------------
O41516_9VIRU/119-276--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713--------------------------------------------------------------------------------
RPOA_PRRSL/1601-1897--------------------------------------------------------------------------------
RPOA_LDVP/1420-1715--------------------------------------------------------------------------------
RPOA_SHFV/1368-1665--------------------------------------------------------------------------------
Q99AV6_PRRSV/1716-2013--------------------------------------------------------------------------------
RPOA_EAVBU/963-1269--------------------------------------------------------------------------------

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF05580

Q46028_CLODI/132-352---------------------------ETK.KENGKY--KL-------------GLWVRDKIS-----------------
Q97HE0_CLOAB/173-391---------------------------KVKCKSDENY--KI-------------GLWVRDSTA-----------------
Q9K975_BACHD/206-424---------------------------LKN.KGESTF--RM-------------GLYIRDSAA-----------------
P71028_BACIU/197-414---------------------------EKD.EGEGKY--RI-------------GLYIRDSAA-----------------
Q8XJE5_CLOPE/165-382---------------------------LSK.NSEGDY--KI-------------GLWVRDSTA-----------------
Q8RAC0_THETN/198-414---------------------------VKS.KEDKQY--RI-------------GLWVRDHTA-----------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

O09461_9FLAV/1588-1798--------------------------------------------------------------------------------
Q04232_BVDV/149-359--------------------------------------------------------------------------------
Q68287_9FLAV/2-212--------------------------------------------------------------------------------
O11993_BVDV/1590-1800--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782--------------------------------------------------------------------------------
PET_ECO44/46-729--------------------------------------------------------------------------------
IGA0_HAEIN/17-865--------------------------------------------------------------------------------
SEPA_SHIFL/46-800--------------------------------------------------------------------------------
PIC_SHIFL/49-802--------------------------------------------------------------------------------
HBP_ECOLX/44-811--------------------------------------------------------------------------------
HAP2_HAEIF/17-765--------------------------------------------------------------------------------
IGA_NEIGO/19-849--------------------------------------------------------------------------------
ESPP_ECO57/47-730--------------------------------------------------------------------------------

PF05409

R1AB_FIPV/2932-3214--------------------------------------------------------------------------------
R1AB_PEDV7/3026-3317--------------------------------------------------------------------------------
R1AB_IBVBC/2808-3109--------------------------------------------------------------------------------
R1AB_CVMJH/3365-3658--------------------------------------------------------------------------------
R1AB_CVH22/2994-3284--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321-----------------------------------------------------------------------------VED
POLG_TUMVJ/107-361-----------------------------------------------------------------------------HEE
Q85074_9POTV/144-397-----------------------------------------------------------------------------AAL
POLG_ZYMVR/71-312-----------------------------------------------------------------------------FDT
P90213_9POTV/300-546-----------------------------------------------------------------------------HKE
POLG_PEMVC/44-286-----------------------------------------------------------------------------AEL
POLG_TVMV/30-273-----------------------------------------------------------------------------KDI
POLG_RGMVD/13-255-----------------------------------------------------------------------------QVD
POLG_LMVE/179-436-----------------------------------------------------------------------------AQM
POLG_PVMA/45-297-----------------------------------------------------------------------------EFT
POLG_PSBMV/143-396-----------------------------------------------------------------------------ARL
Q82933_9POTV/2-236-----------------------------------------------------------------------------AGE
POLG_PVYN/41-283-----------------------------------------------------------------------------ADL
Q65892_BYMV/40-283-----------------------------------------------------------------------------ADL
POLG_BCMNN/77-316-----------------------------------------------------------------------------LKK
POLG_ZYMVC/70-309-----------------------------------------------------------------------------FST
Q65852_BYMV/40-283-----------------------------------------------------------------------------SDL
POLG_SBMVG/69-307-----------------------------------------------------------------------------FDQ
O73463_MDMV/2-232-----------------------------------------------------------------------------AGT
POLG_PVYHU/41-283-----------------------------------------------------------------------------ASL
POLG_PPVD/59-307-----------------------------------------------------------------------------TAS
Q85057_9POTV/204-442-----------------------------------------------------------------------------MQQ
O39734_9POTV/410-663-----------------------------------------------------------------------------TQQ
POLG_ZYMVS/71-312-----------------------------------------------------------------------------FNN
POLG_PRSVH/300-546-----------------------------------------------------------------------------HKE
POLG_TEV/53-303-----------------------------------------------------------------------------VIF

PF03510

POLG_RHDV3/1120-1218--------------------------------------------------------------------------------
O92368_VESV/1208-1312--------------------------------------------------------------------------------
POLG_SVM93/997-1103--------------------------------------------------------------------------------
Q9QRV9_9CALI/1095-1199--------------------------------------------------------------------------------
POLG_PESV/1063-1169--------------------------------------------------------------------------------

PF05416

POLG_SOUV3/707-1268RQRYEEELAEVQAGGDGGIGETEMEIRHRVFYKSKSRKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDEREVDYN
Q9YQ23_VESV/628-1162RERFERDLAERQADDADYDVG...AIRQKYFGRGKAAKA.................QRKRIDWNPTGPLWADDDRQVDYD
Q80J95_9CALI/650-1163RER.EEELLERDEEEAIFGDG.........FGLKATRRSRKAERAKLGLVSGGDIRARKPIDWNVVGPSWADDDRQVDYG
Q8JJL0_9CALI/645-1175RDRYYEEVAVARATEEDFCEEEEAKIRQRIF..RPTRKQRKEERGVLGLVTGSDIRKRRPDDFQPKGNLWADDTRSVDYN
Q80RD7_9CALI/641-1177RDKYYEEVAIARATEEDFCEEEEAKIRQRIF..RPTRKQRKEERASLGLVTGSEIRKRNPDDFKPKGKLWADDERVVDYN

PF01732

A5IYK2_MYCAP/279-649...............................................VDEFVES..........................
Q6MUH9_MYCMS/258-617...............................................VIDQDEK..........................
Q2SR25_MYCCT/264-622...............................................VIERDEK..........................
D3VQF5_MYCA6/359-733...............................................RRDP.............................
Q4A635_MYCS5/147-497................................................................................
Q4A5A2_MYCS5/91-491...............................................QA...............................
C7LM95_MYCML/189-571...............................................NG...............................
A5IYA1_MYCAP/186-569...............................................NG...............................
Q4A798_MYCH7/125-523...............................................KG...............................
Q4A5G2_MYCS5/337-740...............................................DPK..............................
D3FFM3_MYCGH/244-661...............................................DN...............................
C5J6P1_MYCCR/115-482...............................................T................................
Q7NAU7_MYCGA/221-623...............................................RKN..............................
Q7NAG1_MYCGA/203-712...............................................ELE..............................
D3FHQ1_MYCGH/203-710...............................................EMA..............................
Q4A5P6_MYCS5/166-643...............................................GDYVNEVKG........................
D1J8A8_MYCHP/334-723...............................................GE...............................
B3XS56_UREUR/379-750...............................................GK...............................
B2D8H3_UREPR/376-752...............................................HK...............................
Q9PR98_UREPA/413-786...............................................KP...............................
Q6MSY9_MYCMS/283-769SWDDKQIENYIDIQLKQLKLNFEDESGQIDKQIATTNRENTGIIDNLQKQKNELESKYKKDKDEISKLGKDGLVKWQQKQ
C7LKT8_MYCML/288-775KWTDEQIKQYIARQLWQLEQNLKYDLNLVEKDIATTRPDLTGVIAEHNKKKARIQSEFEQEKKKISALNRNKLVQWQKEE
Q98Q64_MYCPU/350-715...............................................NA...............................
Q98QS3_MYCPU/339-702................................................................................
D3FJ19_MYCGF/216-600...............................................DPVKSRESEKL......................
Q7NAJ2_MYCGA/204-545...............................................DSPIKQDNSN.......................
Q4A7B5_MYCH7/323-738...............................................LK.......................FRPDGGQG
Q98PH9_MYCPU/101-415...............................................ID...............................
Q8EWB5_MYCPE/130-442...............................................MG...............................
Q8EW95_MYCPE/145-484...............................................TI...............................
Y068_MYCGE/48-383...............................................N................................
Y084_MYCPN/45-410...............................................D................................
Y588_MYCPN/75-444...............................................D................................
Y395_MYCGE/89-428...............................................D................................
Y592_MYCPN/104-443...............................................E................................
Y083_MYCPN/52-447...............................................Q................................
Y582_MYCPN/44-388...............................................K................................
Q4A8M7_MYCH7/557-908...............................................TESKNIIADFGAKVLEKDSINSSLRARSLVIQL
Q8EWN7_MYCPE/57-397...............................................STNKAVY..........................
B3XTP3_UREUR/59-344...............................................NN...............................

PF00949

Y298_MYCGA/335-468--------------------------------------------------------------------------------
Q4VIX4_9FLAV/1520-1672--------------------------------------------------------------------------------
O36765_9FLAV/1520-1672--------------------------------------------------------------------------------
Q3I100_WNV/1521-1673--------------------------------------------------------------------------------
Q32ZD1_9FLAV/1516-1668--------------------------------------------------------------------------------
Q32ZD7_9FLAV/1513-1665--------------------------------------------------------------------------------
Q32ZD2_9FLAV/1515-1667--------------------------------------------------------------------------------
Q32ZD5_9FLAV/1508-1660--------------------------------------------------------------------------------
Q98Y40_9FLAV/1491-1643--------------------------------------------------------------------------------
Q5DSL2_9FLAV/1489-1641--------------------------------------------------------------------------------
Q9J8E1_9FLAV/1491-1643--------------------------------------------------------------------------------
Q2YHE7_9FLAV/1490-1642--------------------------------------------------------------------------------
A0EKU1_9FLAV/1504-1656--------------------------------------------------------------------------------
A0EKU7_9FLAV/1506-1658--------------------------------------------------------------------------------
A0EKU5_9FLAV/1507-1659--------------------------------------------------------------------------------
Q91B85_9FLAV/1509-1661--------------------------------------------------------------------------------
POLG_LANVT/1507-1659--------------------------------------------------------------------------------
Q3Y6G7_9FLAV/1507-1659--------------------------------------------------------------------------------
Q6JJM0_9FLAV/1507-1659--------------------------------------------------------------------------------
Q8VBK7_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU2_9FLAV/1509-1661--------------------------------------------------------------------------------
Q5G264_9FLAV/1507-1659--------------------------------------------------------------------------------
A0EKU6_9FLAV/1510-1662--------------------------------------------------------------------------------
A0EKU3_9FLAV/1496-1648--------------------------------------------------------------------------------
Y577_MYCPN/197-333--------------------------------------------------------------------------------
Y067_MYCGE/321-456--------------------------------------------------------------------------------
Y083_MYCPN/328-467--------------------------------------------------------------------------------
Y068_MYCGE/272-402--------------------------------------------------------------------------------
Y084_MYCPN/296-431--------------------------------------------------------------------------------
Y588_MYCPN/338-464--------------------------------------------------------------------------------
Y395_MYCGE/314-448--------------------------------------------------------------------------------
Y592_MYCPN/334-455--------------------------------------------------------------------------------
Y589_MYCPN/14-134--------------------------------------------------------------------------------
Y591_MYCPN/171-291--------------------------------------------------------------------------------
Y586_MYCPN/154-286--------------------------------------------------------------------------------
Q8QVE1_9FLAV/1495-1635--------------------------------------------------------------------------------
Q6A4R3_AEDAL/768-912--------------------------------------------------------------------------------
Q80DQ3_9FLAV/1484-1633--------------------------------------------------------------------------------
Q8JJZ3_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9JAD5_9FLAV/1479-1630--------------------------------------------------------------------------------
Q9J9C2_9FLAV/1482-1633--------------------------------------------------------------------------------
Q8QL64_9FLAV/1478-1629--------------------------------------------------------------------------------
POLG_YEFVE/1501-1655--------------------------------------------------------------------------------
Q32ZD3_9FLAV/1496-1649--------------------------------------------------------------------------------
Q32ZD9_9FLAV/1506-1659--------------------------------------------------------------------------------
Q7T918_9FLAV/1515-1668--------------------------------------------------------------------------------
Q32ZD6_9FLAV/1505-1657--------------------------------------------------------------------------------
Q32ZD8_9FLAV/1507-1659--------------------------------------------------------------------------------
Q32ZE1_9FLAV/1514-1666--------------------------------------------------------------------------------
Q32ZE0_9FLAV/1519-1670--------------------------------------------------------------------------------

PF02907

POLG_HCVJL/1060-1208--------------------------------------------------------------------------------
POLG_HCVNZ/1062-1210--------------------------------------------------------------------------------
POLG_HCVEV/1057-1205--------------------------------------------------------------------------------
O56074_9FLAV/1007-1154--------------------------------------------------------------------------------
Q96898_9FLAV/992-1139--------------------------------------------------------------------------------
Q9WM98_9FLAV/924-1071--------------------------------------------------------------------------------
POLG_GBVB/970-1118--------------------------------------------------------------------------------
Q9Q9A7_9HEPC/1060-1208--------------------------------------------------------------------------------
Q9QIX6_9HEPC/1056-1204--------------------------------------------------------------------------------

PF10459

B4SLK2_STRM5/22-718------------------------------------------ANLTGDP.....MGAVVA.LGGCTASFVSPQGLVVTNH
A1SA55_SHEAM/18-726------------------------------------------ADLSRYP.....MNAVVG.LGYCTASFVSPQGLAVTNH
A3J218_9FLAO/21-713------------------------------------------YSINNHS....LKDAIVQFNGGCTAEMISKDGLVLTNH
A3J4B3_9FLAO/17-708------------------------------------------YSVNHSS....LKDAVPHFDGGCTAEMISPKGLLLTNH
E0THX8_PARBH/23-721------------------------------------------TDLTGFP.....MGAVIS.LGGCTASFVSDEGLVVTNH
A3WDJ5_9SPHN/23-720------------------------------------------TDLTGFP.....MGAVVS.LGGCSASFVSPEGLVVTNH
F2GAE2_ALTMD/22-719------------------------------------------NNLTAFP.....MGAIVS.LGGCSASFVSDKGLAVTNH
A4C924_9GAMM/18-739------------------------------------------AQLDQYP.....LNAVVG.LGYCSASFVSPQGLVVTNH
A4CBH4_9GAMM/20-717------------------------------------------SKLTEFP.....MNAVIS.LGGCTASFVSPQGLVVTNH
A5FMW8_FLAJ1/19-712------------------------------------------YSINHHS....LKDAIVQFNGGCTAEIVSKEGLVLTNH
B8E9P0_SHEB2/18-729------------------------------------------ADLTSYP.....MNAVVG.LGYCTASFVSPQGLVVTNH
A5PEK4_9SPHN/21-716------------------------------------------SDLTGFP.....MGAIVS.LGGCSASFVSPEGLVVTNH
A5ZH65_9BACE/21-717------------------------------------------YNPNGVS....LKDAVGIFGGGCTGEIISPEGLILTNH
A6E8C7_9SPHI/24-720------------------------------------------YNPNGIS....LVDALVN.VGGCTGSFVSNSGLIITNH
A6EQ24_9BACT/17-690------------------------------------------YDVNNSS....LKDAIGHFNGGCTSEVISPKGLLLTNH
A6ERE5_9BACT/20-712------------------------------------------YSINNQS....LKDAIVQFNGGCTASIVSESGLVLTNH
A6GH08_9DELT/30-733------------------------------------------WRDAGTESDGGLMRASVW.LGGCSAAFISSDGLVATNH
A6GI93_9DELT/51-752------------------------------------------TQPTEFP.....LGAIVS.LGGCSASFVSNEGLIITNH
A6GWM2_FLAPJ/17-707------------------------------------------YSVNHSS....LKDAVPHFNGGCTSEVISPKGLILTNH
A6KZW8_BACV8/17-706------------------------------------------YNPGGKA....LANAVVSFGGFCSGVVVSPDGLVFTNH
A6L2J7_BACV8/19-726------------------------------------------YCPDSIS....LKDAVVHFGGGCTGEIISAEGLVLTNH
A6L2J8_BACV8/21-719------------------------------------------YNPNRVS....LKDAVGIFGGGCTGEIISPDGLILTNH
A6LID5_PARD8/19-717------------------------------------------YSAEAPS....LKDAVVRFGGGCTGEMISPDGLVLTNH
A6WS02_SHEB8/18-716------------------------------------------SKLTEFP.....MNAVIS.LGGCTASFVSPKGLVVTNH
A7AAA4_9PORP/22-711------------------------------------------YSETDPC....VANAVVIFGGGCSGITVSNEGLIFTNH
A7AHP4_9PORP/19-717------------------------------------------YSPDSAS....LKDAVVIFGGGCTGEIVSPEGLLLTNH
A7HA06_ANADF/20-725------------------------------------------ADLTGQP.....MGAIVS.LGGCSASFVSPDGLVATNH
A7HFU9_ANADF/37-699------------------------------------------ENARLSS.........ARLAGGCSASFVSEDGLVMTNH
A7V0H7_BACUN/20-709------------------------------------------YNTKRPS....LKDAVVSFGGFCSGVVVSGDGLVFTNH
A7V1I5_BACUN/23-719------------------------------------------YNPNGVS....LKDAVGIFGGGCTGEIISPEGLILTNH
A8FR99_SHESH/24-737------------------------------------------ADLTQYP.....MNAVVG.LGYCTASFVSPQGLVVTNH
Q024G1_SOLUE/22-694------------------------------------------WDPARGT...GLLAATIS.TGGCSAGFVTSTGLFLTNH
Q027J4_SOLUE/18-549------------------------------------------NHLGLAT.........VR.IGGGTGAFVSPNGLILTNY
Q029T1_SOLUE/24-727------------------------------------------ADLSGQP.....MGAIVS.LGGCTASFVSPDGLIVTNH
Q02D16_SOLUE/31-664------------------------------------------DHLRLSS.........VK.IGAGSGAFVSPTGLLLTTR
Q07XT1_SHEFN/18-727------------------------------------------ADLGQYP.....MNAVVS.LGYCTASFVSPQGLVVTNH
Q08V25_STIAD/73-737------------------------------------------DKVRLSS.........ARIAGGCSASFVSANGLVMTNH
Q08VC9_STIAD/18-714------------------------------------------WDPKRGT...GLLAGTVN.VGGCSGAFISSSGLVITNH
Q11SC7_CYTH3/21-702------------------------------------------YSVNNSS....LKDAVVNFGNFCTGEIISQDGLILTNH
Q12RW4_SHEDO/18-728------------------------------------------ADLSQYP.....MNAVVS.LGYCTASFVSPQGLVVTNH
Q1D5W7_MYXXD/35-700------------------------------------------DNVRLSS.........ARLAGGCSASFVSANGLVMTNH
Q1D9F6_MYXXD/17-714------------------------------------------WDPKRGT...GLLAGAVN.VGGCSGAFIAASGLVITNH
Q1DDZ2_MYXXD/18-682------------------------------------------DHVRLGS.........VRLAGGCSASFVSPEGLVMTNH
Q1GVV7_SPHAL/23-684------------------------------------------DHTRAAA.........VRLTGGCSASFVSNEGLILTNH
Q1IPC2_KORVE/27-692------------------------------------------DHLRLSS.........SR.APGGSSEFVSPDGLLMTNH
Q1NG15_9SPHN/26-683------------------------------------------DHVRKSA.........VRLTGGCSASFVSDAGLILTNH
Q2G546_NOVAD/56-713------------------------------------------DRVQAAA.........VRLTGGCSASFVSPDGLILTNH
Q2IEV3_ANADE/18-687------------------------------------------DRARLAS.........ARLARGCSASFVSDGGLVMTNH
Q2NZP5_XANOM/22-715------------------------------------------ADLTGDP.....MGAVVS.LGGCTASFVSPQGLVVTNH
Q2S133_SALRD/5-639------------------------------------------AHLRRSV.........LR.LPGCTGALVSADGLALTTA
Q2S134_SALRD/69-734------------------------------------------TKARRGA.........LRFGSGCSASFVSSRGLVMTNH
Q3REP2_XYLFA/22-714------------------------------------------SNLTGDP.....MGAVVS.LGNCTASLVSPEGLVITNH
Q488S2_COLP3/26-729------------------------------------------TDLTGFP.....MGAIVS.LGGCTASFVSDQGLVATNH
Q5LIW7_BACFN/34-723------------------------------------------YSTRHPS....LKDAVVSFGGFCSGVVVSEDGLVFTNH
Q5QV86_IDILO/17-717------------------------------------------SKLTEFP.....AAAIVS.LGGCSASFVSPEGLVATNH
Q64RG4_BACFR/19-718------------------------------------------YNPDGIA....LKDAVVHFGGGCTGEIISAEGLVLTNH
Q7MV25_PORGI/21-718------------------------------------------YNPNGTS....LKDAVVLFDGGCTGEVVSDRGLVLTNH
Q7MWU6_PORGI/24-711------------------------------------------YSFDKPS....IANAVVIFGGGCTGITVSDQGLIFTNH
Q7NHA9_GLOVI/34-698------------------------------------------ERVRLAS.........LRLAGGCSGSFVSPNGLVMTNH
Q7UKL5_RHOBA/28-688------------------------------------------KHLQLSS.........VRFNSGGSGSFVSSNGLVLTNH
Q8A2L6_BACTN/20-711------------------------------------------YNPKKPA....LANAVVSFGGFCSGVVVSEDGLVFTNH

PF00548

Q8JJT0_PSV13/1680-1844-------------------------------------------------------------AK--SIMRS-------NLC
POLG_HRV8A/1522-1687-------------------------------------------------------------GR--SLLKH-------NCC
POLG_EC01F/1540-1705-------------------------------------------------------------AV--AMMKR-------NAS
POLG_HRV14/1538-1702-------------------------------------------------------------AL--SLLRK-------NIM
POLG_BOVEV/1532-1697-------------------------------------------------------------GV--SLLKK-------NIR
POLG_CX16G/1549-1714-------------------------------------------------------------AL--SLLRR-------NIR
POLG_HE701/1555-1720-------------------------------------------------------------AQ--AIMRK-------NTV
POLG_PEV9U/1525-1690-------------------------------------------------------------GV--GMMKK-------NIV
Q04107_HRV1A/162-327-------------------------------------------------------------GR--SILKN-------NTC
Q6TGL9_9ENTO/1563-1728-------------------------------------------------------------AV--AMAKI-------NIV
Q66776_ERBV1/1905-2095-------------------------------------------------------------NS--LSLLN-------NVV
Q6TPI6_9PICO/1649-1833-------------------------------------------------------------.Q--KMVMG-------NTK
Q7T7N7_9ENTO/1563-1728-------------------------------------------------------------AV--AMAKK-------NIL
Q8B552_9PICO/1782-1946-------------------------------------------------------------AK--SLMKS-------SLF
POLG_TMEVG/1636-1816-------------------------------------------------------------EL--FCAKN-------MVS
POL1_BBWVS/957-1123-------------------------------------------------------------GR--SFLGV-------NHF
POLG_HPE2W/1517-1692-------------------------------------------------------------LE--HIISQ-------MAY
Q80N16_9PICO/1589-1765-------------------------------------------------------------LE--HCFAQ-------TAY
Q9IM09_9ENTO/1556-1721-------------------------------------------------------------SI--SLLRH-------NIR
O39818_9PICO/1580-1761-------------------------------------------------------------.Q--QSIMK-------NVQ

PF00863

POLG_PEMVM/2056-2290-------------------------------------------------------------NY--NPIAT.......SIC
Q98WK5_PRSVW/2281-2513-------------------------------------------------------------NY--NGIAS.......VVC
Q98810_9POTV/196-430-------------------------------------------------------------DY--NPIAT.......AIC
Q7T915_9POTV/2040-2274-------------------------------------------------------------DY--NGIST.......IVC
Q89255_9POTY/427-646-------------------------------------------------------------VG--VDVAN.......RVG
Q82933_9POTV/1990-2223-------------------------------------------------------------NY--NPISD.......NIC
Q9YZN8_9POTV/2078-2312-------------------------------------------------------------DY--NPISN.......NIC
Q8QXL0_9POTV/1962-2196-------------------------------------------------------------DY--NPIAS.......NIC
O10243_CYVV/709-943-------------------------------------------------------------DY--NPISQ.......NVC
Q8QXN3_9POTV/1986-2220-------------------------------------------------------------DY--TPISQ.......QLC
POL1_BAYMJ/1361-1581-------------------------------------------------------------VG--VDVAT.......RVG
POLG_PPVNA/2048-2282-------------------------------------------------------------DY--NPIAS.......SIC
Q8QV60_9POTV/2016-2250-------------------------------------------------------------DY--SGIST.......LIC
POLG_LMV0/2213-2447-------------------------------------------------------------DY--NPIAS.......AIC
Q8UZ37_9POTV/2108-2341-------------------------------------------------------------DY--NPVAA.......CVC
POLG_SPMMV/2424-2646-------------------------------------------------------------..--.HIAS.......RLA
O89525_9POTY/1998-2231-------------------------------------------------------------DY--HPVSS.......NLC
Q7T4I3_TUMVJ/2115-2349-------------------------------------------------------------DY--NPISN.......NIC
Q8QQA0_9POTV/2042-2276-------------------------------------------------------------CY--DPIAK.......NIC
Q8QY00_9POTV/2175-2409-------------------------------------------------------------DY--NGISS.......LVC
Q9WAA3_9POTY/1259-1474-------------------------------------------------------------..--KPMSSFTIDSAKMVG
O39734_9POTV/2413-2647-------------------------------------------------------------DY--NPIAS.......VIC
Q65883_BYMV/335-569-------------------------------------------------------------DY--NPIAS.......NVC
Q9E160_9POTY/1951-2181-------------------------------------------------------------SL--DHIHQ.......NQV
Q7T7N5_9POTV/2211-2445-------------------------------------------------------------DY--NGVAS.......AIC
Q8QXL1_9POTV/1986-2220-------------------------------------------------------------DY--TPISN.......QLC
POLG_OMV/121-355-------------------------------------------------------------DY--NVVSN.......VVC
Q9QBT4_PVMA/2030-2264-------------------------------------------------------------DY--NPISS.......VIC
Q80MX2_9POTY/190-375-------------------------------------------------------------..--..IMN.......MIG
Q80P26_9POTV/2027-2261-------------------------------------------------------------DY--NPIAQ.......TIC
Q8UZ27_9POTY/1335-1554-------------------------------------------------------------VG--IDVAK.......NVG
Q9WID3_9POTV/2038-2271-------------------------------------------------------------DH--NQVSK.......LIC
Q88507_TEV/2036-2269-------------------------------------------------------------DY--NPISS.......AIC
Q7T5A6_9POTV/2385-2619-------------------------------------------------------------NY--NAISS.......VIC
Q912R2_9POTV/2117-2351-------------------------------------------------------------DY--NSTAT.......IVC
Q9YNB1_9POTY/405-628-------------------------------------------------------------DI--SHVEK.......NVG
Q9QBG1_9POTY/1362-1581-------------------------------------------------------------VS--VDVAT.......RIG
Q88925_TVMV/2000-2232-------------------------------------------------------------DF--NPISA.......CVC
O73463_MDMV/1986-2220-------------------------------------------------------------DY--TPIAN.......QIG

PF12381

Q6EEL1_9SECO/2617-2847-------------------------------------------------------------TILTDKLIN-------ISA
O11979_9SECO/2603-2833-------------------------------------------------------------SILSNQLTK-------ISC
Q1MNG4_9SECO/2627-2857-------------------------------------------------------------NLIDTHMAG-------MSC

PF12380

B3U1H5_YHV/2834-3117-------------------------------------------------------------KHPYNKYRS-------NIV
Q9IHZ8_GAVAU/2823-3106-------------------------------------------------------------KHPYNKYRK-------NIV

PF13365

DEG15_ARATH/376-594--------------------------------------------------------------------------------
C9Z823_STRSW/62-228--------------------------------------------------------------------------------
C9ZGQ1_STRSW/72-240--------------------------------------------------------------------------------
Q93JK9_STRCO/54-222--------------------------------------------------------------------------------
C7QED1_CATAD/56-225--------------------------------------------------------------------------------
B8M3P5_TALSN/58-198--------------------------------------------------------------------------------
YH05_SCHPO/99-245--------------------------------------------------------------------------------
C1EGI7_MICSR/60-206--------------------------------------------------------------------------------
A9RQ61_PHYPA/48-194--------------------------------------------------------------------------------
D0MZM5_PHYIT/91-230--------------------------------------------------------------------------------
NM111_PICGU/100-246--------------------------------------------------------------------------------
A9GTT3_SORC5/149-297--------------------------------------------------------------------------------
A9ERE8_SORC5/153-297--------------------------------------------------------------------------------
B2J8D1_NOSP7/164-308--------------------------------------------------------------------------------
Q2P9Y4_9ACTO/162-308--------------------------------------------------------------------------------
B6QXD8_9RHOB/76-232--------------------------------------------------------------------------------
Q9RTZ8_DEIRA/130-275--------------------------------------------------------------------------------
C3HBL0_BACTU/109-260--------------------------------------------------------------------------------
D2R623_PIRSD/145-303--------------------------------------------------------------------------------
E3IWP0_FRASU/134-282--------------------------------------------------------------------------------
D0LEN3_GORB4/141-289--------------------------------------------------------------------------------
D2BAE5_STRRD/123-274--------------------------------------------------------------------------------
Q2RS04_RHORT/145-306--------------------------------------------------------------------------------
Q467S2_METBF/103-254--------------------------------------------------------------------------------
Y4FB_RHISN/90-251--------------------------------------------------------------------------------
A3VZZ0_9RHOB/114-264--------------------------------------------------------------------------------
B6R9Y4_9RHOB/91-243--------------------------------------------------------------------------------
D3CTM8_9ACTO/100-254--------------------------------------------------------------------------------
B8END1_METSB/102-257--------------------------------------------------------------------------------
D4GHS4_PANAM/109-260--------------------------------------------------------------------------------
D3QBE9_STANL/212-368--------------------------------------------------------------------------------
D3PTY7_STANL/202-361--------------------------------------------------------------------------------
D0N2P9_PHYIT/200-360--------------------------------------------------------------------------------
Q846R2_MYXXA/58-225--------------------------------------------------------------------------------
C6X4V5_FLAB3/104-266--------------------------------------------------------------------------------
B8ICT9_METNO/161-326--------------------------------------------------------------------------------
Q1DE46_MYXXD/139-306--------------------------------------------------------------------------------
B4VV96_9CYAN/140-327--------------------------------------------------------------------------------
D2R618_PIRSD/120-277--------------------------------------------------------------------------------
A8FZT0_SHESH/365-519--------------------------------------------------------------------------------
B9M1H9_GEOSF/322-480--------------------------------------------------------------------------------
B1XYW2_LEPCP/349-527--------------------------------------------------------------------------------
C3Y7C8_BRAFL/939-1107--------------------------------------------------------------------------------
C3YHU1_BRAFL/637-805--------------------------------------------------------------------------------
C3Y9V9_BRAFL/396-567--------------------------------------------------------------------------------
F111B_HUMAN/475-664--------------------------------------------------------------------------------
D4A8N0_RAT/367-556--------------------------------------------------------------------------------
B4VT06_9CYAN/299-436--------------------------------------------------------------------------------
B8H010_CAUCN/64-248--------------------------------------------------------------------------------
C7PQU4_CHIPD/127-299--------------------------------------------------------------------------------
A3JWZ9_9RHOB/120-292--------------------------------------------------------------------------------
Q211I3_RHOPB/126-305--------------------------------------------------------------------------------
D2R1J4_PIRSD/67-236--------------------------------------------------------------------------------
D2R620_PIRSD/144-326--------------------------------------------------------------------------------
C6JD09_9FIRM/162-306--------------------------------------------------------------------------------
C0CMS9_9FIRM/152-296--------------------------------------------------------------------------------
D4LWF1_9FIRM/167-311--------------------------------------------------------------------------------
C4ZI06_EUBR3/149-289--------------------------------------------------------------------------------
C0FTN1_9FIRM/149-293--------------------------------------------------------------------------------
C9L519_RUMHA/148-292--------------------------------------------------------------------------------
D4M0U9_9FIRM/159-303--------------------------------------------------------------------------------
B5CQ59_9FIRM/147-291--------------------------------------------------------------------------------
A5KN66_9FIRM/147-291--------------------------------------------------------------------------------
B6FP33_9CLOT/144-288--------------------------------------------------------------------------------
A7B169_RUMGN/176-320--------------------------------------------------------------------------------
B0NI56_EUBSP/167-311--------------------------------------------------------------------------------
C0B801_9FIRM/151-295--------------------------------------------------------------------------------
B0G1M9_9FIRM/149-293--------------------------------------------------------------------------------
C4Z416_EUBE2/141-284--------------------------------------------------------------------------------
B7AVI8_9FIRM/172-316--------------------------------------------------------------------------------
C5ELW4_9FIRM/172-316--------------------------------------------------------------------------------
C4G4N6_ABIDE/156-298--------------------------------------------------------------------------------
C1IAW0_9CLOT/114-253--------------------------------------------------------------------------------
B8AM75_ORYSI/89-258--------------------------------------------------------------------------------
B5JQS5_9BACT/61-197--------------------------------------------------------------------------------
B3DXV6_METI4/79-214--------------------------------------------------------------------------------
C5YNZ0_SORBI/297-442--------------------------------------------------------------------------------
C5YX14_SORBI/284-426--------------------------------------------------------------------------------
Q0JIU9_ORYSJ/149-291--------------------------------------------------------------------------------
B9G3S8_ORYSJ/109-256--------------------------------------------------------------------------------
C5WUT6_SORBI/430-572--------------------------------------------------------------------------------
C5XIJ1_SORBI/75-220--------------------------------------------------------------------------------
B9S6M7_RICCO/99-269--------------------------------------------------------------------------------
Q6ATB3_ORYSJ/64-208--------------------------------------------------------------------------------
C5Y9X9_SORBI/128-269--------------------------------------------------------------------------------
B9FMK5_ORYSJ/181-321--------------------------------------------------------------------------------
Q7EYD8_ORYSJ/206-349--------------------------------------------------------------------------------
B2IZX6_NOSP7/35-159--------------------------------------------------------------------------------
Q01SP4_SOLUE/26-150--------------------------------------------------------------------------------
A7NIM6_ROSCS/38-173--------------------------------------------------------------------------------
D1CHW8_THET1/35-167--------------------------------------------------------------------------------
Q0RIR2_FRAAA/55-221--------------------------------------------------------------------------------
A2SLK2_METPP/110-244--------------------------------------------------------------------------------
B1ZW96_OPITP/85-238--------------------------------------------------------------------------------
A2SLB0_METPP/51-178--------------------------------------------------------------------------------
C6XBL7_METSD/51-179--------------------------------------------------------------------------------
B9TFS6_RICCO/49-177--------------------------------------------------------------------------------
C6WXC4_METML/54-182--------------------------------------------------------------------------------
B6BWJ8_9PROT/54-182--------------------------------------------------------------------------------
B9TJ43_RICCO/62-190--------------------------------------------------------------------------------
B6BVZ4_9PROT/47-175--------------------------------------------------------------------------------
C6XD83_METSD/47-175--------------------------------------------------------------------------------
C6WVZ4_METML/47-174--------------------------------------------------------------------------------
Q2W2I3_MAGSA/355-483--------------------------------------------------------------------------------
C6BGJ0_RALP1/55-184--------------------------------------------------------------------------------
B3QPC6_CHLP8/57-184--------------------------------------------------------------------------------
Q0YS38_9CHLB/89-216--------------------------------------------------------------------------------
Q3B4M2_PELLD/76-203--------------------------------------------------------------------------------
C7RR92_ACCPU/56-182--------------------------------------------------------------------------------
C7RR91_ACCPU/52-180--------------------------------------------------------------------------------
Q1IY94_DEIGD/67-198--------------------------------------------------------------------------------
B8BSP4_THAPS/582-769--------------------------------------------------------------------------------
Q3M8K4_ANAVT/33-168--------------------------------------------------------------------------------
D5WKU5_BURSC/40-175--------------------------------------------------------------------------------
Q7NEY6_GLOVI/37-172--------------------------------------------------------------------------------
Q01SP5_SOLUE/107-240--------------------------------------------------------------------------------
Q98IG3_RHILO/78-212--------------------------------------------------------------------------------
B0U7I8_METS4/36-169--------------------------------------------------------------------------------
Q89E13_BRAJA/35-167--------------------------------------------------------------------------------
A7H8S6_ANADF/35-169--------------------------------------------------------------------------------
B4UF27_ANASK/45-180--------------------------------------------------------------------------------
D1CHW7_THET1/37-171--------------------------------------------------------------------------------
D1C9X4_SPHTD/41-176--------------------------------------------------------------------------------
Q1DFJ7_MYXXD/51-186--------------------------------------------------------------------------------
B4WI21_9SYNE/33-173--------------------------------------------------------------------------------
D2R6U2_PIRSD/68-213--------------------------------------------------------------------------------
D5SYB2_PLAL2/75-226--------------------------------------------------------------------------------
A6C5I0_9PLAN/58-206--------------------------------------------------------------------------------
Q7UNU5_RHOBA/96-240--------------------------------------------------------------------------------
A4A0T0_9PLAN/66-211--------------------------------------------------------------------------------
A9F4P7_SORC5/37-166--------------------------------------------------------------------------------
A9FFZ4_SORC5/137-265--------------------------------------------------------------------------------
B6B9E4_9RHOB/398-528--------------------------------------------------------------------------------
D0D6Q7_9RHOB/389-519--------------------------------------------------------------------------------
Q9Z529_STRCO/60-203--------------------------------------------------------------------------------
A4A0S9_9PLAN/71-202--------------------------------------------------------------------------------
D5SYB3_PLAL2/92-222--------------------------------------------------------------------------------
D2R6U3_PIRSD/90-221--------------------------------------------------------------------------------
Q7UNU4_RHOBA/89-223--------------------------------------------------------------------------------
Q67SY9_SYMTH/37-178--------------------------------------------------------------------------------
D2Q0V1_KRIFD/123-243--------------------------------------------------------------------------------
B0T7U9_CAUSK/55-188--------------------------------------------------------------------------------
A9VXT6_METEP/54-187--------------------------------------------------------------------------------
B9JA65_AGRRK/33-164--------------------------------------------------------------------------------
D3NU60_AZOS1/54-191--------------------------------------------------------------------------------
A8TSL0_9PROT/61-191--------------------------------------------------------------------------------
Q126C2_POLSJ/74-216--------------------------------------------------------------------------------
A2SEV1_METPP/84-217--------------------------------------------------------------------------------
D0RMV8_9PROT/62-194--------------------------------------------------------------------------------
D1CC35_THET1/99-237--------------------------------------------------------------------------------
B3S5U4_TRIAD/329-491--------------------------------------------------------------------------------
B4UTS4_BP163/66-193--------------------------------------------------------------------------------
Q11LS4_MESSB/40-170--------------------------------------------------------------------------------
C4RAG7_9PROT/100-239--------------------------------------------------------------------------------
C5JAK2_9BACT/101-240--------------------------------------------------------------------------------
C5JBN6_9BACT/99-238--------------------------------------------------------------------------------
A0L9W3_MAGSM/126-265--------------------------------------------------------------------------------
D0LGQ1_HALO1/668-816--------------------------------------------------------------------------------
Q08Z65_STIAD/79-228--------------------------------------------------------------------------------
Q2II41_ANADE/64-213--------------------------------------------------------------------------------
C1N754_MICPC/393-574--------------------------------------------------------------------------------
C1EFA7_MICSR/414-629--------------------------------------------------------------------------------
B9H2S3_POPTR/409-631--------------------------------------------------------------------------------
A5BEH1_VITVI/502-717--------------------------------------------------------------------------------
Q0PY37_SOLLC/412-632--------------------------------------------------------------------------------
A9TAV2_PHYPA/699-919--------------------------------------------------------------------------------
C0PL31_MAIZE/403-612--------------------------------------------------------------------------------
Q00YL5_OSTTA/68-221--------------------------------------------------------------------------------
A4S513_OSTLU/76-226--------------------------------------------------------------------------------
C1N5V8_MICPC/175-398--------------------------------------------------------------------------------
A8I3D5_CHLRE/134-313--------------------------------------------------------------------------------
A4S4E4_OSTLU/26-173--------------------------------------------------------------------------------
A1VVN7_POLNA/138-318--------------------------------------------------------------------------------
Q08MN7_STIAD/50-171--------------------------------------------------------------------------------
Q2YD45_NITMU/56-221--------------------------------------------------------------------------------
D2QY05_PIRSD/202-373--------------------------------------------------------------------------------
A9ZKZ5_COXBE/58-186--------------------------------------------------------------------------------
A5E551_LODEL/303-457--------------------------------------------------------------------------------
A3LV17_PICST/282-443--------------------------------------------------------------------------------
Q6BLK4_DEBHA/295-454--------------------------------------------------------------------------------
A5DCA5_PICGU/274-427--------------------------------------------------------------------------------
D0N1Z1_PHYIT/130-271--------------------------------------------------------------------------------
D5SQ02_PLAL2/103-278--------------------------------------------------------------------------------
C1MYV6_MICPC/213-422--------------------------------------------------------------------------------
A1DKZ3_NEOFI/106-274--------------------------------------------------------------------------------
C9SS84_VERA1/110-286--------------------------------------------------------------------------------
B2ACI3_PODAN/114-282--------------------------------------------------------------------------------
A4YLF4_BRASO/29-179--------------------------------------------------------------------------------
B4VWK9_9CYAN/26-185--------------------------------------------------------------------------------
Q7URA6_RHOBA/240-384--------------------------------------------------------------------------------
D2R0U2_PIRSD/218-358--------------------------------------------------------------------------------
A3ZSU8_9PLAN/169-309--------------------------------------------------------------------------------
A6CCJ8_9PLAN/216-356--------------------------------------------------------------------------------
B5W7L6_SPIMA/53-196--------------------------------------------------------------------------------
B0JV48_MICAN/59-215--------------------------------------------------------------------------------
A0ZIJ6_NODSP/50-187--------------------------------------------------------------------------------
B0C7H5_ACAM1/295-465--------------------------------------------------------------------------------
A0YM55_LYNSP/62-208--------------------------------------------------------------------------------
Q060L2_9SYNE/66-212--------------------------------------------------------------------------------
A2CDP2_PROM3/91-233--------------------------------------------------------------------------------
B0C4I5_ACAM1/51-195--------------------------------------------------------------------------------
Q113N3_TRIEI/93-237--------------------------------------------------------------------------------
A8YFS3_MICAE/52-220--------------------------------------------------------------------------------
B4VKH5_9CYAN/399-535--------------------------------------------------------------------------------
B0C7H5_ACAM1/63-201--------------------------------------------------------------------------------
Q4C9U0_CROWT/64-213--------------------------------------------------------------------------------
E0U9M4_CYAP2/69-211--------------------------------------------------------------------------------
B7KH20_CYAP7/52-196--------------------------------------------------------------------------------
Q92JT1_RHIME/45-189--------------------------------------------------------------------------------
B8HSI3_CYAP4/55-201--------------------------------------------------------------------------------
B6BL05_9PROT/72-191--------------------------------------------------------------------------------
D3B2A3_POLPA/90-296--------------------------------------------------------------------------------
B7FUE8_PHATC/1283-1490--------------------------------------------------------------------------------
C2FHG0_LACPA/165-321--------------------------------------------------------------------------------
B0EDS2_ENTDS/219-353--------------------------------------------------------------------------------
B3QZR5_PHYMT/297-472--------------------------------------------------------------------------------
B9IN99_POPTR/16-159--------------------------------------------------------------------------------
D1W398_9BACT/21-163--------------------------------------------------------------------------------
Q7MW22_PORGI/27-170--------------------------------------------------------------------------------
A6L245_BACV8/25-170--------------------------------------------------------------------------------
Q84SQ1_ORYSJ/91-253--------------------------------------------------------------------------------
A8YNP5_MICAE/435-587--------------------------------------------------------------------------------
B8BM04_ORYSI/29-174--------------------------------------------------------------------------------
A3WZP2_9BRAD/25-182--------------------------------------------------------------------------------
B6SLW3_MAIZE/46-198--------------------------------------------------------------------------------
B4W048_9CYAN/24-160--------------------------------------------------------------------------------
B7KID8_CYAP7/23-153--------------------------------------------------------------------------------
Q10YA2_TRIEI/28-156--------------------------------------------------------------------------------
C4RBC6_9ACTO/39-187--------------------------------------------------------------------------------
B5HRW8_9ACTO/52-200--------------------------------------------------------------------------------
B4VL88_9CYAN/23-161--------------------------------------------------------------------------------
Q10V37_TRIEI/25-170--------------------------------------------------------------------------------
B0JTN4_MICAN/27-184--------------------------------------------------------------------------------
B8HMX0_CYAP4/25-181--------------------------------------------------------------------------------
A8ZQB3_ACAM1/33-191--------------------------------------------------------------------------------
A3XNG0_LEEBM/39-192--------------------------------------------------------------------------------
D4N037_9FIRM/379-516--------------------------------------------------------------------------------
D1W141_9BACT/221-392--------------------------------------------------------------------------------
Q72KS5_THET2/61-193--------------------------------------------------------------------------------
B7A6E3_THEAQ/62-195--------------------------------------------------------------------------------
D3PR00_MEIRD/62-196--------------------------------------------------------------------------------
B4D8F4_9BACT/72-317--------------------------------------------------------------------------------
B3PHV0_CELJU/204-337--------------------------------------------------------------------------------
A7BUM9_9GAMM/28-164--------------------------------------------------------------------------------
C7PQR9_CHIPD/410-553--------------------------------------------------------------------------------
Q75HK9_ORYSJ/40-213--------------------------------------------------------------------------------
A0CQA0_PARTE/272-415--------------------------------------------------------------------------------
Q7Q9T3_ANOGA/284-425--------------------------------------------------------------------------------
B3NQY9_DROER/305-445--------------------------------------------------------------------------------
D2QDD9_SPILD/31-236--------------------------------------------------------------------------------
A9VAG6_MONBE/28-203--------------------------------------------------------------------------------
A3SCU7_9RHOB/196-330--------------------------------------------------------------------------------
A0LWM1_ACIC1/250-384--------------------------------------------------------------------------------
A9AU45_BURM1/75-243--------------------------------------------------------------------------------
B8EPM5_METSB/283-415--------------------------------------------------------------------------------
B4D163_9BACT/76-206--------------------------------------------------------------------------------
B4CWZ6_9BACT/327-458--------------------------------------------------------------------------------
B4CWZ7_9BACT/330-461--------------------------------------------------------------------------------
B4D4S9_9BACT/50-179--------------------------------------------------------------------------------
C0AF95_9BACT/54-190--------------------------------------------------------------------------------
B9YD37_9FIRM/27-200--------------------------------------------------------------------------------
B2ULX5_AKKM8/77-314--------------------------------------------------------------------------------
Q1GZ24_METFK/25-167--------------------------------------------------------------------------------
Q0AUX9_SYNWW/105-235--------------------------------------------------------------------------------
Q1PY07_9BACT/57-189--------------------------------------------------------------------------------
C3QH30_9BACE/51-184--------------------------------------------------------------------------------
A5ZI03_9BACE/49-181--------------------------------------------------------------------------------
B5CVV9_9BACE/52-183--------------------------------------------------------------------------------
A6LC71_PARD8/50-181--------------------------------------------------------------------------------
B0CAU9_ACAM1/85-242--------------------------------------------------------------------------------
D5ST85_PLAL2/188-324--------------------------------------------------------------------------------
A4YVG9_BRASO/68-206--------------------------------------------------------------------------------
A2SCU5_METPP/86-236--------------------------------------------------------------------------------
Q08Q29_STIAD/85-219--------------------------------------------------------------------------------
C8N8L7_9GAMM/65-197--------------------------------------------------------------------------------
Q21G29_SACD2/103-235--------------------------------------------------------------------------------
C0DWH2_EIKCO/92-250--------------------------------------------------------------------------------
D1NAH5_9BACT/62-195--------------------------------------------------------------------------------
A8KF66_BURPE/83-236--------------------------------------------------------------------------------
Q82G14_STRAW/89-242--------------------------------------------------------------------------------
C0GIE8_9FIRM/109-240--------------------------------------------------------------------------------
A6CKL8_9BACI/105-229--------------------------------------------------------------------------------
D3FST1_BACPE/122-248--------------------------------------------------------------------------------
A4A524_9GAMM/61-225--------------------------------------------------------------------------------
A4BT63_9GAMM/57-219--------------------------------------------------------------------------------
A1WX57_HALHL/64-228--------------------------------------------------------------------------------
Q3SMJ5_THIDA/81-243--------------------------------------------------------------------------------
Q15WK4_PSEA6/58-219--------------------------------------------------------------------------------
D5UDV9_CELFN/76-207--------------------------------------------------------------------------------
C6AVQ8_RHILS/33-192--------------------------------------------------------------------------------
D2S688_GEOOG/217-353--------------------------------------------------------------------------------
D3QA66_STANL/219-357--------------------------------------------------------------------------------
D3LKZ9_MICLU/283-419--------------------------------------------------------------------------------
B4V9A1_9ACTO/51-211--------------------------------------------------------------------------------
B4CXG1_9BACT/84-257--------------------------------------------------------------------------------
Q1D137_MYXXD/39-183--------------------------------------------------------------------------------
D3W785_9VIRU/161-295--------------------------------------------------------------------------------
B4V7A8_9ACTO/24-181--------------------------------------------------------------------------------
Q15T30_PSEA6/50-191--------------------------------------------------------------------------------
C9BDM8_ENTFC/121-272--------------------------------------------------------------------------------
B8AXY3_ORYSI/1277-1457--------------------------------------------------------------------------------
C5Y9N3_SORBI/149-346--------------------------------------------------------------------------------
C5WUT2_SORBI/32-182--------------------------------------------------------------------------------
B9G3S5_ORYSJ/55-216--------------------------------------------------------------------------------
Q11A08_TRIEI/47-187--------------------------------------------------------------------------------
Q111L2_TRIEI/52-195--------------------------------------------------------------------------------
B7KEX9_CYAP7/49-192--------------------------------------------------------------------------------
B2XS89_9VIRU/586-711--------------------------------------------------------------------------------
NS1A_OASV1/438-558--------------------------------------------------------------------------------
NS1AB_HASV1/447-565--------------------------------------------------------------------------------
B3EEJ2_CHLL2/96-337--------------------------------------------------------------------------------
Q1D8L6_MYXXD/88-220--------------------------------------------------------------------------------
A8TZT7_9PROT/75-215--------------------------------------------------------------------------------
C6XKV2_HIRBI/68-210--------------------------------------------------------------------------------
Q0C5Y2_HYPNA/27-169--------------------------------------------------------------------------------
B0T391_CAUSK/70-212--------------------------------------------------------------------------------
A9F8J5_SORC5/19-173--------------------------------------------------------------------------------
Q3IXI9_RHOS4/47-206--------------------------------------------------------------------------------

PF00089

CFAI_HUMAN/340-569-----------------------------------------------------------------------L....PWQV
SP24D_ANOGA/50-264-----------------------------------------------------------------------F....PHQV
TRY5_AEDAE/40-260-----------------------------------------------------------------------V....PFQV
UROK_HUMAN/179-419-----------------------------------------------------------------------Q....PWFA
MASP1_MOUSE/454-696-----------------------------------------------------------------------M....PWIA
CTR1_ANOGA/33-250-----------------------------------------------------------------------A....PYQV
CFAD_HUMAN/26-248-----------------------------------------------------------------------R....PYMA
ACRO_RAT/43-286-----------------------------------------------------------------------W....PWMV
HPT_HUMAN/162-399-----------------------------------------------------------------------F....PWQA
CASP_MESAU/445-682-----------------------------------------------------------------------F....PWQV
SNAK_DROME/186-427-----------------------------------------------------------------------F....PHMA
PCE_TACTR/128-370-----------------------------------------------------------------------W....PWMT
STUB_DROME/544-782-----------------------------------------------------------------------W....PWQV
TRYU_DROME/28-254-----------------------------------------------------------------------T....KYVV
TRYI_DROME/28-245-----------------------------------------------------------------------A....PWQV
TRYB_MANSE/25-252-----------------------------------------------------------------------Y....PTIV
TRYP_FUSOX/25-244-----------------------------------------------------------------------F....PFIV
TRYP_STRGR/37-252-----------------------------------------------------------------------F....PFMV
TRY1_HUMAN/24-239-----------------------------------------------------------------------V....PYQV
TRYP_PIG/9-224-----------------------------------------------------------------------I....PYQV
TRY1_SALSA/21-235-----------------------------------------------------------------------Q....THQV
TRYP_PLEPL/23-242-----------------------------------------------------------------------R....PFMA
DEGP3_ARATH/99-287-----------------------------------------------------------------------F...QPWQI
DEGP2_ARATH/121-308-----------------------------------------------------------------------L....PWQK
DEGS_ECOLI/62-244-----------------------------------------------------------------------Q........
DEGS_HAEIN/37-240-----------------------------------------------------------------------S....PAVV
YYXA_BACSU/99-283-----------------------------------------------------------------------G......SG
DEGP_SALTY/97-278-----------------------------------------------------------------------Q......QK
Q44596_BRUAO/85-261-----------------------------------------------------------------------Q........
DEGPL_BRUSU/125-298-----------------------------------------------------------------------G........
O06439_RHOCA/59-235-----------------------------------------------------------------------D........
HHOA_SYNY3/95-274-----------------------------------------------------------------------R......RI
HTRA_SYNY3/156-334-----------------------------------------------------------------------R........
O42417_CHICK/87-286-----------------------------------------------------------------------V........
ETA_STAAU/70-274-----------------------------------------------------------------------Y....NTIG
ETB_STAAU/59-251-----------------------------------------------------------------------V...G..TV
SPLB_STAAU/37-234-----------------------------------------------------------------------I...FPYTG
SPLC_STAAU/38-233-----------------------------------------------------------------------F....PYNG
MPR_BACSU/95-311-----------------------------------------------------------------------STTSFPYRA
PRTC_STRGR/205-383-----------------------------------------------------------------------S...GRCSV
Q55353_STRSQ/198-372-----------------------------------------------------------------------G....RCSV
Q55352_STRSQ/202-378-----------------------------------------------------------------------G....RCSI
Q54395_STRLI/158-342-----------------------------------------------------------------------A....RCSL
SP1_RARFA/205-391-----------------------------------------------------------------------.....DYWG
CERC_SCHMA/28-256-----------------------------------------------------------------------E...FPFIA
Q54344_STRLI/47-254-----------------------------------------------------------------------H....AFTA
CFAB_HUMAN/481-752-----------------------------------------------------------------------K...QPWQA
PROZ_BOVIN/143-352-----------------------------------------------------------------------F....PWQV
CAC3_BOVIN/12-246-----------------------------------------------------------------------W....SWQV
CELA1_PIG/27-259-----------------------------------------------------------------------W....PSQI
CTRA_BOVIN/16-238-----------------------------------------------------------------------W....PWQV
CTRL_HALRU/24-251-----------------------------------------------------------------------F....PWQG
COGS_HYPLI/31-252-----------------------------------------------------------------------F....PYQA
CTRB1_LITVA/46-263-----------------------------------------------------------------------W....PHQA
CATG_MOUSE/21-238-----------------------------------------------------------------------Y....PYMA
MCPT2_RAT/21-239-----------------------------------------------------------------------R....PYMA
ELNE_HUMAN/30-242-----------------------------------------------------------------------W....PFMV
PRTN3_HUMAN/28-243-----------------------------------------------------------------------R....PYMA
GRAK_RAT/26-248-----------------------------------------------------------------------R....PFMA
GRAM_RAT/21-245-----------------------------------------------------------------------R....PYMV
KLK1_MOUSE/25-253-----------------------------------------------------------------------Q....PWQV
KLK2_RAT/25-251-----------------------------------------------------------------------Q....PWQV
VSPCA_AGKCO/1-217-----------------------------------------------------------------------H....RFLA
HGF_RAT/496-719-----------------------------------------------------------------------G.....WMV
ENTK_PIG/800-1029-----------------------------------------------------------------------W....PWVV
PRSS8_HUMAN/45-281-----------------------------------------------------------------------W....PWQV
HGFA_HUMAN/408-641-----------------------------------------------------------------------H....PWLA
TPA_HUMAN/311-556-----------------------------------------------------------------------H....PWQA
FA10_HUMAN/235-462-----------------------------------------------------------------------C....PWQA
THRB_BOVIN/367-616-----------------------------------------------------------------------S....PWQV
PROC_HUMAN/212-445-----------------------------------------------------------------------S....PWQV

PF09342

Q7QJ48_ANOGA/1759-1982-------------------------------------------------------------..........DDYDWPWNT
Q8WSJ2_BOMMO/1512-1777-------------------------------------------------------------..............CPWIA
NUDEL_DROME/2005-2298-------------------------------------------------------------LVNEQLHEAIEELHWPWLA

PF03761

Q9U2W2_CAEEL/6-282-------------------------------------------------------------ENEERLKSCGNTFLPIPSI
Q21628_CAEEL/5-298-------------------------------------------------------------EVANLRASCKNKTLPPNNQ
O45371_CAEEL/3-276-------------------------------------------------------------ENIQRLESCG.KILPEES.
O76649_CAEEL/2-297-------------------------------------------------------------ENQVLQSYCG.RTPFLQRR
A8XIB1_CAEBR/15-285-------------------------------------------------------------ENQSRLKSCGNFKLPQHSQ
A8WNY9_CAEBR/3-296-------------------------------------------------------------ENEQTQLICGKKADGYSRK
Q9XWZ8_CAEEL/4-272-------------------------------------------------------------ENDKRLETCGNEHIGKPSK
O62223_CAEEL/7-278-------------------------------------------------------------ENKERLNTCG.........
O62231_CAEEL/5-272-------------------------------------------------------------ENKDRASTCGKEVLERKG.

PF00944

POLS_AURAV/110-268--------------------------------------------------------------------------------
P89913_SINDV/109-267--------------------------------------------------------------------------------
POLS_BFV/98-255--------------------------------------------------------------------------------
POLS_EEEV/103-260--------------------------------------------------------------------------------
O41516_9VIRU/119-276--------------------------------------------------------------------------------

PF05579

RPOA_LDVC/1418-1713------------------------------------------------------------------------------IT
RPOA_PRRSL/1601-1897------------------------------------------------------------------------------LT
RPOA_LDVP/1420-1715------------------------------------------------------------------------------VT
RPOA_SHFV/1368-1665------------------------------------------------------------------------------LS
Q99AV6_PRRSV/1716-2013------------------------------------------------------------------------------LT
RPOA_EAVBU/963-1269------------------------------------------------------------------------------LA

PF00947

POLG_HE701/883-1009--------------------------------------------------------------------------------
POLG_POL1M/899-1025--------------------------------------------------------------------------------
POLG_PEV9U/854-980--------------------------------------------------------------------------------
POLG_CXB1J/867-993--------------------------------------------------------------------------------
POLG_HRV1B/873-998--------------------------------------------------------------------------------
POLG_BOVEV/859-985--------------------------------------------------------------------------------
POLG_CX16G/881-1007--------------------------------------------------------------------------------
POLG_CXA21/897-1023--------------------------------------------------------------------------------
POLG_HRV14/874-1000--------------------------------------------------------------------------------

PF05580

Q46028_CLODI/132-352--------------------------------------------------------------------------------
Q97HE0_CLOAB/173-391--------------------------------------------------------------------------------
Q9K975_BACHD/206-424--------------------------------------------------------------------------------
P71028_BACIU/197-414--------------------------------------------------------------------------------
Q8XJE5_CLOPE/165-382--------------------------------------------------------------------------------
Q8RAC0_THETN/198-414--------------------------------------------------------------------------------

PF02122

P1_TYYVF/206-408--------------------------------------------------------------------------------
P1_PLRV1/207-407--------------------------------------------------------------------------------
Q17S70_9LUTE/218-418--------------------------------------------------------------------------------
Q2L3H9_9LUTE/218-419--------------------------------------------------------------------------------
P1_PNLV/224-424--------------------------------------------------------------------------------
Q65968_9LUTE/202-403--------------------------------------------------------------------------------
Q670I3_9LUTE/214-415--------------------------------------------------------------------------------
Q70AF6_9LUTE/441-642--------------------------------------------------------------------------------
Q83737_9LUTE/202-414--------------------------------------------------------------------------------
P1_PEMVW/318-522--------------------------------------------------------------------------------
Q89645_9LUTE/210-411--------------------------------------------------------------------------------
Q8JZ11_9LUTE/202-403--------------------------------------------------------------------------------
Q91AV6_9LUTE/212-414--------------------------------------------------------------------------------
Q9EB08_9VIRU/363-572--------------------------------------------------------------------------------
Q9IZF6_9LUTE/208-408--------------------------------------------------------------------------------

PF05578

O09461_9FLAV/1588-1798--------------------------------------------------------------------------------
Q04232_BVDV/149-359--------------------------------------------------------------------------------
Q68287_9FLAV/2-212--------------------------------------------------------------------------------
O11993_BVDV/1590-1800--------------------------------------------------------------------------------

PF02395

HAP1_HAEIN/17-782---------------------------------------------------------------------LGIASQ..AWA
PET_ECO44/46-729---------------------------------------------------------------------YTN..I..IYA
IGA0_HAEIN/17-865---------------------------------------------------------------------YALTPY..TEA
SEPA_SHIFL/46-800---------------------------------------------------------------------LSLSSAWPALS
PIC_SHIFL/49-802---------------------------------------------------------------------YSQ..I..SQA
HBP_ECOLX/44-811---------------------------------------------------------------------VLFSAG..SLA
HAP2_HAEIF/17-765---------------------------------------------------------------------LGIVSQ..AWA
IGA_NEIGO/19-849---------------------------------------------------------------------YALTPY..SEA
ESPP_ECO57/47-730---------------------------------------------------------------------LLQSSY..SFA

PF05409

R1AB_FIPV/2932-3214--------------------------------------------------------------------------------
R1AB_PEDV7/3026-3317--------------------------------------------------------------------------------
R1AB_IBVBC/2808-3109--------------------------------------------------------------------------------
R1AB_CVMJH/3365-3658--------------------------------------------------------------------------------
R1AB_CVH22/2994-3284--------------------------------------------------------------------------------

PF13611

A8QWY6_9POTV/120-263--------------------------------------------------------------------------------
C4N217_9POTY/195-312--------------------------------------------------------------------------------
C7C6C1_9POTY/195-312--------------------------------------------------------------------------------
C7C6C2_9POTY/191-308--------------------------------------------------------------------------------
D2SLL9_9POTY/584-708--------------------------------------------------------------------------------
POLG_BSTV1/239-359--------------------------------------------------------------------------------

PF01577

POLG_PEMVM/73-321VFANFFAKKERSDELLTRYYGKVVQKGNKLMVKRAPL-------------------------------------------
POLG_TUMVJ/107-361ANKERALFLDWEASLKRSSYGIAENEKVVMTTRGVSK-------------------------------------------
Q85074_9POTV/144-397QLAVAKATIAREEKIKQAALSKFDKNSQVKHTGLKDN-------------------------------------------
POLG_ZYMVR/71-312DPEMRFRLTRNE.....MSKVKKGPNGRMILRKPRAQ-------------------------------------------
P90213_9POTV/300-546HAKIEAIRVRKEKERDQRIFAALEAKLNLGTRRKGQI-------------------------------------------
POLG_PEMVC/44-286EKHLEPYLQKRM.....DATIRQTKGGTLVYKHMSEA-------------------------------------------
POLG_TVMV/30-273FSSIKERLERKR.....HGKICRMKNGSIYIKAASST-------------------------------------------
POLG_RGMVD/13-255GTWVPRVFEEKEMARLLAEKQHARVMRATQEMMKAPN-------------------------------------------
POLG_LMVE/179-436EVDKAEQDLAFACLNASLKPRLEGRTTATIARRRDGC-------------------------------------------
POLG_PVMA/45-297LAKSLQRQAHGVVKVDKHGTARIKRASKHHMSCLEQQ-------------------------------------------
POLG_PSBMV/143-396QAAVAKSTIEREEKERQFAFSKLEEKLRARREKLKDG-------------------------------------------
Q82933_9POTV/2-236WNTVVGKRNQR........KTEEQRIFDAQKRFYETH-------------------------------------------
POLG_PVYN/41-283ETQLSARLLKQK.....YATVRVLKNGTFTYRYKTDA-------------------------------------------
Q65892_BYMV/40-283EMRCAERVKR.......MGELCFSKKGRYITMIPKPD-------------------------------------------
POLG_BCMNN/77-316NSDLQKRLFIGQ.....NSPIKQKKGGACFVRSLSFK-------------------------------------------
POLG_ZYMVC/70-309D.EMKFRLTRNE.....MSKLKKGPSGRIVLRKPSKQ-------------------------------------------
Q65852_BYMV/40-283EARCAERLKR.......MGELCFSRRGRYTTMVPKPD-------------------------------------------
POLG_SBMVG/69-307DVGIQRRLLVNK.....HSSIQSTKEGWFDLASLNFR-------------------------------------------
O73463_MDMV/2-232WTHVTHKWQP.......NLDN.PRDVRRIMELFAAKG-------------------------------------------
POLG_PVYHU/41-283EMQLSARLRRQE.....FATIRTSKNGTCMYRYKTDA-------------------------------------------
POLG_PPVD/59-307AWKGLEEKLQPMFAKREFSKTVTKRKGLRCFKESSEK-------------------------------------------
Q85057_9POTV/204-442NSALQRKLLIQQ.....QSTIEQRPKGAVQLRFCSYE-------------------------------------------
O39734_9POTV/410-663AAAEKEKLVWKKLDEQLATRNEIRKDLKVKWRWGLYR-------------------------------------------
POLG_ZYMVS/71-312DPEDAFRLTRNG.....MSKVKKGPNGRIILRKPKAR-------------------------------------------
POLG_PRSVH/300-546HAKIAAIQVQKEREKDQKVFSALELRLNLKSRRRNQA-------------------------------------------
POLG_TEV/53-303GEDYITEADLPYTPLHLEVDAEMERMYYLGRRALTHG-------------------------------------------

PF03510

POLG_RHDV3/1120-1218--------------------GRMI----HI---GNG--------------------------------------------
O92368_VESV/1208-1312--------------------GYAI----HI---GHG--------------------------------------------
POLG_SVM93/997-1103--------------------GYGV----HI---GNG--------------------------------------------
Q9QRV9_9CALI/1095-1199--------------------GYCV----HM---GHG--------------------------------------------
POLG_PESV/1063-1169--------------------GWAV----HI---GNG--------------------------------------------

PF05416

POLG_SOUV3/707-1268EKISFEAPPTLWSRVTKFGSGWGF----WV---SPT--------------------------------------------
Q9YQ23_VESV/628-1162EVIDFQAPPSIWSRIQKFGSGWGC----WV---SPT--------------------------------------------
Q80J95_9CALI/650-1163EKINFEAPVSIWSRVVQFGTGWGF----WV---SGH--------------------------------------------
Q8JJL0_9CALI/645-1175ERLDFEAPPSVWSRIVPLGTGWGF----WV---SSN--------------------------------------------
Q80RD7_9CALI/641-1177EKLSFEAPPSIWSRIVNFGSGWGF----WV---SPS--------------------------------------------

PF01732

A5IYK2_MYCAP/279-649....TRQWSKRLNFARHSGTA--W----VIDRVKT..........................TNTDY--------------
Q6MUH9_MYCMS/258-617....TLQEIPRLNFANASGTA--W----VIDRIDNK.........................EDKNN--------------
Q2SR25_MYCCT/264-622....TFEEIKRLNFANASGTA--W----IIDRIKN..........................DDKDN--------------
D3VQF5_MYCA6/359-733....YRSTPDHLATSQTVGTV--W----VMDRIISPEA.......................EKDDS--------------
Q4A635_MYCS5/147-497...............TIAGTA--W----VLDYHYDK.........................NNPKE--------------
Q4A5A2_MYCS5/91-491...............SYVGTM--W----LLDYQK...........................ISDTQ--------------
C7LM95_MYCML/189-571...........GSLSNGTGTG--W----LLDYHKY..........................NNENK--------------
A5IYA1_MYCAP/186-569...........DLLSDGTGTA--W----LLDYHKYT.........................NSDNK--------------
Q4A798_MYCH7/125-523.VKLYGEPEENKFLATENGTI--W----LLDYHK...........................KDENN--------------
Q4A5G2_MYCS5/337-740....AENGGNKDWVGTLGGTA--W----LLDYHKNT.........................QNPNK--------------
D3FFM3_MYCGH/244-661.........GTAHPIVDQGTG--W----VLDYAKNS.........................SNNNQ--------------
C5J6P1_MYCCR/115-482....DENDVNDIVPYEPTGTG--W----LLDAAYN..........................QNKTE--------------
Q7NAU7_MYCGA/221-623....SSNSNIEQLYYLNNGTG--W----LLDYQVSP.........................QNPDL--------------
Q7NAG1_MYCGA/203-712....KIPKGSSKAYLTYRGTA--W----ILDYELD..........................SNGYP--------------
D3FHQ1_MYCGH/203-710....KVQGGQNYSSLTYKGTA--W----ILDYELD..........................DSGYP--------------
Q4A5P6_MYCS5/166-643....DIEDTGVNTVKTNKGTA--W----ILDYVKPN.........................DSSYP--------------
D1J8A8_MYCHP/334-723..........ERKFTNTAGTT--W----IMDYQQRS.........................DGKYP--------------
B3XS56_UREUR/379-750..........KDTWDKSSGTT--W----ILDYQKTN.........................DDKYP--------------
B2D8H3_UREPR/376-752..........NNTYNKTAGTT--W----ILDYQKTS.........................DNKYP--------------
Q9PR98_UREPA/413-786...........RESDVVAGTM--W----IMDYQKRN.........................DNKYP--------------
Q6MSY9_MYCMS/283-769IQEYKEKKELKQFQASESGTM--W----IMDYLTEN.........................DGKNP--------------
C7LKT8_MYCML/288-775IEKYKKKKEEKIFQTSESGTM--W----IMDYINEN.........................NNKTP--------------
Q98Q64_MYCPU/350-715....NGEIEDAKVSTKDIGTM--W----ILDYEKTN.........................NGKYP--------------
Q98QS3_MYCPU/339-702..........GNLANTNSGTM--W----ILDYVKEP.........................NKAYP--------------
D3FJ19_MYCGF/216-600....TDEQKIDQKLQSYLGTT--W----ILDYKLAE.........................NGKYP--------------
Q7NAJ2_MYCGA/204-545....HVSENAGDNVGNWSGTA--W----LLDYDLTS.........................DNSYP--------------
Q4A7B5_MYCH7/323-738EPEYLDPKEIVHFSKGFHGTM--N----ILDYKKED.........................GQKYP--------------
Q98PH9_MYCPU/101-415.........QDGKPAKASGTT--W----ILDYQLTE.........................DGSYP--------------
Q8EWB5_MYCPE/130-442...............INSGTG--W----ILDYKLTQD........................SSSYP--------------
Q8EW95_MYCPE/145-484..................GTA--W----ILDYKLTS.........................DNSYP--------------
Y068_MYCGE/48-383................TYGTG--W----LIDWKGDENNP......................EKNDP--------------
Y084_MYCPN/45-410................SYGTG--W----LIDWKGDENKP......................SNTDP--------------
Y588_MYCPN/75-444................IYGTG--W----LFDWKGDEKALGIDGSFVPSITSNIDNSL....LKDDQ--------------
Y395_MYCGE/89-428................SYGTG--W----LIDWKGDENTT......................QKQGS--------------
Y592_MYCPN/104-443................AYGTG--W----LIDWKDV..........................KQDNK--------------
Y083_MYCPN/52-447................EFGTG--W----LIDWKGDENKNLSKNKEGQTASQTRSSSEQTTDQDANL--------------
Y582_MYCPN/44-388....TEKDKSQIDFGSIHGTG--W----LIDWKEVDKKD......................KKANK--------------
Q4A8M7_MYCH7/557-908RSNEYDRQTKTNTSKITSGTA--W----VFDRKLKK.........................DPKNP--------------
Q8EWN7_MYCPE/57-397................EFGTA--W----IYAKEAN..........................QGSND--------------
B3XTP3_UREUR/59-344............QAINIFGTG--W----IFDFQEDP.........................ITENI--------------

PF00949

Y298_MYCGA/335-468---------Q.......IPIT--S----DS-------------------------------RGSPG--------------
Q4VIX4_9FLAV/1520-1672---------Q.......AGVG--I----MY-------------------------------EGVFH--------------
O36765_9FLAV/1520-1672---------Q.......AGVG--V----MY-------------------------------ENVFH--------------
Q3I100_WNV/1521-1673---------Q.......AGAG--V----MV-------------------------------EGVFH--------------
Q32ZD1_9FLAV/1516-1668---------Q.......AGVG--V----MF-------------------------------DGVFH--------------
Q32ZD7_9FLAV/1513-1665---------Q.......SGVG--V----MW-------------------------------DGVFH--------------
Q32ZD2_9FLAV/1515-1667---------Q.......AGVG--V----MH-------------------------------EGVFH--------------
Q32ZD5_9FLAV/1508-1660---------Q.......IGAG--V----MV-------------------------------KGTFH--------------
Q98Y40_9FLAV/1491-1643---------Q.......VGVG--V----FQ-------------------------------ENVFH--------------
Q5DSL2_9FLAV/1489-1641---------Q.......VGVG--V----QK-------------------------------EGVFH--------------
Q9J8E1_9FLAV/1491-1643---------Q.......IGAG--V----YK-------------------------------EGTFH--------------
Q2YHE7_9FLAV/1490-1642---------Q.......VGVG--I----HM-------------------------------EGVFH--------------
A0EKU1_9FLAV/1504-1656---------Q.......IGVG--Y----GN-------------------------------GGVLH--------------
A0EKU7_9FLAV/1506-1658---------Q.......IGVG--Y----GN-------------------------------AGVLH--------------
A0EKU5_9FLAV/1507-1659---------Q.......IGVG--Y----GH-------------------------------NGVLH--------------
Q91B85_9FLAV/1509-1661---------Q.......IGVG--Y----GA-------------------------------KGVLH--------------
POLG_LANVT/1507-1659---------Q.......IGVG--Y----GA-------------------------------KGVLH--------------
Q3Y6G7_9FLAV/1507-1659---------Q.......VGVG--Y----GS-------------------------------KGVLH--------------
Q6JJM0_9FLAV/1507-1659---------Q.......VGVG--F----GS-------------------------------KGVLH--------------
Q8VBK7_9FLAV/1507-1659---------Q.......IGVG--Y----GA-------------------------------KGVLH--------------
A0EKU2_9FLAV/1509-1661---------Q.......IGVG--Y----GQ-------------------------------RGVLH--------------
Q5G264_9FLAV/1507-1659---------Q.......IGVG--Y----GS-------------------------------HGVLH--------------
A0EKU6_9FLAV/1510-1662---------Q.......IGVG--Y----GK-------------------------------QGVLH--------------
A0EKU3_9FLAV/1496-1648---------Q.......IGVG--Y----GL-------------------------------NNVFH--------------
Y577_MYCPN/197-333---------E........DVA--Q----VT-------------------------------FKEPW--------------
Y067_MYCGE/321-456---------VY....VERDDG--L----PT-------------------------------LTFNE--------------
Y083_MYCPN/328-467---------KEQSAYVVRESG--L----PT-------------------------------LTMNV--------------
Y068_MYCGE/272-402---------R......TIDLS--R----EV-------------------------------PTLIQ--------------
Y084_MYCPN/296-431---------R.......EIPT--L----IQ-------------------------------NKS..--------------
Y588_MYCPN/338-464---------R...........--.----..-------------------------------.....--------------
Y395_MYCGE/314-448---------A.......KEIP--V----IT-------------------------------KNARK--------------
Y592_MYCPN/334-455---------N.......KEVS--R----IT-------------------------------RNIRK--------------
Y589_MYCPN/14-134---------P.......TLTK--N----LR-------------------------------QG...--------------
Y591_MYCPN/171-291---------A.......RLTK--N----LR-------------------------------QG...--------------
Y586_MYCPN/154-286---------EQRKEHMDKTTQ--I----LH-------------------------------EKPFV--------------
Q8QVE1_9FLAV/1495-1635---------Q.......IGIG--Y----VH-------------------------------NGTLT--------------
Q6A4R3_AEDAL/768-912---------Q.......RGIG--V----AK-------------------------------NGVFH--------------
Q80DQ3_9FLAV/1484-1633---------Q.......RGVG--F----AK-------------------------------NGVFH--------------
Q8JJZ3_9FLAV/1479-1630---------Q.......VGVG--V----WS-------------------------------EGSFH--------------
Q9JAD5_9FLAV/1479-1630---------Q.......VGVG--I----WT-------------------------------GNSFH--------------
Q9J9C2_9FLAV/1482-1633---------Q.......VGVG--I----WK-------------------------------QGVFH--------------
Q8QL64_9FLAV/1478-1629---------Q.......VGIG--V----LK-------------------------------EGVFH--------------
POLG_YEFVE/1501-1655---------Q.......RGVG--V----AQ-------------------------------GGVFH--------------
Q32ZD3_9FLAV/1496-1649---------Q.......KGVG--V----VK-------------------------------DGVFH--------------
Q32ZD9_9FLAV/1506-1659---------Q.......RGVG--V----VK-------------------------------EGVFH--------------
Q7T918_9FLAV/1515-1668---------Q.......KGVG--V----GK-------------------------------SGTFH--------------
Q32ZD6_9FLAV/1505-1657---------Q.......LGVG--V----MT-------------------------------QGVFH--------------
Q32ZD8_9FLAV/1507-1659---------Q.......IGVG--V----MY-------------------------------EGVFH--------------
Q32ZE1_9FLAV/1514-1666---------Q.......VGVG--V----MQ-------------------------------EGVFH--------------
Q32ZE0_9FLAV/1519-1670---------Q.......VGVG--V----MH-------------------------------EGVFH--------------

PF02907

POLG_HCVJL/1060-1208-----------------LATC--V-------------------------------------NGVCW--------------
POLG_HCVNZ/1062-1210-----------------LGTT--V-------------------------------------GGVIW--------------
POLG_HCVEV/1057-1205-----------------LGIC--I-------------------------------------NGVMW--------------
O56074_9FLAV/1007-1154-----------------MGTC--V-------------------------------------NGVMY--------------
Q96898_9FLAV/992-1139-----------------MGCC--V-------------------------------------NGVVY--------------
Q9WM98_9FLAV/924-1071-----------------MGTC--L-------------------------------------NGLLF--------------
POLG_GBVB/970-1118-----------------MGFV--C-------------------------------------DNVLY--------------
Q9Q9A7_9HEPC/1060-1208-----------------LGTS--I-------------------------------------SGVLW--------------
Q9QIX6_9HEPC/1056-1204-----------------LATC--I-------------------------------------NGVCW--------------

PF10459

B4SLK2_STRM5/22-718HCAYGAIQLNSTAQKNLIKDG--F----NAPTLKDELSAGPNARVFVLDQITDVTAQA---KAAIAGAGNDPLARSRALD
A1SA55_SHEAM/18-726HCAFRAIQYNSSKEKNYLADG--F----LATSMDKEPSAGPNERLYVTEAVTDVSAQI---RDALP...EEPLARVEAIE
A3J218_9FLAO/21-713HCGYDAIAELSSAEKNYLKDG--Y----WAKTKSDELKP.SSLYVRFFVRMDDCTKRI---LAVVN.SGMSEADREKAIN
A3J4B3_9FLAO/17-708HCGYDNIQSHSTVENDYLTNG--F----WAYKMEDELPN.KDLTVTFIIKIEDVTNKI---FDGVL.NLPTESDKQKKIQ
E0THX8_PARBH/23-721HCARGSVQYNSTEENNYLADG--F----LAAANTDELPAAPGTRVYVTVQVDDVTDQI---RSGID.GEMSGEEVFAAID
A3WDJ5_9SPHN/23-720HCARGSVQYNSTAENNYLANG--F----LAGTKDAELPAAPGSRVYVTTELTDVTQRV---REGTA..DMTPIDRYAAIE
F2GAE2_ALTMD/22-719HCARGSVQYNSTPENNYLKDG--F----LAKEIGDELPAAPGTRMFVTVDFSDVTDKV---VGGIN.DDVQGRERYDLIE
A4C924_9GAMM/18-739HCAYGAIQNNSTAQKNLITEG--F----LAKNFEQELPAGPQERLYITEQVTDVTDNV---IGTLS.ADLTGKARYDAIE
A4CBH4_9GAMM/20-717HCAYGSIQYNSTPENNILENG--F----LAKSPAEDLPAAPGSRVYVTETVTDVTDKV---IKGTQ..KLNAKARYDALE
A5FMW8_FLAJ1/19-712HCGYNAIAELSTAEQNYLKDG--F----WAKQKSAEMKP.KSLYVRFFVRMDDVSKRI---LSKVN.DQMTETERNKIIQ
B8E9P0_SHEB2/18-729HCAFKAIQYNTKKEHNYLEQG--F----LATSMDKEPSAGPNERLYITEAVTDVTAQI---NQGLS...QDPLSRYEDIQ
A5PEK4_9SPHN/21-716HCARGSVQYNSTAENNYLENG--F----LAKAKGDELPAAPGSRIYVTTALTDVTQRM---RAGTE..AMEPTERYDTVE
A5ZH65_9BACE/21-717HCGYASIQQHSSVEHDYLTDG--F----WATSRDKELPT.PGLKFTFIERIEDITDIV---NAKIA..AKEITESESFSS
A6E8C7_9SPHI/24-720HCAFSAVQLASTPEHDYLSNG--F----VAKSQEAEIEA.KGLTCRITDSYEDVSDQV---LGAVA.QVDDPASRLQMIN
A6EQ24_9BACT/17-690HCGFGQIQSHSSLENDYLKGG--F----WAMNLEEELPN.EGLYVEFIVRIEDVTSAM---LEGVT.DNLTPKERQSKID
A6ERE5_9BACT/20-712HCGYSAIAELSSAEQNHLKNG--Y----WAASKKDELKP.ESLYVRFFVRMDDVSERI---LSLVN.DAMSEKEREAIIN
A6GH08_9DELT/30-733HCAYGALQANSTVEHDYIEDG--F----LAKTRDEELPA.PGRSVRALREITDVTETI---AKAVE.GVEDDAARAKAIE
A6GI93_9DELT/51-752HCVTGALARNSKPGENLLEDG--F----LAKTKAEERWAGPRQRVWVTNSFTDVTDQV---LNGLE.AIDDPQARFDEMN
A6GWM2_FLAPJ/17-707HCGFDAIQNHSSVDHDYLTNG--F----WAMKMEDELPN.ENLVVTFIVSINDVTAQV---LDGVA.SITSETEKQNKIQ
A6KZW8_BACV8/17-706HCGYDAIQQHSSVEHDYLRDG--F----VADSLSKELPN.PDLFVSFLIRTEDVTERV---LQAIP.VGTKENDRALIVD
A6L2J7_BACV8/19-726HCGYSYIQQHSSVEHDYLTDG--F----WAMSRKEELPC.KGLTVTFIDRILDVTPYV---KEQLA.KDEDPEGLNYLSP
A6L2J8_BACV8/21-719HCGYGAIQQHSSVEHDYLTDG--F----WAKSRKEELPT.PGLKFKFVERIVDVTDKV---NNKVK..SGEVKEEETFEY
A6LID5_PARD8/19-717HCGYSSIQRHSTLEHDYLTDG--F----WAMSRDKELPN.PGLTVTFIDKIDDVTDYV---RTELK.KITDPNSMEFLSA
A6WS02_SHEB8/18-716HCAYGAIQYNSTPEKNLLQDG--F----LAKTFADELPATPGSRVYVTEDVTNVTERV---KGGLE..GKVGSAFYQGVE
A7AAA4_9PORP/22-711HCGFGSIQQLSSVEHDYLKDG--F----VSQSKEEELPV.PGLTVRYLRETVDVSDRI---NSQIA.SIKEEHLRLAAAD
A7AHP4_9PORP/19-717HCGYGCIQRHSTLEHDYLTDG--F----WAMSRDQELPN.PGMTVTFIDKIEDVTDYV---KKELE.KDTDPNSMNFLSP
A7HA06_ANADF/20-725HCVIGTLQFNSTPERNLLEDG--F----VARARAEELWSGPGARVFVTVSVKEVTAEI---AGGID.ARVGDAERGKLLE
A7HFU9_ANADF/37-699HCAHECIEQLSTAQKDFVKSG--F----YAKTLPDEVKC.PTVEVNQLVQITDVTQRI---RAATK..GLEGEAYHKALQ
A7V0H7_BACUN/20-709HCGFSSIQQHSSVEHDYLKDG--F----VARNLSEELPN.PELYVRFLLHQQDVTRRV---LGAVK.PDMNESERTSVVD
A7V1I5_BACUN/23-719HCGYGAIQQHSSVEHDYLTDG--F----WAMNRSEELPT.PGLKFRFVHRIVDITDLV---NAKIK..AGEVTEIDALTS
A8FR99_SHESH/24-737HCAYRAIQYNSKKEHNYIADG--F----LAKSKDAEPSAGPNERLYITEAVTDVSKAV---TDNLS...QDPLVRYEEIQ
Q024G1_SOLUE/22-694HCLFGIVQEHSSPARDLITNG--F----IAGSREEELRG.KVARITVPHRFTDVTKEV---NAAVA.AGANDLARSKAIE
Q027J4_SOLUE/18-549HVASACI..............--.----.......ESKC.PGMVASAL..........---...................
Q029T1_SOLUE/24-727HCVTGGLQFNSTPARNLLKDG--Y----LAKTRSEELPNGPGSRVFVTSAVTEVTSAI---TGNID.AKATDRERYELIE
Q02D16_SOLUE/31-664QIAGDCLAAQSSTAHDYFRDG--F----QAASPAAELPC.PGLAASVLVKIDDVTESV---KAAGT........TLALRN
Q07XT1_SHEFN/18-727HCAYRGIQYNSKKEHNYLADG--F----LANTQAEEPSAGPNERLYITQEVTNVTDSV---MANLS...TEPLVRFEDIQ
Q08V25_STIAD/73-737HCTRGCIEQLSTADKDYIANG--F----YAKAPTDELKC.PAMEINQLAEITDVTDRL---NTATQ..GRTGKEYSDTLK
Q08VC9_STIAD/18-714HCVFSIVQEHSSPQRDLISQG--F----LAQNREAELPG.KGARILVPRAFTDVTKEV---RAAVP.AGADDLVRFKAIE
Q11SC7_CYTH3/21-702HCGFDAIQSHSSVEHDYITDG--F----WAMDRSQELSN.PGLTVTFLIRMEDVTSRF---TGKTE..........EEQT
Q12RW4_SHEDO/18-728HCAYRAIQYNSKSEHNYLENG--F----LAKTKADEPSAGPNERLYITEAVTDVTKQV---MANLS...ADPLARYEDIQ
Q1D5W7_MYXXD/35-700HCARGCIDQLSTAKKDYIANG--F----YAKAQGEETQC.PAMEINQLVKITDVTETL---NKATQ..GLTGKKYADTLK
Q1D9F6_MYXXD/17-714HCAFGVIQEHSTPQRDLITQG--F----LASKREDELPG.KGSRVQVPRSFTDVTKTV---LAAVP.ADADDITRYKAIE
Q1DDZ2_MYXXD/18-682HCIRGCIEDLSSPKKDLLAKG--F----YASSAAQELRC.PKVEANQLVEMTDVTAKM---NAATK..GLTGAAFNTALK
Q1GVV7_SPHAL/23-684HCVVGCLQNLSSADSDLVAGG--F----NAADRARELKC.PGQQAEVVTAITDVTGSI---RAAIG..SLTGEALVKARD
Q1IPC2_KORVE/27-692HVAQSCIHDLSSGGKDYMKDG--F----YAATREQEPKC.PGIEFLVLTDIKDVSEQI---HSAVK.ARMASAESGKATR
Q1NG15_9SPHN/26-683HCVASCLFDNSSADADLLDKG--F----IAARREDEKAC.PGQQAEIVTAIADVTGTV---QGAYK..GMTGEALTRARD
Q2G546_NOVAD/56-713HCVVECAQDNSTDENDLLKLG--F----VPVRREEELKC.PGQQAEVVTAIGDVTARV---RAAIG..TATGEALVKARD
Q2IEV3_ANADE/18-687HCVHECVEELSSAGRDLVASG--Y----LARSGAEELRC.PAMQVDQLLRITDVTKRV---HGALA..GLEGARFNAALQ
Q2NZP5_XANOM/22-715HCAYGAIQLNSTAQKNLIRDG--F----SATSAGAELSAGPNARIYVLDRITDVTAQA---KAAIVGAGSDALKRTQALE
Q2S133_SALRD/5-639RCVRRHLNSQGDT.......A--I----VAARPADERAV.PALHADRLVRTSDVTAAV---RTARQ..DTAKAAAISAVQ
Q2S134_SALRD/69-734HCAREHITDVRRDGEALLKNG--F----YAAARSDERRA.PDLHVDQLVEAENVTGTV---YDGLR...EGREAGAQARE
Q3REP2_XYLFA/22-714HCAYGAIQLNSTPKKNLIKEG--F----NALTQTDEVSAGPNARIYVLEQITDVTAQA---KAALAAAGNDPFKRTTALE
Q488S2_COLP3/26-729HCVYGSVQYNSTAENNLLKNG--F----LAKNFAEELPATPGSRIYVTEEITEVTKLV---KSGVT.EKMSGSDRYKAVD
Q5LIW7_BACFN/34-723HCGFSSIQQHSSVDHDYLKDG--F----TAHSREEELPN.PELYVRFLLRTENVTRRV---LKATT.PGMTESERSLAID
Q5QV86_IDILO/17-717HCAYNSIAHNSTPENDLLANG--F----LAKGLDAEVPAAPGSRIFVTKAVDDVTNKV---IDAKV.TELTGKARLDAIE
Q64RG4_BACFR/19-718HCGYGAIQQHSSVDHDYLTNG--F----WAMNRNEELPC.KGLTVTFIDRILDVTTYV---NEQLK.KDDDPNGINYLSP
Q7MV25_PORGI/21-718HCGYDMIQAHSTLEHNYLENG--F----WAMREADELPN.KDISVVFIDKIEDVTDYV---KKDLK.AIKDPNSMDYLSP
Q7MWU6_PORGI/24-711HCGYGAIQSQSTVDHDYLRDG--F----VSRTMGEELPI.PGLSVKYLRKIVKVTDKV---EGQLK.GITDEMERLRKAQ
Q7NHA9_GLOVI/34-698HCAATCIEELSTAQQNYIESG--F----LARRPEAELKC.PDVELNQLTAIEDVTERV---KKATA..NLSGQQFSDAQK
Q7UKL5_RHOBA/28-688HVASDTLAKLSSKERNLIDDG--F----LAKSFDEELKA.PDLELNQLISIEDVTDRI---NQQIT.NADDAEEAAKERR
Q8A2L6_BACTN/20-711HCGFSSIQQHSSVEHDYLKDG--F----VARNLGEELPN.PELYVRFLLRTEDVTKRV---LSAAK.HAHTESERRVVVD

PF00548

Q8JJT0_PSV13/1680-1844QVTT...........SVGPFTGL..G--IY---DNI--------------------------------------------
POLG_HRV8A/1522-1687VVTT...........DKGKFTGL..G--IY---DQV--------------------------------------------
POLG_EC01F/1540-1705TVKT...........EYGEFTML..G--IY---DRW--------------------------------------------
POLG_HRV14/1538-1702TITT...........SKGEFTGL..G--IH---DRV--------------------------------------------
POLG_BOVEV/1532-1697TVKT...........GAGEFTAL..G--VY---DTV--------------------------------------------
POLG_CX16G/1549-1714QVQT...........DQGHFTML..G--VR---DRL--------------------------------------------
POLG_HE701/1555-1720IART...........SKGEFTML..G--IY---DRI--------------------------------------------
POLG_PEV9U/1525-1690TVRT...........GAGEFTGL..G--VH---DHV--------------------------------------------
Q04107_HRV1A/162-327VITT...........GNGKFTGL..G--IH---DRI--------------------------------------------
Q6TGL9_9ENTO/1563-1728TATT...........SKGEFTML..G--VH---DNV--------------------------------------------
Q66776_ERBV1/1905-2095PVTVSTVIETENGPLSQIVSECCGTY--LY---NKV--------------------------------------------
Q6TPI6_9PICO/1649-1833PVELI........LDGKTVAICCATG--VF---GTA--------------------------------------------
Q7T7N7_9ENTO/1563-1728TATT...........EKGEFTML..G--VY---DRV--------------------------------------------
Q8B552_9PICO/1782-1946PVCT...........STGSYTAL..G--LF---DQW--------------------------------------------
POLG_TMEVG/1636-1816PITFY........YPDKAEVTQSCLL--LR---AHL--------------------------------------------
POL1_BBWVS/957-1123LRMI...........PNGVMVKLETG--MT---ETY--------------------------------------------
POLG_HPE2W/1517-1692ITGS...........TTGHITHCAGY--QH---DEI--------------------------------------------
Q80N16_9PICO/1589-1765ISSS...........ETTDIIHCSAL--FE---DTI--------------------------------------------
Q9IM09_9ENTO/1556-1721TATT...........VNGEFTML..G--IY---DRV--------------------------------------------
O39818_9PICO/1580-1761PIELY........LDNELVTDCSALG--VY---DNS--------------------------------------------

PF00863

POLG_PEMVM/2056-2290KLVNE----------SDGHSETIHGI--GF---GPV--------------------------------------------
Q98WK5_PRSVW/2281-2513HLKNT----------S.GDGRSLFGV--GY---NSF--------------------------------------------
Q98810_9POTV/196-430MICND----------SEGYQTKLFGI--GF---GSF--------------------------------------------
Q7T915_9POTV/2040-2274QLTND----------SDGLKETMYGI--GY---GPI--------------------------------------------
Q89255_9POTY/427-646RIA..----------..IGTYNLNCF--LY---SDW--------------------------------------------
Q82933_9POTV/1990-2223LLKND----------SDGKNIELYGI--GF---GPY--------------------------------------------
Q9YZN8_9POTV/2078-2312KLINR----------SEGERDTMYGI--GF---GPV--------------------------------------------
Q8QXL0_9POTV/1962-2196HLTNN----------SDGHSDSLFGI--GY---GPL--------------------------------------------
O10243_CYVV/709-943LLTNE----------SEGHREKMFGI--GY---GSV--------------------------------------------
Q8QXN3_9POTV/1986-2220LVQND----------SDGIKRNVFSI--GY---GSY--------------------------------------------
POL1_BAYMJ/1361-1581RIF..----------..IGTFNMNCY--FY---SDW--------------------------------------------
POLG_PPVNA/2048-2282QLNNS----------SGARQSEMFGL--GF---GGL--------------------------------------------
Q8QV60_9POTV/2016-2250KIVNA----------SDGCTETIFGI--GY---GSY--------------------------------------------
POLG_LMV0/2213-2447LLTNE----------SDGMKETMYGI--GF---GNT--------------------------------------------
Q8UZ37_9POTV/2108-2341KITNE----------SDGVITHIFGI--GY---GPF--------------------------------------------
POLG_SPMMV/2424-2646IVR..----------..THKGETHGI--FH---GDK--------------------------------------------
O89525_9POTY/1998-2231ALEYY----------CGDMRTSIYGV--CY---GPY--------------------------------------------
Q7T4I3_TUMVJ/2115-2349HLTNV----------SDGASNSLYGV--GF---GPL--------------------------------------------
Q8QQA0_9POTV/2042-2276KIVFT----------SDGTISDGYGI--GY---GSI--------------------------------------------
Q8QY00_9POTV/2175-2409QLTNI----------SDGHCETIFGI--GY---GSY--------------------------------------------
Q9WAA3_9POTY/1259-1474FIK..----------..TAKDTLNCI--LY---GDW--------------------------------------------
O39734_9POTV/2413-2647HLVNE----------ADGRTSDCFGI--GY---GGL--------------------------------------------
Q65883_BYMV/335-569LLENE----------SAEHCDEIFGI--GY---GNV--------------------------------------------
Q9E160_9POTY/1951-2181ILV..----------..EDNQQLNGL--IV---GNI--------------------------------------------
Q7T7N5_9POTV/2211-2445QLTNN----------SNGRSTTTYGV--GF---GSY--------------------------------------------
Q8QXL1_9POTV/1986-2220IIENH----------SNDVRQCMYAI--GY---GSY--------------------------------------------
POLG_OMV/121-355RLTNE----------SDGHSASLFGL--GY---GGY--------------------------------------------
Q9QBT4_PVMA/2030-2264QLENE----------SEGRTTQLFGI--GF---GPF--------------------------------------------
Q80MX2_9POTY/190-375HVQ..----------..IGEGRLHCL--LY---KDF--------------------------------------------
Q80P26_9POTV/2027-2261LLTVE----------TECGRTSTHGL--GF---GSL--------------------------------------------
Q8UZ27_9POTY/1335-1554KLT..----------..IGTFSVNCY--FY---HDW--------------------------------------------
Q9WID3_9POTV/2038-2271KLEND----------SDDCVTSIHGV--GF---GSI--------------------------------------------
Q88507_TEV/2036-2269HLTNE----------SDGHTTSLYGI--GF---GPF--------------------------------------------
Q7T5A6_9POTV/2385-2619HLELK----------SDGNERKTFGI--GY---GPY--------------------------------------------
Q912R2_9POTV/2117-2351HISNE----------SNGHKMTLFGI--GY---GSI--------------------------------------------
Q9YNB1_9POTY/405-628LIS..----------..DGSYTSQCF--IT---QSW--------------------------------------------
Q9QBG1_9POTY/1362-1581RIS..----------..IGTFNVNCF--LY---SDW--------------------------------------------
Q88925_TVMV/2000-2232LLENS----------SDGHSERLFGI--GF---GPY--------------------------------------------
O73463_MDMV/1986-2220IIENH----------SDDVRLCMYAI--GY---GSY--------------------------------------------

PF12381

Q6EEL1_9SECO/2617-2847VIVN-----------LTPTRRAYMNVVRLI---GTI--------------------------------------------
O11979_9SECO/2603-2833VILN-----------VTPGRTAYLNVMRLC---GTF--------------------------------------------
Q1MNG4_9SECO/2627-2857IIIS-----------ELGNVFRTFGVLRLC---GTY--------------------------------------------

PF12380

B3U1H5_YHV/2834-3117RVY--------------GERGDLNGF--LS---GKF--------------------------------------------
Q9IHZ8_GAVAU/2823-3106RVY--------------GERGDLNGF--LS---GKS--------------------------------------------

PF13365

DEG15_ARATH/376-594------------------ASG..I....IL...NEHG.....................----------------------
C9Z823_STRSW/62-228------------------CSG..S....II...RFPDSLD..................----------------------
C9ZGQ1_STRSW/72-240------------------CSG..S....VV...RMPASED..................----------------------
Q93JK9_STRCO/54-222------------------CSG..S....VV...RLPASED..................----------------------
C7QED1_CATAD/56-225------------------CSA..S....LV...RYPTSLS..................----------------------
B8M3P5_TALSN/58-198------------------ASA..F....LV...NKQF.....................----------------------
YH05_SCHPO/99-245------------------ATG..F....VV...NKTL.....................----------------------
C1EGI7_MICSR/60-206------------------ATG..F....VV...DAAR.....................----------------------
A9RQ61_PHYPA/48-194------------------ATG..F....VV...DKQR.....................----------------------
D0MZM5_PHYIT/91-230------------------ATG..F....VV...DAEK.....................----------------------
NM111_PICGU/100-246------------------ATG..F....VV...DSER.....................----------------------
A9GTT3_SORC5/149-297------------------GTG..F....LI...EGR......................----------------------
A9ERE8_SORC5/153-297------------------GTG..F....LV...TGD......................----------------------
B2J8D1_NOSP7/164-308------------------GTG..F....LV...AED......................----------------------
Q2P9Y4_9ACTO/162-308------------------GTA..F....RI...TDD......................----------------------
B6QXD8_9RHOB/76-232------------------GTG..F....LV...GHG......................----------------------
Q9RTZ8_DEIRA/130-275------------------GTG..W....LC...SPQ......................----------------------
C3HBL0_BACTU/109-260------------------GTG..F....LV...SPS......................----------------------
D2R623_PIRSD/145-303------------------GTG..S....MI...SPS......................----------------------
E3IWP0_FRASU/134-282------------------GTG..S....LV...SPE......................----------------------
D0LEN3_GORB4/141-289------------------GTG..F....LV...SPT......................----------------------
D2BAE5_STRRD/123-274------------------GTG..F....LV...SPR......................----------------------
Q2RS04_RHORT/145-306------------------GTG..F....LV...APD......................----------------------
Q467S2_METBF/103-254------------------GTG..F....LV...GPN......................----------------------
Y4FB_RHISN/90-251------------------GTG..F....LI...GPR......................----------------------
A3VZZ0_9RHOB/114-264------------------GSG..F....AV...APG......................----------------------
B6R9Y4_9RHOB/91-243------------------GSG..F....LV...GPN......................----------------------
D3CTM8_9ACTO/100-254------------------GTG..F....LV...SPW......................----------------------
B8END1_METSB/102-257------------------ATG..F....LI...SAD......................----------------------
D4GHS4_PANAM/109-260------------------GSG..F....LT...YGN......................----------------------
D3QBE9_STANL/212-368------------------CTA..F....RV...GNTN.....................----------------------
D3PTY7_STANL/202-361------------------CTA..W....RV...GSKN.....................----------------------
D0N2P9_PHYIT/200-360------------------CTG..W....LI...GSEG.....................----------------------
Q846R2_MYXXA/58-225------------------CTG..W....LV...GSQG.....................----------------------
C6X4V5_FLAB3/104-266------------------GTG..F....LL...APG......................----------------------
B8ICT9_METNO/161-326------------------GTG..F....LV...GSG......................----------------------
Q1DE46_MYXXD/139-306------------------GTG..F....LV...SPS......................----------------------
B4VV96_9CYAN/140-327------------------GTG..F....LL...GPS......................----------------------
D2R618_PIRSD/120-277------------------GSG..F....LV...GSD......................----------------------
A8FZT0_SHESH/365-519------------------GTG..F....VV...KGKELHAS.................----------------------
B9M1H9_GEOSF/322-480------------------GSG..F....LV...RGSELCLG.................----------------------
B1XYW2_LEPCP/349-527------------------GTG..F....LV...RAADFGLT.................----------------------
C3Y7C8_BRAFL/939-1107------------------GTG..F....LL...SKG......................----------------------
C3YHU1_BRAFL/637-805------------------GTG..F....LL...NKG......................----------------------
C3Y9V9_BRAFL/396-567------------------GSG..F....LI...GRK......................----------------------
F111B_HUMAN/475-664------------------ATC..F....VF...NGG......................----------------------
D4A8N0_RAT/367-556------------------ATC..F....VF...KGL......................----------------------
B4VT06_9CYAN/299-436------------------GTG..V....LI...GKN......................----------------------
B8H010_CAUCN/64-248------------------GTG..W....VV...DSGAD....................----------------------
C7PQU4_CHIPD/127-299------------------GTG..W....MV...APD......................----------------------
A3JWZ9_9RHOB/120-292------------------GTG..W....LV...AEH......................----------------------
Q211I3_RHOPB/126-305------------------GTG..W....IV...GSDLG....................----------------------
D2R1J4_PIRSD/67-236------------------GTA..F....LV...GDG......................----------------------
D2R620_PIRSD/144-326------------------GTG..F....IV...GPN......................----------------------
C6JD09_9FIRM/162-306------------------TEG..L....VF...LETET....................----------------------
C0CMS9_9FIRM/152-296------------------AMG..I....II...LEDYR....................----------------------
D4LWF1_9FIRM/167-311------------------EEG..F....VF...LKNDE....................----------------------
C4ZI06_EUBR3/149-289------------------GVG..V....IL...RDNGK....................----------------------
C0FTN1_9FIRM/149-293------------------GSG..I....II...ANSGQ....................----------------------
C9L519_RUMHA/148-292------------------ISG..L....LV...AESGQ....................----------------------
D4M0U9_9FIRM/159-303------------------VSG..V....IV...ADNGQ....................----------------------
B5CQ59_9FIRM/147-291------------------VSG..V....IT...ADNGQ....................----------------------
A5KN66_9FIRM/147-291------------------VTG..V....IA...GDNGR....................----------------------
B6FP33_9CLOT/144-288------------------VSG..V....IV...ADNGQ....................----------------------
A7B169_RUMGN/176-320------------------CTG..L....IA...ADNGQ....................----------------------
B0NI56_EUBSP/167-311------------------TAG..L....II...ADNGQ....................----------------------
C0B801_9FIRM/151-295------------------VSG..V....IF...WDNGA....................----------------------
B0G1M9_9FIRM/149-293------------------ISG..M....IV...ADNGQ....................----------------------
C4Z416_EUBE2/141-284------------------VAG..L....VV...ANVNS....................----------------------
B7AVI8_9FIRM/172-316------------------VSG..V....IF...AEVDA....................----------------------
C5ELW4_9FIRM/172-316------------------FSG..I....II...ARTRS....................----------------------
C4G4N6_ABIDE/156-298------------------AAG..Y....II...ALQND....................----------------------
C1IAW0_9CLOT/114-253------------------TTG..V....II...ESNG.....................----------------------
B8AM75_ORYSI/89-258------------------ASG..F....II...DFDKSS...................----------------------
B5JQS5_9BACT/61-197------------------LSG..F....YI...DEKG.....................----------------------
B3DXV6_METI4/79-214------------------CSG..F....FI...DPKG.....................----------------------
C5YNZ0_SORBI/297-442------------------CTG..F....FI...NYDGC....................----------------------
C5YX14_SORBI/284-426------------------CTG..F....FI...GWNGS....................----------------------
Q0JIU9_ORYSJ/149-291------------------CTG..F....FI...EWNGC....................----------------------
B9G3S8_ORYSJ/109-256------------------CTG..T....IM...EYGPS....................----------------------
C5WUT6_SORBI/430-572------------------CTG..I....FV...GNQSD....................----------------------
C5XIJ1_SORBI/75-220------------------CSG..I....AI...GCQGC....................----------------------
B9S6M7_RICCO/99-269------------------GSG..T....VI...ESDDT....................----------------------
Q6ATB3_ORYSJ/64-208------------------FSG..I....VV...SWNETT...................----------------------
C5Y9X9_SORBI/128-269------------------CTG..I....FV...GWNETT...................----------------------
B9FMK5_ORYSJ/181-321------------------RTG..F....VV...SWDGAT...................----------------------
Q7EYD8_ORYSJ/206-349------------------CTG..V....VIGWDGANKR....................----------------------
B2IZX6_NOSP7/35-159------------------GSG.......VI...WQTD.....................----------------------
Q01SP4_SOLUE/26-150------------------GSG.......IV...WKPD.....................----------------------
A7NIM6_ROSCS/38-173------------------GTG.......VV...WQIG.....................----------------------
D1CHW8_THET1/35-167------------------GSG.......II...WAPS.....................----------------------
Q0RIR2_FRAAA/55-221------------------GSG.......IV...YRSN.....................----------------------
A2SLK2_METPP/110-244------------------GAG.......FVI.SGAEG.....................----------------------
B1ZW96_OPITP/85-238------------------GSG..V....VI...AVEG.....................----------------------
A2SLB0_METPP/51-178------------------GSG.......VI...VGPG.....................----------------------
C6XBL7_METSD/51-179------------------GSG.......VV...VAEN.....................----------------------
B9TFS6_RICCO/49-177------------------GSG.......VV...VAPD.....................----------------------
C6WXC4_METML/54-182------------------GSG.......VV...VAKD.....................----------------------
B6BWJ8_9PROT/54-182------------------GSG.......VV...IKKN.....................----------------------
B9TJ43_RICCO/62-190------------------GSG.......VV...VSPE.....................----------------------
B6BVZ4_9PROT/47-175------------------GSG.......VV...VAKD.....................----------------------
C6XD83_METSD/47-175------------------GSG.......VI...VAPN.....................----------------------
C6WVZ4_METML/47-174------------------GSG.......VV...VEQN.....................----------------------
Q2W2I3_MAGSA/355-483------------------GSA.......VA...MDER.....................----------------------
C6BGJ0_RALP1/55-184------------------GSA.......VV...IADG.....................----------------------
B3QPC6_CHLP8/57-184------------------GSG.......VV...MPDG.....................----------------------
Q0YS38_9CHLB/89-216------------------GSG.......IV...ISSG.....................----------------------
Q3B4M2_PELLD/76-203------------------GSG.......VV...LPGG.....................----------------------
C7RR92_ACCPU/56-182------------------LSA.......VT...IGEA.....................----------------------
C7RR91_ACCPU/52-180------------------GSG.......VV...VHAG.....................----------------------
Q1IY94_DEIGD/67-198------------------GGG..PVSGTVI...GEE......................----------------------
B8BSP4_THAPS/582-769------------------GSG..F....VV...GFDDSIIDDI...............----------------------
Q3M8K4_ANAVT/33-168------------------SSG.......IH...WRNG.....................----------------------
D5WKU5_BURSC/40-175------------------SSG.......VI...WRRG.....................----------------------
Q7NEY6_GLOVI/37-172------------------PSG.......VL...WREG.....................----------------------
Q01SP5_SOLUE/107-240------------------SSG.......VF...WRPG.....................----------------------
Q98IG3_RHILO/78-212------------------ASA.......FH...WSDG.....................----------------------
B0U7I8_METS4/36-169------------------ASG.......FV...WKPG.....................----------------------
Q89E13_BRAJA/35-167------------------ATG.......FV...WKPG.....................----------------------
A7H8S6_ANADF/35-169------------------ASG.......VA...WSAD.....................----------------------
B4UF27_ANASK/45-180------------------ASG.......VV...WSAD.....................----------------------
D1CHW7_THET1/37-171------------------ASG.......IV...WSAD.....................----------------------
D1C9X4_SPHTD/41-176------------------ATG.......II...WRAD.....................----------------------
Q1DFJ7_MYXXD/51-186------------------TTG.......IV...WDAE.....................----------------------
B4WI21_9SYNE/33-173------------------GTG.......IH...WKRG.....................----------------------
D2R6U2_PIRSD/68-213------------------ASG..I....IV...SSEG.....................----------------------
D5SYB2_PLAL2/75-226------------------NTG..F....LI...SSEG.....................----------------------
A6C5I0_9PLAN/58-206------------------STG..F....LV...SPEG.....................----------------------
Q7UNU5_RHOBA/96-240------------------QSG..F....LV...SPAG.....................----------------------
A4A0T0_9PLAN/66-211------------------QSG..F....VI...SPEG.....................----------------------
A9F4P7_SORC5/37-166------------------TTG..W....VA...LGNG.....................----------------------
A9FFZ4_SORC5/137-265------------------GDG.....................................----------------------
B6B9E4_9RHOB/398-528------------------RSG..F....FV...DGNG.....................----------------------
D0D6Q7_9RHOB/389-519------------------VSG..F....FV...DAGG.....................----------------------
Q9Z529_STRCO/60-203------------------GTG..F....LA...DHHG.....................----------------------
A4A0S9_9PLAN/71-202------------------CSA..L....VV...SADG.....................----------------------
D5SYB3_PLAL2/92-222------------------TTG..V....IV...GSDG.....................----------------------
D2R6U3_PIRSD/90-221------------------TTG..L....II...SSDG.....................----------------------
Q7UNU4_RHOBA/89-223------------------TSG..V....VI...DEQG.....................----------------------
Q67SY9_SYMTH/37-178------------------GTG.......VI...LDHY.....................----------------------
D2Q0V1_KRIFD/123-243------------------ATG.......VL...LPDG.....................----------------------
B0T7U9_CAUSK/55-188------------------GNG..V....VI...SENG.....................----------------------
A9VXT6_METEP/54-187------------------GNG..V....VI...REDG.....................----------------------
B9JA65_AGRRK/33-164------------------GSG..V....VI...RNNG.....................----------------------
D3NU60_AZOS1/54-191------------------GSG..I....VI...DGSG.....................----------------------
A8TSL0_9PROT/61-191------------------GSG..I....VI...DKGG.....................----------------------
Q126C2_POLSJ/74-216------------------GSG..V....VI...GADG.....................----------------------
A2SEV1_METPP/84-217------------------GSG..V....VI...ASDG.....................----------------------
D0RMV8_9PROT/62-194------------------GTG..V....VI...DKK......................----------------------
D1CC35_THET1/99-237------------------GNG..V....VM...NLDG.....................----------------------
B3S5U4_TRIAD/329-491------------------GSG..V....VI...DRYK.....................----------------------
B4UTS4_BP163/66-193------------------GTG..F....HI...GGG......................----------------------
Q11LS4_MESSB/40-170------------------GSG.......VH...IGDG.....................----------------------
C4RAG7_9PROT/100-239------------------ATG..A....LV...SPNG.....................----------------------
C5JAK2_9BACT/101-240------------------ASG..A....IV...SSHG.....................----------------------
C5JBN6_9BACT/99-238------------------GSG..A....LV...GANG.....................----------------------
A0L9W3_MAGSM/126-265------------------GSG..V....LI...SSKG.....................----------------------
D0LGQ1_HALO1/668-816------------------GSG..V....IV...ARDGN....................----------------------
Q08Z65_STIAD/79-228------------------ASG..V....VIGTEHTEEGR...................----------------------
Q2II41_ANADE/64-213------------------ASG..I....AF...AHEGG....................----------------------
C1N754_MICPC/393-574------------------ASG..I....VL...TAGDGAR..................----------------------
C1EFA7_MICSR/414-629------------------ASG..V....VIGVHGSGGEGEEGGGGIGGVGGVEWGGGG----------------------
B9H2S3_POPTR/409-631------------------ASG..V....LL...NDQG.....................----------------------
A5BEH1_VITVI/502-717------------------ASG..V....VL...NSQG.....................----------------------
Q0PY37_SOLLC/412-632------------------ASG..V....LL...NKQG.....................----------------------
A9TAV2_PHYPA/699-919------------------ASG..V....IL...NKTG.....................----------------------
C0PL31_MAIZE/403-612------------------ASG..I....VL...NKRG.....................----------------------
Q00YL5_OSTTA/68-221------------------RSG.......FVWYVDAND.....................----------------------
A4S513_OSTLU/76-226------------------GSG.......VV...WYIDDA...................----------------------
C1N5V8_MICPC/175-398------------------GVG.......VL...WSDR.....................----------------------
A8I3D5_CHLRE/134-313------------------GSG.......IV...WDTAG....................----------------------
A4S4E4_OSTLU/26-173------------------GSG..V....VV...RHRGV....................----------------------
A1VVN7_POLNA/138-318------------------GTG..F....LV...GPQ......................----------------------
Q08MN7_STIAD/50-171------------------GPG..V....IV...GSQG.....................----------------------
Q2YD45_NITMU/56-221------------------GSG..V....AL...GAD......................----------------------
D2QY05_PIRSD/202-373------------------GSS..V....VT...ENTGG....................----------------------
A9ZKZ5_COXBE/58-186------------------GSA.......IA...TSKT.....................----------------------
A5E551_LODEL/303-457------------------GST.......IL...YKPN.....................----------------------
A3LV17_PICST/282-443------------------GTC..I....YY...NET......................----------------------
Q6BLK4_DEBHA/295-454------------------GSC..V....YY...NHT......................----------------------
A5DCA5_PICGU/274-427------------------GTC..T....YV...SS.......................----------------------
D0N1Z1_PHYIT/130-271------------------GMG.......VF...FSST.....................----------------------
D5SQ02_PLAL2/103-278------------------ASG..I....LIRGANPQE.....................----------------------
C1MYV6_MICPC/213-422------------------GSG..V....HI...GGG......................----------------------
A1DKZ3_NEOFI/106-274------------------GTA..V....CI...HPDG.....................----------------------
C9SS84_VERA1/110-286------------------GTA..I....CV...DSSG.....................----------------------
B2ACI3_PODAN/114-282------------------GTA..V....CI...HPSG.....................----------------------
A4YLF4_BRASO/29-179------------------GSG..V....QV...DAL......................----------------------
B4VWK9_9CYAN/26-185------------------GSG..F....II...RADG.....................----------------------
Q7URA6_RHOBA/240-384------------------GTG..T....II...DTNGD....................----------------------
D2R0U2_PIRSD/218-358------------------GTG..T....II...DTHDD....................----------------------
A3ZSU8_9PLAN/169-309------------------GTG..T....IV...HSHHG....................----------------------
A6CCJ8_9PLAN/216-356------------------GSG..T....VI...HSAVG....................----------------------
B5W7L6_SPIMA/53-196------------------GSG..V....II...AREGD....................----------------------
B0JV48_MICAN/59-215------------------GSG..S....II...AKEGK....................----------------------
A0ZIJ6_NODSP/50-187------------------GSG..V....IV...ARKGN....................----------------------
B0C7H5_ACAM1/295-465------------------GSG..V....II...ARQGQ....................----------------------
A0YM55_LYNSP/62-208------------------GSG..V....IV...AKLGQ....................----------------------
Q060L2_9SYNE/66-212------------------GSG..V....IV...KKDGN....................----------------------
A2CDP2_PROM3/91-233------------------GSG..V....LV...KQEGN....................----------------------
B0C4I5_ACAM1/51-195------------------GSG..V....LI...KRNDN....................----------------------
Q113N3_TRIEI/93-237------------------GSG..V....II...GRKDS....................----------------------
A8YFS3_MICAE/52-220------------------GTG.......AI...VQKQKYIFKG...............----------------------
B4VKH5_9CYAN/399-535------------------GSG..V....II...AKHKE....................----------------------
B0C7H5_ACAM1/63-201------------------GSG..T....LI...SKQNN....................----------------------
Q4C9U0_CROWT/64-213------------------SSG..V....II...SKKSN....................----------------------
E0U9M4_CYAP2/69-211------------------QSG..I....LI...TEDKN....................----------------------
B7KH20_CYAP7/52-196------------------QSG..V....LL...SQDEN....................----------------------
Q92JT1_RHIME/45-189------------------GSG..V....VV...SVEG.....................----------------------
B8HSI3_CYAP4/55-201------------------GTG..V....II...NRSAD....................----------------------
B6BL05_9PROT/72-191------------------GSA..V....IV...SNNG.....................----------------------
D3B2A3_POLPA/90-296------------------GTG..F....CV...KKD......................----------------------
B7FUE8_PHATC/1283-1490------------------GSG..F....IV...DKRL.....................----------------------
C2FHG0_LACPA/165-321------------------GTG..F....SI...GVD......................----------------------
B0EDS2_ENTDS/219-353------------------GSC..C....GI...KHWGE....................----------------------
B3QZR5_PHYMT/297-472------------------GSG.......II...FKYHKIKD.................----------------------
B9IN99_POPTR/16-159------------------GSG..V....II...DEGR.....................----------------------
D1W398_9BACT/21-163------------------GTA..F....FV...DDN......................----------------------
Q7MW22_PORGI/27-170------------------GTA..F....FI...KDD......................----------------------
A6L245_BACV8/25-170------------------GTA..F....YI...GNG......................----------------------
Q84SQ1_ORYSJ/91-253------------------GSG..F....II...SSTADG...................----------------------
A8YNP5_MICAE/435-587------------------GTG..Y....VV...KRQGT....................----------------------
B8BM04_ORYSI/29-174------------------GTG..F....II...GKTRK....................----------------------
A3WZP2_9BRAD/25-182------------------GTA..F....TI...DVDDR....................----------------------
B6SLW3_MAIZE/46-198------------------GTS..F....AI...KKRLDG...................----------------------
B4W048_9CYAN/24-160------------------GTG..F....FV...APE......................----------------------
B7KID8_CYAP7/23-153------------------GTG..F....FV...SPR......................----------------------
Q10YA2_TRIEI/28-156------------------GTG..F....WV...TPG......................----------------------
C4RBC6_9ACTO/39-187------------------GTG..F....LV...APA......................----------------------
B5HRW8_9ACTO/52-200------------------GAG..F....LV...AEG......................----------------------
B4VL88_9CYAN/23-161------------------GTG..F....FV...SSDG.....................----------------------
Q10V37_TRIEI/25-170------------------GTG..F....AF...YRKDN....................----------------------
B0JTN4_MICAN/27-184------------------GAG..F....LI...SSE......................----------------------
B8HMX0_CYAP4/25-181------------------GAG..F....LV...SDR......................----------------------
A8ZQB3_ACAM1/33-191------------------GTG..F....YL...SGR......................----------------------
A3XNG0_LEEBM/39-192------------------STG..F....FF...ESGK.....................----------------------
D4N037_9FIRM/379-516------------------GTG..F....LL...KGI......................----------------------
D1W141_9BACT/221-392------------------GSG..YTCTKTL...QASGSVGFRA...............----------------------
Q72KS5_THET2/61-193------------------GTG..F....FV...GKD......................----------------------
B7A6E3_THEAQ/62-195------------------GTG.......FF...YAPG.....................----------------------
D3PR00_MEIRD/62-196------------------GSG..F....FI...SADG.....................----------------------
B4D8F4_9BACT/72-317------------------GTG..F....VI...NKDG.....................----------------------
B3PHV0_CELJU/204-337------------------GTG..F....YF...NSIG.....................----------------------
A7BUM9_9GAMM/28-164------------------GTG..F....FI...SFEG.....................----------------------
C7PQR9_CHIPD/410-553------------------GTA..FHLKGV.............................----------------------
Q75HK9_ORYSJ/40-213------------------GTG..F....CI...DQRG.....................----------------------
A0CQA0_PARTE/272-415------------------GSG..I....LV...NDQLNK...................----------------------
Q7Q9T3_ANOGA/284-425------------------GTGCAF....EL...NGKR.....................----------------------
B3NQY9_DROER/305-445------------------GTG..T....FIRVHNKR......................----------------------
D2QDD9_SPILD/31-236------------------GTATLF....FI...NEEG.....................----------------------
A9VAG6_MONBE/28-203------------------GLG..F....YL...GNG......................----------------------
A3SCU7_9RHOB/196-330------------------GTA..F....FL...DGV......................----------------------
A0LWM1_ACIC1/250-384------------------GTA..F....ALALPQASGS....................----------------------
A9AU45_BURM1/75-243------------------