Sequence alignment for CL0127

PF03255

ACCA_SHIFL/4-151---------------NFLDFEQPIAELEAKIDS-----------------------------------------------
ACCA_SYNE7/10-154---------------ILLEFEKPLVELEERITQ-----------------------------------------------
ACCA_HELPY/3-141---------------VYLDFENHIKEIQNEIE.-----------------------------------------------
ACCA_HAEIN/4-147---------------EYLDFELPIAELEAKIEA-----------------------------------------------
ACCA_AQUAE/7-151---------------MHLEFEKELLEIKEKIDR-----------------------------------------------
ACCA_CHLPN/2-146---------------ELLPHEKQVVEYEKAIAE-----------------------------------------------
ACCA_CYACA/9-153---------------PLEELESSLTKTESKAYY-----------------------------------------------
ACCA_ANTSP/7-151---------------LSLNFLKPVLELEYQIDQ-----------------------------------------------
ACCA_PEA/91-235---------------VILEFEKPLINMEKKIND-----------------------------------------------
Q39833_SOYBN/89-233---------------VTLDFEKPLVDLQKKIID-----------------------------------------------
ACCA_BACSU/3-147---------------PRLEFEKPVIELQTKIAE-----------------------------------------------
ACCA_DEIRA/1-145---------------MTSTPADALRELEARVRD-----------------------------------------------
ACCA_PORPU/9-153---------------TVPDFMRPVAELESQVAE-----------------------------------------------
P71532_9PROT/2-146---------------HILEFEKPIAELEGKIEE-----------------------------------------------
ACCA_SYNY3/9-153---------------FLLDFEKPLYELEEKINQ-----------------------------------------------

PF01039

PCCB_SACEN/46-544KQHAKGKRTARERIDMLLDEGS.FVELDEHARHRSTNFGM..DADRPYGDGVVTGWGTVDGRRVCVFSQDFTVFGGSLGE
ACACB_HUMAN/1780-2334QEYPEGRDVIVIGNDITFRIGS.FGPGEDLLYLRASEMAR...AEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDP
PCCB_BACSU/26-505QQRQKGKLTARERIIFLLDQDS.FIELHPFMESQVLTREQ...R..MLGDGVVTGYGTIDGRSVYVFAQDFTVYGGALGE
YNGE_BACSU/27-509SNREKGKLFVRERLSLLFDDDI...ELEDAFFAECMSDG.......LPADGVVTAIGKIGGQTVCVMANDSTVKAGSWGA
12S_PROFR/38-522KQHSQGKQTARERLNNLLDPHS.FDEVGAFRKHRTTLFGM..DKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGE
ACACA_HUMAN/1669-2223PEYPEGRDIIVIGNDITYRIGS.FGPQEDLLFLRASELAR...AEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDP
PCCB_HUMAN/57-537AQHKRGKLTARERISLLLDPGS.FVESDMFVEHRCADFGMAADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSG
Q39478_9STRA/1471-2014PEYPEGRQVVVIVNDVTVQSGS.FGVEEDEVFFKASKYAR...ENKLPRVYIACNSGARIGLVDDLKPKFQIKFIDEASP
Q9ZCU2_RICPR/30-512AQHQKGKLTARERIEVLLDPNS.FTETGMFVSHRCDNFGMQNKK..FLGDGVVTGYGTINGRLVFIYSQDFTVLGGSLGE
O87201_CORGT/38-535KVHAAGRKTARERIEYLLDEGS.FVEIDALARHRSKNFGLDAKRP..ATDGVVTGYGTIDGRKVCVFSQDGAVFGGALGE
ACC1_ARATH/1587-2139PEFPMGRKLLVIANDVTFKAGS.FGPREDAFFLAVTELAC...AKKLPLIYLAANSGARLGVAEEVKACFKVGWSDEISP
Q57079_9FIRM/29-507KQHAQGKMTARERLAKLFDDNS.FVELDQFVKHRCVNFGQ..EKKELPGEGVVTGYGTIDGRLVYAFAQDFTVEGGSLGE
ACCD_MYCTU/12-482AVLDRGSFVSWDSEPLAVPVAD...SYARELAAARAATG........ADESVQTGEGRVFGRRVAVVACEFDFLGGSIGV
O60033_EMEND/1606-2161PEYPEGRRFIIVANDITFQIGS.FGPLEDKFFHKCTELAR...KLGIPRVYLSANSGARIGMADELIPYFSVAWNDPAKP
O06165_MYCTU/41-527RHVSRGKLLPRERVDRLLDPGSPFLELAPLAAG.GMYGDE..S....PGAGIITGIGRVSGRQCVIVANDATVKGGTYYP
O48959_WHEAT/1642-2195PEYPNGRQIVVIANDITFRAGS.FGPREDAFFETVTNLAC...ERKLPLIYLAANSGARIGIADEVKSCFRVGWSDDGSP
HFA1_YEAST/1619-2176PEYPEGRNMIVISNDITYNIGS.FGPREDLFFDRVTNYAR...ERGIPRIYLAANSGAKLGIAEELIPLFRVAWNDPSDP
Q12721_USTMD/1546-2102PEYPAGRKLVVIGNDVTIQAGS.FGPVEDRFFAAASKLAR...ELGVPRLYISANSGARIGLATEALDLFKVKFVGD.DP
O28066_ARCFU/27-514RQHEQGKLTARERIELLLDPGS.FVEINPFVEKRNTDFGL..DKMDLPADGVVTGYGTVDGRPVAVFAQDFTVMGGSLGE
O86318_MYCTU/45-527RHHARGNLTPRERIELLVDPDSPFLELSPLAAY...GSNF..Q....IGASLVTGIGAVCGVECMIVANDPTVKGGTSNP
Q20676_CAEEL/55-534AQHARGKLTARERIDLLLDRNT.FREYDMFAEHTCNDFGMQKEK..YPGDSVVTGRGEINGRTVFVFSQDFTVFGGSLSS
PCCB_RHOER/5-474APVTKSESSTDPRDPLARLENL.FDPGTTVPLHARDKS............GVLAASGNIDGVRTIAYCSDATVMGGAMGV
Q41511_WHEAT/1583-2142PEFPGGREIIVVANDVTFKAGS.FGPREDAFFDAVTNLAC...ERKIPLIYLSATAGARLGVAEEIKACFHVGWSDDQSP
O86517_STRCO/39-525AQHAKGKLTARERIELLLDPGS.FREVEQLRRHRATGFGLEAKKP..YTDGVITGWGTVEGRTVFVYAHDFRIFGGALGE
O52601_SULME/26-513AQHEKGKMTARERIALLFDEGT.FSEIMTFARTQSTEFGL..DKTDLYGDGVVTGWGKIDGRTAFVYSQDFTSLGGTLGE
O24789_MYXXA/32-522KQHESGKLTARERIDLLLDPGS.FCELDKFVTHRSSEFGMGDKK..IPGHGVVTGYGTVEGRKVFVFAQDFTVFGGSLSG
O59018_PYRHO/28-520KQHEKGKLTARERLELLLDPGS.FVEIGMFVKHRATEFGM..DKRELPADGVITGYGTINGRLVFVYAQDFTVMGGSLGE
PCCB_MYCLE/50-547KVHAKGKFTARERIYALLDDDS.FVELDALARHRSTNFGLGENRP..VGDGVVTGYGTIDGRDVCIFSQDVTVFGGSLGE
ACAC_YEAST/1574-2130PEYPRGRQFVVVANDITFKIGS.FGPQEDEFFNKVTEYAR...KRGIPRIYLAANSGARIGMAEEIVPLFQVAWNDAANP
MCCB_ARATH/93-585RNRSRNKLLPRERIDRLLDPGSSFLELSQLAGHELYEEPL.......PSGGIITGIGPIHGRICMFMANDPTVKGGTYYP
ACAC_SCHPO/1615-2170PEYPNGRKIIVVANDITFQIGS.FGPQEDEYFYKVTQLAR...QRGIPRIYLAANSGARIGVADEIVPLFNIAWVDPDSP
MCCB_CAEEL/119-606LHRSRGKMLARERIDGIVDAGSPFIEFSQLAGYEMYGKEE..V....PSGGILTGVGIVSGRVCVIVANDATVKGGTYYP
O88155_CORGT/44-541KVHAAGRLTARERLDYLLDEGS.FIETDQLARHRTTAFGLGAKRP..ATDGIVTGWGTIDGREVCIFSQDGTVFGGALGE
GCDA_ACIFV/54-573DVNKRGELTALQRIEKLVEPGS.WRPLNTLFNPQGNKNG.........SVAIVKGLGRVNGKWCVVVASDNKKLAGAWVP

PF06833

Q8P4U4_XANCP/5-230--ALFDQLFPL...GHAIACHDDVLTGSATT.AAGEVT------------------------------------------
Q89XP1_BRAJA/5-233--DIIASLFPD...GHEVSNDNGVLHGSATLRSGGTML------------------------------------------
Q9I6S6_PSEAE/11-268--AWFQALAGSLAPRPGDPASLRVADAELDGYPVRFLA------------------------------------------
O32714_KLEPN/10-266--LWLNKLAPDAPLMSGLCPSVQVADGQINGENVRFIA------------------------------------------
Q89UY5_BRAJA/5-233--DILAGLFPN...GRKIETTGAMIAGQATLPDGGPIH------------------------------------------
O54417_ACICA/5-236--LLLKQLFPK...QLDYQINGYVIKGNAET.EAGPVR------------------------------------------
Q93L25_BURCE/5-230--ALAEALFGR...HHGMEADGDFLHGEPRF.DGQPLT------------------------------------------
Q87V58_PSESM/9-266--NWFNALSADASEVTGLPASLKVADGLLGEQPVRFVA------------------------------------------
Q9Z449_PSEPU/6-260--NWLSGLAGGQA.LPGYPASLLVIDGELDNRLVRFIA------------------------------------------

PF01972

Y137_METJA/3-286--------------------------------------------------------------------------------
Y1495_METJA/9-292--------------------------------------------------------------------------------
O29403_ARCFU/7-290--------------------------------------------------------------------------------
O66996_AQUAE/1-288--------------------------------------------------------------------------------

PF00574

Q7XBR2_ORYSJ/73-254--------------------------------------------------------------------------------
CLPP2_BORBU/6-189--------------------------------------------------------------------------------
CLPP1_BORBU/13-194--------------------------------------------------------------------------------
CLPP1_CAEEL/34-215--------------------------------------------------------------------------------
CLPP_OENEH/21-204--------------------------------------------------------------------------------
CLPP4_ARATH/74-253--------------------------------------------------------------------------------
CLPP1_CHLTR/3-189--------------------------------------------------------------------------------
Q9CFR9_LACLA/7-176--------------------------------------------------------------------------------
CLPP1_PSEAE/28-209--------------------------------------------------------------------------------
CLPP_LISIN/12-193--------------------------------------------------------------------------------
Q9EYD3_9VIRU/6-171--------------------------------------------------------------------------------
Q9B0E1_9CAUD/16-186--------------------------------------------------------------------------------
CLPP_BRUME/20-201--------------------------------------------------------------------------------
CLPP2_RHIME/20-201--------------------------------------------------------------------------------
CLPP_CHLMO/342-515--------------------------------------------------------------------------------
Q8P2G1_STRPQ/13-175--------------------------------------------------------------------------------
CLPP_CHLVU/13-196--------------------------------------------------------------------------------
CLPP_NEIMA/16-199--------------------------------------------------------------------------------
CLPP_MESVI/13-196--------------------------------------------------------------------------------
Q98RU2_GUITH/45-228--------------------------------------------------------------------------------
Q9ST19_BRACM/82-261--------------------------------------------------------------------------------
CLPP2_BACHD/13-194--------------------------------------------------------------------------------
CLPP_CAUCR/20-201--------------------------------------------------------------------------------
CLPP5_ARATH/107-288--------------------------------------------------------------------------------
CLPP_MOUSE/63-244--------------------------------------------------------------------------------
CLPP_THETN/12-193--------------------------------------------------------------------------------
O97252_PLAF7/180-359--------------------------------------------------------------------------------
CLPP1_AGRT5/16-197--------------------------------------------------------------------------------
CLPP_XYLFA/19-200--------------------------------------------------------------------------------
Q42886_SOLLC/95-274--------------------------------------------------------------------------------
CLPP1_TREPA/17-198--------------------------------------------------------------------------------
CLPP2_MYCLE/27-207--------------------------------------------------------------------------------
CLPP_STAAW/12-193--------------------------------------------------------------------------------
CLPP_NEPOL/13-196--------------------------------------------------------------------------------
Q8VQM6_BACTU/12-193--------------------------------------------------------------------------------
CLPP_PSINU/13-197--------------------------------------------------------------------------------
CLPP_DEIRA/15-196--------------------------------------------------------------------------------
CLPP1_BACHD/12-193--------------------------------------------------------------------------------
CLPP_THEMA/21-202--------------------------------------------------------------------------------
CLPP2_TREPA/15-193--------------------------------------------------------------------------------
CLPP_CHLTE/37-218--------------------------------------------------------------------------------
TEPA_BACHD/48-232--------------------------------------------------------------------------------
CLPP3_NOSS1/13-196--------------------------------------------------------------------------------
CLPPL_CYAPA/12-197--------------------------------------------------------------------------------
Q92CR8_LISIN/4-186--------------------------------------------------------------------------------
CLPP3_AGRT5/23-198--------------------------------------------------------------------------------
CLPP1_RHILO/16-197--------------------------------------------------------------------------------
CLPP1_SYNE7/10-191--------------------------------------------------------------------------------
Q9XJT4_BPD3/38-211--------------------------------------------------------------------------------
CLPP_PINCO/13-197--------------------------------------------------------------------------------
CLPP_CLOPE/13-194--------------------------------------------------------------------------------
CLPP_RICPR/12-193--------------------------------------------------------------------------------
CLPP2_CORGL/13-195--------------------------------------------------------------------------------
CLPP1_CORGL/24-204--------------------------------------------------------------------------------
CLPP5_STRCO/18-201--------------------------------------------------------------------------------
CLPP_CLOAB/12-193--------------------------------------------------------------------------------
CLPP_HELPJ/12-193--------------------------------------------------------------------------------
CLPP_YEREN/25-206--------------------------------------------------------------------------------
CLPP1_MYCTU/11-193--------------------------------------------------------------------------------
CLPP_HAEIN/12-193--------------------------------------------------------------------------------
CLPP_CHLRE/310-482--------------------------------------------------------------------------------
CLPP1_STRCO/32-208--------------------------------------------------------------------------------
CLPR2_ARATH/79-263--------------------------------------------------------------------------------
CLPP3_SYNY3/13-197--------------------------------------------------------------------------------
CLPP4_STRCO/14-196--------------------------------------------------------------------------------
CLPP2_PSEAE/13-193--------------------------------------------------------------------------------
CLPP_STRSL/10-193--------------------------------------------------------------------------------
CLPP_WHEAT/13-197--------------------------------------------------------------------------------
CLPP2_STRCO/28-210--------------------------------------------------------------------------------
CLPP_AQUAE/19-200--------------------------------------------------------------------------------
Q8W605_9CAUD/17-189--------------------------------------------------------------------------------
CLPP_BUCAP/16-197--------------------------------------------------------------------------------
CLPP3_SYNE7/13-197--------------------------------------------------------------------------------
CLPP2_CHLPN/12-193--------------------------------------------------------------------------------
CLPP1_NOSS1/11-192--------------------------------------------------------------------------------
CLPP_CHAGL/13-197--------------------------------------------------------------------------------
CLPP2_ARATH/41-222--------------------------------------------------------------------------------
CLPP_RALSO/34-215--------------------------------------------------------------------------------
CLPP_AZOBR/20-201--------------------------------------------------------------------------------
CLPP2_SYNY3/32-213--------------------------------------------------------------------------------
Q8ZQG9_SALTY/47-225--------------------------------------------------------------------------------
CLPP_CAMJE/11-192--------------------------------------------------------------------------------
CLPP2_MYXXD/11-192--------------------------------------------------------------------------------
Q8LTH1_9CAUD/11-173--------------------------------------------------------------------------------
Q9VKY3_DROME/38-219--------------------------------------------------------------------------------
CLPP_PARDE/13-195--------------------------------------------------------------------------------

PF08496

SOHB_ECOLI/1-158--------------------------------------------------------------------------------
Q5E611_VIBF1/1-162--------------------------------------------------------------------------------
A6VNT8_ACTSZ/3-162--------------------------------------------------------------------------------
A6B5B8_VIBPA/1-162--------------------------------------------------------------------------------
A4WAZ3_ENT38/1-156--------------------------------------------------------------------------------
Q1YTC2_9GAMM/5-169--------------------------------------------------------------------------------
A6F3C8_9ALTE/1-162--------------------------------------------------------------------------------
A4A337_9GAMM/1-163--------------------------------------------------------------------------------
Q3KBK2_PSEPF/1-148--------------------------------------------------------------------------------
A5IG60_LEGPC/1-132--------------------------------------------------------------------------------
Q1ZKS7_PHOAS/1-162--------------------------------------------------------------------------------
Q02KX5_PSEAB/1-148--------------------------------------------------------------------------------
A1U0U5_MARAV/1-161--------------------------------------------------------------------------------
Q6ML34_BDEBA/1-147--------------------------------------------------------------------------------
Q3IL32_PSEHT/2-148--------------------------------------------------------------------------------
A6FH33_9GAMM/1-168--------------------------------------------------------------------------------
A8H339_SHEPA/1-152--------------------------------------------------------------------------------
A4N5P9_HAEIF/3-161--------------------------------------------------------------------------------
Q9CN58_PASMU/3-161--------------------------------------------------------------------------------
A4SQD5_AERS4/1-146--------------------------------------------------------------------------------
Q8D8J0_VIBVU/1-162--------------------------------------------------------------------------------
Q2NT44_SODGM/1-157--------------------------------------------------------------------------------
A3MY80_ACTP2/3-160--------------------------------------------------------------------------------
Q0HK69_SHESM/1-149--------------------------------------------------------------------------------
A6VW04_MARMS/2-155--------------------------------------------------------------------------------
Q9JYH3_NEIMB/20-177--------------------------------------------------------------------------------
Q15TT9_PSEA6/1-153--------------------------------------------------------------------------------
Q7N4B0_PHOLL/1-157--------------------------------------------------------------------------------
A2P5Z2_VIBCL/4-165--------------------------------------------------------------------------------
Q48IH2_PSE14/1-148--------------------------------------------------------------------------------
Q2BGB6_9GAMM/2-159--------------------------------------------------------------------------------
Q0ABV0_ALHEH/1-149--------------------------------------------------------------------------------
SOHB_BUCBP/1-161--------------------------------------------------------------------------------
Q7VMW6_HAEDU/3-160--------------------------------------------------------------------------------
A8GF70_SERP5/1-157--------------------------------------------------------------------------------
Q21J53_SACD2/1-173--------------------------------------------------------------------------------
Q1ZDS7_9GAMM/1-157--------------------------------------------------------------------------------
A4BQR1_9GAMM/1-148--------------------------------------------------------------------------------
A0YBD9_9GAMM/1-153--------------------------------------------------------------------------------
Q486S9_COLP3/1-158--------------------------------------------------------------------------------
A3JG92_9ALTE/1-170--------------------------------------------------------------------------------
A3YDK4_9GAMM/1-156--------------------------------------------------------------------------------
Q12LC5_SHEDO/1-148--------------------------------------------------------------------------------
Q83EG9_COXBU/7-154--------------------------------------------------------------------------------
SOHB_BUCAP/1-152--------------------------------------------------------------------------------
Q1QW68_CHRSD/2-155--------------------------------------------------------------------------------
A4CBK8_9GAMM/1-146--------------------------------------------------------------------------------
Q2SJ39_HAHCH/1-155--------------------------------------------------------------------------------
A7FI22_YERP3/1-157--------------------------------------------------------------------------------
F2GC42_ALTMD/1-150--------------------------------------------------------------------------------
Q65TF7_MANSM/3-162--------------------------------------------------------------------------------
A4VLP8_PSEU5/21-167--------------------------------------------------------------------------------
Q3JCU0_NITOC/2-143--------------------------------------------------------------------------------
Q0VQ70_ALCBS/2-158--------------------------------------------------------------------------------
SOHB_BUCAI/1-147--------------------------------------------------------------------------------
Q6D4V2_ERWCT/3-159--------------------------------------------------------------------------------
A4XVC0_PSEMY/1-147--------------------------------------------------------------------------------
A1SW75_PSYIN/12-168--------------------------------------------------------------------------------
A7JRK9_PASHA/3-159--------------------------------------------------------------------------------
Q3SFM4_THIDA/2-147--------------------------------------------------------------------------------
C1DKS7_AZOVD/3-150--------------------------------------------------------------------------------
A7JGQ6_FRANO/7-150--------------------------------------------------------------------------------
A0Z237_9GAMM/1-168--------------------------------------------------------------------------------
Q5QYQ0_IDILO/1-143--------------------------------------------------------------------------------
Q080A4_SHEFN/5-151--------------------------------------------------------------------------------
SOHB_BUCSC/1-159--------------------------------------------------------------------------------
A7MN97_CROS8/1-158--------------------------------------------------------------------------------
A1S7G8_SHEAM/1-147--------------------------------------------------------------------------------

PF01343

PFAP_LEPBO/1-153--------------------------------------------------------------------------------
Y651_METJA/110-263--------------------------------------------------------------------------------
O30523_9VIBR/105-255--------------------------------------------------------------------------------
SOHB_HAEIN/163-314--------------------------------------------------------------------------------
O26897_METTH/96-249--------------------------------------------------------------------------------
SPPA_HAEIN/387-539--------------------------------------------------------------------------------
SPPA_SYNY3/126-282--------------------------------------------------------------------------------
SOHB_SHIFL/160-311--------------------------------------------------------------------------------
SPPA_BACSU/129-283--------------------------------------------------------------------------------
P95072_MYCTU/128-283--------------------------------------------------------------------------------
SPPA_ECOLI/140-296--------------------------------------------------------------------------------
SPPA_SYNY3/383-536--------------------------------------------------------------------------------
SPPA_ECOLI/391-543--------------------------------------------------------------------------------
P95072_MYCTU/402-555--------------------------------------------------------------------------------
VCAC_LAMBD/148-300--------------------------------------------------------------------------------
VG05_BPP21/144-296--------------------------------------------------------------------------------
P71127_CAMJU/101-254--------------------------------------------------------------------------------
Y021_SYNY3/67-220--------------------------------------------------------------------------------
O25976_HELPY/103-256--------------------------------------------------------------------------------
SPPA_HAEIN/132-288--------------------------------------------------------------------------------

PF00378

MENB_BACSU/14-259--------------------------------------------------------------------------------
ECHP_HUMAN/4-262--------------------------------------------------------------------------------
PKSH_BACSU/10-251--------------------------------------------------------------------------------
PKSI_BACSU/8-249--------------------------------------------------------------------------------
CAID_ECOLI/6-253--------------------------------------------------------------------------------
ECHA_HUMAN/42-315--------------------------------------------------------------------------------
FADB_PSEFR/10-268--------------------------------------------------------------------------------
ECHM_HUMAN/40-282--------------------------------------------------------------------------------
ECI1_MOUSE/37-283--------------------------------------------------------------------------------
ECHM_CAEEL/38-280--------------------------------------------------------------------------------
ECI1_HUMAN/50-296--------------------------------------------------------------------------------
ECHH_RHOCB/7-249--------------------------------------------------------------------------------
FADB_ECOLI/10-267--------------------------------------------------------------------------------

PF13766

B9A058_HUMAN/37-154--------------------------------------------------------------------------------
B4QYI3_DROSI/224-341--------------------------------------------------------------------------------
B0WY25_CULQU/220-337--------------------------------------------------------------------------------
B9G752_ORYSJ/181-304--------------------------------------------------------------------------------
D3TLD0_GLOMM/247-364--------------------------------------------------------------------------------
B4KAQ0_DROMO/226-344--------------------------------------------------------------------------------
B9IL60_POPTR/222-345--------------------------------------------------------------------------------
B7H599_BACC4/230-347--------------------------------------------------------------------------------
A5BFY2_VITVI/246-369--------------------------------------------------------------------------------
A9SIW3_PHYPA/223-346--------------------------------------------------------------------------------
C6T7J7_SOYBN/264-387--------------------------------------------------------------------------------
C0SE19_PARBP/271-391--------------------------------------------------------------------------------
C5PDB4_COCP7/292-413--------------------------------------------------------------------------------
B9RD44_RICCO/269-392--------------------------------------------------------------------------------
A7GPH6_BACCN/229-346--------------------------------------------------------------------------------
HIBC5_ARATH/263-386--------------------------------------------------------------------------------
Q08V22_STIAD/183-300--------------------------------------------------------------------------------
B7Q287_IXOSC/156-273--------------------------------------------------------------------------------
Q2IY83_RHOP2/228-346--------------------------------------------------------------------------------
A8R3R7_PSEPU/42-163--------------------------------------------------------------------------------
Q1NB11_9SPHN/238-356--------------------------------------------------------------------------------
C6XIW5_HIRBI/216-334--------------------------------------------------------------------------------
D9QHM1_BRESC/216-334--------------------------------------------------------------------------------
A7HX73_PARL1/219-336--------------------------------------------------------------------------------
Q134G5_RHOPS/230-346--------------------------------------------------------------------------------
Q212Q2_RHOPB/228-346--------------------------------------------------------------------------------
B7Q288_IXOSC/259-376--------------------------------------------------------------------------------
B6HLY2_PENCW/268-389--------------------------------------------------------------------------------
B4W849_9CAUL/219-337--------------------------------------------------------------------------------
Q1QKA8_NITHX/229-347--------------------------------------------------------------------------------
C5FQU8_ARTOC/270-391--------------------------------------------------------------------------------
B9TBM0_RICCO/227-344--------------------------------------------------------------------------------
Q0UDB2_PHANO/242-370--------------------------------------------------------------------------------
B8IPL3_METNO/223-343--------------------------------------------------------------------------------
A3IAF9_9BACI/236-353--------------------------------------------------------------------------------
Q1D8V8_MYXXD/230-347--------------------------------------------------------------------------------
D3NUG5_AZOS1/225-342--------------------------------------------------------------------------------
B8BI61_ORYSI/267-391--------------------------------------------------------------------------------
B9MUQ3_POPTR/225-348--------------------------------------------------------------------------------
A4YSR1_BRASO/219-337--------------------------------------------------------------------------------
Q1YU68_9GAMM/224-352--------------------------------------------------------------------------------
B1ZJ11_METPB/263-383--------------------------------------------------------------------------------
Q13IB6_BURXL/234-356--------------------------------------------------------------------------------
B2UHN2_RALPJ/243-369--------------------------------------------------------------------------------
B5GMB4_STRCL/289-407--------------------------------------------------------------------------------
A2WG07_9BURK/236-363--------------------------------------------------------------------------------
B9Z557_9NEIS/241-360--------------------------------------------------------------------------------
B2JLZ0_BURP8/237-363--------------------------------------------------------------------------------
Q1MLQ4_RHIL3/228-346--------------------------------------------------------------------------------
B4RB39_PHEZH/219-337--------------------------------------------------------------------------------
B2W7S4_PYRTR/289-417--------------------------------------------------------------------------------
A0NMD5_9RHOB/218-335--------------------------------------------------------------------------------
B8ESI3_METSB/218-335--------------------------------------------------------------------------------
C9SRJ5_VERA1/267-392--------------------------------------------------------------------------------
Q4KC65_PSEF5/240-361--------------------------------------------------------------------------------
Q2SVM5_BURTA/241-365--------------------------------------------------------------------------------
B9J934_AGRRK/225-343--------------------------------------------------------------------------------
C4WVV0_ACYPI/243-363--------------------------------------------------------------------------------
Q5Z107_NOCFA/222-340--------------------------------------------------------------------------------
A1WLH8_VEREI/235-356--------------------------------------------------------------------------------
Q12AQ1_POLSJ/237-356--------------------------------------------------------------------------------
B1MKI3_MYCA9/216-334--------------------------------------------------------------------------------
Q4ZVK4_PSEU2/240-361--------------------------------------------------------------------------------
E8YRL2_9BURK/242-368--------------------------------------------------------------------------------
C7YU81_NECH7/264-385--------------------------------------------------------------------------------
E8RLF2_ASTEC/222-340--------------------------------------------------------------------------------
Q88H70_PSEPK/234-355--------------------------------------------------------------------------------
B6QX63_9RHOB/228-349--------------------------------------------------------------------------------
Q4DMX9_TRYCC/226-347--------------------------------------------------------------------------------
C3KAC3_PSEFS/239-360--------------------------------------------------------------------------------
B0T1J0_CAUSK/220-338--------------------------------------------------------------------------------
C1DFA4_AZOVD/229-350--------------------------------------------------------------------------------
B4FC76_MAIZE/51-185--------------------------------------------------------------------------------
A1U6V2_MARAV/235-354--------------------------------------------------------------------------------
Q143S2_BURXL/249-375--------------------------------------------------------------------------------
A8L896_FRASN/269-387--------------------------------------------------------------------------------
A3LLW1_PSEAI/235-355--------------------------------------------------------------------------------
B1FYK7_9BURK/243-363--------------------------------------------------------------------------------
A4T9D3_MYCGI/230-348--------------------------------------------------------------------------------
B9B8U0_9BURK/244-367--------------------------------------------------------------------------------
A7INC3_XANP2/220-343--------------------------------------------------------------------------------
B7G076_PHATC/242-366--------------------------------------------------------------------------------
Q1GNL4_SPHAL/222-340--------------------------------------------------------------------------------
B9Z3L5_9NEIS/240-359--------------------------------------------------------------------------------
B8HBE4_ARTCA/223-343--------------------------------------------------------------------------------
A3JYR4_9RHOB/216-334--------------------------------------------------------------------------------
Q4DAM8_TRYCC/234-355--------------------------------------------------------------------------------
A5V401_SPHWW/222-340--------------------------------------------------------------------------------
A3QDJ0_SHELP/243-361--------------------------------------------------------------------------------
A5W4F7_PSEP1/228-349--------------------------------------------------------------------------------
B2JKB1_BURP8/241-361--------------------------------------------------------------------------------
B8K6S2_VIBPA/241-360--------------------------------------------------------------------------------
Q13ZL1_BURXL/241-361--------------------------------------------------------------------------------
Q1VBB4_VIBAL/239-357--------------------------------------------------------------------------------
Q7NWA8_CHRVO/237-355--------------------------------------------------------------------------------
C5CR27_VARPS/239-358--------------------------------------------------------------------------------
A6GRM3_9BURK/262-382--------------------------------------------------------------------------------
Q15XB2_PSEA6/243-360--------------------------------------------------------------------------------
Q2N893_ERYLH/222-342--------------------------------------------------------------------------------
Q7VYA4_BORPE/252-372--------------------------------------------------------------------------------
Q2L131_BORA1/252-372--------------------------------------------------------------------------------
B0CSR7_LACBS/265-392--------------------------------------------------------------------------------
A9INM9_BORPD/252-372--------------------------------------------------------------------------------
B1LX53_METRJ/220-338--------------------------------------------------------------------------------
A3XC08_9RHOB/216-334--------------------------------------------------------------------------------
C5C8N8_MICLC/257-384--------------------------------------------------------------------------------
Q381D8_TRYB2/226-347--------------------------------------------------------------------------------
Q1YGH5_MOBAS/224-342--------------------------------------------------------------------------------
E3IZ76_FRASU/226-344--------------------------------------------------------------------------------
A4BVU9_9GAMM/241-360--------------------------------------------------------------------------------
A3SY56_9RHOB/216-334--------------------------------------------------------------------------------
Q5LRB7_SILPO/216-334--------------------------------------------------------------------------------
Q485B6_COLP3/257-376--------------------------------------------------------------------------------
B9NSD8_9RHOB/216-334--------------------------------------------------------------------------------
Q8PMW0_XANAC/244-363--------------------------------------------------------------------------------
B8KU28_9GAMM/244-363--------------------------------------------------------------------------------
Q4Q4Q4_LEIMA/228-351--------------------------------------------------------------------------------
B8LA21_9GAMM/238-357--------------------------------------------------------------------------------
A6F0M9_9ALTE/235-354--------------------------------------------------------------------------------
C9PG12_VIBFU/216-335--------------------------------------------------------------------------------
B7RWK1_9GAMM/244-363--------------------------------------------------------------------------------
A9D9E4_9RHIZ/215-331--------------------------------------------------------------------------------
Q6BIA2_DEBHA/282-408--------------------------------------------------------------------------------
B2IDI2_BEII9/219-339--------------------------------------------------------------------------------
A3VYK2_9RHOB/217-335--------------------------------------------------------------------------------
Q6LIA0_PHOPR/241-360--------------------------------------------------------------------------------
C9QFQ9_VIBOR/241-360--------------------------------------------------------------------------------
D3DBM7_9ACTO/251-369--------------------------------------------------------------------------------
A9FQT5_9RHOB/216-334--------------------------------------------------------------------------------
B6BEV0_9RHOB/216-334--------------------------------------------------------------------------------
A1SIK1_NOCSJ/213-330--------------------------------------------------------------------------------
A4C9M2_9GAMM/236-355--------------------------------------------------------------------------------
D0L573_GORB4/229-343--------------------------------------------------------------------------------
Q46TC0_CUPPJ/240-362--------------------------------------------------------------------------------
A6AP67_VIBHA/240-359--------------------------------------------------------------------------------
Q28R37_JANSC/214-335--------------------------------------------------------------------------------
Q0RM03_FRAAA/274-392--------------------------------------------------------------------------------
A4SZ56_POLSQ/226-345--------------------------------------------------------------------------------
Q164T3_ROSDO/216-334--------------------------------------------------------------------------------
Q488V8_COLP3/238-357--------------------------------------------------------------------------------
Q3IGC8_PSEHT/246-365--------------------------------------------------------------------------------
Q084X0_SHEFN/240-358--------------------------------------------------------------------------------
E3I3E7_RHOVT/218-336--------------------------------------------------------------------------------
Q6CA37_YARLI/262-380--------------------------------------------------------------------------------
Q0FTH2_9RHOB/216-334--------------------------------------------------------------------------------
B0TMR3_SHEHH/260-386--------------------------------------------------------------------------------
A8FTB5_SHESH/254-372--------------------------------------------------------------------------------
Q8PB61_XANCP/244-363--------------------------------------------------------------------------------
A9DFC7_9GAMM/243-361--------------------------------------------------------------------------------
Q12MV4_SHEDO/240-361--------------------------------------------------------------------------------
Q87II2_VIBPA/240-359--------------------------------------------------------------------------------
A4WS71_RHOS5/212-330--------------------------------------------------------------------------------
A6D633_9VIBR/241-360--------------------------------------------------------------------------------
A9V573_MONBE/229-344--------------------------------------------------------------------------------
A3U2T9_9RHOB/217-331--------------------------------------------------------------------------------
A1K1H9_AZOSB/239-359--------------------------------------------------------------------------------
B8KL52_9GAMM/239-358--------------------------------------------------------------------------------
A3VDC8_9RHOB/216-333--------------------------------------------------------------------------------
B1KMU0_SHEWM/250-368--------------------------------------------------------------------------------
B9W7B3_CANDC/277-400--------------------------------------------------------------------------------
Q2C757_9GAMM/264-383--------------------------------------------------------------------------------
Q1GHN1_SILST/216-334--------------------------------------------------------------------------------
A0Z2J1_9GAMM/235-354--------------------------------------------------------------------------------
B9KJQ6_RHOSK/212-329--------------------------------------------------------------------------------
A4EVS1_9RHOB/216-334--------------------------------------------------------------------------------
C5MFF3_CANTT/281-404--------------------------------------------------------------------------------
A3LXK5_PICST/255-378--------------------------------------------------------------------------------
C7D792_9RHOB/220-337--------------------------------------------------------------------------------
A8LME8_DINSH/216-334--------------------------------------------------------------------------------
D2VUW6_NAEGR/1151-1277--------------------------------------------------------------------------------
B1VFJ2_CORU7/237-360--------------------------------------------------------------------------------
C4R612_PICPG/259-389--------------------------------------------------------------------------------
C0WF71_9CORY/225-342--------------------------------------------------------------------------------
A7TTD5_VANPO/277-405--------------------------------------------------------------------------------
C5DX08_ZYGRC/263-400--------------------------------------------------------------------------------
Q6NI92_CORDI/230-349--------------------------------------------------------------------------------
Q4Q4Q6_LEIMA/230-354--------------------------------------------------------------------------------
Q5KPF9_CRYNJ/272-407--------------------------------------------------------------------------------
Q6FM09_CANGA/273-401--------------------------------------------------------------------------------
C3PF52_CORA7/224-341--------------------------------------------------------------------------------

PF03572

Q8CVF0_LEPIN/340-512--------------------------------------------------------------------------------
RET3_XENLA/1022-1198--------------------------------------------------------------------------------
CTPA_SYNP2/215-376--------------------------------------------------------------------------------
Q81R25_BACAN/181-400--------------------------------------------------------------------------------
Q7UUN0_RHOBA/410-573--------------------------------------------------------------------------------
Q8HXM2_BLABR/30-208--------------------------------------------------------------------------------
Q8Y2I4_RALSO/213-395--------------------------------------------------------------------------------
Q8DII0_THEEB/215-376--------------------------------------------------------------------------------
O57689_DANRE/419-585--------------------------------------------------------------------------------
Q8R712_THETN/193-353--------------------------------------------------------------------------------
Q87YB6_PSESM/365-539--------------------------------------------------------------------------------
TRI_SULSO/887-1042--------------------------------------------------------------------------------
Q7VMG7_HAEDU/365-546--------------------------------------------------------------------------------
Q8R7P6_THETN/299-499--------------------------------------------------------------------------------
Q8A406_BACTN/202-362--------------------------------------------------------------------------------
Q7NKF3_GLOVI/143-304--------------------------------------------------------------------------------
TRI_THEAC/878-1033--------------------------------------------------------------------------------
Q8S3I7_NICPL/284-447--------------------------------------------------------------------------------
O83301_TREPA/167-332--------------------------------------------------------------------------------
Q7TUF4_PROMP/222-383--------------------------------------------------------------------------------
O57689_DANRE/126-302--------------------------------------------------------------------------------
Q87CM3_XYLFT/366-549--------------------------------------------------------------------------------
Q8R6Q0_THETN/169-397--------------------------------------------------------------------------------
O04073_SCEOB/276-438--------------------------------------------------------------------------------
Q87PB1_VIBPA/356-526--------------------------------------------------------------------------------
Q8A2L4_BACTN/546-711--------------------------------------------------------------------------------
Q8EDY9_SHEON/364-534--------------------------------------------------------------------------------
Q97LQ5_CLOAB/210-372--------------------------------------------------------------------------------
O66985_AQUAE/192-355--------------------------------------------------------------------------------
Q9RU43_DEIRA/206-370--------------------------------------------------------------------------------
P73458_SYNY3/220-381--------------------------------------------------------------------------------
Q7UNS4_RHOBA/218-383--------------------------------------------------------------------------------
Q9RUS4_DEIRA/235-411--------------------------------------------------------------------------------
Q894Q8_CLOTE/197-416--------------------------------------------------------------------------------
Q84FE7_MYXXA/208-376--------------------------------------------------------------------------------
Q82BY0_STRAW/878-1033--------------------------------------------------------------------------------
Q8YRM4_NOSS1/218-379--------------------------------------------------------------------------------
Q8CVF1_LEPIN/197-364--------------------------------------------------------------------------------
Q8A5K0_BACTN/312-500--------------------------------------------------------------------------------
Q89KT1_BRAJA/201-369--------------------------------------------------------------------------------
Q8ENJ3_OCEIH/223-384--------------------------------------------------------------------------------
Q8XNN1_CLOPE/231-397--------------------------------------------------------------------------------
Q8P5D2_XANCP/126-301--------------------------------------------------------------------------------
PRC_HAEIN/363-533--------------------------------------------------------------------------------
Q8Y649_LISMO/229-395--------------------------------------------------------------------------------
Q7NHI8_GLOVI/142-311--------------------------------------------------------------------------------
P75023_SYNY3/244-405--------------------------------------------------------------------------------
Q9L5V8_9BACT/892-1048--------------------------------------------------------------------------------
RET3_HUMAN/742-918--------------------------------------------------------------------------------
Q9SVY2_ARATH/303-473--------------------------------------------------------------------------------
Q9A2X1_CAUCR/195-362--------------------------------------------------------------------------------
Q8R7P7_THETN/191-422--------------------------------------------------------------------------------
Y858_CHLTR/316-560--------------------------------------------------------------------------------
Q8FYM8_BRUSU/181-348--------------------------------------------------------------------------------
Q8KAA8_CHLTE/214-383--------------------------------------------------------------------------------
Q8ZXG0_PYRAE/836-991--------------------------------------------------------------------------------
Q7VFQ7_HELHP/223-383--------------------------------------------------------------------------------
Q8A3B9_BACTN/191-351--------------------------------------------------------------------------------
Q92UP4_RHIME/234-388--------------------------------------------------------------------------------
Q7VBS8_PROMA/229-390--------------------------------------------------------------------------------
O23614_ARATH/320-483--------------------------------------------------------------------------------
Q879Y2_XYLFT/195-361--------------------------------------------------------------------------------
RET3_XENLA/721-897--------------------------------------------------------------------------------
Q87CV7_XYLFT/204-366--------------------------------------------------------------------------------
Q815H1_BACCR/212-374--------------------------------------------------------------------------------
Q87UG9_PSESM/211-377--------------------------------------------------------------------------------
Q7V214_PROMP/205-366--------------------------------------------------------------------------------
Q7NPI8_GLOVI/227-389--------------------------------------------------------------------------------
Q9FL23_ARATH/306-469--------------------------------------------------------------------------------
Q82H90_STRAW/894-1049--------------------------------------------------------------------------------
Q893L7_CLOTE/248-394--------------------------------------------------------------------------------
Q9AAF2_CAUCR/247-457--------------------------------------------------------------------------------
Q87Q24_VIBPA/260-446--------------------------------------------------------------------------------
RET3_HUMAN/438-617--------------------------------------------------------------------------------
Q7UJ42_RHOBA/384-569--------------------------------------------------------------------------------
CTPAL_STAES/226-390--------------------------------------------------------------------------------
Q8R7Q0_THETN/178-406--------------------------------------------------------------------------------
Q8R8M1_THETN/207-366--------------------------------------------------------------------------------
Q822D8_CHLCV/312-557--------------------------------------------------------------------------------
Q8YPV0_NOSS1/193-349--------------------------------------------------------------------------------
PRC_ECOLI/356-530--------------------------------------------------------------------------------
RET3_XENLA/127-301--------------------------------------------------------------------------------
Q865N9_FOSFO/35-213--------------------------------------------------------------------------------
Q892K7_CLOTE/192-411--------------------------------------------------------------------------------
NSR_LACLL/123-302--------------------------------------------------------------------------------
Q7X344_9BACT/201-370--------------------------------------------------------------------------------
Q834H3_ENTFA/208-374--------------------------------------------------------------------------------
Q40067_HORVU/170-334--------------------------------------------------------------------------------
Q7PB48_RICSI/193-360--------------------------------------------------------------------------------
Y1016_CHLPN/316-561--------------------------------------------------------------------------------
Q89X80_BRAJA/202-369--------------------------------------------------------------------------------
Q8DGJ2_THEEB/238-398--------------------------------------------------------------------------------
Q9CP01_PASMU/362-532--------------------------------------------------------------------------------
Q896W4_CLOTE/217-379--------------------------------------------------------------------------------
Q7MSB3_WOLSU/198-359--------------------------------------------------------------------------------
Q9WZK6_THEMA/203-364--------------------------------------------------------------------------------
Q8YW78_NOSS1/226-387--------------------------------------------------------------------------------
Q83BH0_COXBU/210-383--------------------------------------------------------------------------------
Q7NSR6_CHRVO/194-376--------------------------------------------------------------------------------
O18857_PHATA/57-235--------------------------------------------------------------------------------
Q9RUA1_DEIRA/235-408--------------------------------------------------------------------------------
Q9A6Q6_CAUCR/254-429--------------------------------------------------------------------------------
Q7MTT6_PORGI/195-361--------------------------------------------------------------------------------
Q9L1S8_STRCO/194-352--------------------------------------------------------------------------------
Q82PY7_STRAW/269-453--------------------------------------------------------------------------------
RET3_HUMAN/1041-1217--------------------------------------------------------------------------------
O30968_NOSP7/217-378--------------------------------------------------------------------------------
Q7MXF8_PORGI/163-329--------------------------------------------------------------------------------
Q8KDJ6_CHLTE/340-525--------------------------------------------------------------------------------
Q8A1T1_BACTN/145-316--------------------------------------------------------------------------------
Q7NGR6_GLOVI/216-377--------------------------------------------------------------------------------
Q8R640_FUSNN/203-364--------------------------------------------------------------------------------
RET3_XENLA/423-598--------------------------------------------------------------------------------
Q82TT8_NITEU/202-384--------------------------------------------------------------------------------
Q7NL17_GLOVI/226-387--------------------------------------------------------------------------------
Q8DZX2_STRA5/125-302--------------------------------------------------------------------------------
CTPA_SYNY3/218-379--------------------------------------------------------------------------------
O25905_HELPY/210-371--------------------------------------------------------------------------------
Q7U4U5_SYNPX/228-389--------------------------------------------------------------------------------
Q7MUB1_PORGI/151-321--------------------------------------------------------------------------------
CTPB_BACSU/213-375--------------------------------------------------------------------------------
O84448_CHLTR/354-525--------------------------------------------------------------------------------
Q8DJ23_THEEB/220-381--------------------------------------------------------------------------------
TRI_THEVO/839-994--------------------------------------------------------------------------------
Q8A7W6_BACTN/916-1071--------------------------------------------------------------------------------
Q9KNC0_VIBCH/209-365--------------------------------------------------------------------------------
Q7U711_SYNPX/231-392--------------------------------------------------------------------------------
Q8YU55_NOSS1/219-380--------------------------------------------------------------------------------
Q8KD83_CHLTE/187-349--------------------------------------------------------------------------------
Q8EBT8_SHEON/888-1043--------------------------------------------------------------------------------
Q8ABF6_BACTN/222-423--------------------------------------------------------------------------------
Q7VS41_BORPE/198-377--------------------------------------------------------------------------------
CTPA_BACSU/201-363--------------------------------------------------------------------------------
TRIC_SULTO/669-824--------------------------------------------------------------------------------
Q9K6X5_BACHD/210-372--------------------------------------------------------------------------------
Q7MVK0_PORGI/205-366--------------------------------------------------------------------------------
Q8P3J7_XANCP/253-471--------------------------------------------------------------------------------
Q89ZW2_BACTN/204-370--------------------------------------------------------------------------------
Q8EKP4_SHEON/197-361--------------------------------------------------------------------------------
Q7TUQ0_PROMM/225-386--------------------------------------------------------------------------------
Q890X6_CLOTE/207-369--------------------------------------------------------------------------------
Q7NPD6_GLOVI/225-386--------------------------------------------------------------------------------

PF03255

ACCA_SHIFL/4-151--------LTAVSRQDEK.-------------------------------------------------------------
ACCA_SYNE7/10-154--------IRTLAA....D-------------------------------------------------------------
ACCA_HELPY/3-141--------.LALIR.....-------------------------------------------------------------
ACCA_HAEIN/4-147--------LRAAS..DDK.-------------------------------------------------------------
ACCA_AQUAE/7-151--------LLGLYR....L-------------------------------------------------------------
ACCA_CHLPN/2-146--------FKEKNK....K-------------------------------------------------------------
ACCA_CYACA/9-153--------LSKLVY....R-------------------------------------------------------------
ACCA_ANTSP/7-151--------LSKMTY....K-------------------------------------------------------------
ACCA_PEA/91-235--------FRKVAE....K-------------------------------------------------------------
Q39833_SOYBN/89-233--------VQKMAN....E-------------------------------------------------------------
ACCA_BACSU/3-147--------LKKFTQ....D-------------------------------------------------------------
ACCA_DEIRA/1-145--------LEATAER....-------------------------------------------------------------
ACCA_PORPU/9-153--------LKRLAP....K-------------------------------------------------------------
P71532_9PROT/2-146--------LRHLS..D.G.-------------------------------------------------------------
ACCA_SYNY3/9-153--------IRELAE....E-------------------------------------------------------------

PF01039

PCCB_SACEN/46-544VFGEK...IVKVMDLAMKT...............GCPLVGINDSGGA....RIQEGVAALGLYAEIFKRNTHASG.VIPQ
ACACB_HUMAN/1780-2334HKGFKYLYLTPQDYTRISSLNSVHC...KHIEEGGESRYMITDIIGKDDG....LGVENLRGSGMIAGESSLAYE.EIVT
PCCB_BACSU/26-505THARK...ICALMDLAAKN...............KAPIIGLNDSGGA....RIQEGVLSLDGYGHIFYRNVLYSG.VIPQ
YNGE_BACSU/27-509KTVEK...IIRIQEIAEKL...............NCPLIYLVDSAGARIT.DQINVFPGRRGAGRIFYNQVKLSG.RIPQ
12S_PROFR/38-522TQSTK...VVETMEQALLT...............GTPFLFFYDSGGA....RIQEGIDSLSGYGKMFFANVKLSG.VVPQ
ACACA_HUMAN/1669-2223YKGYRYLYLTPQDYKRVSALNSVHC...EHVEDEGESRYKITDIIGKEEG....IGPENLRGSGMIAGESSLAYN.EIIT
PCCB_HUMAN/57-537AHAQK...ICKIMDQAITV...............GAPVIGLNDSGGA....RIQEGVESLAGYADIFLRNVTASG.VIPQ
Q39478_9STRA/1471-2014SKGFEYLYLDDATYKSLPEGSVNV....RKVPEG.WA...ITDIIGTNEG....IGVENLQGSGKIAGETSRAYD.EIFT
Q9ZCU2_RICPR/30-512YHAKK...ICDIIDQAIAT...............GAPVIGINDSGGA....RIQEGVDALAGYGELFQRNVLASG.VIPQ
O87201_CORGT/38-535VYGEK...IVKVMDLAIKT...............GVPLIGINEGAGA....RIQEGVVSLGLYSQIFYRNTQASG.VIPQ
ACC1_ARATH/1587-2139ENGFQYIYLSPEDHERIGSSVIAH....EVKLSSGETRWVIDTIVGKEDG....IGVENLTGSGAIAGAYSKAYN.ETFT
Q57079_9FIRM/29-507MHAAK...IVKVQRLAMKM...............GAPIVGINDSGGA....RIQEAVDALAGYGKIFFENTNASG.VIPQ
ACCD_MYCTU/12-482AAAER...ITAAVERATAE..............R.LPLLASPSSGGT....RMQEGTVAFLQMVKIAAAIQLHNQARLPY
O60033_EMEND/1606-2161EAGFKYLYLTPEVKKKFDASKQKEVI.TELIHDEGEERHKITTIIGAKDG....LGVECLKGSGLIAGATSRAYE.DIFT
O06165_MYCTU/41-527MTVKK...HLRAQEVALQN...............MLPCIYLVDSGGA.FLPRQDEVFPDREHFGRIFYNQATMSAKGIPQ
O48959_WHEAT/1642-2195ERGFQYIYLTEEDHARISASVIAH....KMQLDNGEIRWVIDSVVGKEDG....LGVENIHGSAAIASAYSRAYE.ETFT
HFA1_YEAST/1619-2176TKGFQYLYLAPKDMQLLKDSGKGNSVVVEHKMVYGEERYIIKAIVGFEEG....LGVECLQGSGLIAGATSKAYR.DIFT
Q12721_USTMD/1546-2102AKGFEYIYLDDESLQAVQAKAPNSVMTKPVQAADGSVHNIITDIIGKPQGG...LGVECLSGSGLIAGETSRAKD.QIFT
O28066_ARCFU/27-514MHGFK...IAYILDFAMKL...............GIPVVGLNDSGGA....RIQEGVDALKGYGDIFYRNTLASG.VIPQ
O86318_MYCTU/45-527WTLRK...ILRANQIAFEN...............RLPVISLVESGGA.DLPTQKEIFIPG...GQMFRDLTRLSAAGIPT
Q20676_CAEEL/55-534IHAKK...IVKIMREAMLV...............GAPVIGLNDSGGA....RIQEGVESLAGYADIFQENVMASG.VVPQ
PCCB_RHOER/5-474DGCKH...LVKAIDTAIEE...............ESPIVGLWHSGGA....RLAEGVEALHAVGLVFEAMVRASG.LIPQ
Q41511_WHEAT/1583-2142ERGFHYIYLTEQDYSRLSSSVIAHE...LKVPESGETRWVVDTIVGKEDG....LGCENLHGSGAIASAYSKAYR.ETFT
O86517_STRCO/39-525AHATK...IHKIMDMAIAA...............GAPLVSLNDGAGA....RIQEGVSALAGYGGIFQRNTKASG.VIPQ
O52601_SULME/26-513MHASK...IGKVYELALKV...............GAPVIGINDSGGA....RIQEGAASLEGYGLVFKNNVMASG.VIPQ
O24789_MYXXA/32-522AYAQK...ICKIMDLATRV...............GAPVIGLNDSGGA....RIQEGVESLAGYADIFVRNTGCSG.VVPQ
O59018_PYRHO/28-520MHAMK...IKRIMELALEA...............GAPVIGLNDSGGA....RIQEGVDSLKGYGEIFKMNTILSG.VVPQ
PCCB_MYCLE/50-547VYGEK...IVKVQELAIKT...............GRPLIGINDGAGA....RIQEGVVSLGLYSRIFRNNILASG.VIPQ
ACAC_YEAST/1574-2130DKGFQYLYLTSEGMETLKKFDKENSVLTERTVINGEERFVIKTIIGSEDG....LGVECLRGSGLIAGATSRAYH.DIFT
MCCB_ARATH/93-585ITIKK...HLRAQEIAARC...............RLPCIYLVDSGGA.YLPKQAEVFPDKENFGRVFYNESVMSSDGIPQ
ACAC_SCHPO/1615-2170EKGFDYIYLTPEAYERLQKENPNILTTEEVVTETGELRHKITTIIGSSEG....LGVECLRGSGLIAGVTSRAYN.DIFT
MCCB_CAEEL/119-606ITVKK...HLRAQEIAREN...............KLPCIYLVDSGGA.NLPRQADIFADSQHFGRIFYNQATMSSEGIPQ
O88155_CORGT/44-541VYGEK...MIKIMELAIDT...............GRPLIGLYEGAGA....RIQDGAVSLDFISQTFYQNIQASG.VIPQ
GCDA_ACIFV/54-573GQAEC...LLRASDTAKTL...............HVPLVYVLNCSGVKFD.EQEKVYPNRRGGGTPFFRNAELNQLGIPV

PF06833

Q8P4U4_XANCP/5-230--------VIGTAN.....-------------------------------------------------------------
Q89XP1_BRAJA/5-233--------VIGIAN.....-------------------------------------------------------------
Q9I6S6_PSEAE/11-268--------VVPDPDNPFPR-------------------------------------------------------------
O32714_KLEPN/10-266--------VVPDANNHYPR-------------------------------------------------------------
Q89UY5_BRAJA/5-233--------VLGITQ.....-------------------------------------------------------------
O54417_ACICA/5-236--------ILGTVN.....-------------------------------------------------------------
Q93L25_BURCE/5-230--------VIGTTN.....-------------------------------------------------------------
Q87V58_PSESM/9-266--------VIADTNNRFPR-------------------------------------------------------------
Q9Z449_PSEPU/6-260--------VVPDAENPFPR-------------------------------------------------------------

PF01972

Y137_METJA/3-286--------------------------------------------------------------------------------
Y1495_METJA/9-292--------------------------------------------------------------------------------
O29403_ARCFU/7-290--------------------------------------------------------------------------------
O66996_AQUAE/1-288--------------------------------------------------------------------------------

PF00574

Q7XBR2_ORYSJ/73-254--------------------------------------------------------------------------------
CLPP2_BORBU/6-189--------------------------------------------------------------------------------
CLPP1_BORBU/13-194--------------------------------------------------------------------------------
CLPP1_CAEEL/34-215--------------------------------------------------------------------------------
CLPP_OENEH/21-204--------------------------------------------------------------------------------
CLPP4_ARATH/74-253--------------------------------------------------------------------------------
CLPP1_CHLTR/3-189--------------------------------------------------------------------------------
Q9CFR9_LACLA/7-176--------------------------------------------------------------------------------
CLPP1_PSEAE/28-209--------------------------------------------------------------------------------
CLPP_LISIN/12-193--------------------------------------------------------------------------------
Q9EYD3_9VIRU/6-171--------------------------------------------------------------------------------
Q9B0E1_9CAUD/16-186--------------------------------------------------------------------------------
CLPP_BRUME/20-201--------------------------------------------------------------------------------
CLPP2_RHIME/20-201--------------------------------------------------------------------------------
CLPP_CHLMO/342-515--------------------------------------------------------------------------------
Q8P2G1_STRPQ/13-175--------------------------------------------------------------------------------
CLPP_CHLVU/13-196--------------------------------------------------------------------------------
CLPP_NEIMA/16-199--------------------------------------------------------------------------------
CLPP_MESVI/13-196--------------------------------------------------------------------------------
Q98RU2_GUITH/45-228--------------------------------------------------------------------------------
Q9ST19_BRACM/82-261--------------------------------------------------------------------------------
CLPP2_BACHD/13-194--------------------------------------------------------------------------------
CLPP_CAUCR/20-201--------------------------------------------------------------------------------
CLPP5_ARATH/107-288--------------------------------------------------------------------------------
CLPP_MOUSE/63-244--------------------------------------------------------------------------------
CLPP_THETN/12-193--------------------------------------------------------------------------------
O97252_PLAF7/180-359--------------------------------------------------------------------------------
CLPP1_AGRT5/16-197--------------------------------------------------------------------------------
CLPP_XYLFA/19-200--------------------------------------------------------------------------------
Q42886_SOLLC/95-274--------------------------------------------------------------------------------
CLPP1_TREPA/17-198--------------------------------------------------------------------------------
CLPP2_MYCLE/27-207--------------------------------------------------------------------------------
CLPP_STAAW/12-193--------------------------------------------------------------------------------
CLPP_NEPOL/13-196--------------------------------------------------------------------------------
Q8VQM6_BACTU/12-193--------------------------------------------------------------------------------
CLPP_PSINU/13-197--------------------------------------------------------------------------------
CLPP_DEIRA/15-196--------------------------------------------------------------------------------
CLPP1_BACHD/12-193--------------------------------------------------------------------------------
CLPP_THEMA/21-202--------------------------------------------------------------------------------
CLPP2_TREPA/15-193--------------------------------------------------------------------------------
CLPP_CHLTE/37-218--------------------------------------------------------------------------------
TEPA_BACHD/48-232--------------------------------------------------------------------------------
CLPP3_NOSS1/13-196--------------------------------------------------------------------------------
CLPPL_CYAPA/12-197--------------------------------------------------------------------------------
Q92CR8_LISIN/4-186--------------------------------------------------------------------------------
CLPP3_AGRT5/23-198--------------------------------------------------------------------------------
CLPP1_RHILO/16-197--------------------------------------------------------------------------------
CLPP1_SYNE7/10-191--------------------------------------------------------------------------------
Q9XJT4_BPD3/38-211--------------------------------------------------------------------------------
CLPP_PINCO/13-197--------------------------------------------------------------------------------
CLPP_CLOPE/13-194--------------------------------------------------------------------------------
CLPP_RICPR/12-193--------------------------------------------------------------------------------
CLPP2_CORGL/13-195--------------------------------------------------------------------------------
CLPP1_CORGL/24-204--------------------------------------------------------------------------------
CLPP5_STRCO/18-201--------------------------------------------------------------------------------
CLPP_CLOAB/12-193--------------------------------------------------------------------------------
CLPP_HELPJ/12-193--------------------------------------------------------------------------------
CLPP_YEREN/25-206--------------------------------------------------------------------------------
CLPP1_MYCTU/11-193--------------------------------------------------------------------------------
CLPP_HAEIN/12-193--------------------------------------------------------------------------------
CLPP_CHLRE/310-482--------------------------------------------------------------------------------
CLPP1_STRCO/32-208--------------------------------------------------------------------------------
CLPR2_ARATH/79-263--------------------------------------------------------------------------------
CLPP3_SYNY3/13-197--------------------------------------------------------------------------------
CLPP4_STRCO/14-196--------------------------------------------------------------------------------
CLPP2_PSEAE/13-193--------------------------------------------------------------------------------
CLPP_STRSL/10-193--------------------------------------------------------------------------------
CLPP_WHEAT/13-197--------------------------------------------------------------------------------
CLPP2_STRCO/28-210--------------------------------------------------------------------------------
CLPP_AQUAE/19-200--------------------------------------------------------------------------------
Q8W605_9CAUD/17-189--------------------------------------------------------------------------------
CLPP_BUCAP/16-197--------------------------------------------------------------------------------
CLPP3_SYNE7/13-197--------------------------------------------------------------------------------
CLPP2_CHLPN/12-193--------------------------------------------------------------------------------
CLPP1_NOSS1/11-192--------------------------------------------------------------------------------
CLPP_CHAGL/13-197--------------------------------------------------------------------------------
CLPP2_ARATH/41-222--------------------------------------------------------------------------------
CLPP_RALSO/34-215--------------------------------------------------------------------------------
CLPP_AZOBR/20-201--------------------------------------------------------------------------------
CLPP2_SYNY3/32-213--------------------------------------------------------------------------------
Q8ZQG9_SALTY/47-225--------------------------------------------------------------------------------
CLPP_CAMJE/11-192--------------------------------------------------------------------------------
CLPP2_MYXXD/11-192--------------------------------------------------------------------------------
Q8LTH1_9CAUD/11-173--------------------------------------------------------------------------------
Q9VKY3_DROME/38-219--------------------------------------------------------------------------------
CLPP_PARDE/13-195--------------------------------------------------------------------------------

PF08496

SOHB_ECOLI/1-158--------------------------------------------------------------------------------
Q5E611_VIBF1/1-162--------------------------------------------------------------------------------
A6VNT8_ACTSZ/3-162--------------------------------------------------------------------------------
A6B5B8_VIBPA/1-162--------------------------------------------------------------------------------
A4WAZ3_ENT38/1-156--------------------------------------------------------------------------------
Q1YTC2_9GAMM/5-169--------------------------------------------------------------------------------
A6F3C8_9ALTE/1-162--------------------------------------------------------------------------------
A4A337_9GAMM/1-163--------------------------------------------------------------------------------
Q3KBK2_PSEPF/1-148--------------------------------------------------------------------------------
A5IG60_LEGPC/1-132--------------------------------------------------------------------------------
Q1ZKS7_PHOAS/1-162--------------------------------------------------------------------------------
Q02KX5_PSEAB/1-148--------------------------------------------------------------------------------
A1U0U5_MARAV/1-161--------------------------------------------------------------------------------
Q6ML34_BDEBA/1-147--------------------------------------------------------------------------------
Q3IL32_PSEHT/2-148--------------------------------------------------------------------------------
A6FH33_9GAMM/1-168--------------------------------------------------------------------------------
A8H339_SHEPA/1-152--------------------------------------------------------------------------------
A4N5P9_HAEIF/3-161--------------------------------------------------------------------------------
Q9CN58_PASMU/3-161--------------------------------------------------------------------------------
A4SQD5_AERS4/1-146--------------------------------------------------------------------------------
Q8D8J0_VIBVU/1-162--------------------------------------------------------------------------------
Q2NT44_SODGM/1-157--------------------------------------------------------------------------------
A3MY80_ACTP2/3-160--------------------------------------------------------------------------------
Q0HK69_SHESM/1-149--------------------------------------------------------------------------------
A6VW04_MARMS/2-155--------------------------------------------------------------------------------
Q9JYH3_NEIMB/20-177--------------------------------------------------------------------------------
Q15TT9_PSEA6/1-153--------------------------------------------------------------------------------
Q7N4B0_PHOLL/1-157--------------------------------------------------------------------------------
A2P5Z2_VIBCL/4-165--------------------------------------------------------------------------------
Q48IH2_PSE14/1-148--------------------------------------------------------------------------------
Q2BGB6_9GAMM/2-159--------------------------------------------------------------------------------
Q0ABV0_ALHEH/1-149--------------------------------------------------------------------------------
SOHB_BUCBP/1-161--------------------------------------------------------------------------------
Q7VMW6_HAEDU/3-160--------------------------------------------------------------------------------
A8GF70_SERP5/1-157--------------------------------------------------------------------------------
Q21J53_SACD2/1-173--------------------------------------------------------------------------------
Q1ZDS7_9GAMM/1-157--------------------------------------------------------------------------------
A4BQR1_9GAMM/1-148--------------------------------------------------------------------------------
A0YBD9_9GAMM/1-153--------------------------------------------------------------------------------
Q486S9_COLP3/1-158--------------------------------------------------------------------------------
A3JG92_9ALTE/1-170--------------------------------------------------------------------------------
A3YDK4_9GAMM/1-156--------------------------------------------------------------------------------
Q12LC5_SHEDO/1-148--------------------------------------------------------------------------------
Q83EG9_COXBU/7-154--------------------------------------------------------------------------------
SOHB_BUCAP/1-152--------------------------------------------------------------------------------
Q1QW68_CHRSD/2-155--------------------------------------------------------------------------------
A4CBK8_9GAMM/1-146--------------------------------------------------------------------------------
Q2SJ39_HAHCH/1-155--------------------------------------------------------------------------------
A7FI22_YERP3/1-157--------------------------------------------------------------------------------
F2GC42_ALTMD/1-150--------------------------------------------------------------------------------
Q65TF7_MANSM/3-162--------------------------------------------------------------------------------
A4VLP8_PSEU5/21-167--------------------------------------------------------------------------------
Q3JCU0_NITOC/2-143--------------------------------------------------------------------------------
Q0VQ70_ALCBS/2-158--------------------------------------------------------------------------------
SOHB_BUCAI/1-147--------------------------------------------------------------------------------
Q6D4V2_ERWCT/3-159--------------------------------------------------------------------------------
A4XVC0_PSEMY/1-147--------------------------------------------------------------------------------
A1SW75_PSYIN/12-168--------------------------------------------------------------------------------
A7JRK9_PASHA/3-159--------------------------------------------------------------------------------
Q3SFM4_THIDA/2-147--------------------------------------------------------------------------------
C1DKS7_AZOVD/3-150--------------------------------------------------------------------------------
A7JGQ6_FRANO/7-150--------------------------------------------------------------------------------
A0Z237_9GAMM/1-168--------------------------------------------------------------------------------
Q5QYQ0_IDILO/1-143--------------------------------------------------------------------------------
Q080A4_SHEFN/5-151--------------------------------------------------------------------------------
SOHB_BUCSC/1-159--------------------------------------------------------------------------------
A7MN97_CROS8/1-158--------------------------------------------------------------------------------
A1S7G8_SHEAM/1-147--------------------------------------------------------------------------------

PF01343

PFAP_LEPBO/1-153--------------------------------------------------------------------------------
Y651_METJA/110-263--------------------------------------------------------------------------------
O30523_9VIBR/105-255--------------------------------------------------------------------------------
SOHB_HAEIN/163-314--------------------------------------------------------------------------------
O26897_METTH/96-249--------------------------------------------------------------------------------
SPPA_HAEIN/387-539--------------------------------------------------------------------------------
SPPA_SYNY3/126-282--------------------------------------------------------------------------------
SOHB_SHIFL/160-311--------------------------------------------------------------------------------
SPPA_BACSU/129-283--------------------------------------------------------------------------------
P95072_MYCTU/128-283--------------------------------------------------------------------------------
SPPA_ECOLI/140-296--------------------------------------------------------------------------------
SPPA_SYNY3/383-536--------------------------------------------------------------------------------
SPPA_ECOLI/391-543--------------------------------------------------------------------------------
P95072_MYCTU/402-555--------------------------------------------------------------------------------
VCAC_LAMBD/148-300--------------------------------------------------------------------------------
VG05_BPP21/144-296--------------------------------------------------------------------------------
P71127_CAMJU/101-254--------------------------------------------------------------------------------
Y021_SYNY3/67-220--------------------------------------------------------------------------------
O25976_HELPY/103-256--------------------------------------------------------------------------------
SPPA_HAEIN/132-288--------------------------------------------------------------------------------

PF00378

MENB_BACSU/14-259----------------------------------------------------------------------------LYET
ECHP_HUMAN/4-262----------------------------------------------------------------------------YTRL
PKSH_BACSU/10-251----------------------------------------------------------------------------KVRF
PKSI_BACSU/8-249----------------------------------------------------------------------------LIEI
CAID_ECOLI/6-253----------------------------------------------------------------------------HLTR
ECHA_HUMAN/42-315----------------------------------------------------------------------------NYGV
FADB_PSEFR/10-268----------------------------------------------------------------------------VTAL
ECHM_HUMAN/40-282----------------------------------------------------------------------------KRGK
ECI1_MOUSE/37-283----------------------------------------------------------------------------ETEG
ECHM_CAEEL/38-280----------------------------------------------------------------------------KVGE
ECI1_HUMAN/50-296----------------------------------------------------------------------------EPDA
ECHH_RHOCB/7-249----------------------------------------------------------------------------RYEI
FADB_ECOLI/10-267----------------------------------------------------------------------------LDWL

PF13766

B9A058_HUMAN/37-154--------------------------------------------------------------------------------
B4QYI3_DROSI/224-341--------------------------------------------------------------------------------
B0WY25_CULQU/220-337--------------------------------------------------------------------------------
B9G752_ORYSJ/181-304--------------------------------------------------------------------------------
D3TLD0_GLOMM/247-364--------------------------------------------------------------------------------
B4KAQ0_DROMO/226-344--------------------------------------------------------------------------------
B9IL60_POPTR/222-345--------------------------------------------------------------------------------
B7H599_BACC4/230-347--------------------------------------------------------------------------------
A5BFY2_VITVI/246-369--------------------------------------------------------------------------------
A9SIW3_PHYPA/223-346--------------------------------------------------------------------------------
C6T7J7_SOYBN/264-387--------------------------------------------------------------------------------
C0SE19_PARBP/271-391--------------------------------------------------------------------------------
C5PDB4_COCP7/292-413--------------------------------------------------------------------------------
B9RD44_RICCO/269-392--------------------------------------------------------------------------------
A7GPH6_BACCN/229-346--------------------------------------------------------------------------------
HIBC5_ARATH/263-386--------------------------------------------------------------------------------
Q08V22_STIAD/183-300--------------------------------------------------------------------------------
B7Q287_IXOSC/156-273--------------------------------------------------------------------------------
Q2IY83_RHOP2/228-346--------------------------------------------------------------------------------
A8R3R7_PSEPU/42-163--------------------------------------------------------------------------------
Q1NB11_9SPHN/238-356--------------------------------------------------------------------------------
C6XIW5_HIRBI/216-334--------------------------------------------------------------------------------
D9QHM1_BRESC/216-334--------------------------------------------------------------------------------
A7HX73_PARL1/219-336--------------------------------------------------------------------------------
Q134G5_RHOPS/230-346--------------------------------------------------------------------------------
Q212Q2_RHOPB/228-346--------------------------------------------------------------------------------
B7Q288_IXOSC/259-376--------------------------------------------------------------------------------
B6HLY2_PENCW/268-389--------------------------------------------------------------------------------
B4W849_9CAUL/219-337--------------------------------------------------------------------------------
Q1QKA8_NITHX/229-347--------------------------------------------------------------------------------
C5FQU8_ARTOC/270-391--------------------------------------------------------------------------------
B9TBM0_RICCO/227-344--------------------------------------------------------------------------------
Q0UDB2_PHANO/242-370--------------------------------------------------------------------------------
B8IPL3_METNO/223-343--------------------------------------------------------------------------------
A3IAF9_9BACI/236-353--------------------------------------------------------------------------------
Q1D8V8_MYXXD/230-347--------------------------------------------------------------------------------
D3NUG5_AZOS1/225-342--------------------------------------------------------------------------------
B8BI61_ORYSI/267-391--------------------------------------------------------------------------------
B9MUQ3_POPTR/225-348--------------------------------------------------------------------------------
A4YSR1_BRASO/219-337--------------------------------------------------------------------------------
Q1YU68_9GAMM/224-352--------------------------------------------------------------------------------
B1ZJ11_METPB/263-383--------------------------------------------------------------------------------
Q13IB6_BURXL/234-356--------------------------------------------------------------------------------
B2UHN2_RALPJ/243-369--------------------------------------------------------------------------------
B5GMB4_STRCL/289-407--------------------------------------------------------------------------------
A2WG07_9BURK/236-363--------------------------------------------------------------------------------
B9Z557_9NEIS/241-360--------------------------------------------------------------------------------
B2JLZ0_BURP8/237-363--------------------------------------------------------------------------------
Q1MLQ4_RHIL3/228-346--------------------------------------------------------------------------------
B4RB39_PHEZH/219-337--------------------------------------------------------------------------------
B2W7S4_PYRTR/289-417--------------------------------------------------------------------------------
A0NMD5_9RHOB/218-335--------------------------------------------------------------------------------
B8ESI3_METSB/218-335--------------------------------------------------------------------------------
C9SRJ5_VERA1/267-392--------------------------------------------------------------------------------
Q4KC65_PSEF5/240-361--------------------------------------------------------------------------------
Q2SVM5_BURTA/241-365--------------------------------------------------------------------------------
B9J934_AGRRK/225-343--------------------------------------------------------------------------------
C4WVV0_ACYPI/243-363--------------------------------------------------------------------------------
Q5Z107_NOCFA/222-340--------------------------------------------------------------------------------
A1WLH8_VEREI/235-356--------------------------------------------------------------------------------
Q12AQ1_POLSJ/237-356--------------------------------------------------------------------------------
B1MKI3_MYCA9/216-334--------------------------------------------------------------------------------
Q4ZVK4_PSEU2/240-361--------------------------------------------------------------------------------
E8YRL2_9BURK/242-368--------------------------------------------------------------------------------
C7YU81_NECH7/264-385--------------------------------------------------------------------------------
E8RLF2_ASTEC/222-340--------------------------------------------------------------------------------
Q88H70_PSEPK/234-355--------------------------------------------------------------------------------
B6QX63_9RHOB/228-349--------------------------------------------------------------------------------
Q4DMX9_TRYCC/226-347--------------------------------------------------------------------------------
C3KAC3_PSEFS/239-360--------------------------------------------------------------------------------
B0T1J0_CAUSK/220-338--------------------------------------------------------------------------------
C1DFA4_AZOVD/229-350--------------------------------------------------------------------------------
B4FC76_MAIZE/51-185--------------------------------------------------------------------------------
A1U6V2_MARAV/235-354--------------------------------------------------------------------------------
Q143S2_BURXL/249-375--------------------------------------------------------------------------------
A8L896_FRASN/269-387--------------------------------------------------------------------------------
A3LLW1_PSEAI/235-355--------------------------------------------------------------------------------
B1FYK7_9BURK/243-363--------------------------------------------------------------------------------
A4T9D3_MYCGI/230-348--------------------------------------------------------------------------------
B9B8U0_9BURK/244-367--------------------------------------------------------------------------------
A7INC3_XANP2/220-343--------------------------------------------------------------------------------
B7G076_PHATC/242-366--------------------------------------------------------------------------------
Q1GNL4_SPHAL/222-340--------------------------------------------------------------------------------
B9Z3L5_9NEIS/240-359--------------------------------------------------------------------------------
B8HBE4_ARTCA/223-343--------------------------------------------------------------------------------
A3JYR4_9RHOB/216-334--------------------------------------------------------------------------------
Q4DAM8_TRYCC/234-355--------------------------------------------------------------------------------
A5V401_SPHWW/222-340--------------------------------------------------------------------------------
A3QDJ0_SHELP/243-361--------------------------------------------------------------------------------
A5W4F7_PSEP1/228-349--------------------------------------------------------------------------------
B2JKB1_BURP8/241-361--------------------------------------------------------------------------------
B8K6S2_VIBPA/241-360--------------------------------------------------------------------------------
Q13ZL1_BURXL/241-361--------------------------------------------------------------------------------
Q1VBB4_VIBAL/239-357--------------------------------------------------------------------------------
Q7NWA8_CHRVO/237-355--------------------------------------------------------------------------------
C5CR27_VARPS/239-358--------------------------------------------------------------------------------
A6GRM3_9BURK/262-382--------------------------------------------------------------------------------
Q15XB2_PSEA6/243-360--------------------------------------------------------------------------------
Q2N893_ERYLH/222-342--------------------------------------------------------------------------------
Q7VYA4_BORPE/252-372--------------------------------------------------------------------------------
Q2L131_BORA1/252-372--------------------------------------------------------------------------------
B0CSR7_LACBS/265-392--------------------------------------------------------------------------------
A9INM9_BORPD/252-372--------------------------------------------------------------------------------
B1LX53_METRJ/220-338--------------------------------------------------------------------------------
A3XC08_9RHOB/216-334--------------------------------------------------------------------------------
C5C8N8_MICLC/257-384--------------------------------------------------------------------------------
Q381D8_TRYB2/226-347--------------------------------------------------------------------------------
Q1YGH5_MOBAS/224-342--------------------------------------------------------------------------------
E3IZ76_FRASU/226-344--------------------------------------------------------------------------------
A4BVU9_9GAMM/241-360--------------------------------------------------------------------------------
A3SY56_9RHOB/216-334--------------------------------------------------------------------------------
Q5LRB7_SILPO/216-334--------------------------------------------------------------------------------
Q485B6_COLP3/257-376--------------------------------------------------------------------------------
B9NSD8_9RHOB/216-334--------------------------------------------------------------------------------
Q8PMW0_XANAC/244-363--------------------------------------------------------------------------------
B8KU28_9GAMM/244-363--------------------------------------------------------------------------------
Q4Q4Q4_LEIMA/228-351--------------------------------------------------------------------------------
B8LA21_9GAMM/238-357--------------------------------------------------------------------------------
A6F0M9_9ALTE/235-354--------------------------------------------------------------------------------
C9PG12_VIBFU/216-335--------------------------------------------------------------------------------
B7RWK1_9GAMM/244-363--------------------------------------------------------------------------------
A9D9E4_9RHIZ/215-331--------------------------------------------------------------------------------
Q6BIA2_DEBHA/282-408--------------------------------------------------------------------------------
B2IDI2_BEII9/219-339--------------------------------------------------------------------------------
A3VYK2_9RHOB/217-335--------------------------------------------------------------------------------
Q6LIA0_PHOPR/241-360--------------------------------------------------------------------------------
C9QFQ9_VIBOR/241-360--------------------------------------------------------------------------------
D3DBM7_9ACTO/251-369--------------------------------------------------------------------------------
A9FQT5_9RHOB/216-334--------------------------------------------------------------------------------
B6BEV0_9RHOB/216-334--------------------------------------------------------------------------------
A1SIK1_NOCSJ/213-330--------------------------------------------------------------------------------
A4C9M2_9GAMM/236-355--------------------------------------------------------------------------------
D0L573_GORB4/229-343--------------------------------------------------------------------------------
Q46TC0_CUPPJ/240-362--------------------------------------------------------------------------------
A6AP67_VIBHA/240-359--------------------------------------------------------------------------------
Q28R37_JANSC/214-335--------------------------------------------------------------------------------
Q0RM03_FRAAA/274-392--------------------------------------------------------------------------------
A4SZ56_POLSQ/226-345--------------------------------------------------------------------------------
Q164T3_ROSDO/216-334--------------------------------------------------------------------------------
Q488V8_COLP3/238-357--------------------------------------------------------------------------------
Q3IGC8_PSEHT/246-365--------------------------------------------------------------------------------
Q084X0_SHEFN/240-358--------------------------------------------------------------------------------
E3I3E7_RHOVT/218-336--------------------------------------------------------------------------------
Q6CA37_YARLI/262-380--------------------------------------------------------------------------------
Q0FTH2_9RHOB/216-334--------------------------------------------------------------------------------
B0TMR3_SHEHH/260-386--------------------------------------------------------------------------------
A8FTB5_SHESH/254-372--------------------------------------------------------------------------------
Q8PB61_XANCP/244-363--------------------------------------------------------------------------------
A9DFC7_9GAMM/243-361--------------------------------------------------------------------------------
Q12MV4_SHEDO/240-361--------------------------------------------------------------------------------
Q87II2_VIBPA/240-359--------------------------------------------------------------------------------
A4WS71_RHOS5/212-330--------------------------------------------------------------------------------
A6D633_9VIBR/241-360--------------------------------------------------------------------------------
A9V573_MONBE/229-344--------------------------------------------------------------------------------
A3U2T9_9RHOB/217-331--------------------------------------------------------------------------------
A1K1H9_AZOSB/239-359--------------------------------------------------------------------------------
B8KL52_9GAMM/239-358--------------------------------------------------------------------------------
A3VDC8_9RHOB/216-333--------------------------------------------------------------------------------
B1KMU0_SHEWM/250-368--------------------------------------------------------------------------------
B9W7B3_CANDC/277-400--------------------------------------------------------------------------------
Q2C757_9GAMM/264-383--------------------------------------------------------------------------------
Q1GHN1_SILST/216-334--------------------------------------------------------------------------------
A0Z2J1_9GAMM/235-354--------------------------------------------------------------------------------
B9KJQ6_RHOSK/212-329--------------------------------------------------------------------------------
A4EVS1_9RHOB/216-334--------------------------------------------------------------------------------
C5MFF3_CANTT/281-404--------------------------------------------------------------------------------
A3LXK5_PICST/255-378--------------------------------------------------------------------------------
C7D792_9RHOB/220-337--------------------------------------------------------------------------------
A8LME8_DINSH/216-334--------------------------------------------------------------------------------
D2VUW6_NAEGR/1151-1277--------------------------------------------------------------------------------
B1VFJ2_CORU7/237-360--------------------------------------------------------------------------------
C4R612_PICPG/259-389--------------------------------------------------------------------------------
C0WF71_9CORY/225-342--------------------------------------------------------------------------------
A7TTD5_VANPO/277-405--------------------------------------------------------------------------------
C5DX08_ZYGRC/263-400--------------------------------------------------------------------------------
Q6NI92_CORDI/230-349--------------------------------------------------------------------------------
Q4Q4Q6_LEIMA/230-354--------------------------------------------------------------------------------
Q5KPF9_CRYNJ/272-407--------------------------------------------------------------------------------
Q6FM09_CANGA/273-401--------------------------------------------------------------------------------
C3PF52_CORA7/224-341--------------------------------------------------------------------------------

PF03572

Q8CVF0_LEPIN/340-512--------------------------------------------------------------------------------
RET3_XENLA/1022-1198--------------------------------------------------------------------------------
CTPA_SYNP2/215-376--------------------------------------------------------------------------------
Q81R25_BACAN/181-400--------------------------------------------------------------------------------
Q7UUN0_RHOBA/410-573--------------------------------------------------------------------------------
Q8HXM2_BLABR/30-208--------------------------------------------------------------------------------
Q8Y2I4_RALSO/213-395--------------------------------------------------------------------------------
Q8DII0_THEEB/215-376--------------------------------------------------------------------------------
O57689_DANRE/419-585--------------------------------------------------------------------------------
Q8R712_THETN/193-353--------------------------------------------------------------------------------
Q87YB6_PSESM/365-539--------------------------------------------------------------------------------
TRI_SULSO/887-1042--------------------------------------------------------------------------------
Q7VMG7_HAEDU/365-546--------------------------------------------------------------------------------
Q8R7P6_THETN/299-499--------------------------------------------------------------------------------
Q8A406_BACTN/202-362--------------------------------------------------------------------------------
Q7NKF3_GLOVI/143-304--------------------------------------------------------------------------------
TRI_THEAC/878-1033--------------------------------------------------------------------------------
Q8S3I7_NICPL/284-447--------------------------------------------------------------------------------
O83301_TREPA/167-332--------------------------------------------------------------------------------
Q7TUF4_PROMP/222-383--------------------------------------------------------------------------------
O57689_DANRE/126-302--------------------------------------------------------------------------------
Q87CM3_XYLFT/366-549--------------------------------------------------------------------------------
Q8R6Q0_THETN/169-397--------------------------------------------------------------------------------
O04073_SCEOB/276-438--------------------------------------------------------------------------------
Q87PB1_VIBPA/356-526--------------------------------------------------------------------------------
Q8A2L4_BACTN/546-711--------------------------------------------------------------------------------
Q8EDY9_SHEON/364-534--------------------------------------------------------------------------------
Q97LQ5_CLOAB/210-372--------------------------------------------------------------------------------
O66985_AQUAE/192-355--------------------------------------------------------------------------------
Q9RU43_DEIRA/206-370--------------------------------------------------------------------------------
P73458_SYNY3/220-381--------------------------------------------------------------------------------
Q7UNS4_RHOBA/218-383--------------------------------------------------------------------------------
Q9RUS4_DEIRA/235-411--------------------------------------------------------------------------------
Q894Q8_CLOTE/197-416--------------------------------------------------------------------------------
Q84FE7_MYXXA/208-376--------------------------------------------------------------------------------
Q82BY0_STRAW/878-1033--------------------------------------------------------------------------------
Q8YRM4_NOSS1/218-379--------------------------------------------------------------------------------
Q8CVF1_LEPIN/197-364--------------------------------------------------------------------------------
Q8A5K0_BACTN/312-500--------------------------------------------------------------------------------
Q89KT1_BRAJA/201-369--------------------------------------------------------------------------------
Q8ENJ3_OCEIH/223-384--------------------------------------------------------------------------------
Q8XNN1_CLOPE/231-397--------------------------------------------------------------------------------
Q8P5D2_XANCP/126-301--------------------------------------------------------------------------------
PRC_HAEIN/363-533--------------------------------------------------------------------------------
Q8Y649_LISMO/229-395--------------------------------------------------------------------------------
Q7NHI8_GLOVI/142-311--------------------------------------------------------------------------------
P75023_SYNY3/244-405--------------------------------------------------------------------------------
Q9L5V8_9BACT/892-1048--------------------------------------------------------------------------------
RET3_HUMAN/742-918--------------------------------------------------------------------------------
Q9SVY2_ARATH/303-473--------------------------------------------------------------------------------
Q9A2X1_CAUCR/195-362--------------------------------------------------------------------------------
Q8R7P7_THETN/191-422--------------------------------------------------------------------------------
Y858_CHLTR/316-560--------------------------------------------------------------------------------
Q8FYM8_BRUSU/181-348--------------------------------------------------------------------------------
Q8KAA8_CHLTE/214-383--------------------------------------------------------------------------------
Q8ZXG0_PYRAE/836-991--------------------------------------------------------------------------------
Q7VFQ7_HELHP/223-383--------------------------------------------------------------------------------
Q8A3B9_BACTN/191-351--------------------------------------------------------------------------------
Q92UP4_RHIME/234-388--------------------------------------------------------------------------------
Q7VBS8_PROMA/229-390--------------------------------------------------------------------------------
O23614_ARATH/320-483--------------------------------------------------------------------------------
Q879Y2_XYLFT/195-361--------------------------------------------------------------------------------
RET3_XENLA/721-897--------------------------------------------------------------------------------
Q87CV7_XYLFT/204-366--------------------------------------------------------------------------------
Q815H1_BACCR/212-374--------------------------------------------------------------------------------
Q87UG9_PSESM/211-377--------------------------------------------------------------------------------
Q7V214_PROMP/205-366--------------------------------------------------------------------------------
Q7NPI8_GLOVI/227-389--------------------------------------------------------------------------------
Q9FL23_ARATH/306-469--------------------------------------------------------------------------------
Q82H90_STRAW/894-1049--------------------------------------------------------------------------------
Q893L7_CLOTE/248-394--------------------------------------------------------------------------------
Q9AAF2_CAUCR/247-457--------------------------------------------------------------------------------
Q87Q24_VIBPA/260-446--------------------------------------------------------------------------------
RET3_HUMAN/438-617--------------------------------------------------------------------------------
Q7UJ42_RHOBA/384-569--------------------------------------------------------------------------------
CTPAL_STAES/226-390--------------------------------------------------------------------------------
Q8R7Q0_THETN/178-406--------------------------------------------------------------------------------
Q8R8M1_THETN/207-366--------------------------------------------------------------------------------
Q822D8_CHLCV/312-557--------------------------------------------------------------------------------
Q8YPV0_NOSS1/193-349--------------------------------------------------------------------------------
PRC_ECOLI/356-530--------------------------------------------------------------------------------
RET3_XENLA/127-301--------------------------------------------------------------------------------
Q865N9_FOSFO/35-213--------------------------------------------------------------------------------
Q892K7_CLOTE/192-411--------------------------------------------------------------------------------
NSR_LACLL/123-302--------------------------------------------------------------------------------
Q7X344_9BACT/201-370--------------------------------------------------------------------------------
Q834H3_ENTFA/208-374--------------------------------------------------------------------------------
Q40067_HORVU/170-334--------------------------------------------------------------------------------
Q7PB48_RICSI/193-360--------------------------------------------------------------------------------
Y1016_CHLPN/316-561--------------------------------------------------------------------------------
Q89X80_BRAJA/202-369--------------------------------------------------------------------------------
Q8DGJ2_THEEB/238-398--------------------------------------------------------------------------------
Q9CP01_PASMU/362-532--------------------------------------------------------------------------------
Q896W4_CLOTE/217-379--------------------------------------------------------------------------------
Q7MSB3_WOLSU/198-359--------------------------------------------------------------------------------
Q9WZK6_THEMA/203-364--------------------------------------------------------------------------------
Q8YW78_NOSS1/226-387--------------------------------------------------------------------------------
Q83BH0_COXBU/210-383--------------------------------------------------------------------------------
Q7NSR6_CHRVO/194-376--------------------------------------------------------------------------------
O18857_PHATA/57-235--------------------------------------------------------------------------------
Q9RUA1_DEIRA/235-408--------------------------------------------------------------------------------
Q9A6Q6_CAUCR/254-429--------------------------------------------------------------------------------
Q7MTT6_PORGI/195-361--------------------------------------------------------------------------------
Q9L1S8_STRCO/194-352--------------------------------------------------------------------------------
Q82PY7_STRAW/269-453--------------------------------------------------------------------------------
RET3_HUMAN/1041-1217--------------------------------------------------------------------------------
O30968_NOSP7/217-378--------------------------------------------------------------------------------
Q7MXF8_PORGI/163-329--------------------------------------------------------------------------------
Q8KDJ6_CHLTE/340-525--------------------------------------------------------------------------------
Q8A1T1_BACTN/145-316--------------------------------------------------------------------------------
Q7NGR6_GLOVI/216-377--------------------------------------------------------------------------------
Q8R640_FUSNN/203-364--------------------------------------------------------------------------------
RET3_XENLA/423-598--------------------------------------------------------------------------------
Q82TT8_NITEU/202-384--------------------------------------------------------------------------------
Q7NL17_GLOVI/226-387--------------------------------------------------------------------------------
Q8DZX2_STRA5/125-302--------------------------------------------------------------------------------
CTPA_SYNY3/218-379--------------------------------------------------------------------------------
O25905_HELPY/210-371--------------------------------------------------------------------------------
Q7U4U5_SYNPX/228-389--------------------------------------------------------------------------------
Q7MUB1_PORGI/151-321--------------------------------------------------------------------------------
CTPB_BACSU/213-375--------------------------------------------------------------------------------
O84448_CHLTR/354-525--------------------------------------------------------------------------------
Q8DJ23_THEEB/220-381--------------------------------------------------------------------------------
TRI_THEVO/839-994--------------------------------------------------------------------------------
Q8A7W6_BACTN/916-1071--------------------------------------------------------------------------------
Q9KNC0_VIBCH/209-365--------------------------------------------------------------------------------
Q7U711_SYNPX/231-392--------------------------------------------------------------------------------
Q8YU55_NOSS1/219-380--------------------------------------------------------------------------------
Q8KD83_CHLTE/187-349--------------------------------------------------------------------------------
Q8EBT8_SHEON/888-1043--------------------------------------------------------------------------------
Q8ABF6_BACTN/222-423--------------------------------------------------------------------------------
Q7VS41_BORPE/198-377--------------------------------------------------------------------------------
CTPA_BACSU/201-363--------------------------------------------------------------------------------
TRIC_SULTO/669-824--------------------------------------------------------------------------------
Q9K6X5_BACHD/210-372--------------------------------------------------------------------------------
Q7MVK0_PORGI/205-366--------------------------------------------------------------------------------
Q8P3J7_XANCP/253-471--------------------------------------------------------------------------------
Q89ZW2_BACTN/204-370--------------------------------------------------------------------------------
Q8EKP4_SHEON/197-361--------------------------------------------------------------------------------
Q7TUQ0_PROMM/225-386--------------------------------------------------------------------------------
Q890X6_CLOTE/207-369--------------------------------------------------------------------------------
Q7NPD6_GLOVI/225-386--------------------------------------------------------------------------------

PF03255

ACCA_SHIFL/4-151--------------------------------------------------------------------------------
ACCA_SYNE7/10-154--------------------------------------------------------------------------------
ACCA_HELPY/3-141--------------------------------------------------------------------------------
ACCA_HAEIN/4-147--------------------------------------------------------------------------------
ACCA_AQUAE/7-151--------------------------------------------------------------------------------
ACCA_CHLPN/2-146--------------------------------------------------------------------------------
ACCA_CYACA/9-153--------------------------------------------------------------------------------
ACCA_ANTSP/7-151--------------------------------------------------------------------------------
ACCA_PEA/91-235--------------------------------------------------------------------------------
Q39833_SOYBN/89-233--------------------------------------------------------------------------------
ACCA_BACSU/3-147--------------------------------------------------------------------------------
ACCA_DEIRA/1-145--------------------------------------------------------------------------------
ACCA_PORPU/9-153--------------------------------------------------------------------------------
P71532_9PROT/2-146--------------------------------------------------------------------------------
ACCA_SYNY3/9-153--------------------------------------------------------------------------------

PF01039

PCCB_SACEN/46-544ISLIMGPCAGGAVYSPAITDFTVMVDQ.TSHMFITGPDVIK..............TVTG..EDVSFEDLGGARTHNERSG
ACACB_HUMAN/1780-2334ISLVTCRAIGIGAYLVRLGQRVIQVEN..SHIILTGASALN..............KVLG.REVYTSNNQLGGVQIMHYNG
PCCB_BACSU/26-505ISVILGPCAGGAVYSPALTDFIFMAEQ.TGRMFITGPKVIE..............KVTG..EQVDAESLGGAGIHNAVSG
YNGE_BACSU/27-509ICLLFGPSAAGGAYIPAFCDIVVMVDG.NASMYLGSPRMAE..............MVIG..EKVSLEEMGGARMHCSISG
12S_PROFR/38-522IAIIAGPCAGGASYSPALTDFIIMTKK..AHMFITGPQVIK..............SVTG..EDVTADELGGAEAHMAISG
ACACA_HUMAN/1669-2223ISLVTCRAIGIGAYLVRLGQRTIQVEN..SHLILTGAGALN..............KVLG.REVYTSNNQLGGIQIMHNNG
PCCB_HUMAN/57-537ISLIMGPCAGGAVYSPALTDFTFMVKD.TSYLFITGPDVVK..............SVTN..EDVTQEELGGAKTHTTMSG
Q39478_9STRA/1471-2014LSYVTGRSVGIGAYLVRLGQRIIQMKQ..GPMILTGYGALN..............KLLG.REVYNSNDQLGGPQVMFPNG
Q9ZCU2_RICPR/30-512ITLIMGPCAGGAVYSPALTDFIFMVKN.SSYMFVTGPDVVK..............TVTG..EEVTQEKLGGARMHTTKSG
O87201_CORGT/38-535ISLIMGACAGGHVYSPALTDFIVMVDQ.TSKMFITGPDVIK..............TVTG..EDVTQEELGGAHTHMATSG
ACC1_ARATH/1587-2139LTFVSGRTVGIGAYLARLGMRCIQRLD..QPIILTGFSTLN..............KLLG.REVYSSHMQLGGPKIMGTNG
Q57079_9FIRM/29-507ISVIMGPCAGGAVYSPALTDFIYMVKN.TSQMFITGPAVIK..............SVTG..EEVTAEDLGGAMAHNSVSG
ACCD_MYCTU/12-482LVYLRHPTTG.GVFASWGSLGHLTVAEPGALIGFLGPRVYE..............LLYGDPFPSGVQTAENLRRHGIIDG
O60033_EMEND/1606-2161ITLVTCRSVGIGAYLVRLGQRAIQVEG..QPIILTGAPAIN..............KLLG.REVYTSNLQLGGTQIMYRNG
O06165_MYCTU/41-527VAAVLGSCTAGGAYVPAMSDEAVIVRE.QGTIFLGGPPLVK..............AATG..EIVSAEELGGGDLHSRTSG
O48959_WHEAT/1642-2195LTFVTGRTVGIGAYLARLGIRCIQRTD..QPIILTGFSALN..............KLLG.REVYSSHMQLGGPKIMATNG
HFA1_YEAST/1619-2176ITAVTCRSVGIGSYLVRLGQRTIQVED..KPIILTGASAIN..............KVLG.TDIYTSNLQIGGTQIMYKNG
Q12721_USTMD/1546-2102ATIITGRSVGIGAYLARLGERVIQVEG..SPLILTGYQALN..............KLLG.REVYTSNLQLGGPQIMYKNG
O28066_ARCFU/27-514ISVIMGPCAGGAVYSPAIGDFIVMTKNPNCYMFITGPQVIK..............TVTG..EEVSAFDLGGWQAHAMKSG
O86318_MYCTU/45-527IALVFGNSTAGGAYVPGMSDHVVMIKE.RSKVFLAGPPLVK..............MATG..EESDDESLGGAEMHARISG
Q20676_CAEEL/55-534ISMIMGPCAGGAVYSPALTDFTFMVRD.TSYLFITGPDVVK..............AVTN..EEVTQEELGGAKTHTVTSG
PCCB_RHOER/5-474ISVVLGFAAGGAAYGPALTDVVIMAPE..GRVFVTGPDVVR..............SVTG..EQVDMVSLGGPDTHTKKSG
Q41511_WHEAT/1583-2142LTFVTGRAIGIGAYLARLGMRCIQRLD..QPIILTGYSALN..............KLLG.REVYSSQMQLGGPKIMATNG
O86517_STRCO/39-525ISVMLGPCAGGAAYSPALTDFVFMVRD.TSQMFITGPDVVK..............AVTG..EEITQNGLGGADVHAETSG
O52601_SULME/26-513ITIMAGPAAGGAVYSPALTDFLIMVKGDAYYMFVTGPEITK..............VVLG..EDVSMQDLGGAVVHASKSG
O24789_MYXXA/32-522ISLIMGPCAGGAVYSPAITDFIMMVKD.TSYMFITGPDVIK..............TVTH..EEVSKEALGGAVTHNQKSG
O59018_PYRHO/28-520ITAIMGPCAGGAVYSPAIGDFILMVDNPSTFMFITGPQVVK..............AVTG..VEVTPVQLGGAMVHAQRSG
PCCB_MYCLE/50-547ISLIMGAAAGGHVYSPALTDFVVMVDQ.TSQMFITGPDVIK..............TVTG..EDVTMEELGGAHTHMAKSG
ACAC_YEAST/1574-2130ITLVTCRSVGIGAYLVRLGQRAIQVEG..QPIILTGAPAIN..............KMLG.REVYTSNLQLGGTQIMYNNG
MCCB_ARATH/93-585IAIVLGSCTAGGAYIPAMADESVMVKG.NGTIFLAGPPLVK..............AATG..EEVSAEDLGGATVHCTVSG
ACAC_SCHPO/1615-2170CTLVTCRAVGIGAYLVRLGQRAVQIEG..QPIILTGAPALN..............KVLG.REVYTSNLQLGGTQVMHRNG
MCCB_CAEEL/119-606LAVVMGSCTAGGAYVPAMSDQAIIVKG.TGTVFLGGPPLVK..............AATG..EEISAEELGGADLHCGESG
O88155_CORGT/44-541ISVIMGACAGGNAYGPALTDFVVMVDK.TSKMFVTGPDVIK..............TVTG..EEITQEELGGATTHMVTAG
GCDA_ACIFV/54-573IVGIYGTNPAGGGYHSISPTVIIAHEKANMAVGGAGIMGGMNPKGHVDLEYANEIADMV.DRTGKTEPPGAVDIHYTETG

PF06833

Q8P4U4_XANCP/5-230--------------------------------------------------------------------------------
Q89XP1_BRAJA/5-233--------------------------------------------------------------------------------
Q9I6S6_PSEAE/11-268--------------------------------------------------------------------------------
O32714_KLEPN/10-266--------------------------------------------------------------------------------
Q89UY5_BRAJA/5-233--------------------------------------------------------------------------------
O54417_ACICA/5-236--------------------------------------------------------------------------------
Q93L25_BURCE/5-230--------------------------------------------------------------------------------
Q87V58_PSESM/9-266--------------------------------------------------------------------------------
Q9Z449_PSEPU/6-260--------------------------------------------------------------------------------

PF01972

Y137_METJA/3-286------------------------------------------GEKMDPLSGFISSLIWWLLFFYLIMAPQIQYKQLQLAR
Y1495_METJA/9-292------------------------------------------KIMGDEMTS..MDMFFFLFIFLLFIYPEMMMRYRIMKR
O29403_ARCFU/7-290------------------------------------------VTYSDPMAS.LSGLFWILLFLYLIFAPQLKHQQLLAAR
O66996_AQUAE/1-288------------------------------------------MPYYDPFSY.LFSLLWFLLFVFILLSPWYKRMALIKAR

PF00574

Q7XBR2_ORYSJ/73-254--------------------------------------------------------------------------------
CLPP2_BORBU/6-189--------------------------------------------------------------------------------
CLPP1_BORBU/13-194--------------------------------------------------------------------------------
CLPP1_CAEEL/34-215--------------------------------------------------------------------------------
CLPP_OENEH/21-204--------------------------------------------------------------------------------
CLPP4_ARATH/74-253--------------------------------------------------------------------------------
CLPP1_CHLTR/3-189--------------------------------------------------------------------------------
Q9CFR9_LACLA/7-176--------------------------------------------------------------------------------
CLPP1_PSEAE/28-209--------------------------------------------------------------------------------
CLPP_LISIN/12-193--------------------------------------------------------------------------------
Q9EYD3_9VIRU/6-171--------------------------------------------------------------------------------
Q9B0E1_9CAUD/16-186--------------------------------------------------------------------------------
CLPP_BRUME/20-201--------------------------------------------------------------------------------
CLPP2_RHIME/20-201--------------------------------------------------------------------------------
CLPP_CHLMO/342-515--------------------------------------------------------------------------------
Q8P2G1_STRPQ/13-175--------------------------------------------------------------------------------
CLPP_CHLVU/13-196--------------------------------------------------------------------------------
CLPP_NEIMA/16-199--------------------------------------------------------------------------------
CLPP_MESVI/13-196--------------------------------------------------------------------------------
Q98RU2_GUITH/45-228--------------------------------------------------------------------------------
Q9ST19_BRACM/82-261--------------------------------------------------------------------------------
CLPP2_BACHD/13-194--------------------------------------------------------------------------------
CLPP_CAUCR/20-201--------------------------------------------------------------------------------
CLPP5_ARATH/107-288--------------------------------------------------------------------------------
CLPP_MOUSE/63-244--------------------------------------------------------------------------------
CLPP_THETN/12-193--------------------------------------------------------------------------------
O97252_PLAF7/180-359--------------------------------------------------------------------------------
CLPP1_AGRT5/16-197--------------------------------------------------------------------------------
CLPP_XYLFA/19-200--------------------------------------------------------------------------------
Q42886_SOLLC/95-274--------------------------------------------------------------------------------
CLPP1_TREPA/17-198--------------------------------------------------------------------------------
CLPP2_MYCLE/27-207--------------------------------------------------------------------------------
CLPP_STAAW/12-193--------------------------------------------------------------------------------
CLPP_NEPOL/13-196--------------------------------------------------------------------------------
Q8VQM6_BACTU/12-193--------------------------------------------------------------------------------
CLPP_PSINU/13-197--------------------------------------------------------------------------------
CLPP_DEIRA/15-196--------------------------------------------------------------------------------
CLPP1_BACHD/12-193--------------------------------------------------------------------------------
CLPP_THEMA/21-202--------------------------------------------------------------------------------
CLPP2_TREPA/15-193--------------------------------------------------------------------------------
CLPP_CHLTE/37-218--------------------------------------------------------------------------------
TEPA_BACHD/48-232--------------------------------------------------------------------------------
CLPP3_NOSS1/13-196--------------------------------------------------------------------------------
CLPPL_CYAPA/12-197--------------------------------------------------------------------------------
Q92CR8_LISIN/4-186--------------------------------------------------------------------------------
CLPP3_AGRT5/23-198--------------------------------------------------------------------------------
CLPP1_RHILO/16-197--------------------------------------------------------------------------------
CLPP1_SYNE7/10-191--------------------------------------------------------------------------------
Q9XJT4_BPD3/38-211--------------------------------------------------------------------------------
CLPP_PINCO/13-197--------------------------------------------------------------------------------
CLPP_CLOPE/13-194--------------------------------------------------------------------------------
CLPP_RICPR/12-193--------------------------------------------------------------------------------
CLPP2_CORGL/13-195--------------------------------------------------------------------------------
CLPP1_CORGL/24-204--------------------------------------------------------------------------------
CLPP5_STRCO/18-201--------------------------------------------------------------------------------
CLPP_CLOAB/12-193--------------------------------------------------------------------------------
CLPP_HELPJ/12-193--------------------------------------------------------------------------------
CLPP_YEREN/25-206--------------------------------------------------------------------------------
CLPP1_MYCTU/11-193--------------------------------------------------------------------------------
CLPP_HAEIN/12-193--------------------------------------------------------------------------------
CLPP_CHLRE/310-482--------------------------------------------------------------------------------
CLPP1_STRCO/32-208--------------------------------------------------------------------------------
CLPR2_ARATH/79-263--------------------------------------------------------------------------------
CLPP3_SYNY3/13-197--------------------------------------------------------------------------------
CLPP4_STRCO/14-196--------------------------------------------------------------------------------
CLPP2_PSEAE/13-193--------------------------------------------------------------------------------
CLPP_STRSL/10-193--------------------------------------------------------------------------------
CLPP_WHEAT/13-197--------------------------------------------------------------------------------
CLPP2_STRCO/28-210--------------------------------------------------------------------------------
CLPP_AQUAE/19-200--------------------------------------------------------------------------------
Q8W605_9CAUD/17-189--------------------------------------------------------------------------------
CLPP_BUCAP/16-197--------------------------------------------------------------------------------
CLPP3_SYNE7/13-197--------------------------------------------------------------------------------
CLPP2_CHLPN/12-193--------------------------------------------------------------------------------
CLPP1_NOSS1/11-192--------------------------------------------------------------------------------
CLPP_CHAGL/13-197--------------------------------------------------------------------------------
CLPP2_ARATH/41-222--------------------------------------------------------------------------------
CLPP_RALSO/34-215--------------------------------------------------------------------------------
CLPP_AZOBR/20-201--------------------------------------------------------------------------------
CLPP2_SYNY3/32-213--------------------------------------------------------------------------------
Q8ZQG9_SALTY/47-225--------------------------------------------------------------------------------
CLPP_CAMJE/11-192--------------------------------------------------------------------------------
CLPP2_MYXXD/11-192--------------------------------------------------------------------------------
Q8LTH1_9CAUD/11-173--------------------------------------------------------------------------------
Q9VKY3_DROME/38-219--------------------------------------------------------------------------------
CLPP_PARDE/13-195--------------------------------------------------------------------------------

PF08496

SOHB_ECOLI/1-158--------------------------------------------------------------------------------
Q5E611_VIBF1/1-162--------------------------------------------------------------------------------
A6VNT8_ACTSZ/3-162--------------------------------------------------------------------------------
A6B5B8_VIBPA/1-162--------------------------------------------------------------------------------
A4WAZ3_ENT38/1-156--------------------------------------------------------------------------------
Q1YTC2_9GAMM/5-169--------------------------------------------------------------------------------
A6F3C8_9ALTE/1-162--------------------------------------------------------------------------------
A4A337_9GAMM/1-163--------------------------------------------------------------------------------
Q3KBK2_PSEPF/1-148--------------------------------------------------------------------------------
A5IG60_LEGPC/1-132--------------------------------------------------------------------------------
Q1ZKS7_PHOAS/1-162--------------------------------------------------------------------------------
Q02KX5_PSEAB/1-148--------------------------------------------------------------------------------
A1U0U5_MARAV/1-161--------------------------------------------------------------------------------
Q6ML34_BDEBA/1-147--------------------------------------------------------------------------------
Q3IL32_PSEHT/2-148--------------------------------------------------------------------------------
A6FH33_9GAMM/1-168--------------------------------------------------------------------------------
A8H339_SHEPA/1-152--------------------------------------------------------------------------------
A4N5P9_HAEIF/3-161--------------------------------------------------------------------------------
Q9CN58_PASMU/3-161--------------------------------------------------------------------------------
A4SQD5_AERS4/1-146--------------------------------------------------------------------------------
Q8D8J0_VIBVU/1-162--------------------------------------------------------------------------------
Q2NT44_SODGM/1-157--------------------------------------------------------------------------------
A3MY80_ACTP2/3-160--------------------------------------------------------------------------------
Q0HK69_SHESM/1-149--------------------------------------------------------------------------------
A6VW04_MARMS/2-155--------------------------------------------------------------------------------
Q9JYH3_NEIMB/20-177--------------------------------------------------------------------------------
Q15TT9_PSEA6/1-153--------------------------------------------------------------------------------
Q7N4B0_PHOLL/1-157--------------------------------------------------------------------------------
A2P5Z2_VIBCL/4-165--------------------------------------------------------------------------------
Q48IH2_PSE14/1-148--------------------------------------------------------------------------------
Q2BGB6_9GAMM/2-159--------------------------------------------------------------------------------
Q0ABV0_ALHEH/1-149--------------------------------------------------------------------------------
SOHB_BUCBP/1-161--------------------------------------------------------------------------------
Q7VMW6_HAEDU/3-160--------------------------------------------------------------------------------
A8GF70_SERP5/1-157--------------------------------------------------------------------------------
Q21J53_SACD2/1-173--------------------------------------------------------------------------------
Q1ZDS7_9GAMM/1-157--------------------------------------------------------------------------------
A4BQR1_9GAMM/1-148--------------------------------------------------------------------------------
A0YBD9_9GAMM/1-153--------------------------------------------------------------------------------
Q486S9_COLP3/1-158--------------------------------------------------------------------------------
A3JG92_9ALTE/1-170--------------------------------------------------------------------------------
A3YDK4_9GAMM/1-156--------------------------------------------------------------------------------
Q12LC5_SHEDO/1-148--------------------------------------------------------------------------------
Q83EG9_COXBU/7-154--------------------------------------------------------------------------------
SOHB_BUCAP/1-152--------------------------------------------------------------------------------
Q1QW68_CHRSD/2-155--------------------------------------------------------------------------------
A4CBK8_9GAMM/1-146--------------------------------------------------------------------------------
Q2SJ39_HAHCH/1-155--------------------------------------------------------------------------------
A7FI22_YERP3/1-157--------------------------------------------------------------------------------
F2GC42_ALTMD/1-150--------------------------------------------------------------------------------
Q65TF7_MANSM/3-162--------------------------------------------------------------------------------
A4VLP8_PSEU5/21-167--------------------------------------------------------------------------------
Q3JCU0_NITOC/2-143--------------------------------------------------------------------------------
Q0VQ70_ALCBS/2-158--------------------------------------------------------------------------------
SOHB_BUCAI/1-147--------------------------------------------------------------------------------
Q6D4V2_ERWCT/3-159--------------------------------------------------------------------------------
A4XVC0_PSEMY/1-147--------------------------------------------------------------------------------
A1SW75_PSYIN/12-168--------------------------------------------------------------------------------
A7JRK9_PASHA/3-159--------------------------------------------------------------------------------
Q3SFM4_THIDA/2-147--------------------------------------------------------------------------------
C1DKS7_AZOVD/3-150--------------------------------------------------------------------------------
A7JGQ6_FRANO/7-150--------------------------------------------------------------------------------
A0Z237_9GAMM/1-168--------------------------------------------------------------------------------
Q5QYQ0_IDILO/1-143--------------------------------------------------------------------------------
Q080A4_SHEFN/5-151--------------------------------------------------------------------------------
SOHB_BUCSC/1-159--------------------------------------------------------------------------------
A7MN97_CROS8/1-158--------------------------------------------------------------------------------
A1S7G8_SHEAM/1-147--------------------------------------------------------------------------------

PF01343

PFAP_LEPBO/1-153--------------------------------------------------------------------------------
Y651_METJA/110-263--------------------------------------------------------------------------------
O30523_9VIBR/105-255--------------------------------------------------------------------------------
SOHB_HAEIN/163-314--------------------------------------------------------------------------------
O26897_METTH/96-249--------------------------------------------------------------------------------
SPPA_HAEIN/387-539--------------------------------------------------------------------------------
SPPA_SYNY3/126-282--------------------------------------------------------------------------------
SOHB_SHIFL/160-311--------------------------------------------------------------------------------
SPPA_BACSU/129-283--------------------------------------------------------------------------------
P95072_MYCTU/128-283--------------------------------------------------------------------------------
SPPA_ECOLI/140-296--------------------------------------------------------------------------------
SPPA_SYNY3/383-536--------------------------------------------------------------------------------
SPPA_ECOLI/391-543--------------------------------------------------------------------------------
P95072_MYCTU/402-555--------------------------------------------------------------------------------
VCAC_LAMBD/148-300--------------------------------------------------------------------------------
VG05_BPP21/144-296--------------------------------------------------------------------------------
P71127_CAMJU/101-254--------------------------------------------------------------------------------
Y021_SYNY3/67-220--------------------------------------------------------------------------------
O25976_HELPY/103-256--------------------------------------------------------------------------------
SPPA_HAEIN/132-288--------------------------------------------------------------------------------

PF00378

MENB_BACSU/14-259YNGIAKITINRPE.VHNAFTPKTVAEMIDAFADARDDQNVGVIVLAGAGDKAFCSGGDQKVRGHG..GYVGDDQIPRLNV
ECHP_HUMAN/4-262HNALALIRLRNP..PVNAISTTLLRDIKEGLQKAVIDHTIK.AIVICGAEGKFSAGADIRGFSAP........RTFGLTL
PKSH_BACSU/10-251QASVCYITFHRPE.ANNTINDTLIEECLQVLNQCETSTVT..VVVLEGLPEVFCFGADFQEIYQE.MKRGRKQASSQEPL
PKSI_BACSU/8-249ESAIIQVKMQDRT.HKNAFSQELTDDLIQAFEYIRQNPKYK.AVILTGYDNYFASGGTQEGLLRI......QQGLTKFTD
CAID_ECOLI/6-253NGSILEITLDRP..KANAIDAKTSFEMGEVFLNFRDDPQLRVAIITGAGEKFFSAGWDLKAAAEG....EAPDADFGPGG
ECHA_HUMAN/42-315KGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAAC..KTLQEVTQLSQEA
FADB_PSEFR/10-268ESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIKADASVK.GVIVSSGKDVFIVGADITEFVENFKLPDAELIAGNLEA
ECHM_HUMAN/40-282NNTVGLIQLNRPK.ALNALCDGLIDELNQALKTFEEDPAVG.AIVLTGGDKAFAAGADIKEMQNL.....SFQDCYSSKF
ECI1_MOUSE/37-283PAGVAVMKLRNP..PVNSLSLECLTEFTISLEKLENDKSIRGVILTSECPGIFSAGLDLLEMYGR...NPAHYAEYWKNV
ECHM_CAEEL/38-280KQNVALIKLNRPK.ALNALCAQLMTELADALEVLDTDKSVG.AIVITGSERAFAAGADIKEMTNN.....EFATTFSGSF
ECI1_HUMAN/50-296GAGVAVMKFKNP..PVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGR...SPAHYAGYWKAV
ECHH_RHOCB/7-249SEGLAVITLDRPE.VMNALNAAMRHELTAALHRARGEAR...AIVLTGSGRAFCSGQDLGDGAAE...GLNLETVLREEY
FADB_ECOLI/10-267EDGIAELVFDAPG.SVNKLDTATVASLGEAIGVLEQQSDLK.GLLLRSNKAAFIVGADITEFLSLFLVPEEQLSQWLHFA

PF13766

B9A058_HUMAN/37-154--------------------------------------------------------------------------------
B4QYI3_DROSI/224-341--------------------------------------------------------------------------------
B0WY25_CULQU/220-337--------------------------------------------------------------------------------
B9G752_ORYSJ/181-304--------------------------------------------------------------------------------
D3TLD0_GLOMM/247-364--------------------------------------------------------------------------------
B4KAQ0_DROMO/226-344--------------------------------------------------------------------------------
B9IL60_POPTR/222-345--------------------------------------------------------------------------------
B7H599_BACC4/230-347--------------------------------------------------------------------------------
A5BFY2_VITVI/246-369--------------------------------------------------------------------------------
A9SIW3_PHYPA/223-346--------------------------------------------------------------------------------
C6T7J7_SOYBN/264-387--------------------------------------------------------------------------------
C0SE19_PARBP/271-391--------------------------------------------------------------------------------
C5PDB4_COCP7/292-413--------------------------------------------------------------------------------
B9RD44_RICCO/269-392--------------------------------------------------------------------------------
A7GPH6_BACCN/229-346--------------------------------------------------------------------------------
HIBC5_ARATH/263-386--------------------------------------------------------------------------------
Q08V22_STIAD/183-300--------------------------------------------------------------------------------
B7Q287_IXOSC/156-273--------------------------------------------------------------------------------
Q2IY83_RHOP2/228-346--------------------------------------------------------------------------------
A8R3R7_PSEPU/42-163--------------------------------------------------------------------------------
Q1NB11_9SPHN/238-356--------------------------------------------------------------------------------
C6XIW5_HIRBI/216-334--------------------------------------------------------------------------------
D9QHM1_BRESC/216-334--------------------------------------------------------------------------------
A7HX73_PARL1/219-336--------------------------------------------------------------------------------
Q134G5_RHOPS/230-346--------------------------------------------------------------------------------
Q212Q2_RHOPB/228-346--------------------------------------------------------------------------------
B7Q288_IXOSC/259-376--------------------------------------------------------------------------------
B6HLY2_PENCW/268-389--------------------------------------------------------------------------------
B4W849_9CAUL/219-337--------------------------------------------------------------------------------
Q1QKA8_NITHX/229-347--------------------------------------------------------------------------------
C5FQU8_ARTOC/270-391--------------------------------------------------------------------------------
B9TBM0_RICCO/227-344--------------------------------------------------------------------------------
Q0UDB2_PHANO/242-370--------------------------------------------------------------------------------
B8IPL3_METNO/223-343--------------------------------------------------------------------------------
A3IAF9_9BACI/236-353--------------------------------------------------------------------------------
Q1D8V8_MYXXD/230-347--------------------------------------------------------------------------------
D3NUG5_AZOS1/225-342--------------------------------------------------------------------------------
B8BI61_ORYSI/267-391--------------------------------------------------------------------------------
B9MUQ3_POPTR/225-348--------------------------------------------------------------------------------
A4YSR1_BRASO/219-337--------------------------------------------------------------------------------
Q1YU68_9GAMM/224-352--------------------------------------------------------------------------------
B1ZJ11_METPB/263-383--------------------------------------------------------------------------------
Q13IB6_BURXL/234-356--------------------------------------------------------------------------------
B2UHN2_RALPJ/243-369--------------------------------------------------------------------------------
B5GMB4_STRCL/289-407--------------------------------------------------------------------------------
A2WG07_9BURK/236-363--------------------------------------------------------------------------------
B9Z557_9NEIS/241-360--------------------------------------------------------------------------------
B2JLZ0_BURP8/237-363--------------------------------------------------------------------------------
Q1MLQ4_RHIL3/228-346--------------------------------------------------------------------------------
B4RB39_PHEZH/219-337--------------------------------------------------------------------------------
B2W7S4_PYRTR/289-417--------------------------------------------------------------------------------
A0NMD5_9RHOB/218-335--------------------------------------------------------------------------------
B8ESI3_METSB/218-335--------------------------------------------------------------------------------
C9SRJ5_VERA1/267-392--------------------------------------------------------------------------------
Q4KC65_PSEF5/240-361--------------------------------------------------------------------------------
Q2SVM5_BURTA/241-365--------------------------------------------------------------------------------
B9J934_AGRRK/225-343--------------------------------------------------------------------------------
C4WVV0_ACYPI/243-363--------------------------------------------------------------------------------
Q5Z107_NOCFA/222-340--------------------------------------------------------------------------------
A1WLH8_VEREI/235-356--------------------------------------------------------------------------------
Q12AQ1_POLSJ/237-356--------------------------------------------------------------------------------
B1MKI3_MYCA9/216-334--------------------------------------------------------------------------------
Q4ZVK4_PSEU2/240-361--------------------------------------------------------------------------------
E8YRL2_9BURK/242-368--------------------------------------------------------------------------------
C7YU81_NECH7/264-385--------------------------------------------------------------------------------
E8RLF2_ASTEC/222-340--------------------------------------------------------------------------------
Q88H70_PSEPK/234-355--------------------------------------------------------------------------------
B6QX63_9RHOB/228-349--------------------------------------------------------------------------------
Q4DMX9_TRYCC/226-347--------------------------------------------------------------------------------
C3KAC3_PSEFS/239-360--------------------------------------------------------------------------------
B0T1J0_CAUSK/220-338--------------------------------------------------------------------------------
C1DFA4_AZOVD/229-350--------------------------------------------------------------------------------
B4FC76_MAIZE/51-185--------------------------------------------------------------------------------
A1U6V2_MARAV/235-354--------------------------------------------------------------------------------
Q143S2_BURXL/249-375--------------------------------------------------------------------------------
A8L896_FRASN/269-387--------------------------------------------------------------------------------
A3LLW1_PSEAI/235-355--------------------------------------------------------------------------------
B1FYK7_9BURK/243-363--------------------------------------------------------------------------------
A4T9D3_MYCGI/230-348--------------------------------------------------------------------------------
B9B8U0_9BURK/244-367--------------------------------------------------------------------------------
A7INC3_XANP2/220-343--------------------------------------------------------------------------------
B7G076_PHATC/242-366--------------------------------------------------------------------------------
Q1GNL4_SPHAL/222-340--------------------------------------------------------------------------------
B9Z3L5_9NEIS/240-359--------------------------------------------------------------------------------
B8HBE4_ARTCA/223-343--------------------------------------------------------------------------------
A3JYR4_9RHOB/216-334--------------------------------------------------------------------------------
Q4DAM8_TRYCC/234-355--------------------------------------------------------------------------------
A5V401_SPHWW/222-340--------------------------------------------------------------------------------
A3QDJ0_SHELP/243-361--------------------------------------------------------------------------------
A5W4F7_PSEP1/228-349--------------------------------------------------------------------------------
B2JKB1_BURP8/241-361--------------------------------------------------------------------------------
B8K6S2_VIBPA/241-360--------------------------------------------------------------------------------
Q13ZL1_BURXL/241-361--------------------------------------------------------------------------------
Q1VBB4_VIBAL/239-357--------------------------------------------------------------------------------
Q7NWA8_CHRVO/237-355--------------------------------------------------------------------------------
C5CR27_VARPS/239-358--------------------------------------------------------------------------------
A6GRM3_9BURK/262-382--------------------------------------------------------------------------------
Q15XB2_PSEA6/243-360--------------------------------------------------------------------------------
Q2N893_ERYLH/222-342--------------------------------------------------------------------------------
Q7VYA4_BORPE/252-372--------------------------------------------------------------------------------
Q2L131_BORA1/252-372--------------------------------------------------------------------------------
B0CSR7_LACBS/265-392--------------------------------------------------------------------------------
A9INM9_BORPD/252-372--------------------------------------------------------------------------------
B1LX53_METRJ/220-338--------------------------------------------------------------------------------
A3XC08_9RHOB/216-334--------------------------------------------------------------------------------
C5C8N8_MICLC/257-384--------------------------------------------------------------------------------
Q381D8_TRYB2/226-347--------------------------------------------------------------------------------
Q1YGH5_MOBAS/224-342--------------------------------------------------------------------------------
E3IZ76_FRASU/226-344--------------------------------------------------------------------------------
A4BVU9_9GAMM/241-360--------------------------------------------------------------------------------
A3SY56_9RHOB/216-334--------------------------------------------------------------------------------
Q5LRB7_SILPO/216-334--------------------------------------------------------------------------------
Q485B6_COLP3/257-376--------------------------------------------------------------------------------
B9NSD8_9RHOB/216-334--------------------------------------------------------------------------------
Q8PMW0_XANAC/244-363--------------------------------------------------------------------------------
B8KU28_9GAMM/244-363--------------------------------------------------------------------------------
Q4Q4Q4_LEIMA/228-351--------------------------------------------------------------------------------
B8LA21_9GAMM/238-357--------------------------------------------------------------------------------
A6F0M9_9ALTE/235-354--------------------------------------------------------------------------------
C9PG12_VIBFU/216-335--------------------------------------------------------------------------------
B7RWK1_9GAMM/244-363--------------------------------------------------------------------------------
A9D9E4_9RHIZ/215-331--------------------------------------------------------------------------------
Q6BIA2_DEBHA/282-408--------------------------------------------------------------------------------
B2IDI2_BEII9/219-339--------------------------------------------------------------------------------
A3VYK2_9RHOB/217-335--------------------------------------------------------------------------------
Q6LIA0_PHOPR/241-360--------------------------------------------------------------------------------
C9QFQ9_VIBOR/241-360--------------------------------------------------------------------------------
D3DBM7_9ACTO/251-369--------------------------------------------------------------------------------
A9FQT5_9RHOB/216-334--------------------------------------------------------------------------------
B6BEV0_9RHOB/216-334--------------------------------------------------------------------------------
A1SIK1_NOCSJ/213-330--------------------------------------------------------------------------------
A4C9M2_9GAMM/236-355--------------------------------------------------------------------------------
D0L573_GORB4/229-343--------------------------------------------------------------------------------
Q46TC0_CUPPJ/240-362--------------------------------------------------------------------------------
A6AP67_VIBHA/240-359--------------------------------------------------------------------------------
Q28R37_JANSC/214-335--------------------------------------------------------------------------------
Q0RM03_FRAAA/274-392--------------------------------------------------------------------------------
A4SZ56_POLSQ/226-345--------------------------------------------------------------------------------
Q164T3_ROSDO/216-334--------------------------------------------------------------------------------
Q488V8_COLP3/238-357--------------------------------------------------------------------------------
Q3IGC8_PSEHT/246-365--------------------------------------------------------------------------------
Q084X0_SHEFN/240-358--------------------------------------------------------------------------------
E3I3E7_RHOVT/218-336--------------------------------------------------------------------------------
Q6CA37_YARLI/262-380--------------------------------------------------------------------------------
Q0FTH2_9RHOB/216-334--------------------------------------------------------------------------------
B0TMR3_SHEHH/260-386--------------------------------------------------------------------------------
A8FTB5_SHESH/254-372--------------------------------------------------------------------------------
Q8PB61_XANCP/244-363--------------------------------------------------------------------------------
A9DFC7_9GAMM/243-361--------------------------------------------------------------------------------
Q12MV4_SHEDO/240-361--------------------------------------------------------------------------------
Q87II2_VIBPA/240-359--------------------------------------------------------------------------------
A4WS71_RHOS5/212-330--------------------------------------------------------------------------------
A6D633_9VIBR/241-360--------------------------------------------------------------------------------
A9V573_MONBE/229-344--------------------------------------------------------------------------------
A3U2T9_9RHOB/217-331--------------------------------------------------------------------------------
A1K1H9_AZOSB/239-359--------------------------------------------------------------------------------
B8KL52_9GAMM/239-358--------------------------------------------------------------------------------
A3VDC8_9RHOB/216-333--------------------------------------------------------------------------------
B1KMU0_SHEWM/250-368--------------------------------------------------------------------------------
B9W7B3_CANDC/277-400--------------------------------------------------------------------------------
Q2C757_9GAMM/264-383--------------------------------------------------------------------------------
Q1GHN1_SILST/216-334--------------------------------------------------------------------------------
A0Z2J1_9GAMM/235-354--------------------------------------------------------------------------------
B9KJQ6_RHOSK/212-329--------------------------------------------------------------------------------
A4EVS1_9RHOB/216-334--------------------------------------------------------------------------------
C5MFF3_CANTT/281-404--------------------------------------------------------------------------------
A3LXK5_PICST/255-378--------------------------------------------------------------------------------
C7D792_9RHOB/220-337--------------------------------------------------------------------------------
A8LME8_DINSH/216-334--------------------------------------------------------------------------------
D2VUW6_NAEGR/1151-1277--------------------------------------------------------------------------------
B1VFJ2_CORU7/237-360--------------------------------------------------------------------------------
C4R612_PICPG/259-389--------------------------------------------------------------------------------
C0WF71_9CORY/225-342--------------------------------------------------------------------------------
A7TTD5_VANPO/277-405--------------------------------------------------------------------------------
C5DX08_ZYGRC/263-400--------------------------------------------------------------------------------
Q6NI92_CORDI/230-349--------------------------------------------------------------------------------
Q4Q4Q6_LEIMA/230-354--------------------------------------------------------------------------------
Q5KPF9_CRYNJ/272-407--------------------------------------------------------------------------------
Q6FM09_CANGA/273-401--------------------------------------------------------------------------------
C3PF52_CORA7/224-341--------------------------------------------------------------------------------

PF03572

Q8CVF0_LEPIN/340-512--------------------------------------------------------------------------------
RET3_XENLA/1022-1198--------------------------------------------------------------------------------
CTPA_SYNP2/215-376--------------------------------------------------------------------------------
Q81R25_BACAN/181-400--------------------------------------------------------------------------------
Q7UUN0_RHOBA/410-573--------------------------------------------------------------------------------
Q8HXM2_BLABR/30-208--------------------------------------------------------------------------------
Q8Y2I4_RALSO/213-395--------------------------------------------------------------------------------
Q8DII0_THEEB/215-376--------------------------------------------------------------------------------
O57689_DANRE/419-585--------------------------------------------------------------------------------
Q8R712_THETN/193-353--------------------------------------------------------------------------------
Q87YB6_PSESM/365-539--------------------------------------------------------------------------------
TRI_SULSO/887-1042--------------------------------------------------------------------------------
Q7VMG7_HAEDU/365-546--------------------------------------------------------------------------------
Q8R7P6_THETN/299-499--------------------------------------------------------------------------------
Q8A406_BACTN/202-362--------------------------------------------------------------------------------
Q7NKF3_GLOVI/143-304--------------------------------------------------------------------------------
TRI_THEAC/878-1033--------------------------------------------------------------------------------
Q8S3I7_NICPL/284-447--------------------------------------------------------------------------------
O83301_TREPA/167-332--------------------------------------------------------------------------------
Q7TUF4_PROMP/222-383--------------------------------------------------------------------------------
O57689_DANRE/126-302--------------------------------------------------------------------------------
Q87CM3_XYLFT/366-549--------------------------------------------------------------------------------
Q8R6Q0_THETN/169-397--------------------------------------------------------------------------------
O04073_SCEOB/276-438--------------------------------------------------------------------------------
Q87PB1_VIBPA/356-526--------------------------------------------------------------------------------
Q8A2L4_BACTN/546-711--------------------------------------------------------------------------------
Q8EDY9_SHEON/364-534--------------------------------------------------------------------------------
Q97LQ5_CLOAB/210-372--------------------------------------------------------------------------------
O66985_AQUAE/192-355--------------------------------------------------------------------------------
Q9RU43_DEIRA/206-370--------------------------------------------------------------------------------
P73458_SYNY3/220-381--------------------------------------------------------------------------------
Q7UNS4_RHOBA/218-383--------------------------------------------------------------------------------
Q9RUS4_DEIRA/235-411--------------------------------------------------------------------------------
Q894Q8_CLOTE/197-416--------------------------------------------------------------------------------
Q84FE7_MYXXA/208-376--------------------------------------------------------------------------------
Q82BY0_STRAW/878-1033--------------------------------------------------------------------------------
Q8YRM4_NOSS1/218-379--------------------------------------------------------------------------------
Q8CVF1_LEPIN/197-364--------------------------------------------------------------------------------
Q8A5K0_BACTN/312-500--------------------------------------------------------------------------------
Q89KT1_BRAJA/201-369--------------------------------------------------------------------------------
Q8ENJ3_OCEIH/223-384--------------------------------------------------------------------------------
Q8XNN1_CLOPE/231-397--------------------------------------------------------------------------------
Q8P5D2_XANCP/126-301--------------------------------------------------------------------------------
PRC_HAEIN/363-533--------------------------------------------------------------------------------
Q8Y649_LISMO/229-395--------------------------------------------------------------------------------
Q7NHI8_GLOVI/142-311--------------------------------------------------------------------------------
P75023_SYNY3/244-405--------------------------------------------------------------------------------
Q9L5V8_9BACT/892-1048--------------------------------------------------------------------------------
RET3_HUMAN/742-918--------------------------------------------------------------------------------
Q9SVY2_ARATH/303-473--------------------------------------------------------------------------------
Q9A2X1_CAUCR/195-362--------------------------------------------------------------------------------
Q8R7P7_THETN/191-422--------------------------------------------------------------------------------
Y858_CHLTR/316-560--------------------------------------------------------------------------------
Q8FYM8_BRUSU/181-348--------------------------------------------------------------------------------
Q8KAA8_CHLTE/214-383--------------------------------------------------------------------------------
Q8ZXG0_PYRAE/836-991--------------------------------------------------------------------------------
Q7VFQ7_HELHP/223-383--------------------------------------------------------------------------------
Q8A3B9_BACTN/191-351--------------------------------------------------------------------------------
Q92UP4_RHIME/234-388--------------------------------------------------------------------------------
Q7VBS8_PROMA/229-390--------------------------------------------------------------------------------
O23614_ARATH/320-483--------------------------------------------------------------------------------
Q879Y2_XYLFT/195-361--------------------------------------------------------------------------------
RET3_XENLA/721-897--------------------------------------------------------------------------------
Q87CV7_XYLFT/204-366--------------------------------------------------------------------------------
Q815H1_BACCR/212-374--------------------------------------------------------------------------------
Q87UG9_PSESM/211-377--------------------------------------------------------------------------------
Q7V214_PROMP/205-366--------------------------------------------------------------------------------
Q7NPI8_GLOVI/227-389--------------------------------------------------------------------------------
Q9FL23_ARATH/306-469--------------------------------------------------------------------------------
Q82H90_STRAW/894-1049--------------------------------------------------------------------------------
Q893L7_CLOTE/248-394--------------------------------------------------------------------------------
Q9AAF2_CAUCR/247-457--------------------------------------------------------------------------------
Q87Q24_VIBPA/260-446--------------------------------------------------------------------------------
RET3_HUMAN/438-617--------------------------------------------------------------------------------
Q7UJ42_RHOBA/384-569--------------------------------------------------------------------------------
CTPAL_STAES/226-390--------------------------------------------------------------------------------
Q8R7Q0_THETN/178-406--------------------------------------------------------------------------------
Q8R8M1_THETN/207-366--------------------------------------------------------------------------------
Q822D8_CHLCV/312-557--------------------------------------------------------------------------------
Q8YPV0_NOSS1/193-349--------------------------------------------------------------------------------
PRC_ECOLI/356-530--------------------------------------------------------------------------------
RET3_XENLA/127-301--------------------------------------------------------------------------------
Q865N9_FOSFO/35-213--------------------------------------------------------------------------------
Q892K7_CLOTE/192-411--------------------------------------------------------------------------------
NSR_LACLL/123-302--------------------------------------------------------------------------------
Q7X344_9BACT/201-370--------------------------------------------------------------------------------
Q834H3_ENTFA/208-374--------------------------------------------------------------------------------
Q40067_HORVU/170-334--------------------------------------------------------------------------------
Q7PB48_RICSI/193-360--------------------------------------------------------------------------------
Y1016_CHLPN/316-561--------------------------------------------------------------------------------
Q89X80_BRAJA/202-369--------------------------------------------------------------------------------
Q8DGJ2_THEEB/238-398--------------------------------------------------------------------------------
Q9CP01_PASMU/362-532--------------------------------------------------------------------------------
Q896W4_CLOTE/217-379--------------------------------------------------------------------------------
Q7MSB3_WOLSU/198-359--------------------------------------------------------------------------------
Q9WZK6_THEMA/203-364--------------------------------------------------------------------------------
Q8YW78_NOSS1/226-387--------------------------------------------------------------------------------
Q83BH0_COXBU/210-383--------------------------------------------------------------------------------
Q7NSR6_CHRVO/194-376--------------------------------------------------------------------------------
O18857_PHATA/57-235--------------------------------------------------------------------------------
Q9RUA1_DEIRA/235-408--------------------------------------------------------------------------------
Q9A6Q6_CAUCR/254-429--------------------------------------------------------------------------------
Q7MTT6_PORGI/195-361--------------------------------------------------------------------------------
Q9L1S8_STRCO/194-352--------------------------------------------------------------------------------
Q82PY7_STRAW/269-453--------------------------------------------------------------------------------
RET3_HUMAN/1041-1217--------------------------------------------------------------------------------
O30968_NOSP7/217-378--------------------------------------------------------------------------------
Q7MXF8_PORGI/163-329--------------------------------------------------------------------------------
Q8KDJ6_CHLTE/340-525--------------------------------------------------------------------------------
Q8A1T1_BACTN/145-316--------------------------------------------------------------------------------
Q7NGR6_GLOVI/216-377--------------------------------------------------------------------------------
Q8R640_FUSNN/203-364--------------------------------------------------------------------------------
RET3_XENLA/423-598--------------------------------------------------------------------------------
Q82TT8_NITEU/202-384--------------------------------------------------------------------------------
Q7NL17_GLOVI/226-387--------------------------------------------------------------------------------
Q8DZX2_STRA5/125-302--------------------------------------------------------------------------------
CTPA_SYNY3/218-379--------------------------------------------------------------------------------
O25905_HELPY/210-371--------------------------------------------------------------------------------
Q7U4U5_SYNPX/228-389--------------------------------------------------------------------------------
Q7MUB1_PORGI/151-321--------------------------------------------------------------------------------
CTPB_BACSU/213-375--------------------------------------------------------------------------------
O84448_CHLTR/354-525--------------------------------------------------------------------------------
Q8DJ23_THEEB/220-381--------------------------------------------------------------------------------
TRI_THEVO/839-994--------------------------------------------------------------------------------
Q8A7W6_BACTN/916-1071--------------------------------------------------------------------------------
Q9KNC0_VIBCH/209-365--------------------------------------------------------------------------------
Q7U711_SYNPX/231-392--------------------------------------------------------------------------------
Q8YU55_NOSS1/219-380--------------------------------------------------------------------------------
Q8KD83_CHLTE/187-349--------------------------------------------------------------------------------
Q8EBT8_SHEON/888-1043--------------------------------------------------------------------------------
Q8ABF6_BACTN/222-423--------------------------------------------------------------------------------
Q7VS41_BORPE/198-377--------------------------------------------------------------------------------
CTPA_BACSU/201-363--------------------------------------------------------------------------------
TRIC_SULTO/669-824--------------------------------------------------------------------------------
Q9K6X5_BACHD/210-372--------------------------------------------------------------------------------
Q7MVK0_PORGI/205-366--------------------------------------------------------------------------------
Q8P3J7_XANCP/253-471--------------------------------------------------------------------------------
Q89ZW2_BACTN/204-370--------------------------------------------------------------------------------
Q8EKP4_SHEON/197-361--------------------------------------------------------------------------------
Q7TUQ0_PROMM/225-386--------------------------------------------------------------------------------
Q890X6_CLOTE/207-369--------------------------------------------------------------------------------
Q7NPD6_GLOVI/225-386--------------------------------------------------------------------------------

PF03255

ACCA_SHIFL/4-151-LDINIDEEVHRLR------EKSVEL-----------------TRKIFADLGAWQI--------------AQLARHPQRP
ACCA_SYNE7/10-154-NQVDVSGQIQQLE------ARAIQL-----------------RREIFSNLSPAQR--------------IQVARHPRRP
ACCA_HELPY/3-141-GDEDAK...EILE------KRLDKE-----------------VKSIYSNLTDFQK--------------LQLARHPDRP
ACCA_HAEIN/4-147-VDL..TDEIKRLQ------KKSNEL-----------------TKKTFANLDAWQV--------------SRMARHPNRP
ACCA_AQUAE/7-151-GKEEVLSELDELR------KKFKEK-----------------ARKIYRDLSPWER--------------VQVARHPKRP
ACCA_CHLPN/2-146-NSLLSSSEIQKLE------KRLDKL-----------------KEKIYSDLTPWER--------------VQICRHPSRP
ACCA_CYACA/9-153-HDKVVNNKAHILQ------RKLLNL-----------------KKQLFYGLTSYQK--------------LCVARHKRRP
ACCA_ANTSP/7-151-NKSLNIHDLTALK------KQLIKI-----------------KIEIFQSLTPLQR--------------LHLVRQVDRP
ACCA_PEA/91-235-TGVDLSDQILALE------AKYQKA-----------------LVELYTNLTPIQR--------------VTVARHPNRP
Q39833_SOYBN/89-233-TGLDFSDQILSLE------TKYQQA-----------------LKDLYTHLTPIQR--------------VNIARHPNRP
ACCA_BACSU/3-147-SDMDLSAEIERLE------DRLAKL-----------------QDDIYKNLKPWDR--------------VQIARLADRP
ACCA_DEIRA/1-145-TGQNLDAALAPLR------TQLETL-----------------RREHAAGLSRWDR--------------VQLARTPGRP
ACCA_PORPU/9-153-NDKVIENKINRFQ------DKLTKL-----------------QKEIFSSLTPLQR--------------LNLVRQSERP
P71532_9PROT/2-146-GDVNIADEVSKLQ------AKVDKL-----------------LRSTYAKLTPWQK--------------TQVARHPERP
ACCA_SYNY3/9-153-KNVDVSEQLSQLE------SRAEQL-----------------RQEIFSNLNPSQR--------------LQLARHPRRP

PF01039

PCCB_SACEN/46-544NAHYLATDEDDAIS------YVKELLSFLP...SNNL.S....SSPVFPGAEVEEGSVADGVGDADLELDALVPDSPNQP
ACACB_HUMAN/1780-2334VSHITVPDDFEGVY------TILEWLSYMPKDNHS........PVPIITPTDPIDRE....I........EFLPS..RAP
PCCB_BACSU/26-505NAHFSGHTEKEVLT------GVRKLLSYLP...LNGR.T....TEPKPEK....EASRPLLN........RLVPADTTKP
YNGE_BACSU/27-509CGDILAETEEEAIQ------LVRAYLSYFP...ANFQ.E....KAPIHEK.RPPKHFETPLA........DVIPQNQNAP
12S_PROFR/38-522NIHFVAEDDDAAEL------IAKKLLSFLP...QNNT.E....EASFVNP.NNDVSPNTELR........DIVPIDGKKG
ACACA_HUMAN/1669-2223VTHCTVCDDFEGVF------TVLHWLSYMPKSVHS........SVPLLNSKDPIDR......I......IEFVPT..KTP
PCCB_HUMAN/57-537VAHRAFENDVDALC------NLRDFFNYLP...LSSQ.D....PAPVRECHDPSDRLVPELD........TIVPLESTKA
Q39478_9STRA/1471-2014CSHEIVDDDQQGIQ------SIIQWLSFVPKTTDA........VSPVRECADPVNR......D......VQWRPT..PTP
Q9ZCU2_RICPR/30-512VADLAFNNDIEALL------EIRKFFNFLP...SSNR.S....TLPVRPTVDPADRVDMSLS........TLIPNTPNKP
O87201_CORGT/38-535TSHYSASDDSDALD------WVRELTSYLP...SNNR.A....ETPRQE.ADIMIGSIQENINDVDLELDTIIPDSPNQP
ACC1_ARATH/1587-2139VVHLTVSDDLEGVS------AILNWLSYIPAYVGG........PLPVLAPLDPPER......I......VEYVPE...NS
Q57079_9FIRM/29-507VAHFAAENEDDCIA------QIRYLLGFLP...SNNM.E....DAPLVDTGDDPTREDESLN........SLLPDNSNMP
ACCD_MYCTU/12-482VVALDRLRPMLDRA------LTVLIDAPEPLPAPQTP.A....PVPDVPTWDSVVA..............SRRPD...RP
O60033_EMEND/1606-2161VSHMTAANDFDGVE------KIVDWLAFVPEKKGS........LPPIRPLADPWDR......D......VSYHPPA.KQA
O06165_MYCTU/41-527VTDHLADDDEDALR------IVRAIADTFG.PCEPAQ.W....DVRRS...VEPKYPQAELY........DVVPPDPRVP
O48959_WHEAT/1642-2195VVHLTVSDDLEGVS------NILRWLSYVPANIGG........PLPITKSLDPPDR......P......VAYIPE...NT
HFA1_YEAST/1619-2176IAHLTASNDMKAIE------KIMTWLSYVPAKRDM........SPPLLETMDRWDR......D......VDFKPAK.QVP
Q12721_USTMD/1546-2102VSHLTAQDDLDAVR------SFVNWISYVPAQRGG........PLPIMPTTDSWDR......A......VTYQPP..RGP
O28066_ARCFU/27-514NCHLVAEDDRDAMM------LVRRLLSYLP...LNNM.E....DPPVVKTGDDPVRLTPEIY........DVLPDDPQKP
O86318_MYCTU/45-527LADYFALDELDAIR------IGRRIVARLN.WIKQGP......APAP...VTEPLFDAEELI........GIVPPDLRIP
Q20676_CAEEL/55-534VAHGAFDNDVDALM------SLRELFNYLP...LSNT.D....AAPIRAAEDPWDRAVPSLD........TVVPLESTAA
PCCB_RHOER/5-474VAHIAAHDEADALH------RARRLVSMMC...EQGE.F....DQRAAELGD......SDLR........AMMPASAKRA
Q41511_WHEAT/1583-2142VVHLTVSDDLEGVS------AILKWLSYVPPYVGG........PLPIVKSLDPPER......A......VTYFPE...NS
O86517_STRCO/39-525VCHFAYDDEETCLA------EVRYLLSLLP...QNNR.E....NPPRAESSDPVDRRSDTLL........DLVPADGNRP
O52601_SULME/26-513VVHFMVDSEQEAIN------TAKRLLSYLP...SNNM.E....EPPYMDTGDTNDREVKDAE........SIVPTDSAKT
O24789_MYXXA/32-522VAHFAAENEQAAIV------MTRELLSFLP...SNNQ.E....EAPVQPCEDDAFRGRRSRS.......RTIVPSNPNKP
O59018_PYRHO/28-520QAHLIGKSDEEVIM------LIKKLLSYLP...SNNM.E....KPPRVKPKDEPFRRTPELY........DIVPDDPNKG
PCCB_MYCLE/50-547TAHYVASGEQDAFD------WVRDVLSYLP...SNNF.T....DAPRYS.KPVPHGSIEDNLTAKDLELDTLIPDSPNQP
ACAC_YEAST/1574-2130VSHLTAVDDLAGVE------KIVEWMSYVPAKRNM........PVPILETKDTWDR......P......VDFTPTN.DET
MCCB_ARATH/93-585VSDYFAQDELHGLA------IGRNIVKNLHMAAKQGM.EGTFGSKNLVYK..EPLYDINELR........SIAPVDHKQQ
ACAC_SCHPO/1615-2170ISHLTSQDDFDGIS------KIVNWISYIPDKRNN........PVPISPSSDTWDR......D......VEFYPS..QNG
MCCB_CAEEL/119-606VTDYYAHNDKHALY------LARSCIAGLP.PVEEHMTF....N.PN..A.DEPLYPAEEIY........GIVGSNLKKT
O88155_CORGT/44-541NSHYTAATDEEALD------WVQDLVSFLP...SNNR.S....YTPLED.FDEEEGGVEENITADDLKLDEIIPDSATVP
GCDA_ACIFV/54-573FMREVYASEEGVLE------GIKKYVGMLPKYDPEFFRV....DDPKAPAFPADDLY.............SMVPLNDKRA

PF06833

Q8P4U4_XANCP/5-230-..KLEVGVDHALA------LAATVLAST....RTHP------QRPI-----------------------VMLADTAGQR
Q89XP1_BRAJA/5-233-..RTALGVDEAIR------LSAHVLKSI.....GRD------SGPI-----------------------LVLVDSDSQR
Q9I6S6_PSEAE/11-268-ARQGEVGLLEGWG------LAAAVDEALEADREAPR------KRAL-----------------------LAIVDVPSQA
O32714_KLEPN/10-266-AAGGEVGLLEGWT------LAKVVNETIAADADQPV------KRPI-----------------------VAVIDVPSQA
Q89UY5_BRAJA/5-233-..GQPLGVDEAIA------LAGRVIEII....KSND------RAPI-----------------------LVLVDSASQR
O54417_ACICA/5-236-..AAPINQEIAIE------LAGEILQLI....QQQN------KTPV-----------------------VFIVDTQGQD
Q93L25_BURCE/5-230-..HAPIGVELALA------QARVVLDTV....AERP------GQPI-----------------------LLLIDTQGQQ
Q87V58_PSESM/9-266-ARQGEVGLLEGWG------LAKAVDDAIEQDRERAE------KRAL-----------------------IAIVDVPSQA
Q9Z449_PSEPU/6-260-ARSGEVGLLEGWG------LAKAVSEAVAADR.NGQ------KRAI-----------------------VAVIDVPSQA

PF01972

Y137_METJA/3-286LKILRELSNKRNST-VITMIHRQESIGLFGIPV-YKFIT----IEDSEEILRAIRA--------------APK--DKP--
Y1495_METJA/9-292LRCIREIERQRGTR-VIAMIHRQEALTFLGIPI-YKFIT----IEDSEEILRAIRL--------------TPE--DMP--
O29403_ARCFU/7-290RRAMRRIGMKRGSN-VITMIHRQESIGFLGIPI-YRFID----IDDSEKVLRAIRS--------------TPK--DKP--
O66996_AQUAE/1-288EDVIRKLEEKRKSR-VITMIHRQEQIGFLGIPI-FRFMT----IEDSERVLRAIRM--------------TPD--DMP--

PF00574

Q7XBR2_ORYSJ/73-254---PGAG...AGGD.VMGL.LLRERIVFLGNEI.EDFLA----DAVVS.QLLLLDA--------------VDP--NSD--
CLPP2_BORBU/6-189---DNDAC.VLHDK.SLKL.VLKSRSIVIAGEI.TKDVS----RLFQE.KILLLEA--------------LDF--KKP--
CLPP1_BORBU/13-194---GNYE...RVFD.IYSR.LLRERIIFLSGEI.NDPKA----DTVIA.QLLFLES--------------EDS--SKD--
CLPP1_CAEEL/34-215---GKGE...RTYD.IYSR.LLRDRIVCLMTPV.DDFIA----SALIA.QLLFLQS--------------ESG--KKP--
CLPP_OENEH/21-204---EDDA...TWVD.LYNV.LYRTRSIFLGDAI.HFEVA----NHIAG.LMIFLTI--------------QDA--TQN--
CLPP4_ARATH/74-253---RGAE.....SD.VMGL.LLRERIVFLGSSI.DDFVA----DAIMS.QLLLLDA--------------KDP--KKD--
CLPP1_CHLTR/3-189---EGEMM.HKLQD.VIDRKLLDSRRIFFSEPV.TEKSA----TEAIK.KLWYLEL--------------TNP--GQP--
Q9CFR9_LACLA/7-176---IKGD...VVDN.SYGM.MYDWFGIDYTSPS.KVNDA----..........L.V--------------NAD--DEE--
CLPP1_PSEAE/28-209---ARGE...RAYD.IYSR.LLKERIIFLVGQV.EDYMA----NLVVA.QLLFLEA--------------ENP--EKD--
CLPP_LISIN/12-193---SRGE...RAYD.IYSR.LLKDRIIMLGSAI.DDNVA----NSIVS.QLLFLDA--------------QDP--EKD--
Q9EYD3_9VIRU/6-171---PGDA......D.IY...IYDE.IGFWG......VTA----KQFVS.ELNAL..--------------.GD--ITH--
Q9B0E1_9CAUD/16-186---SKGE.....IF.IYGD.IVSDKW.FESDVT.ATDFK----NK........LDE--------------LGD--ISE--
CLPP_BRUME/20-201---NRGE...RAYD.IFSR.LLKERIIFVNGPV.EDGMS----MLVCA.QLLFLEA--------------ENP--KKE--
CLPP2_RHIME/20-201---NRGE...RSYD.IYSR.LLKERIIFLTGPV.EDHMA----TLVCA.QLLFLEA--------------ENP--KKE--
CLPP_CHLMO/342-515---DGSL...NYLD.FYS...YNDSYNDFKTAP.RGKQA----ERAF........Q--------------EEE--SKK--
Q8P2G1_STRPQ/13-175---EGDK...WYYD.......WWEKPCITAKQV.HD...----.........FLDS--------------AGG--E.D--
CLPP_CHLVU/13-196---PGEPS.AQWVD.LYNR.LYRERVLFLCQEL.DDELA----NQLIG.IMLYLNA--------------EEQ--NKG--
CLPP_NEIMA/16-199---GRGE...RAFD.IYSR.LLKERIVFLVGPV.TDESA----NLVVA.QLLFLES--------------ENP--DKD--
CLPP_MESVI/13-196---PGEAV.STYVD.VYNR.LYRERILFLGEDL.DDEVA----NQLIG.VMVFLNS--------------EDD--TKG--
Q98RU2_GUITH/45-228---PGSPS.ADWVD.IYNR.LYRERIIFLGQEI.DDEIA----NQIIA.VMLYLDS--------------EDN--SKP--
Q9ST19_BRACM/82-261---SFEE.....LD.TTNM.LLRQRIVFLGSQV.DDMTA----DLVIS.QLLLLDA--------------QDS--ERD--
CLPP2_BACHD/13-194---GLSE...RSYD.IYSR.LLKDRIVFLGAAI.DDQIA----NSIVA.QLLFLEA--------------ENP--KKD--
CLPP_CAUCR/20-201---SRGE...RAFD.IFSR.LLKERIIFLTGPV.EDGMA----SLICA.QLLFLES--------------ENP--KKE--
CLPP5_ARATH/107-288---MVQE...RFQS.IISQ.LFQYRIIRCGGAV.DDDMA----NIIVA.QLLYLDA--------------VDP--TKD--
CLPP_MOUSE/63-244---GRGE...RAYD.IYSR.LLRERIVCVMGPI.DDSVA----SLVIA.QLLFLQS--------------ESN--KKP--
CLPP_THETN/12-193---NRGE...RAYD.IFSR.LLKDRIVFLGDEI.NDTTA----SLVIA.QMLFLEA--------------EDP--DKD--
O97252_PLAF7/180-359---IKDM....KKD.VKLF.FFKKRIIYLTDEI.NKKTA----DELIS.QLLYLDN--------------INH--N.D--
CLPP1_AGRT5/16-197---SRGE...RSFD.IYSR.LLRERIIFLNGEV.DDTVS----ALVCA.QLLFLEA--------------ENP--KKP--
CLPP_XYLFA/19-200---SRGE...RAYD.IYSR.LLKERLIFLVGPI.DDYMA----NLIVA.QLLFLEA--------------ENP--EKD--
Q42886_SOLLC/95-274---PVGA.....LD.LSTV.LFRNRIIFIGQPV.NSAVA----QKVIS.QLVTLAT--------------IDE--NAD--
CLPP1_TREPA/17-198---GGGE...RSYD.IFSR.LLKDRIIFVDGEI.TDAVA----DLVVA.QLLFLES--------------QNP--DKD--
CLPP2_MYCLE/27-207---VKES......N.PYNK.LFEERIIFLGVQV.DDASA----NDIMA.QLLVLES--------------LDP--DRD--
CLPP_STAAW/12-193---NRGE...RAYD.IYSR.LLKDRIIMLGSQI.DDNVA----NSIVS.QLLFLQA--------------QDS--EKD--
CLPP_NEPOL/13-196---PGESA.PQWVD.LYNR.LYRQRLLFMGQEL.GDELS----NQLCG.IMIYLFA--------------EDP--SIP--
Q8VQM6_BACTU/12-193---KLGE...RSYD.IYSR.LLKDRIIIIGSEI.NDQVA----SSVVA.QLLFLEA--------------EDA--EKD--
CLPP_PSINU/13-197---PGEED.AGWVD.VYNR.LYRERLLFLGQQV.DDEIA----NQLIG.IMMYLNG--------------EDE--NRD--
CLPP_DEIRA/15-196---GRGE...RSYD.IYSR.LLKDRIIFVGTPV.ESQMA----NSIVA.QLLLLDS--------------QNP--EQE--
CLPP1_BACHD/12-193---NRGE...RAYD.IYSR.LLKDRIIMLGTAI.DDNVA----NSIVA.QLLFLQA--------------EDP--DKD--
CLPP_THEMA/21-202---GRYE...RAYD.IFSR.LLKDRIVFLGSPI.DDYVA----NLVIA.QLLFLEA--------------EDP--DKD--
CLPP2_TREPA/15-193---SGES...VFFQ....K.FLETRQILLSGEI.SKDLA----EGIVR.QLFVLES--------------LSV--SKP--
CLPP_CHLTE/37-218---GRGE...RAFD.IFSR.LLRERIIFLGSPI.DEHVA----GLIIA.QLIFLES--------------EDP--ERD--
TEPA_BACHD/48-232---EQSN..IHCIT.VVGQ.I..EGHMQLPPQN.KTTKY----EHIIP.QLVAAEQ--------------NKK--IEG--
CLPP3_NOSS1/13-196---PGGQF.TDWIS.IYDR.LYRERIIFLGRDV.DDEIA----NQIIA.VMLYLDS--------------EDP--GKD--
CLPPL_CYAPA/12-197---DKDRF.ISYFL.INNA.LLNERVIFLCNYE.DATDE----SIYIG.MLLYLES--------------ENS--QKP--
Q92CR8_LISIN/4-186---NKNNE.NITNI.LTQK.LIDTRTVLIYGEI.NQELA----EDVSK.QLLLLES--------------I.S--NDP--
CLPP3_AGRT5/23-198---GKET...EAN.......LFKSRSIFIYGGI.TQELA----QKVCT.QLVAL.A--------------AAS--DDD--
CLPP1_RHILO/16-197---SRGE...RAFD.IFSR.LLRERIIFINGEI.NDDVS----ALVCA.QLLSLES--------------DNP--DKE--
CLPP1_SYNE7/10-191---GRGE...RAFD.IYSR.LLRERIIFLGEPV.TSDVA----NRIVA.QLLFLEA--------------EDP--EKD--
Q9XJT4_BPD3/38-211---SGDNP.DSTIT.IYEP.IGYDWWT..GEGV.T...A----KRIAG....ALRS--------------IGN--DVD--
CLPP_PINCO/13-197---PGDED.ATWVD.LYNR.LYRERLLFLAQDI.NNEIA----NQLMG.LMVYLSA--------------EDA--NKE--
CLPP_CLOPE/13-194---SKGE...RSYD.IFSR.LLKDRIIMLSGEV.NDVTA----NLVVA.QLLFLES--------------EDP--DKD--
CLPP_RICPR/12-193---SRGE...RAYD.IYSR.LLKERIIFVCSTV.EDHMA----NLIVA.QLLFLEA--------------ENP--KKD--
CLPP2_CORGL/13-195---QGGP..GFGND.VFDR.LLSERIIFLGSQV.DDEIA----NKLCA.QILLLSA--------------EDP--TRD--
CLPP1_CORGL/24-204---GTKE.....TN.PYAK.LFEERIIFLGTQV.DDTSA----NDIMA.QLLVLEG--------------MDP--DRD--
CLPP5_STRCO/18-201---SAGT...RTSD.PYSK.LLQERIVFLGTPV.DETSA----NDVTA.QLMYLEH--------------QAP--DRD--
CLPP_CLOAB/12-193---SRGE...RSYD.IYSR.LLKDRVIFLGEEV.NDTTA----SLVVA.QLLFLES--------------EDP--DKD--
CLPP_HELPJ/12-193---ERGE...RSYD.IYSR.LLKDRIVLLSGEI.NDSVA----SSIVA.QLLFLEA--------------EDP--EKD--
CLPP_YEREN/25-206---SRGE...RSYD.IFSR.LLKERIIFLTGQV.EDHMA----NLITA.QMLFLEA--------------ENP--EKD--
CLPP1_MYCTU/11-193---SQGL...SLTDSVYER.LLSERIIFLGSEV.NDEIA----NRLCA.QILLLAA--------------EDA--SKD--
CLPP_HAEIN/12-193---SRGE...RSYD.IYSR.LLKERVIFLSGEV.EDRMA----NLIVA.QLLFLES--------------EDP--TKD--
CLPP_CHLRE/310-482---SKALK.AYNYL.DQGA.LNNES....GRSL.YRKQT----ERVI........Q--------------EEE--SKK--
CLPP1_STRCO/32-208---LGDQ........VYNR.LLGERIIFLGQPV.DDDIA----NKITA.QLLLL.A--------------SDP--DKD--
CLPR2_ARATH/79-263---NREEGTWQWVD.IWNA.LYRERVIFIGQNI.DEEFS----NQILA.TMLYLDT--------------LDD--SRR--
CLPP3_SYNY3/13-197---PGSQY.ERWID.IYTR.LSQERIIFLGQEV.NDSIA----NRIVA.FLLYLDS--------------DDP--SKP--
CLPP4_STRCO/14-196---PQGE...RSYD.VFSR.LLSERIIFLGTEI.DDGVA----NVVIA.QLLHLES--------------SAP--ESE--
CLPP2_PSEAE/13-193---SHGA...IGAK.LMEY.ALKVRKVFVTGGV.DEKMA----KDVVQ.QLHIL.A--------------SIS--DDP--
CLPP_STRSL/10-193---SRGE...ASYD.IYSR.LLKDRIIMLTGPV.EDNMA----NSIIA.QLLFLDA--------------QDN--TKD--
CLPP_WHEAT/13-197---PGDEE.ATWVD.LYNV.MYRERTLFLGQEI.RCEIT----NHITG.LMVYLSI--------------EDG--ISD--
CLPP2_STRCO/28-210---SQGV...REYD.PYAK.LFEERVIFLGVQI.DDASA----NDVMA.QLLCLES--------------MDP--DRD--
CLPP_AQUAE/19-200---PRGE...RAYD.IYSR.LLQDRIVLLGSPI.DDHVA----NLIVA.QLLFLES--------------QDP--DKD--
Q8W605_9CAUD/17-189---NSSEN.PEIAD.LY...LYGS....IGSGW.FDDIT----SSEVQ.N..FL.K--------------TSS--VSQ--
CLPP_BUCAP/16-197---SRGE...RSYD.IYSR.LLKERIIFITGTI.EDNMA----SSIVA.QMLFLEA--------------ESL--DKD--
CLPP3_SYNE7/13-197---PGSSF.ERWID.IYNR.LAMERIIFLGQEV.TDGLA----NSIVA.QLLYLDS--------------EDS--SKP--
CLPP2_CHLPN/12-193---GRGE...RAMD.IYSR.LLKDRIVMIGQEI.TEPLA----NTVIA.QLLFLMS--------------EDP--KKD--
CLPP1_NOSS1/11-192---GRGE...RAFD.IYSR.LLRERIVFLGQQV.DSNLA----NLIVA.QLLFLDA--------------EDP--EKD--
CLPP_CHAGL/13-197---PGDVQ.VQWID.LYNR.LYRERILFLGQTV.NYEIA----NQIIG.LMLYLNG--------------DDK--SKD--
CLPP2_ARATH/41-222---SRGE...RAYD.IFSR.LLKERIICINGPI.NDDTS----HVVVA.QLLYLES--------------ENP--SKP--
CLPP_RALSO/34-215---GRGE...RAYD.IYSR.LLKERVIFMVGEV.NDQTA----NLVVA.QLLFLES--------------ENP--DKD--
CLPP_AZOBR/20-201---NRGE...RGYD.IYSR.LLKERIIFLIGGV.NDAVA----SLICS.QLLFLES--------------ENP--SKD--
CLPP2_SYNY3/32-213---GMGE...RAFD.IYSR.LLRERIIFLGTPV.DDQVA----DSIVA.QLLFLDA--------------EDP--EKD--
Q8ZQG9_SALTY/47-225---SGAE...SWYT.IRAA.ADNAADISIYDEIGGWGIS----AHWFAEELVAL..--------------.GS--ITQ--
CLPP_CAMJE/11-192---SRGE...RSYD.IYSR.LLKDRIIMLSGEI.HDELA----ASIVA.QLLFLEA--------------EDP--TKD--
CLPP2_MYXXD/11-192---HRGE...RAYD.LYSR.LLKDRIIMLGTPV.NDDVA----NIIVA.QLLFLES--------------EDP--DKG--
Q8LTH1_9CAUD/11-173---SNED...KWV...YE.........MLG..M.DSTCP----KDVLT.QL.....--------------EFS--DED--
Q9VKY3_DROME/38-219---GRGE...RAYD.IFSR.LLKERIICLMGNI.TDDIS----STVVA.QLLFLQS--------------ENV--NKP--
CLPP_PARDE/13-195---RGSAC.PRATR.SASS.ISSRAQVIVAGPI.TDKLA----QRTVA.HLLAL.A--------------EDS--DEP--

PF08496

SOHB_ECOLI/1-158------------ME------LLSEYGLFLAKIV-TVVLA----IAAIAAIIVNVAQ--------------RNK..RQR..
Q5E611_VIBF1/1-162------------ME------FLFDYGLFLAKIA-TVVVS----IIAILVAAKAVGG--------------KST..GAK..
A6VNT8_ACTSZ/3-162------------SD------IAVGYGIFILEIL-TILLV----VAGIVAMIFAFKQ--------------RQP..SSH..
A6B5B8_VIBPA/1-162------------ME------FLLDYGLFLAKIV-TVVAA----IIVILILVKSVGS--------------KSG..AAK..
A4WAZ3_ENT38/1-156------------ME------LLSEYGLFLAKIA-TVVIA----IIAIAVLLVNLTQ--------------R.K..RQR..
Q1YTC2_9GAMM/5-169------------LE------FLFEYGLFLAKVV-TGIAA----LVIVVSIIVGLNQ--------------KNRHSGSK..
A6F3C8_9ALTE/1-162------------ME------FLTEFGLFIAKTV-TLVVA----LLVIVSVVLSAAH--------------KDK..DDQGS
A4A337_9GAMM/1-163------------ME------FLSEYGIFLAKAI-TIVVS----AGLIVLLIAAASQ--------------RHR..GET..
Q3KBK2_PSEPF/1-148------------ME------FLTEYASFLAKTV-TLVIA----ILVVLASFAALRS--------------KGR....RKS
A5IG60_LEGPC/1-132------------ME------FLSEYGMFLLKCI-TLVIA----LLILLAGIFSMGR--------------KTK.......
Q1ZKS7_PHOAS/1-162------------ME------FLFDYGLFFAKIA-TVVVA----IVGVLVLVKALNG--------------RHG..SQK..
Q02KX5_PSEAB/1-148------------ME------FIAEYAGFLARTV-TVLAA----IIVVLVVIVALRG--------------RGR....RGA
A1U0U5_MARAV/1-161------------ME------FLTEYGLFLAKVA-TFVVA----AIVLVSIIVSATQ--------------KDR..DDHEG
Q6ML34_BDEBA/1-147------------MD------ALQSIGVFAAQTF-MILFA----VLAVILVIALLAA--------------KAS...HK..
Q3IL32_PSEHT/2-148------------LE------FLYEYGLFFAKTV-TFVIA----IAIILMLIVGAAV--------------KPK..AKK..
A6FH33_9GAMM/1-168------------ME------FLSEYGIFLAKTI-TFVLA----LLFVVVSIISLTS--------------KQK..KSN..
A8H339_SHEPA/1-152------------ME------FLYEYGLFLAKAV-TIVAA----IIAVVIVVLASSM--------------KQK..AEK..
A4N5P9_HAEIF/3-161------------ND------ILTGYGIFILEIL-TILLL----ILAIVGLIISYRQ--------------HNK..SKV..
Q9CN58_PASMU/3-161------------SD------IATGYGLFILEIL-TILLV----IAGIAFMIVTLKQ--------------HKA..KST..
A4SQD5_AERS4/1-146------------MA------FLTEYGLFLAKTL-TLLLA----VAAVILMVIS.SR--------------QPK..SRK..
Q8D8J0_VIBVU/1-162------------ME------FLLDYGLFLAKVV-TFIVA----VVVLLILAKSVSG--------------KSS..AIK..
Q2NT44_SODGM/1-157------------ME------YFALYGLFLAKTL-TVVLA----IGALLIVVFGLRL--------------RTR..QRK..
A3MY80_ACTP2/3-160------------KE------ILLNYGIFLLELL-TLFGI----VAVVVMLILEARK--------------QPE.......
Q0HK69_SHESM/1-149------------ME------FLYEYGMFLAKAV-TIVVA----LVAVIIVVLASTV--------------KHK..SDK..
A6VW04_MARMS/2-155------------LE------FLTDYVGFLLKLV-SVALV----IGVLLAALSSGKR--------------KSQ.......
Q9JYH3_NEIMB/20-177------------KE------ILLNYGIFLLELL-TVFGA----IALIVLAIVQSKK--------------QSE.......
Q15TT9_PSEA6/1-153------------ME------FLYEYGLFIAKAV-TIVIA----ILLVVGGVVGLIS--------------KQK..QPK..
Q7N4B0_PHOLL/1-157------------ME------YLSLYGLFLAKVV-TLVLA----IIALAILGIGIGM--------------RKS..SLK..
A2P5Z2_VIBCL/4-165------------LE------FLLDYGLFLAKIV-TVVVA----LVAVLVIVKSLGG--------------RSG..GAK..
Q48IH2_PSE14/1-148------------MD------FVVDYASFLAKTV-TLVIA----IVVVLVAIASMRG--------------KGR....RKT
Q2BGB6_9GAMM/2-159------------VE------FLADYSLFLAKSV-TVVVA----IIAVVAGIALVSA--------------RSRSDGKH..
Q0ABV0_ALHEH/1-149------------MA------GLEEYLLFLAKGL-TVVAL----VVAAVGMILNSLR--------------WER..PPGID
SOHB_BUCBP/1-161------------MH------FIYDCSLFLFKIV-IVIFF----IIFVSSIILKISR--------------KKN..KNF..
Q7VMW6_HAEDU/3-160------------KE------ILLNYGIFLLELL-TIFGI----IAMVIMLMLADRK--------------NAA.......
A8GF70_SERP5/1-157------------ME------FISVYGLFLAKVA-TVVIA----IAALALLAVSLGQ--------------RKN..RQK..
Q21J53_SACD2/1-173------------ME------FLSEYGLFLAKTV-TFVIA----FAAIVVVIVSAGS--------------KGQGAGK...
Q1ZDS7_9GAMM/1-157------------ME------FLFDFGLFLAKAV-TIVVA----IIAVIGTVVALGS--------------KQK..SKK..
A4BQR1_9GAMM/1-148------------MD------FLYDYGLFLAKTA-TVVIA----LLAVIGTAAATTM--------------RGRGRSRD..
A0YBD9_9GAMM/1-153------------ME------FLSNYGLFLAKAV-TIVVA----VLFVVIGVVAAGG--------------RHK....KEV
Q486S9_COLP3/1-158------------ME------FLYEYGLFLAKAI-TFVLA----VIAIIIAIAGAAT--------------KQQ..HKK..
A3JG92_9ALTE/1-170------------ME------FLADYGLFLAKAV-TLVLA----VVVIITLIISAAQ--------------REK..SSEHE
A3YDK4_9GAMM/1-156------------ME------FLIEYAGFLLKLV-TVALI----IVLTFAGIFASKG--------------KEK.......
Q12LC5_SHEDO/1-148------------ME------FLYEYGLFLAKAV-TILLS----VLAVITMVLMSAI--------------KQK..SDK..
Q83EG9_COXBU/7-154------------MD------FLANYGLFLAKLI-SLVLA----IAVVLFIFFGLIA--------------HAK....NKA
SOHB_BUCAP/1-152------------MN------LLLNYELFLAKAI-TFLF.----IIFITPFIFNIIK--------------RKR..TDQ..
Q1QW68_CHRSD/2-155------------TE------WIAEYALFAAKLA-TLVVA----VGVLVGLVVTLKQ--------------RASGQAEG..
A4CBK8_9GAMM/1-146------------ME------FLYQYGLFLAETV-TFVVA----FIVIAASVAGVAQ--------------KPK..AKK..
Q2SJ39_HAHCH/1-155------------MD------FLTDYGAFLAKTV-TLVAA----ILFVVGTIIALSQ--------------RGK....KHA
A7FI22_YERP3/1-157------------ME------LISLYGLFLAKVV-TIVVA----IGAVVLLVVSQGM--------------RRQ..GQR..
F2GC42_ALTMD/1-150------------ME------FLYEYGLFVAKAV-TLVVA----FIVVVSTIVGVAS--------------KQK..QGK..
Q65TF7_MANSM/3-162------------SE------ILVGYGIFILEIL-TILLV----IAGIVAAIMTLKQ--------------QKN..PQT..
A4VLP8_PSEU5/21-167------------VE------FLVDYASFLAKTV-TLVVA----IVIVLIALASMRR--------------GRS....KQG
Q3JCU0_NITOC/2-143------------SE------LLSEYGLFLAKTL-TIVIL----IALLIRSSISSKS--------------RVQ..AAE..
Q0VQ70_ALCBS/2-158------------IA------FLMEYGMFLAKVA-TLVVA----ILFIFGGIAAAAS--------------RSR..GKGDQ
SOHB_BUCAI/1-147------------MN------LLLNYELFLAKII-TFIII----SISILILFYTIIK--------------RKK..NIQ..
Q6D4V2_ERWCT/3-159------------VE------LLSLYGLFLAKAL-TIVVA----IGALVVLAFGMTQ--------------RKR..QHK..
A4XVC0_PSEMY/1-147------------ME------FLSEYASFLAKTL-TLVVA----IVLVLVALAATRG--------------KGR.....RS
A1SW75_PSYIN/12-168------------LE------YVIEYGLFFAKIV-TFAIA----IIAVVAAVIALVS--------------KQK..NKK..
A7JRK9_PASHA/3-159------------KE------VLLNYGIFLLELL-TVFGI----IAVVVMLILESKK--------------QNE.......
Q3SFM4_THIDA/2-147------------ND------FVARYFLFLAEAA-TLVLA----VTGAIAALIAVAR--------------RRS..EDC..
C1DKS7_AZOVD/3-150------------VE------FFLDYAGFLAQTV-TVVVA----VLVILVAIAVLRS--------------RSR....HRG
A7JGQ6_FRANO/7-150------------IG------FV....FFALSTV-LVVAA----IVIVIGSFFSLLS--------------KAKQEAANLA
A0Z237_9GAMM/1-168------------MD------FFAEVGLFLAEAV-IIVTA----IIVVLIAIAAVSQ--------------RRK.DGEE..
Q5QYQ0_IDILO/1-143------------MD------FVADIGGFLLKAA-IIVVA----VGFIVGLIAQAAQ--------------KQK..KSK..
Q080A4_SHEFN/5-151------------LE------FLYEYGLFLAKAV-TIVVA----ILAVVIFVLAASM--------------KNK..SDK..
SOHB_BUCSC/1-159------------MD------FILNYALFFFKIF-TLFAL----ILTIFLIIVNVAR--------------HKS..KKK..
A7MN97_CROS8/1-158------------MN------LLAEYGLFLAKIV-TVVVA----IAIVIALIANLTQ--------------RKK..AQR..
A1S7G8_SHEAM/1-147------------ME------FLYEYGLFLAKAV-TVVAA----IGAILVMVFAGAA--------------RGK..GDK..

PF01343

PFAP_LEPBO/1-153-----MR-LRKTRK------IVVSMKDMAASGG-YYIAS------SADKIFALSGT--------------I--TGS----
Y651_METJA/110-263-----EE-LAKKKP------VVVYVEGLDASGA-YMVSA------PADYIVAEKHS--------------I--VGS----
O30523_9VIBR/105-255-----HA-SRGKKP------VRAYVGGDGCSAA-YWITT------ACDRVTMDATA--------------R--VGS----
SOHB_HAEIN/163-314-----RL-KQKGIK------LTVAVDKVAASGG-YMMAC------VADKIVSAPFA--------------V--IGS----
O26897_METTH/96-249-----AI-NKSEKP------VVSWISDSGTSGA-YLAAS------ASDRIVASPSA--------------W--VGS----
SPPA_HAEIN/387-539-----NL-QKIGKP------VIVSMGAMAASGG-YWISS------TADYIIADSNT--------------I--TGS----
SPPA_SYNY3/126-282-----KF-KQSGKK------IVAYGLNYSE.LG-YYLAA------TADTILINPMG--------------G--VEI----
SOHB_SHIFL/160-311-----RL-RDKNIP------LTVTVDKVAASGG-YMMAC------VADKIVSAPFA--------------I--VGS----
SPPA_BACSU/129-283-----IK-KETKKP------IYVSMGSMAASGG-YYIST------AADKIFATPET--------------L--TGS----
P95072_MYCTU/128-283-----AA-FSAVKP------SLAWAETYPGTLS-YYLAS------AFGEVWMQPSG--------------S--VGL----
SPPA_ECOLI/140-296-----EF-RDSGKP------VYAVGENYSQ.GQ-YYLAS------FANKIWLSPQG--------------V--VDL----
SPPA_SYNY3/383-536-----EL-LQAQKP------VIISMGNVAASGG-YWIAT------AGEKIVAQPNT--------------V--TGS----
SPPA_ECOLI/391-543-----AA-RAAGKP------VVVSMGGMAASGG-YWIST------PANYIVANPST--------------L--TGS----
P95072_MYCTU/402-555-----RA-RDRGKP------VVASMGAVAASGG-YYVSM------GADAIVANPGT--------------I--TGS----
VCAC_LAMBD/148-300-----AR-VRDIKP------VWALANDMNCSAG-QLLAS------AASRRLVTQTA--------------R--TGS----
VG05_BPP21/144-296-----YR-LRQQKP------VWALCNDTACSAA-MLLAS------ACSRRLVTQTS--------------R--IGS----
P71127_CAMJU/101-254-----KD-LKIKKP------VLVYASGTMASGS-YLAGV------GANKILANPAS--------------F--IGS----
Y021_SYNY3/67-220-----KQ-LSEKIK------VVASFGNISASGG-VYIAM------GCPHIMANSGT--------------I--TGS----
O25976_HELPY/103-256-----AD-LKQKMP------VLAYARGVMASGS-YYAGM------QASEVYASKAS--------------L--IGS----
SPPA_HAEIN/132-288-----HF-KDAGKP------VIAYADNYSQ.GQ-YYLAS------FADEIYLNSIG--------------S--VDI----

PF00378

MENB_BACSU/14-259LDLQRLI-RVIPKP------VVAMVSGYAIGGG-HVLHI------VCDLTIAADNA--------------I..FGQTGPK
ECHP_HUMAN/4-262GHVVDEI-QRNEKP------VVAAIQGMAFGGG-LELAL------GCHYRIAHAEA--------------Q..VGLPEVT
PKSH_BACSU/10-251YDLWMKL-QTGPYV------TISHVRGKVNAGG-LGFVS------ATDIAIADQTA--------------S..FSLSELL
PKSI_BACSU/8-249DNLYSLA-LDCEIP------VIAAMQGHGIGGG-FVMGL------FADIVILSRES--------------V..YTANFMK
CAID_ECOLI/6-253FAGLTEI-FNLDKP------VIAAVNGYAFGGG-FELAL------AADFIVCADNA--------------S..FALPEAK
ECHA_HUMAN/42-315QRIVEKL-EKSTKP------IVAAINGSCLGGG-LEVAI------SCQYRIATKDR--------------KTVLGTPEVL
FADB_PSEFR/10-268NKIFSDF-EDLNVP------TVAAINGIALGGG-LEMCL------AADFRVMADSA--------------K..IGLPEVK
ECHM_HUMAN/40-282LKHWDHL-TQVKKP------VIAAVNGYAFGGG-CELAM------MCDIIYAGEKA--------------Q..FAQPEIL
ECI1_MOUSE/37-283QELWLRL-YTSNMI------LVSAINGASPAGG-CLLAL------CCDYRVMADNP--------------KYTIGLNESL
ECHM_CAEEL/38-280LSNWTAV-SDVKKP------VIAAVNGFALGGG-NELAM------MCDIIYAGEKA--------------R..FGQPEIN
ECI1_HUMAN/50-296QELWLRL-YQSNLV------LVSAINGACPAGG-CLVAL------TCDYRILADNP--------------RYCIGLNETQ
ECHH_RHOCB/7-249EPLLQAI-YSCPLP------VLAAVNGAAAGAG-ANLAL------AADVVIAAQSA--------------A..FMQAFTR
FADB_ECOLI/10-267NSVFNRL-EDLPVP------TIAAVNGYALGGG-CECVL------ATDYRLATPDL--------------R..IGLPETK

PF13766

B9A058_HUMAN/37-154-----IL..EEHMD------KINSCFS.....A-....N----..TVEEIIENLQQ--------------.........D
B4QYI3_DROSI/224-341-----SL..QPVLE------QINKNFS.....A-....D----..SVEGILENLQN--------------.........D
B0WY25_CULQU/220-337-----VL..AKNLK------QINACFS.....G-....P----..TVESILAALEA--------------.........D
B9G752_ORYSJ/181-304-----AL...NRLE------IINKCFS.....K-....R----..TVEEIIASLEQ--------------.........E
D3TLD0_GLOMM/247-364-----SL..APLLE------KINKCFD.....A-....E----..SIEEIIENLKT--------------.........D
B4KAQ0_DROMO/226-344-----SL..TPVLE------QINKHFS.....A-....G----..SVEEILESLRT--------------.........D
B9IL60_POPTR/222-345-----VL...YKIE------TIDKCFS.....H-....D----..TVEEIVDALEN--------------.........E
B7H599_BACC4/230-347-----EL..APSLE------VINSHFA.....F-....D----..TIEEIIHSLEK--------------.........D
A5BFY2_VITVI/246-369-----VL...CRIE------MLDKCFG.....H-....D----..TVEEIVNALES--------------EA.....TGS
A9SIW3_PHYPA/223-346-----PL..H.RYE------DIDECFE.....K-....E----..TVEEIVDTLET--------------KA.....GSN
C6T7J7_SOYBN/264-387-----VL...HRID------TIDRCFS.....H-....E----..TVEEIIEALEK--------------EA.....AES
C0SE19_PARBP/271-391-----PS..GSLRE------SIDRCFS.....A-....N----..TVEEIISRLQE--------------.........E
C5PDB4_COCP7/292-413-----LL.GGSLRE------SIDRCFS.....K-....P----..TVEEIIAALEA--------------E.......TD
B9RD44_RICCO/269-392-----AL...HRIE------TVDRCFG.....Y-....D----..TVEEIFEALES--------------.........E
A7GPH6_BACCN/229-346-----TL..ASILE------NINTHFS.....F-....H----..SIEEIIDSLEK--------------.........D
HIBC5_ARATH/263-386-----VL...HKIE------LIDKYFG.....L-....D----..TVEEIIEAMEN--------------.........E
Q08V22_STIAD/183-300-----PL..RAHQP------AVDRCFA.....A-....D----..RVEDILTALSA--------------.........E
B7Q287_IXOSC/156-273-----DF..EQLMG------RINSAFS.....A-....P----..SVDAIVENLSK--------------.........D
Q2IY83_RHOP2/228-346-----PA..QRHAQ------QIDQWFA.....H-....D----..TVEAIFADLER--------------.........D
A8R3R7_PSEPU/42-163-----PL..AALRP------AIDHFFA.....L-....P----..DVASIIEQLRA--------------VT.....VGD
Q1NB11_9SPHN/238-356-----KL..AASRT------DIDRMFA.....S-....D----..TAEEIVAALEA--------------.........D
C6XIW5_HIRBI/216-334-----SF..VKQLE------TITKCFD.....K-....E----..TVEDVFAALEE--------------.........D
D9QHM1_BRESC/216-334-----PL..APHRE------AIDRLFA.....H-....D----..RVEDIVAALEA--------------.........D
A7HX73_PARL1/219-336-----PL..AELRG------TIDRHFG.....K-....N----..SVAEILASLRA--------------.........D
Q134G5_RHOPS/230-346-----Q....LHGR------QIDAWFA.....H-....D----..TVEEIFADLER--------------.........D
Q212Q2_RHOPB/228-346-----PA..ERHRD------QIDAAFA.....H-....D----..TVEQIVAALSR--------------.........D
B7Q288_IXOSC/259-376-----GL..KKFMG------RINSAFN.....A-....P----..SVEAIIENLSK--------------.........D
B6HLY2_PENCW/268-389-----LM.AGGLRT------AIDRCFR.....F-....N----..TMEEIIQALEE--------------E.......TE
B4W849_9CAUL/219-337-----PL..DGHRE------AIDRLFA.....F-....D----..TVEEIFAALEA--------------.........D
Q1QKA8_NITHX/229-347-----PV..AAIRP------RIDAWFA.....H-....G----..RMDDIIAALNR--------------.........D
C5FQU8_ARTOC/270-391-----LL.AGSLRE------SIDRCFA.....H-....S----..TMEEIISALEK--------------.........E
B9TBM0_RICCO/227-344-----AL..AVDRA------AIDLHFS.....A-....G----..SVPAIVASLQA--------------.........D
Q0UDB2_PHANO/242-370-----IS..GELRK------TIDKVFNS...DQ-....P----..SIQAILTSLEE--------------IRDG.APSSD
B8IPL3_METNO/223-343-----PL..HAARA------LIDACFS.....A-....E----..SVAAVLARLDA--------------A......AAQ
A3IAF9_9BACI/236-353-----EL..EKLQT------VINHHFS.....R-....N----..TIEEIIQSLDY--------------.........D
Q1D8V8_MYXXD/230-347-----PL..GVQRA------AIDRCFA.....A-....E----..RVDDIQQALEL--------------.........E
D3NUG5_AZOS1/225-342-----MV..RALRA------VIDRCYA.....F-....D----..SVEAIVKALEA--------------.........E
B8BI61_ORYSI/267-391-----SI..VHRLE------VIDKCFS.....L-....E----..TVEEIVDAMEI--------------.........E
B9MUQ3_POPTR/225-348-----VL...HRMN------TLNKCFG.....H-....A----..TVEEIVDSLES--------------.........E
A4YSR1_BRASO/219-337-----PV..AAHQA------KIDAWFA.....H-....D----..SMHDVFAALEA--------------.........D
Q1YU68_9GAMM/224-352-----VTAPAWQDP------QIDSIFA.....L-....P----..TVMDMINALEQ--------------.........A
B1ZJ11_METPB/263-383-----PL..VAERA------LIDACFS.....A-....D----..TVAEVLARLDA--------------A......AAE
Q13IB6_BURXL/234-356-----SL..EALMP------AIQHHFD....PA-....R----..SIGQVIDSLDA--------------.........E
B2UHN2_RALPJ/243-369-----PL..AQATP------WVQRYFD....RR-....S----..SVDRIVATLRE--------------SLER.EQARE
B5GMB4_STRCL/289-407-----EL..SGRRE------WIDACYG.....A-....D----..TVEEIVQRLLT--------------.........H
A2WG07_9BURK/236-363-----AL..DSQLP------WIVRHFD.....K-....R----.SGVERIVATLKQ--------------DLARDELPRE
B9Z557_9NEIS/241-360-----NV..ERQLV------AIHRLMN.....R-....G----..SLAAVAQALTD--------------G.......HF
B2JLZ0_BURP8/237-363-----GL..RAFTQ------AIMRHFD....RR-....S----..GIERIVATLRQ--------------DLER.EHARE
Q1MLQ4_RHIL3/228-346-----RL..KQNAA------TIDRAFR.....F-....D----..SVEEILAALAE--------------.........E
B4RB39_PHEZH/219-337-----PI..AAHQD------EIARLFS.....G-....D----..SVEAIVAALEG--------------.........A
B2W7S4_PYRTR/289-417-----IS..GELRR------TIDSVFHV...DQ-....P----..NIKTIMESLNQ--------------VQCE.ATNPE
A0NMD5_9RHOB/218-335-----PV..SENLD------AIGEAFS.....A-....S----..SVEDILSRLDT--------------.........S
B8ESI3_METSB/218-335-----AF..IKERG------WIDRCFK.....A-....R----..TAAAIAQRLGN--------------.........E
C9SRJ5_VERA1/267-392-----LL.AGELRR------AIDRCFT.....K-....D----..SVPEILKALEA--------------E......EGA
Q4KC65_PSEF5/240-361-----PL..QALRP------VIDHFFA.....Q-....A----..DVPSIVEQLRT--------------VT.....VAD
Q2SVM5_BURTA/241-365-----AL..AAARA------SIDRHFA.....Q-....A----..DVAAIAASLDA--------------.........E
B9J934_AGRRK/225-343-----RL..AANRD------AIDRALA.....H-....D----..TVEDILQGLAR--------------.........E
C4WVV0_ACYPI/243-363-----TM..APFVE------KIDSIFS.....H-....E----..RVEAIVDALRT--------------.........D
Q5Z107_NOCFA/222-340-----AL..VAQRD------WIDSCYS.....A-....P----..TVEEIVERLQT--------------.........A
A1WLH8_VEREI/235-356-----RP..ACARA------QIDDYFS.....L-....P----..DATAIVTALEA--------------.........A
Q12AQ1_POLSJ/237-356-----RL..RLHFD------QINALMA.....G-....D----..DLLDIAARLRS--------------L.......QS
B1MKI3_MYCA9/216-334-----DL..LAQRN------WIDECYG.....G-....E----..SVADIVAALQA--------------.........R
Q4ZVK4_PSEU2/240-361-----PL..ESLRH------AIDHFFG.....L-....P----..DVPSMLEQLQQ--------------VV.....IGD
E8YRL2_9BURK/242-368-----AL..APLTQ------RVLRHFD....RR-....S----..GVDRIMATLRQ--------------DLER.DPPRE
C7YU81_NECH7/264-385-----AL.SGEIRR------AIDRCFN.....K-....N----..TISDIIAALES--------------E......RGA
E8RLF2_ASTEC/222-340-----SY..TEHLE------VINRIFG.....K-....A----..TLADIAIALKL--------------.........E
Q88H70_PSEPK/234-355-----PL..EKLRP------AIDHFFA.....L-....P----..DLPAIVEQLRA--------------VS.....IGD
B6QX63_9RHOB/228-349-----PL..HAKAD------VVDECFG.....A-....E----..STLEVVDRLRK--------------LL.....GSE
Q4DMX9_TRYCC/226-347-----TL..EPHRE------TIEKSFAL..EEK-....T----..TVEGIYESLSA--------------.........D
C3KAC3_PSEFS/239-360-----PL..AALRP------AIDHFFA.....L-....P----..DVPSIVEQLQQ--------------VT.....VAD
B0T1J0_CAUSK/220-338-----PL..VSFEQ------DLNRLFV.....G-....E----..SVEQIFEYLDA--------------.........D
C1DFA4_AZOVD/229-350-----EL..KKLHP------AIETHFS.....L-....P----..DIPSIRASLLA--------------.........E
B4FC76_MAIZE/51-185-----QL..KKLLP------YIISSFS.....P-....D----.KSVAESVEELKK--------------CSR..SGDAA
A1U6V2_MARAV/235-354-----HL..EQHEQ------TIARLSA.....G-....D----..ELPAIVEKLGN--------------S.......ES
Q143S2_BURXL/249-375-----TL..PEYTP------LISRHFD....RR-....A----..GIEQIVSTLSA--------------GLAR.HPPQP
A8L896_FRASN/269-387-----SL..AADRT------WIDPCYR.....H-....G----..SVEEILAALTA--------------.........S
A3LLW1_PSEAI/235-355-----QL..LPRRP------RLDALLD.....Q-....P----..DLASAWQALVA--------------L......RDD
B1FYK7_9BURK/243-363-----PL..ARART------LIDRHFA.....L-....P----..DVPRILASLQQ--------------KC.....DRD
A4T9D3_MYCGI/230-348-----PL..SAHRE------WIDSCYA.....A-....G----..TADDIVSALRA--------------.........H
B9B8U0_9BURK/244-367-----AL..ADARA------GIDRHFA.....Q-....P----..DIGAIVASLEA--------------.........E
A7INC3_XANP2/220-343-----TF..ASRAD------FIADTFG.....R-....P----..DVPAILAALDD--------------AAV...AGGE
B7G076_PHATC/242-366-----YL..AQERP------AIDKVFGILSDRS-....K----..GVEDVVESLEN--------------.........L
Q1GNL4_SPHAL/222-340-----AI..TRHID------RINRLFA.....S-....D----..RYEDILAALEA--------------.........D
B9Z3L5_9NEIS/240-359-----NC..ARNLL------TVQRLMS.....L-....G----..SLDAVAAALAG--------------.........T
B8HBE4_ARTCA/223-343-----GL..AGQRQ------WIDSCYD.....S-....A----..DAEAIVGRLRA--------------W......AGD
A3JYR4_9RHOB/216-334-----PL..AARQA------QIDDLFG.....G-....E----..TLRDVLNALRN--------------.........D
Q4DAM8_TRYCC/234-355-----TL..EPHRE------TIEKSFAL..EEK-....T----..TVEGIYESLSA--------------.........D
A5V401_SPHWW/222-340-----PI..LDRQA------DIDRLFA.....S-....D----..RYEDIVAALAA--------------.........D
A3QDJ0_SHELP/243-361-----IL..EQHQA------QIDALMD.....G-.....----..ELNEIMTRVKA--------------V.......ED
A5W4F7_PSEP1/228-349-----EL..KSLHP------AIDEHFT.....Q-....P----..DLSAIRASLQA--------------ER.....RPE
B2JKB1_BURP8/241-361-----PL..ADARM------LIDKHFA.....R-....A----..DVAQIIRSLDL--------------.........E
B8K6S2_VIBPA/241-360-----QL..LPFYP------HIQQACQ.....Q-....D----..SLLQVVDAIDA--------------I.......EG
Q13ZL1_BURXL/241-361-----LL..ANARA------LIDRHFA.....L-....P----..DVARILASLES--------------ER.....NGE
Q1VBB4_VIBAL/239-357-----ML..MPYAE------LIEQLCS.....G-.....----..DLASIVDAISR--------------.........A
Q7NWA8_CHRVO/237-355-----NV..ERNLL------AVHRLMN.....K-....G----..DLAAVSAALTE--------------.........T
C5CR27_VARPS/239-358-----KV..REHYD------TINALMA.....G-....D----..DLLDIARRLRS--------------L.......QS
A6GRM3_9BURK/262-382-----LL..HTHAE------EIDAVMN.....Q-....K----..SLADIDQSLRE--------------L......QQS
Q15XB2_PSEA6/243-360-----PL..QSTLD------ELAMKTS.....A-....A----..DVADQIMGLDA--------------.........Q
Q2N893_ERYLH/222-342-----RI..EGNAD------KIAKHFA.....S-....D----..RYEDILASLEA--------------V.......MD
Q7VYA4_BORPE/252-372-----PL..RQHSF------LVNSLCS.....G-....K----..RLDDIYAEIAE--------------L......KDH
Q2L131_BORA1/252-372-----PL..RQHAF------QINNLCS.....G-....N----..RLDEVYDDLAS--------------F......QHH
B0CSR7_LACBS/265-392-----FT..GRLRV------ALDSAFR.....H-....D----..SVERIFKDLRT--------------LLQ..DGDAT
A9INM9_BORPD/252-372-----PL..RQHAF------QVNSLCS.....G-....N----..NLPEIYRAIAD--------------L......KDH
B1LX53_METRJ/220-338-----PL..VAHRA------VIDRCFS.....F-....D----..MVDEILSALEA--------------.........D
A3XC08_9RHOB/216-334-----SL..QLQQE------EIDRYFA.....G-....E----..TLTDILTLLQT--------------.........Q
C5C8N8_MICLC/257-384-----AL..VADRE------WIEDAYG.....R-....E----..TAAEVLAALDE--------------RAA...AGGE
Q381D8_TRYB2/226-347-----TL..EEHRP------LIEKVFTL..KDT-....S----..TVEDVMGSLAA--------------.........D
Q1YGH5_MOBAS/224-342-----TL..AEQTE------AIDAAFS.....G-....V----..DAADILQRLAL--------------.........D
E3IZ76_FRASU/226-344-----TL..AAARG------WIDSCYA.....A-....G----..SVADILDRLRA--------------.........H
A4BVU9_9GAMM/241-360-----NV..REHRN------LIDRVTD.....H-....Y----..CLEDLVTQLQR--------------.........H
A3SY56_9RHOB/216-334-----AL..EAQAA------EIDSFFG.....G-....E----..TLADILNALRA--------------.........S
Q5LRB7_SILPO/216-334-----EL..RAMQA------EIDRHFG.....G-....E----..TLGDILTSLKG--------------.........D
Q485B6_COLP3/257-376-----PL..KEHQP------LISTFVE.....K-....Q----..ELTEVLAEILG--------------V.......ET
B9NSD8_9RHOB/216-334-----PL..AQMQA------DIDKYFH.....A-....E----..NLGEILNNLRN--------------.........G
Q8PMW0_XANAC/244-363-----PL..QLHAQ------LIERLVS.....S-....E----..SLEHIVAAIMA--------------L.......QS
B8KU28_9GAMM/244-363-----QV..EPHMA------TINQLCD.....G-....D----..DIHSIIDNIMA--------------I.......DT
Q4Q4Q4_LEIMA/228-351-----TI..AHSIS------SLASHFDI...TA-....D----.LTISSILDACRE--------------H.......AQ
B8LA21_9GAMM/238-357-----PL..LANAA------QVDALCE.....G-....D----..DLSAIIDRISG--------------L.......QT
A6F0M9_9ALTE/235-354-----EL..ARHEQ------DIARLSA.....G-....D----..ELPAIVENLLA--------------.........A
C9PG12_VIBFU/216-335-----QL..LPYLA------NIQSACR.....A-....D----..TLADICDNILG--------------I.......RG
B7RWK1_9GAMM/244-363-----QV..EPHAA------TIAQLLD.....G-....E----..DVHDIIDRITS--------------Q.......DT
A9D9E4_9RHIZ/215-331-----PL..MGLRE------QVDRHFA.....L-....A----..SLAKIVASLPD--------------.........D
Q6BIA2_DEBHA/282-408-----PF.TTEQLK------LIKNAFS.....Q-....P----..SIEEVLSYLEK--------------.........D
B2IDI2_BEII9/219-339-----EL..FKLKH------FVDGCFG.....A-....P----..TVADVLEEIDE--------------.........A
A3VYK2_9RHOB/217-335-----PL..RALTP------QIDRHFS.....G-....E----..TLRDIANALRA--------------.........E
Q6LIA0_PHOPR/241-360-----QL..VPYFS------QIQAACS.....G-....N----..DLNTICQNILA--------------I.......DG
C9QFQ9_VIBOR/241-360-----QI..MPYFN------HIQQACA.....A-....D----..DVLHVTDNILA--------------L.......AG
D3DBM7_9ACTO/251-369-----VL..EADAD------WIDACYG.....A-....P----..TVEAILARLRE--------------.........H
A9FQT5_9RHOB/216-334-----TL..APMYD------DIGRNFG.....G-....E----..TLTDILTALDH--------------.........D
B6BEV0_9RHOB/216-334-----TL..RGVRE------DAAKHFG.....K-....D----..SLEDIRQSLEA--------------.........D
A1SIK1_NOCSJ/213-330-----SL..AAQRP------WIDECYS.....A-....P----..TVELILERLRS--------------.........H
A4C9M2_9GAMM/236-355-----NI..KANLA------VIKQMNA.....L-....A----..TLNEKISFLAN--------------V.......DT
D0L573_GORB4/229-343-----PI..AERRD------WIAHAFA.....A-....D----..TVTEIVARCRA--------------.........V
Q46TC0_CUPPJ/240-362-----PL..LEVLP------ALLRHFP.....A-....D----.AGLPEIIASLSC--------------.........Q
A6AP67_VIBHA/240-359-----QI..CPYLD------QIKEACK.....G-....Y----..DLNQIAQRIQA--------------M.......EG
Q28R37_JANSC/214-335-----TL..AAQRR------AIDHLFG.....G-....E----..TLRDLLVDLAH--------------A......PDD
Q0RM03_FRAAA/274-392-----HL..TTDRA------WIDELYR.....G-....D----..KVTEILAALTA--------------.........S
A4SZ56_POLSQ/226-345-----AL..AEKHP------LIDSIFS.....L-....P----..RVEQVIAKLEQ--------------V......APN
Q164T3_ROSDO/216-334-----AL..ADLQP------EIERHFA.....G-....E----..GLSDILTTLQT--------------.........D
Q488V8_COLP3/238-357-----NL..ATNQT------LINDLCR.....S-....D----..NVEKIAANFSS--------------L.......KT
Q3IGC8_PSEHT/246-365-----NI..KANLA------TIQELAE.....F-....T----..TLQQQVDYILN--------------L.......NT
Q084X0_SHEFN/240-358-----PL..QQFQA------QIDLLMS.....G-....D----ILDVHHQLSSLNT--------------.........D
E3I3E7_RHOVT/218-336-----AL..AANRV------EIDALFA.....S-....P----..DAVSIVQSLEN--------------.........A
Q6CA37_YARLI/262-380-----QY.GGEFRA------LIDRTFK.....Y-....D----..AIEDIVAALKQ--------------.........E
Q0FTH2_9RHOB/216-334-----PL..ATAQS------EIDQLFA.....S-....D----..SLPEIKAALDG--------------.........A
B0TMR3_SHEHH/260-386-----QL..KQNQL------LIDELMI.....G-.....----..TLDEIISRVSC--------------LDE...QIGA
A8FTB5_SHESH/254-372-----QL..EAKQT------EIDELMT.....G-.....----..SLTEIVERVSS--------------V.......DC
Q8PB61_XANCP/244-363-----PL..QLHAA------LIASIVS.....A-....G----..TLQQVADALLA--------------L.......QS
A9DFC7_9GAMM/243-361-----QL..EMHKD------DIDVLMS.....G-.....----..SLNEIMARVGE--------------L.......KL
Q12MV4_SHEDO/240-361-----LL..AKEQG------LIDELMT.....G-.....----..TIDEVHRKLCG--------------LD....INDA
Q87II2_VIBPA/240-359-----QI..CPHLE------QIKEACK.....G-....V----..DLNLIAQRIMA--------------M.......ED
A4WS71_RHOS5/212-330-----RL..PEAQA------EIDRLFE.....G-....F----..SLADIIGRLEQ--------------.........A
A6D633_9VIBR/241-360-----QL..KPRLD------EICAACN.....A-....T----..DIGSVFTNIMA--------------L.......PG
A9V573_MONBE/229-344-----VF..AEHME------EIRRCFD.....V-....D----..ALKTCLENLDE--------------.........S
A3U2T9_9RHOB/217-331-----PL..AAEQA------QIDRLFR.....G-.....----..DLPEIMDRLEA--------------.........A
A1K1H9_AZOSB/239-359-----PL..RTHLD------RIEAVVG.....R-....G----..SLAEIAVRLHA--------------L......AAD
B8KL52_9GAMM/239-358-----QV..EAHLP------AINALCD.....G-....D----..DIHDVIDRITS--------------L.......DT
A3VDC8_9RHOB/216-333-----PL..ARAQT------EIDNLFD.....G-.....----..TPADIAAKCDA--------------.........G
B1KMU0_SHEWM/250-368-----QL..AEKQA------EIAELMS.....G-.....----..SLSEIIERVSH--------------.........S
B9W7B3_CANDC/277-400-----FL.STEDIA------TINKAFS.....Q-....N----..TIDDVLKYLEN--------------.........D
Q2C757_9GAMM/264-383-----QL..LPYFA------QIQAACF.....A-....Q----..SLPTIYDQINA--------------........ID
Q1GHN1_SILST/216-334-----KL..QAMQG------DIDATFA.....G-....E----..TAADILTVLRG--------------.........R
A0Z2J1_9GAMM/235-354-----QV..EPLMD------EINAWVS.....G-....D----..DLAEIVDRISL--------------W.......QG
B9KJQ6_RHOSK/212-329-----RL..PVLQA------EIDRLFA.....G-.....----..TLAEILARLEA--------------.........T
A4EVS1_9RHOB/216-334-----TL..EAMQS------DIDRCFS.....G-....E----..ALGDILTVLKG--------------.........D
C5MFF3_CANTT/281-404-----FL.SSDEIA------IVNKAFS.....Q-....D----..SIDGVFKYLET--------------.........E
A3LXK5_PICST/255-378-----PY.TAKELK------VINEAFS.....Q-....K----..SFEDVISYFKQ--------------.........E
C7D792_9RHOB/220-337-----RL..SEKMD------QINVHFG.....G-....E----..ALADIVRSLRQ--------------.........D
A8LME8_DINSH/216-334-----RI..APFCA------EIDADFN.....Y-....V----..FGVEVEAALDT--------------.........R
D2VUW6_NAEGR/1151-1277-----SF..AFELY------KIKEHFS....NK-....K----..SVEEIIQSLKN--------------TITDSTKTKP
B1VFJ2_CORU7/237-360-----TL..LANAQ------LISEIFG.....G-....E----..TWLEIDKALAA--------------ASA...PDEA
C4R612_PICPG/259-389-----KF.SPEELN------TIEAAFDP..KAN-....P----..SVESVISALEA--------------.........D
C0WF71_9CORY/225-342-----PL..AELIE------GIEASFC.....H-....D----..SWQDITAAAKE--------------.........Y
A7TTD5_VANPO/277-405-----FT..DCQLD------VIERAFNI..DAN-....E----..SVTSILNSLDS--------------FAD...ASEE
C5DX08_ZYGRC/263-400-----YT..VDQLR------VIEACFD.....A-Y.SLT----..SIQQLLHNLER--------------VASDPSNSED
Q6NI92_CORDI/230-349-----EL..ATLLP------HIEKTFG.....F-....P----..TWAQINEALDT--------------........YP
Q4Q4Q6_LEIMA/230-354-----TL..AESAP------VLAKAFG.....T-ITPWT----..RLRDIMDVLRA--------------.........D
Q5KPF9_CRYNJ/272-407-----PI.KGEIRK------FLDKTFN.....K-....K----..SIQEIYAALDK--------------SQSDDKLSSE
Q6FM09_CANGA/273-401-----FS..KDQLE------VIEKCFDI..SSG-....E----..SINAIFSKLEA--------------FE....GTPE
C3PF52_CORA7/224-341-----PL..EQVAK------DLEETFT.....L-....P----..TWEEISAELDK--------------.........R

PF03572

Q8CVF0_LEPIN/340-512-----HIGYIKLTG------FVKSEE.......-.GPSV----DREIIEKYKELDK--------------EAQAKGTRLK
RET3_XENLA/1022-1198-----NIGYIRFDM------F..ADSDL.....-LNQVS----DLLVEHVWKKVV.--------------.......DQD
CTPA_SYNP2/215-376-----KVGYIRLNQ------F..SA........-...NA----KTEIIKSLNQLQK--------------......QGAD
Q81R25_BACAN/181-400-----DTLLITLTD------FANIE........-...AI----NKLLDSHKNELN.--------------.......SFQ
Q7UUN0_RHOBA/410-573-----KIGYFRLTN------F..QK........-...ST----PAEVEKALWALSR--------------......QGMR
Q8HXM2_BLABR/30-208-----NVGYLRVDD------V....PSQE...E-VSMQG----GLLGASTWRNLT.--------------.......TTS
Q8Y2I4_RALSO/213-395-----GIAWVRITS------F..QE........-...RT----VPDLAKKLNDLAH--------------Q....DARLK
Q8DII0_THEEB/215-376-----TVGYIRLSQ------F..SA........-...MA----PTEMRKAIQILEQ--------------......QGAE
O57689_DANRE/419-585-----NIGYLRFDM------F....GDFE...H-VATIA----QIIVEHVWNKVV.--------------.......DTD
Q8R712_THETN/193-353-----GIGYIKITE------F..NE........-...NT----TANLTKALLFMDK--------------......NNVK
Q87YB6_PSESM/365-539-----KLGVIDIPA------FYLDFKAYRAGDP-EYKST----TRDVKKLLTELQA--------------......EKVD
TRI_SULSO/887-1042-----RLGYIHIPD------M............-....M----YQGFAEFYRLFMS--------------.....EFHRE
Q7VMG7_HAEDU/365-546-----NIAVIKIPA------FYIGL........-.....----ANDMHKLLAKIKT--------------......KKIE
Q8R7P6_THETN/299-499-----KVAYLKIPE------M....KMSQ...N-DIKKD----GKEIYSFFKEIK.--------------.......DYP
Q8A406_BACTN/202-362-----KVGYISLST------F..SG........-...NP----SKDFKKALLDLKK--------------......QGAT
Q7NKF3_GLOVI/143-304-----GIAQVQLAS------I....G.......-..FGS----ASQVSQALHQAD.--------------.......HSR
TRI_THEAC/878-1033-----TIGYIHIPD------M............-....G----MMGLNEFYRLFIN--------------.....ESSYQ
Q8S3I7_NICPL/284-447-----SVGYVRLKE------F..NA........-...LA----RKDLVTAIKRLEG--------------......MGAS
O83301_TREPA/167-332-----NIAYVRLIE------F..NP........-...VT----ATRMVETVTELRR--------------......QGCD
Q7TUF4_PROMP/222-383-----TIGYLRITQ------F..SE........-...SV----PKKIEEALQELKD--------------......KEVE
O57689_DANRE/126-302-----NIGYLKIQH------I....IGEE...M-AQKVG----PLLLEYIWDKIL.--------------.......PTS
Q87CM3_XYLFT/366-549-----RIGIIKLPT------FYEDFEGRRRNLA-NYTSA----TRDVAKLLTNFKT--------------......DKVD
Q8R6Q0_THETN/169-397-----KVAYLKVYS------F...LIDRHKGEE-EYKKE----KEKIYDFLKGIK.--------------.......DYP
O04073_SCEOB/276-438-----QLGYVRLAT------F..NS........-...NT----TAAAQQAFTELSK--------------......QGVA
Q87PB1_VIBPA/356-526-----KIGVLEVPS------FYVGL........-.....----SQDTDKLLNDLKA--------------......KNVD
Q8A2L4_BACTN/546-711-----KILYVDAGI------M............-....G----LPELDQMMKTNL.--------------.......NAK
Q8EDY9_SHEON/364-534-----KVGVIQIPG------FYMNL........-.....----SQDVEKELLKLNE--------------......AKVE
Q97LQ5_CLOAB/210-372-----EIGYMQVSM------F..DE........-...NT----GNNFNKKIDELKQ--------------......QGMK
O66985_AQUAE/192-355-----GIGYIKISQ------F..TS........-...GT----SKSLEKAILELEN--------------......QNVK
Q9RU43_DEIRA/206-370-----NIGYVALNT------FYNEQ........-....A----SAQFRAAIADMKK--------------......ANVQ
P73458_SYNY3/220-381-----RVGYIRLNQ------F..SA........-...QA----SEEMRQAVQKLEK--------------......ENVV
Q7UNS4_RHOBA/218-383-----DIVYVRMTS------F..GD........-...KT----VSELRSVLSRLMP--------------.....KPDVS
Q9RUS4_DEIRA/235-411-----DVALIRIPT------F............-...LT----GGGVAQRVHDLVN--------------QA..ERVGAQ
Q894Q8_CLOTE/197-416-----DTAYIKINN------F....YHY.....-NIAND----KDKLINFYRKNS.--------------.......DKK
Q84FE7_MYXXA/208-376-----GIGHVKVKN------F..QD........-...RT----DLYLRKELDRLRA--------------LN..GGKELR
Q82BY0_STRAW/878-1033-----RLGYLHVPD------M............-....V----GSGWAQLHRDLRI--------------.....EVARQ
Q8YRM4_NOSS1/218-379-----SFGYLRLTQ------F..NA........-...NA----SMELAHAISSLEK--------------......KGAA
Q8CVF1_LEPIN/197-364-----KLGYIKLNQ------FMGKE........-...NT----LSEFKKELNSLKE--------------......KGAE
Q8A5K0_BACTN/312-500-----KIGYLVYSA------F....E.......-..SGF----DQELFDVFKEFKS--------------......QNIT
Q89KT1_BRAJA/201-369-----DIGYIRVTS------F..NE........-...QT----TDGLKKAIAAISR--------------EI..PQEKLA
Q8ENJ3_OCEIH/223-384-----LTGIIEITN------F..SE........-...KT----GDEFDQQLTELEN--------------......QGIE
Q8XNN1_CLOPE/231-397-----DIGYIEVLA------F..DE........-...GT----AKDFETQLKALEE--------------......KGMK
Q8P5D2_XANCP/126-301-----DVGYVAVPG------L....MTSS..SD-VRGDY----QRALSAALDGMAS--------------......QARC
PRC_HAEIN/363-533-----NIAVIKIPS------FYIGL........-.....----TEDVKKLLVKLEN--------------......QKAE
Q8Y649_LISMO/229-395-----KIAHVTIST------F..SE........-...TT----YDELEKALKSLEK--------------......DGMK
Q7NHI8_GLOVI/142-311-----NIGYLELHG------F....VTPA...Q-AAETA----AAAMRFV....A.--------------.......YTD
P75023_SYNY3/244-405-----RVGYIRLDE------F..SS........-...HS----AEQMEKAITELNK--------------......SRIS
Q9L5V8_9BACT/892-1048-----QIAYVHVKA------M............-....D----SESFRTVFSELLS--------------D...SNRQKK
RET3_HUMAN/742-918-----QLGYLRFDA------M....AELE...T-VKAVG----PQLVRLVWQQLV.--------------.......DTA
Q9SVY2_ARATH/303-473-----KTGYVKLTA------F..SQ........-...TA----ASDMENAVHEMEN--------------......QDVQ
Q9A2X1_CAUCR/195-362-----DYGYVRLPG------F..NE........-...KA----TDALASSVSELKS--------------K....NPKMK
Q8R7P7_THETN/191-422-----KIAYLRVNS------F...LIDKDQNSK-NYREE----KKEIYNFLKTIK.--------------.......DYP
Y858_CHLTR/316-560-----KVGFLRIPT------Y.SWQDMEDF.DP-SGPPP----WEEFAKIIQVFS.--------------......SNTE
Q8FYM8_BRUSU/181-348-----DVGYLRIIS------F..TE........-...QT----SEDLKKAIKDIQE--------------KV..PADKLK
Q8KAA8_CHLTE/214-383-----SSGYVQMNS------F..SE........-...HS----REELSAAIRKIRQ--------------EAAKNRVVLN
Q8ZXG0_PYRAE/836-991-----AVGYIHIPD------M............-....G----PAGYAEFFKSLNA--------------.....EGDKE
Q7VFQ7_HELHP/223-383-----DFAYVRVAS------F..DK........-...NV----TRNVLSSLKQMG.--------------.......KVK
Q8A3B9_BACTN/191-351-----KIGYIRINR------F..GA........-...TT----AEEFKKAMKDLQK--------------......QGMK
Q92UP4_RHIME/234-388-----RIGYLRLWT------L............-...SS----PDGLDIAARELAT--------------G...RLKDAD
Q7VBS8_PROMA/229-390-----HFGYIRLKQ------F..SA........-...NA----AKEMRKALISLER--------------......NDPD
O23614_ARATH/320-483-----KIGYIKLTT------F..NQ........-...NA----SSAVREAIETLRG--------------......NNVN
Q879Y2_XYLFT/195-361-----GYGYIRISV------F..QA........-...DT----GNDFHKHLGQLKQ--------------Q...AGGKLR
RET3_XENLA/721-897-----NVGYLRFDM------M....ADTE...I-IKAIG----PQLVSLVWNKLV.--------------.......ETN
Q87CV7_XYLFT/204-366-----LIGKTLVIA------F....N.......-..EMT----DENTQWALQQIKN--------------......TPAT
Q815H1_BACCR/212-374-----DIGYMQITS------F..AE........-...NT----AKEFKDQLKELEK--------------......KNIK
Q87UG9_PSESM/211-377-----GYGYIRITQ------F..QV........-...KT----GDEVGKALAKFRK--------------D...NGKKMS
Q7V214_PROMP/205-366-----LIGYVRLKQ------F..NA........-...NA----SREMKDTLKDLEI--------------......KKVS
Q7NPI8_GLOVI/227-389-----PIGYIRLSQ------F..NG........-...NA----AQQVRQAIEKLEA--------------......QDAA
Q9FL23_ARATH/306-469-----SVGYIRLKE------F..NA........-...LA----RKDLVIAMKRLLD--------------......KGAS
Q82H90_STRAW/894-1049-----HCGYLHIPD------M............-....G----GSGWAQFNRDLRM--------------.....EVSRP
Q893L7_CLOTE/248-394-----NILYFKYNS------C....M.......-..EMK----DKPFKEFSKELLE--------------VL..DKNNVK
Q9AAF2_CAUCR/247-457-----DAAILTMPT------W....GLY....N-SKWDW----RGWLDREIDALIT--------------......QNVP
Q87Q24_VIBPA/260-446-----KVGYLQYNS------F....E.......-..PSA----QTPLIDAFNKLAE--------------......AQVD
RET3_HUMAN/438-617-----NVGYLRFDS------F....ADAS...V-LGVLA----PYVLRQVWEPLQ.--------------.......DTE
Q7UJ42_RHOBA/384-569-----KLGYINLPS------FYMDMEAARRNET-DYRSS----TRDVERILRDFKS--------------......QNVG
CTPAL_STAES/226-390-----NVGVLTINK------F..QS........-...NT----SGELKSAIIKAHK--------------......QGIR
Q8R7Q0_THETN/178-406-----KIAYLKIYS------F...LIDYHKDGE-GYKKE----RDMIYDFLRNIK.--------------.......DYP
Q8R8M1_THETN/207-366-----KIGYIKITL------F..DQ........-...ST----SSDFKKALERLKK--------------......DGMK
Q822D8_CHLCV/312-557-----SIGFLRIST------Y.SWTDMEDRTAM-NMESP----WDDFSEIISVLQ.--------------......EKTE
Q8YPV0_NOSS1/193-349-----KIGYVHIWS------N............-...AA----DPYQQELQNELIY--------------G...RLRNAD
PRC_ECOLI/356-530-----KVGVLDIPG------FYVGL........-.....----TDDVKVQLQKLEK--------------......QNVS
RET3_XENLA/127-301-----NIGYLRIDF------I....IGQD...V-VQKVG----PHLVNNIWKKLM.--------------.......PTS
Q865N9_FOSFO/35-213-----NVGYLRVDD------I....PSQE...V-VSKLG----GFLVASVWRKLM.--------------.......GTS
Q892K7_CLOTE/192-411-----DTCYVKIHT------F....NHD.....-FVKIN----TDKLLNFYKENA.--------------.......NKK
NSR_LACLL/123-302-----NTLILTIPE------F....TG......-.NDSQ----ASDYANFLESSLH--------------.....KNNYN
Q7X344_9BACT/201-370-----TVGYLLFRN------F....V.......-..EPS----YGALDEAFAALRE--------------......ARAT
Q834H3_ENTFA/208-374-----QIGSIKITS------F..GK........-...KT----YQELKETITNLRD--------------......KGAK
Q40067_HORVU/170-334-----SVGYIHIKE------F..NA........-...VA----KKDLVSALKRLQN--------------......SGAS
Q7PB48_RICSI/193-360-----NIAYIRITT------F..NE........-...ST----ISELKAAVKKLKT--------------E...SKDDLK
Y1016_CHLPN/316-561-----RIGFLRISS------Y.VWTDLEGLEED-HKDSP----WELFGEIIDHLE.--------------......KETD
Q89X80_BRAJA/202-369-----DIAYIRITT------F..NE........-...QT----TEGLKREVANLSN--------------Q...IGDKLK
Q8DGJ2_THEEB/238-398-----RVGYIRLSG------F..NS........-...RS----QQQMQEAIEILQR--------------......EKVQ
Q9CP01_PASMU/362-532-----IVASIKIPS------FYIGL........-.....----TQDVRKLLAEMKT--------------......KKAK
Q896W4_CLOTE/217-379-----NIGYVHIKS------F..GN........-...KT----PELFKKRIENLLN--------------......SNIE
Q7MSB3_WOLSU/198-359-----EMLYVRVTS------F..DK........-...KV----GKRVAEELKKAS.--------------.......WAK
Q9WZK6_THEMA/203-364-----SIGYVRITR------F..GE........-...KA----DSDMKNALDKIFE--------------......KGVK
Q8YW78_NOSS1/226-387-----RVGYIRLRE------F..SA........-...HA----AEQMARAIRNLNG--------------......QKVD
Q83BH0_COXBU/210-383-----GYGYVRITF------F..QG........-...PV----ENQLRDAIDKLKK--------------E...SQGPLK
Q7NSR6_CHRVO/194-376-----GYGYVRIAQ------F..QE........-...HT----AEDLAAGLQKLYQ--------------E...NKQPLK
O18857_PHATA/57-235-----NVGYLRVDY------I....PGRE...M-IEKVG----EFLVNDIWKKVM.--------------.......ETS
Q9RUA1_DEIRA/235-408-----RVAVIDLPS------F............-...LS----TDTAAAFLAQVRQ--------------L...QAAGVR
Q9A6Q6_CAUCR/254-429-----DVGYLNVLT------M..GAFARNAAPD-DPRPL----DAVLDEALSAFV.--------------.......GAK
Q7MTT6_PORGI/195-361-----SIAYVRIDS------W..TG........-...TT----HAEFIEALGRLRK--------------......KGAT
Q9L1S8_STRCO/194-352-----GLTVVKVTS------F..TK........-...GV----GEQVREAVARVP.--------------.......SGA
Q82PY7_STRAW/269-453-----GTGYLRVSG------F....GGYDGDSP-AYARN----SAVLDETLSQVIR--------------......PGLR
RET3_HUMAN/1041-1217-----NIGYLRFDM------F....GDGE...L-LTQVS----RLLVEHIWKKIM.--------------.......HTD
O30968_NOSP7/217-378-----KIGYIRLPE------F..TQ........-...TA----PAQMHRAIEALEK--------------......QQVQ
Q7MXF8_PORGI/163-329-----RTGYIRLSR------F..SR........-...TT----YDEFAEGIALLRG--------------......RGMQ
Q8KDJ6_CHLTE/340-525-----KIGVIVLPS------FYLDFEGERQQKH-NYAST----TKDVARIINELKQ--------------......ENVE
Q8A1T1_BACTN/145-316-----NIGYIRYES------F....S.......-.SGVG----DGNLDEILVYLA.--------------.......TCN
Q7NGR6_GLOVI/216-377-----RVGYIRLSQ------F..NA........-...YA----AKDMGNAVAKLTR--------------......EQAD
Q8R640_FUSNN/203-364-----GIGYLRLTQ------F..GD........-...NV----YPDMKKALEDLQA--------------......KGMK
RET3_XENLA/423-598-----NIGYLRFDQ------F....ADVS...V-IAKLA----PFIVNTVWEPIT.--------------.......ITE
Q82TT8_NITEU/202-384-----GYAYVRITQ------F..QE........-...RT----GENLAEAITKLYS--------------G...SKVPMK
Q7NL17_GLOVI/226-387-----KLGYIQLQQ------F..NA........-...KA----GREVRAALDVLGG--------------......EGAR
Q8DZX2_STRA5/125-302-----DILLITIPS------I....S.......-..KLD----KRSISHYSGKLQN--------------IL..MEKSYK
CTPA_SYNY3/218-379-----SVGYIRLSQ------F..SA........-...NA----YKEVAHALHQLEE--------------......QGAD
O25905_HELPY/210-371-----PYLYVRVSG------F..DK........-...NV----TKSVLEGLKANP.--------------.......KAK
Q7U4U5_SYNPX/228-389-----TLGYLRITQ------F..TD........-...GV----PEQVQQALEELQD--------------......KNIE
Q7MUB1_PORGI/151-321-----SIGYIVYES------F....G.......-.KPIS----NSNISGMLSRLT.--------------.......ECK
CTPB_BACSU/213-375-----SVGYIAIST------F..SE........-...HT----AEDFAKALRELEK--------------......KEIE
O84448_CHLTR/354-525-----IIGKITLHS------FYEGEN.......-.QVSS----EQDLRKAIRELQE--------------......KNLL
Q8DJ23_THEEB/220-381-----PVGYIRLVT------F..SS........-...NA----AGEMRAAIRELEK--------------......QGVE
TRI_THEVO/839-994-----RIGYIHIPD------M............-....G----IMGLNEFYRQYVT--------------.....EASRN
Q8A7W6_BACTN/916-1071-----RLGYVHIQS------M............-....G----DGSFRTVYSDILG--------------K....YNNCD
Q9KNC0_VIBCH/209-365-----RLGYVHLAA------M............-....D----AASFEQMQNDMFG--------------L....EKDKL
Q7U711_SYNPX/231-392-----KIGYIRLKQ------F..NA........-...NA----SREMRAAIQDLDE--------------......QGAQ
Q8YU55_NOSS1/219-380-----KVGYIRLNQ------F..SA........-...NA----SKEMQEAIKNLEK--------------......QQVA
Q8KD83_CHLTE/187-349-----RTGYIRISQ------F..VE........-...TT----GSEFHNAVQKLRD--------------......KGMR
Q8EBT8_SHEON/888-1043-----KIGYLHLYA------M............-....G----GGDIESFAREFYT--------------.....NYDKD
Q8ABF6_BACTN/222-423-----KVGYLMYNS------F....TA......-GTNND----PEKYNNELRKVST--------------IF..QEANVQ
Q7VS41_BORPE/198-377-----NVAYLRIAQ------F..QE........-...KT----GPDLARHLKELGA--------------.....KGAPK
CTPA_BACSU/201-363-----NIGEIQITS------F..SE........-...TT----AKELTDAIDSLEK--------------......KGAK
TRIC_SULTO/669-824-----KLGYVHIPD------M............-....M----YQGFAEFYRLFLS--------------.....EFHRE
Q9K6X5_BACHD/210-372-----TIGMLEITS------F..SE........-...DT----ADRFEEGLAQLEG--------------......EGID
Q7MVK0_PORGI/205-366-----SIGYIRLNN------F..TD........-...KS----AEEVRTALLDLRD--------------.....KQGAK
Q8P3J7_XANCP/253-471-----RLAILRMPD------W....ALY....D-SQWDW----RGFLAQSFSTLAA--------------......RKVP
Q89ZW2_BACTN/204-370-----DIGYVKVSK------F..GR........-...TS----HVELLNALAQLNH--------------......KKCK
Q8EKP4_SHEON/197-361-----NIGYVRLSS------F..QE........-...DS----TEDMVRTLSQWQG--------------......TQLT
Q7TUQ0_PROMM/225-386-----TLGYLRITQ------F..SE........-...GV----PEQVKEALQELSE--------------......KEIE
Q890X6_CLOTE/207-369-----DVALVQVTM------F..DE........-...NT----AKNFKSELDKLKS--------------......QGMK
Q7NPD6_GLOVI/225-386-----KVGYIRLAE------F..SE........-...KA----PNEMQRAFAKLSE--------------......AGVQ

PF03255

ACCA_SHIFL/4-151YTLDYVRLAFDE-------------FDELAGDRAYADD---------KAIVGGI----ARLDGRPV--------------
ACCA_SYNE7/10-154STLDYIQAISDE-------------WIELHGDRNGSDD---------LALVGGV----GALDGQPV--------------
ACCA_HELPY/3-141YAMDYIDLILKD-------------KYEVFGDRHYNDD---------KAIVCFV----GKIDNVPV--------------
ACCA_HAEIN/4-147YTLDYIEHIFTE-------------FEELAGDRAFADD---------KAIVGGL----ARLDGRPV--------------
ACCA_AQUAE/7-151HTSDYIKYLIKD-------------FEEVHGDTCYGDD---------KAVIAGF----GYFRGKPV--------------
ACCA_CHLPN/2-146RTVNYIEGMCEE-------------FVELCGDRTFRDD---------PAVVGGF----VKIQGQRF--------------
ACCA_CYACA/9-153TTLDYIEYLLDS-------------WIELHGDRRGSDD---------PAIITGI----GRIGRRSV--------------
ACCA_ANTSP/7-151TTLDYIGHILDD-------------WIELHGDRGGTDD---------PALIGGL----GKINNRTV--------------
ACCA_PEA/91-235TFLDHMYNMTEK-------------FVELHGDREGYDD---------PAIAAGL----GSIDGKTY--------------
Q39833_SOYBN/89-233TFLDHVFNITEK-------------FVELHGDRAGYDD---------PAIVTGL----GTIDGRSY--------------
ACCA_BACSU/3-147TTLDYIEHLFTD-------------FFECHGDRAYGDD---------EAIVGGI----AKFHGLPV--------------
ACCA_DEIRA/1-145TALDYVDRLCSD-------------WTELHGDRRFGDD---------PALIGGP----ARWQGRPV--------------
ACCA_PORPU/9-153TTLDYIPNILDE-------------WIELHGDRGGADD---------PALVGGI----GKIDGHSI--------------
P71532_9PROT/2-146HTLAYISTLIED-------------FTPLAGDRAFAED---------EAIIGGL----GRFRAASV--------------
ACCA_SYNY3/9-153STLDYIQAIADD-------------WFEMHGDRGGYDD---------PALVGGV----ARLGTRPV--------------

PF01039

PCCB_SACEN/46-544YDMREVITRLVD.............EGEFLEVSALFA----------PNMLCGF----GRIEGASV--------------
ACACB_HUMAN/1780-2334YDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWA----------QTVVTGR----ARLGGIPV--------------
PCCB_BACSU/26-505YDVRKVIRELAD.............PQSFFEIQPFFA----------KNIVIGF----ARLGEKAI--------------
YNGE_BACSU/27-509FDMHELIERVID.............EDSFFEIKALFA----------PELLTGL----ARIHGQPV--------------
12S_PROFR/38-522YDVRDVIAKIVD.............WGDYLEVKAGYA----------TNLVTAF----ARVNGRSV--------------
ACACA_HUMAN/1669-2223YDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWA----------QTVVVGR----ARLGGIPV--------------
PCCB_HUMAN/57-537YNMVDIIHSVVD.............EREFFEIMPNYA----------KNIIVGF----ARMNGRTV--------------
Q39478_9STRA/1471-2014YDPRLMLSGTDEELG.......FFDTGSWKEYLAGWG----------KSVVIGR----GRLGGIPM--------------
Q9ZCU2_RICPR/30-512YDMKELVERIVD.............EGEFFELQPDFA----------KNIIIGF----GYMEGYPV--------------
O87201_CORGT/38-535YDMKEVISRIVDD...........A..EFFEIQEDYA----------ENILCGF----ARVEGRSV--------------
ACC1_ARATH/1587-2139CDPRAAIAGVKDNTGKW..LGGIFDKNSFIETLEGWA----------RTVVTGR----AKLGGIPV--------------
Q57079_9FIRM/29-507YDMKDVIAATVD.............NGEYYEVQPFYA----------TNIITCF----ARFDGQSV--------------
ACCD_MYCTU/12-482GVRQLLRHGATD.............RVLLSGTDQGEA----------ATTLLAL----ARFGGQPT--------------
O60033_EMEND/1606-2161YDVRWLINGKEDEEGFL...PGLFDAGSFEEALGGWA----------RTVVVGR----ARLGGIPM--------------
O06165_MYCTU/41-527YDVHEVVVRIVD.............GSEFSEFKAKYG----------KTLVTAF----ARVHGHPV--------------
O48959_WHEAT/1642-2195CDPRAAISGIDDSQGKW..LGGMFDKDSFVETFEGWA----------KSVVTGR----AKLGGIPV--------------
HFA1_YEAST/1619-2176YEARWLIEGKWDSNNNF..QSGLFDKDSFFETLSGWA----------KGVIVGR----ARLGGIPV--------------
Q12721_USTMD/1546-2102YDPRWLINGTKAEDGTK..LTGLFDEGSFVETLGGWA----------TSVVTGR----ARLGGIPV--------------
O28066_ARCFU/27-514YDVRDVITAVVD.............NGELLEIHPYYA----------PNAVVGF----ARIDGKSV--------------
O86318_MYCTU/45-527FDPREVIARIVD.............GSEFDEFKPLYG----------SSLVTGW----ARLHGYPL--------------
Q20676_CAEEL/55-534YNMKDVVHALVD.............EGDFFEIMPDYA----------KNLVIGF----ARMNGRTV--------------
PCCB_RHOER/5-474YDVRPIVHEMLDNV.........EGESSFEELQGNYA----------RSIVTGF----GRMAGRTV--------------
Q41511_WHEAT/1583-2142CDARAAICGIQDTQGGKW.LDGMFDRESFVETLEGWA----------KTVITGR----AKLGGIPV--------------
O86517_STRCO/39-525YDMTKVIEELVD.............EGEYLEVHERWA----------RNIICAL----ARLDGRVV--------------
O52601_SULME/26-513FDIRDLVYAVVD.............NGEFLEVHKHWA----------QNITVGF----ARVAGNVV--------------
O24789_MYXXA/32-522YDIKEVIKAIVD.............DKHFFEVQEHFA----------KNIVIGF----ARMNGRTV--------------
O59018_PYRHO/28-520YDVRQVIYTIVDRD........ENGNPDFLELQPYFA----------PNAVIGF----GRINGQPV--------------
PCCB_MYCLE/50-547YDMHEVVTRLLDE...........E..EFLEVQAGYA----------TNIVVGL----GRIDDRPV--------------
ACAC_YEAST/1574-2130YDVRWMIEGRETESGFE...YGLFDKGSFFETLSGWA----------KGVVVGR----ARLGGIPL--------------
MCCB_ARATH/93-585FDVRSIIARIVD.............GSEFDEFKKQYG----------TTLVTGF----ARIYGQTV--------------
ACAC_SCHPO/1615-2170YDPRWLIAGKEDEDSFL...YGLFDKGSFQETLNGWA----------KTVVVGR----ARMGGIPT--------------
MCCB_CAEEL/119-606YDVREVIARIVD.............GSRFHEFKERYG----------ETLVTGF----ATIYGQRV--------------
O88155_CORGT/44-541YDVRDVIECLTDD...........G..EYLEIQADRA----------ENVVIAF----GRIEGQSV--------------
GCDA_ACIFV/54-573YDIYNVIARLFD.............NSELHEYKKGYG----------PEMVTGL----AKVNGLLV--------------

PF06833

Q8P4U4_XANCP/5-230LAR----------------------GDELLGINGYFAH---------LAKSLDL----ARARGARL--------------
Q89XP1_BRAJA/5-233MSK----------------------RDELLGLNEFLAH---------LAKVLIH----ADMNGRPT--------------
Q9I6S6_PSEAE/11-268YGR----------------------REEALGIHQALAG---------AVDAYAR----ARLAGHPL--------------
O32714_KLEPN/10-266YGR----------------------REEAFGIHQALAG---------AAGAYAK----ARLAGHPV--------------
Q89UY5_BRAJA/5-233MSK----------------------RDELLGLSEYLSH---------LAKALLL----AEAEGHRT--------------
O54417_ACICA/5-236LSR----------------------ADELLCLNRTFAH---------LASCVDL----LRRSGHAN--------------
Q93L25_BURCE/5-230LRR----------------------RDELLGINRAMAH---------LGACIDL----ARRSGHAV--------------
Q87V58_PSESM/9-266YGR----------------------REEALGIHQALAG---------AVDSYAR----ARLAGHPV--------------
Q9Z449_PSEPU/6-260YGR----------------------REEALGIHQALAG---------AVQAYAQ----ARLAGHPV--------------

PF01972

Y137_METJA/3-286-IDLIIHTPG--------G-----LVLAATQIAKALKA-------H-PAETRVI----VP-HYAMS--------------
Y1495_METJA/9-292-IDLIIHTPG--------G-----LALASEQIALALKE-------H-KAKTTVI----IP-HYAMS--------------
O29403_ARCFU/7-290-IDLIIHTPG--------G-----LVLAATQIAKALHD-------H-PAKTTVI----VP-HYAMS--------------
O66996_AQUAE/1-288-IDLIIHTPG--------G-----LALAATQIANALVK-------H-KAPVRVI----VP-HYAMS--------------

PF00574

Q7XBR2_ORYSJ/73-254-IRLFVNSPG--------G-----SLSATMAIYDVMQL-------V.RADVSTI----GL.GIAGS--------------
CLPP2_BORBU/6-189-IFVYIDSEG--------G-----DIDAGFAIFNMIRF-------V.KPKVFTV----GV.GLVAS--------------
CLPP1_BORBU/13-194-IYLYLNSPG--------G-----SITAGLAIYDTMQY-------I.KPDVRTI----CI.GQAAS--------------
CLPP1_CAEEL/34-215-IHMYINSPG--------G-----SVTAGLAIYDTIQM-------I.SAPVSTW----VI.GQASS--------------
CLPP_OENEH/21-204-LYFFINSPG--------G-----LAVAGLLIYDTMQY-------V.TPPVYTL----GL.GVLAS--------------
CLPP4_ARATH/74-253-IKLFINSPG--------G-----SLSATMAIYDVVQL-------V.RADVSTI----AL.GIAAS--------------
CLPP1_CHLTR/3-189-IVFVINSPG--------G-----SVDAGFAVWDQIKM-------I.SSPLTTV----VT.GLAAS--------------
Q9CFR9_LACLA/7-176-IVLNIASNG--------G-----DVFAASEIYTAIKM-------..NGKPVTV----NIQGLAAS--------------
CLPP1_PSEAE/28-209-IHLYINSPG--------G-----SVTAGMSIYDTMQF-------I.KPNVSTT----CI.GQACS--------------
CLPP_LISIN/12-193-IFLYINSPG--------G-----SISAGMAIYDTMNF-------V.KADVQTI----GM.GMAAS--------------
Q9EYD3_9VIRU/6-171-INLHINSPG--------G-----DVFEGIAIFNALKN-------Q.GATITVY----VD.GVAAS--------------
Q9B0E1_9CAUD/16-186-IDVHINSSG--------G-----SVFEGHAIYNMLKM-------H.PAKINIY----VD.ALAAS--------------
CLPP_BRUME/20-201-INMYINSPG--------G-----VVTSGMAIYDTMQF-------I.RPPVSTL----CM.GQAAS--------------
CLPP2_RHIME/20-201-VALYINSPG--------G-----VVTAGMAIYDTMQF-------I.KPAVSTL----CI.GQAAS--------------
CLPP_CHLMO/342-515-VFVIINSFG--------G-----SVGNGITVHDALQF-------I.KAGSLTL----AL.GVAAS--------------
Q8P2G1_STRPQ/13-175-IQVRLNSGG--------G-----EVFVGSEIYSALKD-------Y.PGNVEVV----IT.GLAAS--------------
CLPP_CHLVU/13-196-LYIYINSPG--------G-----SVTCGIAVYDAMNY-------I.KSEVTTI----CV.GTAAS--------------
CLPP_NEIMA/16-199-IFFYINSPG--------G-----SVTAGMSIYDTMNF-------I.KPDVSTL----CL.GQAAS--------------
CLPP_MESVI/13-196-IFFYINSPG--------G-----SMNAGLGVYDMIQH-------V.NVDVTTI----CM.GLAAS--------------
Q98RU2_GUITH/45-228-IYMYINSPG--------G-----SVISGLAMYDTMRH-------I.KSEVITI----NV.GLAAS--------------
Q9ST19_BRACM/82-261-ITLFINSPG--------G-----SITAGMGIYDAMKQ-------C.KADVSTV----CL.GLAAS--------------
CLPP2_BACHD/13-194-IYLYINSPG--------G-----STSAGFAIYDTMQF-------V.KPSIHTI----CT.GMAAS--------------
CLPP_CAUCR/20-201-IAMYINSPG--------G-----VVTAGLAIYDTMQY-------I.KSPVSTV----CM.GMAAS--------------
CLPP5_ARATH/107-288-IVMYVNSPG--------G-----SVTAGMAIFDTMRH-------I.RPDVSTV----CV.GLAAS--------------
CLPP_MOUSE/63-244-IHMYINSPG--------G-----VVTAGLAIYDTMQY-------I.LNPICTW----CV.GQAAS--------------
CLPP_THETN/12-193-IWLYINSPG--------G-----SITAGLAIYDTMQY-------I.KPDVVTL----CV.GMAAS--------------
O97252_PLAF7/180-359-IKIYINSPG--------G-----SINEGLAILDIFNY-------I.KSDIQTI----SF.GLVAS--------------
CLPP1_AGRT5/16-197-IHLYINSPG--------G-----MVTSGFAMYDTMRY-------I.RAPVHTL----CM.GTARS--------------
CLPP_XYLFA/19-200-INIYINSPG--------G-----VVTAGMAIYDTMQY-------I.KPAVSTI----CV.GQAAS--------------
Q42886_SOLLC/95-274-ILIYLNCPG--------G-----STYSVLAIYDCMSW-------I.KPKVGTV----CF.GAAAS--------------
CLPP1_TREPA/17-198-ISLYINSPG--------G-----AVTAGLAVYDTMQH-------I.CPEVQTI----CL.GQASS--------------
CLPP2_MYCLE/27-207-ITMYINSPG--------G-----GFTSLMAIYDTMQY-------V.RADIQTV----CL.GQAAS--------------
CLPP_STAAW/12-193-IYLYINSPG--------G-----SVTAGFAIYDTIQH-------I.KPDVQTI----CI.GMAAS--------------
CLPP_NEPOL/13-196-LFMYINSPG--------G-----SVTSGLGVFDIATV-------M.MQDVTTI----CV.GIAAS--------------
Q8VQM6_BACTU/12-193-IFLYINSPG--------G-----STTAGFAILDTMNL-------I.KPDVQTL----CM.GFAAS--------------
CLPP_PSINU/13-197-MYSYINSPG--------G-----AVLPGISVYDAMQF-------V.VPDVHTI----CM.GLAAS--------------
CLPP_DEIRA/15-196-IQMYINCPG--------G-----EVYAGLAIYDTMRY-------I.KAPVSTI----CV.GMAMS--------------
CLPP1_BACHD/12-193-ISLYINSPG--------G-----SITAGMAIYDTMQY-------I.KPNVSTI----CI.GMAAS--------------
CLPP_THEMA/21-202-VYLYINSPG--------G-----SVTAGLAIYDTMQY-------I.KCDVSTI----CV.GQAAS--------------
CLPP2_TREPA/15-193-IYMYVDSPG--------G-----DVDAGYAIFDVIRF-------V.KTPVYTI----GM.GLVAS--------------
CLPP_CHLTE/37-218-IYIYINSPG--------G-----SVSAGLGIYDTMQY-------I.RPDISTV----CV.GMAAS--------------
TEPA_BACHD/48-232-LLIILNTVG--------G-----DVEAGLAIAEMVAT-------MSKPTV.TL----VL.GGGHS--------------
CLPP3_NOSS1/13-196-IYLYINSPG--------G-----MVTSGLAIYDTMQH-------I.KSDVVTI----CV.GLAAS--------------
CLPPL_CYAPA/12-197-VSFYINSSI--------T-----FPNLCFGLYDTILQ-------I.KADIVTI----CL.GLAGG--------------
Q92CR8_LISIN/4-186-ITIFINSQG--------G-----HVEAGDTIHDMIKF-------I.KPTVKIV----GT.GWVAS--------------
CLPP3_AGRT5/23-198-IRVYVNSPG--------G-----HVESGDSIHDMIKF-------I.KPKVYII----GT.GWVAS--------------
CLPP1_RHILO/16-197-ISLYINSPG--------G-----VVTSGFAIYDTMQY-------V.SCPVSTV----CM.GFAAS--------------
CLPP1_SYNE7/10-191-IYLYINSPG--------G-----SVYDGLGIFDTMNH-------I.RPDVSTV----CV.GLAAS--------------
Q9XJT4_BPD3/38-211-VTVNINSPG--------G-----DVFEGLAIYNLLRE-------H.KGKVTVN----II.GLAAS--------------
CLPP_PINCO/13-197-IFSFINCPG--------G-----SVIPGVGLYRMMQA-------I.VPDVNTI----CM.GVAAS--------------
CLPP_CLOPE/13-194-IHLYINSPG--------G-----SITSGMAIYDTMQY-------I.KPDVSTI----CI.GMAAS--------------
CLPP_RICPR/12-193-IYMYINSPG--------G-----VVTAGLAIYDTMQF-------I.KPKVATL----CI.GQACS--------------
CLPP2_CORGL/13-195-ISLYINSPG--------G-----SVTAGMAIYDTMKY-------S.PCDIATY----GM.GLAAS--------------
CLPP1_CORGL/24-204-ITLYINSPG--------G-----SFTALMAIYDTMQY-------V.RPDVQTV----CL.GQAAS--------------
CLPP5_STRCO/18-201-IELYVNSPG--------G-----SFTAMTAIYDTMRY-------V.ACDVATT----CL.GQAGP--------------
CLPP_CLOAB/12-193-IYLYINSPG--------G-----SITSGMAIYDTMQY-------V.KPDVSTI----CI.GMAAS--------------
CLPP_HELPJ/12-193-IGLYINSPG--------G-----VITSGLSIYDTMNF-------I.RPDVSTI----CI.GQAAS--------------
CLPP_YEREN/25-206-IFLYINSPG--------G-----VITAGMSIYDTMQF-------I.KPDVSTI----CM.GQACS--------------
CLPP1_MYCTU/11-193-ISLYINSPG--------G-----SISAGMAIYDTMVL-------A.PCDIATY----AM.GMAAS--------------
CLPP_HAEIN/12-193-INIYINSPG--------G-----SVTAGMAIYDTMQF-------I.KPDIRTL----CI.GQACS--------------
CLPP_CHLRE/310-482-VFMIINSFG--------G-----SVGNGITVHDALQF-------I.KAGSLTL----AL.GVAAS--------------
CLPP1_STRCO/32-208-IFLYINSPG--------G-----SITAGMAIYDTMQY-------I.KNDVVTI----AM.GLAAS--------------
CLPR2_ARATH/79-263-IYMYLNGPG--------G-----DLTPSLAIYDTMKS-------L.KSPVGTH----CV.GLAYN--------------
CLPP3_SYNY3/13-197-IYLYINSPG--------G-----SVTAGMAIYDTMQY-------I.KAEVITI----CV.GLAAS--------------
CLPP4_STRCO/14-196-IAVYINSPG--------G-----SFTSLMAIYDTMTF-------V.QAPISTF----CV.GQAAS--------------
CLPP2_PSEAE/13-193-IYMFVNSPG--------G-----HVESGDMIFDAIRF-------I.TPKVIMI----GS.GSVAS--------------
CLPP_STRSL/10-193-IYLYVNTPG--------G-----SVSAGLAIVDTMNF-------I.KSDVQTI----VM.GMAAS--------------
CLPP_WHEAT/13-197-IFLFINSPG--------G-----WLISGMAIFDTMQT-------V.TPDIYTI----CL.GIAAS--------------
CLPP2_STRCO/28-210-ISVYINSPG--------G-----SFTALTAIYDTMQY-------V.KPDVQTV----CM.GQAAS--------------
CLPP_AQUAE/19-200-IYLYINSPG--------G-----SVTAGLAIYDTMQY-------I.KPDVVTI----CM.GQAAS--------------
Q8W605_9CAUD/17-189-INVHVNSGG--------G-----DVFESIAIHNLLKA-------H.PAKISIY----ID.ALAGS--------------
CLPP_BUCAP/16-197-IFLYINSPG--------G-----IITSGMSIYDTMQF-------I.KPDVNTI----CI.GQACS--------------
CLPP3_SYNE7/13-197-IYLYINSPG--------G-----SVTAGMAIYDTMQY-------I.KSPVITI----CL.GLAAS--------------
CLPP2_CHLPN/12-193-IQIFINSPG--------G-----YITAGLAIYDTIRF-------L.GCDVNTY----CI.GQAAS--------------
CLPP1_NOSS1/11-192-IYLYINSPG--------G-----SVTAGMGIFDTMKH-------I.RPDVCTI----CT.GLAAS--------------
CLPP_CHAGL/13-197-MYLYINSPG--------G-----AVVPGIAIYDTMQF-------V.EPEIRTI----CM.GVAAS--------------
CLPP2_ARATH/41-222-IHMYLNSPG--------G-----HVTAGLAIYDTMQY-------I.RSPISTI----CL.GQAAS--------------
CLPP_RALSO/34-215-ISLYINSPG--------G-----SVSAGLAMYDTMQF-------V.KPDVSTL----CM.GMAAS--------------
CLPP_AZOBR/20-201-IALYINSPG--------G-----YVSAGLAIYDTMQY-------I.RPQVSTV----CM.GQAAS--------------
CLPP2_SYNY3/32-213-IQLYINSPG--------G-----SVYAGLAIYDTMQQ-------I.RPDVVTI----CF.GLAAS--------------
Q8ZQG9_SALTY/47-225-INLHIHSPG--------G-----SIFDGLAIYNLLKN-------H.PARKVVY----VD.GVACS--------------
CLPP_CAMJE/11-192-IYLYINSPG--------G-----VITSGFSIYDTMNY-------I.KPDVCTI----CI.GQAAS--------------
CLPP2_MYXXD/11-192-INLYINSPG--------G-----SVTAGLAIYDTMQY-------V.KCPVSTI----CV.GQAAS--------------
Q8LTH1_9CAUD/11-173-VDIIINSNG--------G-----NLVAGSEIYTHLRA-------H.KGKVNVR----IT.AIAAS--------------
Q9VKY3_DROME/38-219-IHLYINSPG--------G-----VVTAGLAIYDTMQY-------V.KPPIATW----CV.GQACS--------------
CLPP_PARDE/13-195-INMLISSPG--------G-----HVESGDMIHDVIKF-------I.RPTVRTI----GL.AWVAS--------------

PF08496

SOHB_ECOLI/1-158.GELRVNNLS--------E-----QYKEMKEELAAALM-------D-SHQQKQW----HK-AQKKK--------------
Q5E611_VIBF1/1-162.GELEVTNLT--------E-----QYKDTVVELEHHLF-------D-DAELKAR----AK-AEKKA--------------
A6VNT8_ACTSZ/3-162.GELKITDLS--------E-----EYADMSKKLQQFHL-------T-EDELKQL----EK-EEKKA--------------
A6B5B8_VIBPA/1-162.GELEVTNLS--------E-----QHKQSIEQLEHHLH-------D-DAFIKAR----DK-AVKKE--------------
A4WAZ3_ENT38/1-156.GELRITRLS--------E-----QYKEMQEDMSVSLL-------D-AHQQKMW----HK-AQKKK--------------
Q1YTC2_9GAMM/5-169.GHLEITPLN--------E-----MFDDMSDAIKFAVM-------D-ESLHKAE----DK-RLQKD--------------
A6F3C8_9ALTE/1-162DGELRVRKLN--------E-----KYRKLRESLQAKLR-------S-DSERKTF----EK-ARKKE--------------
A4A337_9GAMM/1-163NGHIEVHKLN--------D-----RYKDLRETLRDATL-------D-PALRKES----QK-AEKKA--------------
Q3KBK2_PSEPF/1-148AGQLQVSKLN--------D-----FYKGLRERLEQTLL-------D-KDQLKAL----RK-GQAKS--------------
A5IG60_LEGPC/1-132.PKLEITSLN--------E-----EYEHLNALMNKEIL-------G-.......----.K-KPGKK--------------
Q1ZKS7_PHOAS/1-162.GELEVSDLT--------E-----QYKDTVNQLESHLF-------D-KALLKAR----DK-TDKKS--------------
Q02KX5_PSEAB/1-148GGHLDVQKLN--------D-----FYKDLRERVRHSVL-------D-KASLKAL----RK-EESKA--------------
A1U0U5_MARAV/1-161EGELKIRKLN--------D-----QYRRLRESIQARLM-------T-DQERKAW----QK-KKKKE--------------
Q6ML34_BDEBA/1-147.PEIQIELLH--------K-----RYKNFRHLLKAHTV-------T-KSERKEL----KK-KLKEE--------------
Q3IL32_PSEHT/2-148.GEIQIDNIS--------E-----QLDNIKQSFLHNTL-------G-KKELKAH----QK-KLKAD--------------
A6FH33_9GAMM/1-168.GRLEITNLS--------E-----QFKDVEDELQLHLV-------S-EDEAKVL----EK-EQHKA--------------
A8H339_SHEPA/1-152.GELKLTNLS--------E-----NLALLKHDLKEELL-------S-KKAFKAY----EK-QLKAD--------------
A4N5P9_HAEIF/3-161.GELEIKDLS--------E-----EFNEQVRLLRDFNL-------S-EEEQKQQ----AK-AEKKA--------------
Q9CN58_PASMU/3-161.GELVVVDLS--------E-----EYQENSKRLREFSL-------S-EETRKQL----EK-TQKKA--------------
A4SQD5_AERS4/1-146.GELVVTDLS--------S-----ELEAGRYQLQAALA-------G-KTERKQL----EK-ARKAE--------------
Q8D8J0_VIBVU/1-162.GELEITDLS--------E-----LHKSNVEHLEHYLH-------D-EAYLKAR----HK-AEKKE--------------
Q2NT44_SODGM/1-157.GQIQIEDLG--------K-----HYRERQREMQLARL-------G-EAEKGVW----HK-RHKKQ--------------
A3MY80_ACTP2/3-160SGAISITNLT--------E-----KYQEQQKSLANFFL-------S-EEAQKQA----EK-AEKKA--------------
Q0HK69_SHESM/1-149.GELRITNLS--------E-----ELEDLKHSLKEELL-------S-KKQFKAY----EK-QLKAD--------------
A6VW04_MARMS/2-155PGSLSVTKLN--------E-----SYDAMKAELDQQLL-------D-KKTLKSL----AK-EKKKK--------------
Q9JYH3_NEIMB/20-177SGSVVLTDFS--------E-----NYKKQRQSFEAFFL-------S-GEEAKHQ----EK-EEKKK--------------
Q15TT9_PSEA6/1-153.GNLEIDSIS--------E-----RLDDIKDNVNHLIC-------S-KDELKKK----NK-EQKKA--------------
Q7N4B0_PHOLL/1-157.GELKLVDLG--------E-----SYRDKQRQMQRARM-------T-EAEGKIW----QK-EFNKQ--------------
A2P5Z2_VIBCL/4-165.GELEITDLT--------E-----QHKETVERLEAYLH-------D-EAFLKAR----DK-ADKKK--------------
Q48IH2_PSE14/1-148AGQLQVTRLN--------D-----FYKGLRERLEQSLL-------D-KERLKTL----RK-EQGKA--------------
Q2BGB6_9GAMM/2-159.GDIQVTHFN--------D-----ELLDMKEAIEAEIL-------D-KDELKAI----HK-EEKKK--------------
Q0ABV0_ALHEH/1-149GGQLTARPLN--------R-----HYHQLDQSVLAATE-------G-QRAARRY----AR-KAARA--------------
SOHB_BUCBP/1-161.GILSVSSLN--------D-----HYELVKNSIIVQLM-------D-KKTKKLW----NK-KNKML--------------
Q7VMW6_HAEDU/3-160SGAIAITNLT--------E-----KYKEQQEALANFLL-------S-EEAQKQS----ER-KAKKL--------------
A8GF70_SERP5/1-157.GELQLTDLG--------E-----QYRDMQRDMRLARM-------G-DAEQKAW----NK-QFKKQ--------------
Q21J53_SACD2/1-173.GLIEITKLN--------E-----KYDDILHLVKSAVI-------D-EESLKVE----RK-QEKKA--------------
Q1ZDS7_9GAMM/1-157.GDLEVIDLS--------Q-----QLEDTQKCLEEQLL-------S-DAELKSR----HK-AQKKE--------------
A4BQR1_9GAMM/1-148..RLELNRLN--------E-----RYRDRVERIEGVFT-------P-RRPVWHR----KK-RATAT--------------
A0YBD9_9GAMM/1-153GGQIEVTFLN--------D-----EYDDHEHAIKSVIL-------D-EDQLKAE----HK-AEKKQ--------------
Q486S9_COLP3/1-158.GELDITDLS--------E-----QFTETEEDIIHALL-------S-KDEFKEK----EK-ADKKL--------------
A3JG92_9ALTE/1-170DGELRIRKLN--------D-----NYRKLREGIEARLM-------T-DLDRKAF----AK-LRKKE--------------
A3YDK4_9GAMM/1-156PGGLKITKLN--------D-----NYDTAKTQLENELL-------D-KKQLKQQ----QK-EKKKQ--------------
Q12LC5_SHEDO/1-148.GELSLTHVS--------E-----ELTALKHDLKQELL-------T-KKQFKAY----EK-QLKAD--------------
Q83EG9_COXBU/7-154KGKLDVHKLN--------D-----KYKSYHRTLSIAIK-------D-KYELKRF----LK-SQKKE--------------
SOHB_BUCAP/1-152.KKFKIILLE--------E-----KYKNIKKDILLSKM-------N-KLEKKKW----IK-EEKKK--------------
Q1QW68_CHRSD/2-155.NRLRIVALH--------E-----RQRRRRESLRLAGL-------P-AAQRRRA----QK-ALRKE--------------
A4CBK8_9GAMM/1-146.GQIELDDVS--------L-----QLNELKSQFLSATL-------S-KDEFKAF----EK-DEKKR--------------
Q2SJ39_HAHCH/1-155DGEIEVVHLN--------E-----RLKRMREALEHSVF-------S-KEWLKNA----AK-EKKKS--------------
A7FI22_YERP3/1-157.GELNLVDLG--------E-----QYKETQREMRLARM-------S-HAEQKAW----VK-EFKKQ--------------
F2GC42_ALTMD/1-150.GQLEIVSIS--------E-----QLKDITNYAKQVLL-------D-KNALKKL----AK-EQKKE--------------
Q65TF7_MANSM/3-162.GELKLTDLS--------E-----QYQDNVKKLKDFRL-------T-DEELKQA----EK-ARKKA--------------
A4VLP8_PSEU5/21-167GGHLEVHKLN--------E-----FYKSMRERLEQAVL-------E-KDEFKAL----RK-REAKA--------------
Q3JCU0_NITOC/2-143..KLEIKHLN--------K-----YYERMTRTLMMHLM-------P-KKEFVKK----LK-SEKAH--------------
Q0VQ70_ALCBS/2-158DGELKVRHLN--------E-----EFDDLKESLEAEII-------P-EAQRKKA----HK-AKRKQ--------------
SOHB_BUCAI/1-147.SKIKITLLQ--------D-----NYKNVKNKILLSTM-------K-NVEKKIW----FK-KQKEK--------------
Q6D4V2_ERWCT/3-159.GELQVTNLG--------E-----QYQEMQREMQTACM-------S-DTERKLL----SK-QEKKK--------------
A4XVC0_PSEMY/1-147SGQLQVQKLN--------D-----FYRDLRERLEQSVL-------H-KEQLKVA----RK-AEAKA--------------
A1SW75_PSYIN/12-168.GELQLIDLS--------E-----HLKETKKTIEEKLL-------T-HHQLKAR----HK-EEKKN--------------
A7JRK9_PASHA/3-159NGSISITNLS--------E-----KYKEQQKSLSGFFL-------S-EEELKHQ----EK-QEKKV--------------
Q3SFM4_THIDA/2-147.GRLRVSDVG--------R-----RFAAAGDEIRSARL-------D-KRTYRRP----RR-TGRHR--------------
C1DKS7_AZOVD/3-150EGHLEVHRLN--------D-----FYKSLRESLEQIVL-------D-KDRLKTR----RK-AEAKA--------------
A7JGQ6_FRANO/7-150KGRLEINEVA--------T-----EYKHTKQQLLESLL-------E-KKEYKKF----LK-EQKKL--------------
A0Z237_9GAMM/1-168.GYIEVRRLN--------D-----RYTAFHDAVRSFTE-------H-AETRKVR----EK-AEKKT--------------
Q5QYQ0_IDILO/1-143.GDLQVTHLS--------K-----ELNELSEQLKIELM-------D-KKAQKKA----LK-ALKKK--------------
Q080A4_SHEFN/5-151.GELRLTDIS--------D-----ELMQLKHQLKEELL-------P-KKQFKAY----EK-QVKAA--------------
SOHB_BUCSC/1-159.YELDIVSLN--------S-----YYEHVKNKIILSTM-------S-TYEKKIW----NK-SNKLF--------------
A7MN97_CROS8/1-158.GELRVTRLG--------E-----EYKEMKEEVAAALL-------D-PHQHKQW----HK-NQKKK--------------
A1S7G8_SHEAM/1-147.GELVLTNVT--------E-----ELDHLKMHLKHELL-------D-KKAFKAY----EK-AQKAE--------------

PF01343

PFAP_LEPBO/1-153IGVL.-QWLR-------YQ-----RAFGSLGVKMRTYK-------E-GKYKDSL----..-SLFRD--------------
Y651_METJA/110-263IGVRM-DLMH-------YY-----GLMKKLGINVTTIK-------A-GKYKDIG----..-SPFRP--------------
O30523_9VIBR/105-255IGTV.-..VS-------FV-----KRPDAEGAKRFEFV-------S-SQSPNKR----..-..LDP--------------
SOHB_HAEIN/163-314IGVVA-QIPN-------VH-----RLLKKHDVDVDVMT-------A-GEFKRTV----..-TVLGE--------------
O26897_METTH/96-249IGVIL-DLTD-------LS-----QMYRQMGINKYAIK-------A-GEYKDMG----..-ADYRM--------------
SPPA_HAEIN/387-539IGIFT-MFPT-------FE-----NSIKKIGVHADGVS-------T-TELANT.----..-SAFSP--------------
SPPA_SYNY3/126-282NGLGA-QPIF-------FT-----GALAKAGIGVQTLR-------V-GSYKGAV----EP-YTREN--------------
SOHB_SHIFL/160-311IGVVA-QMPN-------FN-----RFLKSKDIDIELHT-------A-GQYKRTL----..-TLLGE--------------
SPPA_BACSU/129-283LGVIM-ESVN-------YS-----KLADKLGISFETIK-------S-GAHKDIM----..-SPSRE--------------
P95072_MYCTU/128-283VGFAT-NATF-------LR-----DALHKAGIEAQFVA-------R-GEYKSAA----NL-FTEDG--------------
SPPA_ECOLI/140-296HGFAT-NGLY-------YK-----SLLDKLKVSTHVFR-------V-GTYKSAV----EP-FIRDD--------------
SPPA_SYNY3/383-536IGVFS-ILFN-------VE-----NLGDRLGLNWDEVA-------T-GELANVG----..-SSIKP--------------
SPPA_ECOLI/391-543IGIFG-VITT-------VE-----NSLDSIGVHTDGVS-------T-SPLADV.----..-SITRA--------------
P95072_MYCTU/402-555IGVIT-GKLV-------VR-----DLKDRLGVGSDAVR-------T-NANADAW----..-SIDAP--------------
VCAC_LAMBD/148-300IGVMM-AHSN-------YG-----AALEKQGVEITLIY-------S-GSHKVDG----..-NPYSH--------------
VG05_BPP21/144-296IGVMM-SHVS-------YA-----GHLAQAGVDITLIY-------S-GAHKVDG----..-NQFEA--------------
P71127_CAMJU/101-254IGVIM-QGAD-------LS-----GLANKLGIKEQTIQ-------A-GEFKSAG----..-TFARA--------------
Y021_SYNY3/67-220IGVIL-RGNN-------LE-----RLLEKVGVSFKVIK-------S-GPYKDIL----..-SFDRE--------------
O25976_HELPY/103-256IGVIF-SGAN-------VE-----NLLNKVGVATQGVH-------A-GEYKEIG----..-TFTRA--------------
SPPA_HAEIN/132-288HGLSQ-ENLY-------FK-----EMLDKLAVTPHIFR-------V-GTYKSAV----EP-FLRND--------------

PF00378

MENB_BACSU/14-259VGSFD-AGYG-------SG-----YLARIVGHKKAREI-------W-YLCRQYN----AQ-EALDM--------------
ECHP_HUMAN/4-262LGLLP-GARG-------TQ-----LLPRLTGVPAALDL-------I-TSGRRIL----AD-EALKL--------------
PKSH_BACSU/10-251FGLYP-.ACV-------LP-----FLIRRIGRQKAHYM-------T-LMTKPIS----VQ-EASEW--------------
PKSI_BACSU/8-249YGFTP-GMGA-------TF-----IVPKKLGFSLAQEI-------L-LNAGSYR----GA-DLEKR--------------
CAID_ECOLI/6-253LGIVP-DSGG-------VL-----RLPKILPPAIVNEM-------V-MTGRRMG----AE-EALRW--------------
ECHA_HUMAN/42-315LGALP-GAGG-------TQ-----RLPKMVGVPAALDM-------M-LTGRSIR----AD-RAKKM--------------
FADB_PSEFR/10-268LGIYP-GFGG-------TV-----RLPRLIGVDNAVEW-------I-ASGKENR----AE-DALKV--------------
ECHM_HUMAN/40-282IGTIP-GAGG-------TQ-----RLTRAVGKSLAMEM-------V-LTGDRIS----AQ-DAKQA--------------
ECI1_MOUSE/37-283LGIVA-PFWF-------KD-----MYVNTIGHREADGA-------L-QLGTLFS----PA-EALKV--------------
ECHM_CAEEL/38-280IGTIP-GAGG-------TQ-----RWARAAGKSFAMEV-------C-LTGNHVT----AQ-EAKEH--------------
ECI1_HUMAN/50-296LGIIA-PFWL-------KD-----TLENTIGHRAAERA-------L-QLGLLFP----PA-EALQV--------------
ECHH_RHOCB/7-249IGLMP-DAGG-------TW-----WLPRQVGMARAMGM-------A-LFAEKIG----AE-EAARM--------------
FADB_ECOLI/10-267LGIMP-GFGG-------SV-----RMPRMLGADSALEI-------I-AAGKDVG----AD-QALKI--------------

PF13766

B9A058_HUMAN/37-154....G.S...-------.S.....FALEQLKVI.NKM.-------.-SPTSLKI----TL-RQLME--------------
B4QYI3_DROSI/224-341....G.S...-------.E.....WAKKTLETL.SKM.-------.-SPTSMKV----TF-RQLEL--------------
B0WY25_CULQU/220-337....G.S...-------.E.....WAQSTLKTL.AKM.-------.-SPLSMKV----TK-KQLDL--------------
B9G752_ORYSJ/181-304APNVA.D...-------.E.....WVASAIQSL.RKA.-------.-SPTSLKI----SL-RSIRE--------------
D3TLD0_GLOMM/247-364....G.S...-------.E.....WALKTVETL.SKM.-------.-SPTSLKV----TH-RQLEL--------------
B4KAQ0_DROMO/226-344....D.S...-------.D.....WAKKQLEIL.SKV.-------.-SPTSLKV----TF-RQLEL--------------
B9IL60_POPTR/222-345....A.ANSY-------NE.....WCRNAIGKI.KEA.-------.-SPLSLKV----TL-HSIRE--------------
B7H599_BACC4/230-347....E.S...-------.S.....FALKTKETL.LSK.-------.-SPISLKV----TL-KQFID--------------
A5BFY2_VITVI/246-369....N.D...-------.P.....WCISTLKKL.RQA.-------.-SPLSLKI----AL-RSIRE--------------
A9SIW3_PHYPA/223-346....E.D...-------.E.....WYSNTLALM.KKV.-------.-SPISLKV----TL-RSIRE--------------
C6T7J7_SOYBN/264-387....N.D...-------.E.....WYSTTLRRI.REA.-------.-SPLSLKV----TL-QSIRE--------------
C0SE19_PARBP/271-391K..TN.R...-------.E.....WAQKTLKTL.ASR.-------.-SPTSLKV----TL-RQLRI--------------
C5PDB4_COCP7/292-413....N.K...-------.E.....WAQKTVETL.KAR.-------.-SPTALKV----TL-RQLRV--------------
B9RD44_RICCO/269-392ASGTN.D...-------.A.....FCNSTLRRL.KEA.-------.-SPLSLKV----SL-RSIRE--------------
A7GPH6_BACCN/229-346....G.G...-------.T.....FALQTKETL.LSK.-------.-SPFSLKV----TL-KQLSE--------------
HIBC5_ARATH/263-386....A.ANSC-------NE.....WCKKTLKQI.KEA.-------.-SPLSLKI----TL-QSIRE--------------
Q08V22_STIAD/183-300....G.T...-------.E.....WAEATRATL.ARM.-------.-SPTSLKV----TL-RQLRT--------------
B7Q287_IXOSC/156-273....A.S...-------.E.....WAQEQAEIL.RKM.-------.-SPLSLKV----TF-RAFQE--------------
Q2IY83_RHOP2/228-346....R.S...-------.D.....FAQATLKAL.RAK.-------.-SPTSLKV----AL-KLLRI--------------
A8R3R7_PSEPU/42-163....S.H...-------.E.....WALKTADLL.ATR.-------.-SPLAMAV----TL-EMLRR--------------
Q1NB11_9SPHN/238-356....G.G...-------.E.....WAQKQLSTL.RTK.-------.-SPQTIKV----AL-RQLVE--------------
C6XIW5_HIRBI/216-334....G.S...-------.E.....WALKQLSIM.KTK.-------.-CPFSLKV----TL-RQMIE--------------
D9QHM1_BRESC/216-334....G.S...-------.D.....WALPQLAIL.KTK.-------.-SPQSLKV----TL-RQLRL--------------
A7HX73_PARL1/219-336....G.G...-------.E.....WETKTADTI.ETK.-------.-SPTSTLV----AF-RQIRE--------------
Q134G5_RHOPS/230-346....G.S...-------.E.....FALATLNAM.RGK.-------.-SPTSLKV----AL-KLLRM--------------
Q212Q2_RHOPB/228-346....G.S...-------.A.....FATTTLQAL.NSK.-------.-SPTSLKV----AL-RLLRS--------------
B7Q288_IXOSC/259-376....T.S...-------.E.....WGQEQAKVL.QKM.-------.-SPLSMKV----TF-RELQE--------------
B6HLY2_PENCW/268-389....H.K...-------.E.....WAQKTLETL.SGR.-------.-SPTSLKV----TL-RQLRL--------------
B4W849_9CAUL/219-337....G.A...-------.D.....WALAQLATL.KTK.-------.-SPQSLKV----TL-RQLRT--------------
Q1QKA8_NITHX/229-347....G.S...-------.E.....LARSTLKTL.NEK.-------.-SPRGMVV----TL-KLLRL--------------
C5FQU8_ARTOC/270-391T..VN.A...-------.D.....WAAKTLKTL.AQR.-------.-SPIALKV----TL-RQLRV--------------
B9TBM0_RICCO/227-344....G.G...-------.E.....FAARTLEVM.ATR.-------.-SPLMMSV----TH-ELIKR--------------
Q0UDB2_PHANO/242-370....L.S...-------.K.....WAKKTIETI.NTR.-------.-SPISVAV----TL-QQMHI--------------
B8IPL3_METNO/223-343....G.S...-------.D.....FAARTAATI.RTR.-------.-SPTSLAV----AF-AQMRR--------------
A3IAF9_9BACI/236-353....P.S...-------.E.....FARDTKHLL.LSK.-------.-SPSSLKI----TL-QQLID--------------
Q1D8V8_MYXXD/230-347....G.T...-------.P.....WAQETWATL.LHM.-------.-CPASLKV----TL-RQLRM--------------
D3NUG5_AZOS1/225-342....G.G...-------.D.....WANGQLATL.RRV.-------.-SPTSLKV----TL-AALRR--------------
B8BI61_ORYSI/267-391....A.ARLN-------ED.....WSTLALKRL.KEA.-------.-SPLALKV----SL-RSIRE--------------
B9MUQ3_POPTR/225-348AARTK.D...-------.D.....WCISTVRKL.REA.-------.-PPLSLKV----SL-RSIRE--------------
A4YSR1_BRASO/219-337....D.S...-------.D.....LAASTLKTL.KEK.-------.-SPRGMVV----TL-KLLRL--------------
Q1YU68_9GAMM/224-352....D.G...-------.E.....WASKTLACL.RQR.-------.-SPLMLHV----SL-EQIRR--------------
B1ZJ11_METPB/263-383....G.S...-------.A.....FAEATAATM.RTR.-------.-SPTSLTI----AL-ALMRR--------------
Q13IB6_BURXL/234-356....R.DPRY-------GE.....WASTTAETL.RQR.-------.-SPLMMCV----TR-EQLLR--------------
B2UHN2_RALPJ/243-369....P.R...-------.Q.....WLQATLEAM.TTH.-------.-SPTMLHV----TR-EALLR--------------
B5GMB4_STRCL/289-407....G.A...-------.P.....AAKETAETL.LTK.-------.-SPTALKV----TL-AALRR--------------
A2WG07_9BURK/236-363....Q.R...-------.Q.....WLQATLDAL.AAH.-------.-SPTMLSV----TR-EALLR--------------
B9Z557_9NEIS/241-360....D.D...-------.P.....WLQAAAHSF.AHG.-------.-SPSSAAV----TW-EIYRR--------------
B2JLZ0_BURP8/237-363....M.R...-------.Q.....WLQATCDAL.TSH.-------.-SPTMLCV----TR-DALLR--------------
Q1MLQ4_RHIL3/228-346....E.G...-------.E.....FAAETCRVM.LTR.-------.-SPTSLKL----AL-RLLRA--------------
B4RB39_PHEZH/219-337....G.T...-------.E.....WAAEQLKIL.RTK.-------.-SPQTMKV----AF-RQLRL--------------
B2W7S4_PYRTR/289-417....I.Q...-------.K.....WADKTFQTI.NSR.-------.-SPISVAV----TL-LQMRV--------------
A0NMD5_9RHOB/218-335....D.A...-------.D.....FAGKTAAAI.RQK.-------.-SPTSVLI----AF-EQMKR--------------
B8ESI3_METSB/218-335....Q.S...-------.G.....FAASCLAAL.ASK.-------.-SPTSLAI----AL-RQVEI--------------
C9SRJ5_VERA1/267-392....T.K...-------.A.....WAQKTLETL.HKR.-------.-SPTAVHV----TL-RQMRV--------------
Q4KC65_PSEF5/240-361....S.H...-------.E.....WARSTADLL.ETR.-------.-SPLAMAV----TL-EMLRH--------------
Q2SVM5_BURTA/241-365....R.D...-------.EAVRAAWADKARDAM.RGGS-------L-SPLSMAV----SL-EVVER--------------
B9J934_AGRRK/225-343....P.G...-------.D.....FAAETAEAI.RTR.-------.-SPTSLKL----TL-RLLRA--------------
C4WVV0_ACYPI/243-363....G.S...-------.E.....WALGILKTL.SEV.-------.-SPTGLKI----TR-KEILK--------------
Q5Z107_NOCFA/222-340....D.A...-------.P.....EARAAAADI.LGK.-------.-SPVALKV----TL-RSLRA--------------
A1WLH8_VEREI/235-356....R.S...-------.D.....WASATAATL.RQR.-------.-SPLMLHV----VL-EQIRR--------------
Q12AQ1_POLSJ/237-356....D.D...-------.P.....WLAAAAATF.TKG.-------.-SPTSAAL----AF-ALWQR--------------
B1MKI3_MYCA9/216-334....G.D...-------.E.....RARAAADQI.LTR.-------.-SPIALSV----TL-AAVRR--------------
Q4ZVK4_PSEU2/240-361....T.R...-------.E.....WALDTVARM.KAH.-------.-SPLGMAV----TL-EMLRR--------------
E8YRL2_9BURK/242-368....A.R...-------.Q.....WLQSTCDAL.AAH.-------.-SPTMLYV----TR-EALLR--------------
C7YU81_NECH7/264-385....T.E...-------.E.....WAQKQIKTL.HKR.-------.-SPTAVHV----AL-RQMRV--------------
E8RLF2_ASTEC/222-340....D.S...-------.D.....WAQHQGEVL.ATR.-------.-SPFSMSV----TL-RHLRE--------------
Q88H70_PSEPK/234-355....S.H...-------.A.....WAVATADQL.ETR.-------.-SPLAMAV----TL-EMLRR--------------
B6QX63_9RHOB/228-349....H.D...-------.D.....FAAAALGTI.SKR.-------.-SPLSMEV----AF-QQVRR--------------
Q4DMX9_TRYCC/226-347....G.G...-------.E.....FAKGTINTL.NRM.-------.-APTSLRV----SL-EMQKR--------------
C3KAC3_PSEFS/239-360....S.H...-------.E.....WALNTVSLM.QTR.-------.-SPLAMAV----TL-EMLRR--------------
B0T1J0_CAUSK/220-338....S.S...-------.D.....WGKAQLAIL.KTK.-------.-SPQTLKV----AF-RQLEA--------------
C1DFA4_AZOVD/229-350....H.RPEY-------RA.....WAEATVRLM.DSR.-------.-SPLALCV----TL-ELLQR--------------
B4FC76_MAIZE/51-185....V.A...-------.E.....WANEALAGI.EKG.-------.-APFSLCL----TQ-KHFSQ--------------
A1U6V2_MARAV/235-354....T.D...-------.P.....WWQACIHTL.KTG.-------.-CPVTAWL----IW-HQIQK--------------
Q143S2_BURXL/249-375....E.A...-------.D.....WLLATLDAL.TQY.-------.-SPTMLMV----TR-EALLR--------------
A8L896_FRASN/269-387....P.A...-------.P.....AARAAAEEI.AAK.-------.-SPTSLKV----TL-RALRS--------------
A3LLW1_PSEAI/235-355....A.D...-------.P.....LLARGAKTL.AEG.-------.-CPMTAHL----VW-QQIQR--------------
B1FYK7_9BURK/243-363....S.A...-------.E.....WAEQVIAVL.RER.-------.-SPLSMAV----SL-EVVTR--------------
A4T9D3_MYCGI/230-348....G.A...-------.Q.....PATDAADLI.ASR.-------.-SPVAVSV----AL-EAVRR--------------
B9B8U0_9BURK/244-367....Q.D...-------.CAAVDGWVEKATHAM.RSE.-------L-SPLSMAV----SL-EVVDR--------------
A7INC3_XANP2/220-343....H.G...-------.E.....FAAATAREV.RLR.-------.-SPTSLCI----AM-EQMRR--------------
B7G076_PHATC/242-366....N.S...-------.D.....FGRKTAGIL.NTM.-------.-SPTSLKV----TL-EGLRR--------------
Q1GNL4_SPHAL/222-340....G.G...-------.E.....WAEKELAAL.HSK.-------.-SPQTCKV----AL-RQLKE--------------
B9Z3L5_9NEIS/240-359A..FE.D...-------.P.....WLAAAARSF.AQG.-------.-CPTSAAA----TW-EIFRR--------------
B8HBE4_ARTCA/223-343....G.S...-------.A.....EASHAADTI.EAK.-------.-SPISVKV----TL-ASLRR--------------
A3JYR4_9RHOB/216-334....P.S...-------.E.....FAAETLKTM.ERV.-------.-SPLSMAL----TL-EMIHR--------------
Q4DAM8_TRYCC/234-355....G.G...-------.E.....FAMEALKLL.RKA.-------.-SPTSLKV----TL-ELFRR--------------
A5V401_SPHWW/222-340....G.G...-------.D.....WALATLKTL.GTK.-------.-SPQACKV----VL-RLLAE--------------
A3QDJ0_SHELP/243-361....A.E...-------.P.....WLSRALSTM.LAG.-------.-SPLSLHL----VY-QQSLL--------------
A5W4F7_PSEP1/228-349....Y.Q...-------.D.....WAEQTVELL.NNR.-------.-SPLAMSA----TL-KLLRL--------------
B2JKB1_BURP8/241-361....G.DCAY-------AD.....WAEQAGAML.RER.-------.-SPLSMAV----SL-EVVTR--------------
B8K6S2_VIBPA/241-360....E.S...-------.Q.....WLARAKSNL.ATG.-------.-SPISAHI----CY-RQLTA--------------
Q13ZL1_BURXL/241-361....A.A...-------.D.....WAEQMIAIL.RER.-------.-SPLSMAV----SL-EVVTR--------------
Q1VBB4_VIBAL/239-357S..VD.N...-------.K.....WFVNAQKSL.NYG.-------.-SPLSLSI----TY-QQLTQ--------------
Q7NWA8_CHRVO/237-355A..FE.D...-------.P.....WLSDAAKNF.RHG.-------.-CPTSAAV----SW-EILDR--------------
C5CR27_VARPS/239-358....D.D...-------.A.....WLQSAAKTF.AKG.-------.-APSSAAL----SF-ELWQR--------------
A6GRM3_9BURK/262-382....K.V...-------.T.....WLANAAQAY.AHG.-------.-SPTSAAL----SF-ELMNR--------------
Q15XB2_PSEA6/243-360....G.D...-------.K.....WLSKAQKTL.QTG.-------.-SPISASL----VF-KQLQH--------------
Q2N893_ERYLH/222-342....E.D...-------.E.....WAAKERDTL.GTK.-------.-SPQTCKV----AL-RQLAE--------------
Q7VYA4_BORPE/252-372....A.D...-------.P.....WLARAAATM.LAG.-------.-SPGSARL----AY-ALQQH--------------
Q2L131_BORA1/252-372....A.D...-------.P.....WLARAAHTL.LAG.-------.-SPGSLRL----TF-TLLQR--------------
B0CSR7_LACBS/265-392....V.R...-------.Q.....WASDSLEML.AMR.-------.-SPTSLKV----AL-KAIRR--------------
A9INM9_BORPD/252-372....A.D...-------.P.....WLARAAATM.LAG.-------.-SPGSARL----AF-TLQQH--------------
B1LX53_METRJ/220-338....G.S...-------.D.....FAATTRATL.LTK.-------.-APSSLVL----TL-CLLRL--------------
A3XC08_9RHOB/216-334....P.S...-------.E.....FAEKTLKTL.GRN.-------.-APLSMAC----TV-ELLHR--------------
C5C8N8_MICLC/257-384....H.A...-------.E.....AAGKAAEAI.RTK.-------.-SPTAVAV----AH-EAQRR--------------
Q381D8_TRYB2/226-347....G.G...-------.E.....FARTAISTM.EKL.-------.-SPTSLKL----AL-KMQQM--------------
Q1YGH5_MOBAS/224-342....G.G...-------.E.....WAQRTAALI.RKG.-------.-SPISVGA----TL-ELVRA--------------
E3IZ76_FRASU/226-344....G.D...-------.P.....AAAAAADEI.AAK.-------.-SPTALTV----TL-AALRR--------------
A4BVU9_9GAMM/241-360G..GT.N...-------.E.....WLAGGVKAL.LEG.-------.-SPTSARV----IF-EQYRR--------------
A3SY56_9RHOB/216-334....D.S...-------.E.....FAADTLKKM.QRS.-------.-SPLAMAC----TV-EIIHR--------------
Q5LRB7_SILPO/216-334....G.G...-------.E.....FSSKILASL.RRN.-------.-SPLSMAC----TV-EMLHR--------------
Q485B6_COLP3/257-376....E.D...-------.K.....WLSRAQKSL.RNG.-------.-SALSAQL----AY-SQLAK--------------
B9NSD8_9RHOB/216-334....D.E...-------.E.....FSSKILATL.QRN.-------.-SPISMAC----TV-EMMHR--------------
Q8PMW0_XANAC/244-363....E.D...-------.S.....WLQAARATL.AAG.-------.-APGSARL----AW-ELYRR--------------
B8KU28_9GAMM/244-363....D.D...-------.K.....WLAKARDGL.AHG.-------.-SKLAALW----IH-RQMTE--------------
Q4Q4Q4_LEIMA/228-351....T.D...-------.P.....LAKAAADLM.PSF.-------.-SPTAMTL----AL-ELLKR--------------
B8LA21_9GAMM/238-357....D.D...-------.A.....WLQAAQKTL.AAG.-------.-APGSARL----AF-ELQRR--------------
A6F0M9_9ALTE/235-354E..ID.S...-------.D.....WWQGCVNNL.RNG.-------.-CPVTAWL----VW-TQLKK--------------
C9PG12_VIBFU/216-335....D.D...-------.K.....WIASARNNL.AAG.-------.-SPISAHI----TY-RQLTE--------------
B7RWK1_9GAMM/244-363....D.D...-------.P.....WLAKARDSL.QQG.-------.-SRLAALW----IH-RQLWE--------------
A9D9E4_9RHIZ/215-331..........-------.D.....WGQATLKAI.RAG.-------.-SPISANC----TL-ELVRR--------------
Q6BIA2_DEBHA/282-408....G.S...-------.E.....FAQKTYKTL.LLK.-------.-SPTSLKV----AF-ELLNR--------------
B2IDI2_BEII9/219-339G.YGG.L...-------.M.....FAMNTYDLI.RTR.-------.-SPLSVTI----AL-KLAQM--------------
A3VYK2_9RHOB/217-335....D.S...-------.D.....FARDTLKTL.SRN.-------.-SPLSMAC----AV-EMIHR--------------
Q6LIA0_PHOPR/241-360....M.G...-------.Q.....WIETAKHTL.EVG.-------.-SPITAHI----CF-RQVTQ--------------
C9QFQ9_VIBOR/241-360....D.A...-------.K.....WLSNAKANL.VSG.-------.-SPITAHI----CF-RQMND--------------
D3DBM7_9ACTO/251-369....G.V...-------.P.....AAAAAADEI.EGK.-------.-SPTALTV----TL-RALRA--------------
A9FQT5_9RHOB/216-334....D.S...-------.S.....FADATLKTL.RRN.-------.-APLSMAA----TV-ELLHR--------------
B6BEV0_9RHOB/216-334....G.S...-------.G.....FAAAALKAL.NRN.-------.-SPLSMAC----TL-EMLRR--------------
A1SIK1_NOCSJ/213-330....P.Q...-------.Q.....LARNAATII.ESQ.-------.-PPTALKV----AL-RALRT--------------
A4C9M2_9GAMM/236-355....D.N...-------.V.....WLQKAIKSL.KHG.-------.-SPLSMCL----IE-QQLIR--------------
D0L573_GORB4/229-343....G.T...-------.P.....DAAKVADTI.AAK.-------.-SPTALAV----TL-RSVRA--------------
Q46TC0_CUPPJ/240-362....D.DPRY-------AE.....WATRTAEAL.RKR.-------.-SPLAACA----TR-ELLLR--------------
A6AP67_VIBHA/240-359....N.T...-------.Q.....WLEVAKKSF.DAG.-------.-SPITAHI----CF-RQVKE--------------
Q28R37_JANSC/214-335....M.A...-------.D.....FVAATHKMM.GRN.-------.-APLSMAC----AI-ELVHR--------------
Q0RM03_FRAAA/274-392....P.V...-------.P.....AATADAAEI.GGK.-------.-CPTSLVV----TL-RALRA--------------
A4SZ56_POLSQ/226-345....G.P...-------.A.....WLAETTELM.KKR.-------.-SPIAMVG----AL-ETIHR--------------
Q164T3_ROSDO/216-334....D.S...-------.D.....FAKDTLKLL.HRN.-------.-SPLAMAC----TV-EVLHR--------------
Q488V8_COLP3/238-357....D.D...-------.K.....WLQRAKNGL.ASG.-------.-SPLAIKW----IF-HQLEL--------------
Q3IGC8_PSEHT/246-365....D.D...-------.K.....WLLKAQKSL.KHG.-------.-CPLSCAL----VS-RQLKT--------------
Q084X0_SHEFN/240-358......L...-------.D.....WLKRAQKTA.LAG.-------.-SPISWHL----IF-AQAAL--------------
E3I3E7_RHOVT/218-336....S.S...-------.S.....LARDAAKAI.RRN.-------.-SPLAVTA----AL-LAVRR--------------
Q6CA37_YARLI/262-380....G.....-------.E.....AGEKIIKLL.GER.-------.-SPTSVKV----TL-AALRR--------------
Q0FTH2_9RHOB/216-334....Q.G...-------.E.....IAERAAKAV.DRN.-------.-APLSMAL----TL-AMLAR--------------
B0TMR3_SHEHH/260-386....Q.H...-------.P.....WLAKAIKTL.LAG.-------.-SPISLSL----VH-LQSKL--------------
A8FTB5_SHESH/254-372....H.D...-------.S.....WLERPLKTL.LSG.-------.-SPLSWHL----IY-RQALL--------------
Q8PB61_XANCP/244-363....E.D...-------.A.....WLQAARATF.AAG.-------.-APGSARL----AW-ELQRH--------------
A9DFC7_9GAMM/243-361....K.E...-------.S.....WLARPIETM.LSG.-------.-SPISLQL----IY-RQAHL--------------
Q12MV4_SHEDO/240-361....E.F...-------.E.....WLARAQKTA.LAG.-------.-SPLSWTL----ID-EQAKL--------------
Q87II2_VIBPA/240-359....S.S...-------.P.....WIAGAKETF.SSG.-------.-SPITAHI----CF-RQVKE--------------
A4WS71_RHOS5/212-330....G.T...-------.G.....LAEEALKAI.RRS.-------.-SPLAMAV----TL-EILRR--------------
A6D633_9VIBR/241-360....N.D...-------.K.....WLVAAKHNL.SQG.-------.-SPITAHI----CF-RQIND--------------
A9V573_MONBE/229-344..........-------.D.....WGRQQLETI.HSM.-------.-CPASVAV----TF-EQLQR--------------
A3U2T9_9RHOB/217-331....E.G...-------.E.....FAAATLKAM.RRN.-------.-SPLAMAV----TL-AMLDR--------------
A1K1H9_AZOSB/239-359....P.D...-------.P.....WLAAAAGSF.VRG.-------.-APSSAAL----SL-ELWRR--------------
B8KL52_9GAMM/239-358....E.D...-------.R.....WLAKARDGL.IYG.-------.-SKLAALW----ID-RQLFE--------------
A3VDC8_9RHOB/216-333....D.S...-------.E.....IARASAKAI.RRA.-------.-SPLSVCC----TL-ANITR--------------
B1KMU0_SHEWM/250-368D..FS.D...-------.T.....WLARPIKTL.LSG.-------.-SPISWHL----IY-RQALL--------------
B9W7B3_CANDC/277-400....G.S...-------.P.....FAKKTLETL.LKK.-------.-PKSSLAV----GF-ELMNH--------------
Q2C757_9GAMM/264-383....GLG...-------.L.....WIETAKKAM.NAG.-------.-SPITAHI----CF-KQIQD--------------
Q1GHN1_SILST/216-334....K.D...-------.S.....FAADTLKVL.ERG.-------.-APLSIAT----TV-EMIHR--------------
A0Z2J1_9GAMM/235-354....D.D...-------.P.....WLMRARDGL.ING.-------.-SKLAAAW----IF-RQLNE--------------
B9KJQ6_RHOSK/212-329....D.T...-------.P.....LAAEALKAL.RRS.-------.-SPLALAA----TL-EILQR--------------
A4EVS1_9RHOB/216-334....G.S...-------.D.....FAKQALKPL.ARN.-------.-SALAMGC----FI-EMLHR--------------
C5MFF3_CANTT/281-404....G.S...-------.P.....FAKKTLDTL.SKK.-------.-PKSSLAV----AF-ALLNA--------------
A3LXK5_PICST/255-378....G.S...-------.Q.....FSKDTLHIF.SQK.-------.-PYSSLKI----AF-ELLNH--------------
C7D792_9RHOB/220-337....D.S...-------.K.....FASETLDKI.GRN.-------.-SPLAMAC----GI-EAIHR--------------
A8LME8_DINSH/216-334....D.T...-------.E.....FSRNALLGL.RRG.-------.-APLSTAS----AL-HLIRM--------------
D2VUW6_NAEGR/1151-1277....E.R...-------.D.....WAANILENM.NQL.-------.-SPLSLKV----TF-RAIQE--------------
B1VFJ2_CORU7/237-360....G.E...-------.K.....FLEDVRAAV.KKA.-------.-NPTSLVA----IT-EIMRH--------------
C4R612_PICPG/259-389....G.S...-------.D.....FALKIVETL.QSK.-------.-SPISLKV----AY-ELLQR--------------
C0WF71_9CORY/225-342..........-------.P.....ELKELVDKLTAQA.-------.-CPTSIVA----AL-ELYRA--------------
A7TTD5_VANPO/277-405....H.A...-------.M.....FAKQVKDKL.LQK.-------.-SMTSLQV----AL-KLLQE--------------
C5DX08_ZYGRC/263-400....A.R...-------.K.....FAQFTLQRL.LTK.-------.-SPTSMQV----AL-RLIHE--------------
Q6NI92_CORDI/230-349....D.R...-------.E.....FVNTVTELL.STA.-------.-NPESLVA----AV-ELMVA--------------
Q4Q4Q6_LEIMA/230-354....G.S...-------.A.....FAASTLEVM.ERN.-------.-SPLGMTL----AL-ENMKR--------------
Q5KPF9_CRYNJ/272-407....V.K...-------.E.....WAAHQKLQM.EAR.-------.-SPTGMAV----AL-QNYRK--------------
Q6FM09_CANGA/273-401....M.M...-------.Q.....FARDTKKKL.ESK.-------.-SMTSMQV----GI-RLMQE--------------
C3PF52_CORA7/224-341......P...-------.N.....IAGEVRRLM.AAA.-------.-CPAAIVA----AN-ELYEA--------------

PF03572

Q8CVF0_LEPIN/340-512ALILDLRNNA.......GG-----YLDLAIDIADMFIE.......K-GLIVSTK....SP-NRSPE..............
RET3_XENLA/1022-1198ALIIDMRFNI.......GG-----PTSSIPIFCSYFFD.......E-GTP.VLL....DK-IYSRT..............
CTPA_SYNP2/215-376RYVLDLRNNP.......GG-----LLQAGIEIARLWLD.......Q-ETIVYTV....NR-QGIFE..............
Q81R25_BACAN/181-400NLIIDVRLNR.......GG-----SDDAFFNLLPYLFE.......D-KEISLFD....SS-DTMQLNHTERNFHLRMKEM
Q7UUN0_RHOBA/410-573SLIIDLRDNP.......GG-----LLPASVEVADRFID.......N-GRILTTR....GR-NAREN..............
Q8HXM2_BLABR/30-208SLVLDLRHCT.......GG-----HASGIAYLISYLYP.......G-NTV.LHV....DT-VYEGL..............
Q8Y2I4_RALSO/213-395GVILDLRNNG.......GG-----VLQAAVGVSAAFLP......PD-VTVVSTN....GQ-VPDAK..............
Q8DII0_THEEB/215-376EYILDLRNNP.......GG-----LLQAGVEIAQLWLD.......S-GAIVYTV....DR-QGIVD..............
O57689_DANRE/419-585ALIIDLRNNI.......GG-----HASSIAGFCSYFFD.......A-DKQ.IVL....DH-IYDRP..............
Q8R712_THETN/193-353KLILDLRNNP.......GG-----LLTEVVSAANFFVP.......Q-GIVVTIE....RR-NGEKE..............
Q87YB6_PSESM/365-539GVVLDLRNNG.......GG-----SLQEATELTSLFID.......K-GPTVLVR....NA-DGKVD..............
TRI_SULSO/887-1042GLVVDVRFNR.......GG-----FVSGLLLEKLLLKR.......V-GYDYPRN....GK-PIPMP..............
Q7VMG7_HAEDU/365-546GLIVDLRDNG.......GG-----SLTEVVELTRLFIK.......S-SPVVQVR....DA-FNRIK..............
Q8R7P6_THETN/299-499YLIIDIRGNG.......GG-----NVMYWIENIVKPLT.......D-KKIAYKA....YT-VVKNYDIKYTKT.......
Q8A406_BACTN/202-362SLVIDLRNNG.......GG-----LLDEAVEIANYFLP......RG-KVIVTTK....GK-TKQAS..............
Q7NKF3_GLOVI/143-304GVILDLRGAG.......GE-----DAQSVADTARLFFP.......T-GASPLVQ....TV-GARDS..............
TRI_THEAC/878-1033GLIVDVRFNG.......GG-----FVSQLIIEKLMNKR.......I-GYDNPRR....GT-LSPYP..............
Q8S3I7_NICPL/284-447SFVLDLRDNL.......GG-----LVQAGIEIAKLFLN......EG-DTVISTV....GR-DPQYR..............
O83301_TREPA/167-332RLILDLRNNP.......GG-----LITAAVDVTSSFIP.......S-GTVVTTK....SR-VQGHS..............
Q7TUF4_PROMP/222-383GVILDLRNNS.......GG-----LVSSGIAVADSFLS.......E-KPIVETK....DR-NGIKD..............
O57689_DANRE/126-302AMILDFRSTV.......TG-----ELSGIPYIVSYFTD.......P-EPL.IHI....DS-VYDRT..............
Q87CM3_XYLFT/366-549GVVLDLRNNG.......GG-----SLDEAIQLTGLFIE.......Q-GPVVQVR....ES-GGRVT..............
Q8R6Q0_THETN/169-397YLVIDVSDNG.......GG-----STKYWVEAIVAPLR.......N-KLKEVEN....LS-VKKTYLIRGGEYIVKLLSN
O04073_SCEOB/276-438GLVLDIRNNG.......GG-----LFPAGVNVARMLVD.......R-GDLVLIA....DS-QGIRD..............
Q87PB1_VIBPA/356-526GIIVDLRNNG.......GG-----ALTEATALTGLFIK.......E-GPVVQVR....DS-YGRIK..............
Q8A2L4_BACTN/546-711GIILDMRKYP.......RW-----DIMEVLGKYLYPQP.......T-TFMWYSI....NS-KKFPG..............
Q8EDY9_SHEON/364-534GVVIDLRGNG.......GG-----ALTEAVLLTGLFID.......M-GPVVQVR....DA-DGRVS..............
Q97LQ5_CLOAB/210-372GLILDLRSNP.......GG-----LLSACIQVTSNFVT......KD-KVIVSTI....DK-YNSKE..............
O66985_AQUAE/192-355GFIIDLRNNP.......GG-----LLSEAVDVGDLFIP......KG-KLIVYTK....GR-KGELH..............
Q9RU43_DEIRA/206-370KLILDLRDNG.......GG-----LLSAGVDVADQFLQ.......S-GPIVSLR....ER-GGQPE..............
P73458_SYNY3/220-381GYIFDLRSNP.......GG-----LLYSSVDIARIWLD.......E-GGIVSTV....DR-RGEVE..............
Q7UNS4_RHOBA/218-383GFVLDLRGNG.......GG-----LLTAAVDVCDMFLS.......S-GRIVSTK....TR-GGVVE..............
Q9RUS4_DEIRA/235-411GVIVDLRGNT.......GG-----SLSECDSAVGAFVP.......S-FTRVAQN....AD-GQSRT..............
Q894Q8_CLOTE/197-416NLVIDLTENR.......GG-----ADSYWMTSIVAPNI.......D-KELKLYN....QY-ALYKNGDIVNDQWVKKHGN
Q84FE7_MYXXA/208-376GLVLDLRNNP.......GG-----LLDQAVAVSDRFLP......GN-LPIVSTR....GR-DGRSA..............
Q82BY0_STRAW/878-1033GLVVDVRENR.......GG-----HTSQLVVEKLARRI.......V-GWDLPRG....MR-PYSYP..............
Q8YRM4_NOSS1/218-379AYILDLRNNP.......GG-----LLQAGIEIARQWLD.......S-GTIVYTV....NR-QGIQG..............
Q8CVF1_LEPIN/197-364GLILDLRMNP.......GG-----LLDLAIALSDLFLK......PD-LDIVSVR....GR-GGELV..............
Q8A5K0_BACTN/312-500ELILDLRYNG.......GG-----DVTSANLISSCIAG.......D-LCIDKTF....AS-YRYNDER............
Q89KT1_BRAJA/201-369GYVMDLRNNP.......GG-----LLDQAVSVSSAFLQ.......R-GEVVSTR....GR-NPEET..............
Q8ENJ3_OCEIH/223-384GLVIDVRGNP.......GG-----LLNVAEDILKHLVP......KD-LPILQIE....DG-EGQVE..............
Q8XNN1_CLOPE/231-397GLILDLRGNP.......GG-----FMKECVDLVSNFVP......KD-KVIVSTI....DK-YGNKE..............
Q8P5D2_XANCP/126-301GWIIDLRQNS.......GG-----TMWPMVNGLQPLLG.......D-HVLGYFL....NA-DGEQT..............
PRC_HAEIN/363-533ALIVDLRENG.......GG-----ALTEAVALSGLFIT.......D-GPVVQVR....DA-YQRIR..............
Q8Y649_LISMO/229-395GLVLDLRGNP.......GG-----LLDQAVSISSLFVP......DG-KIVVQEQ....DK-DGDKS..............
Q7NHI8_GLOVI/142-311ALIIDLRANG.......GG-----SPRMVALLSSYLLE.......G-KP..VHL....NT-IYARP..............
P75023_SYNY3/244-405GYVLDLRGNP.......GG-----LLLSSIDIARLWLN.......R-GEIVSTI....DR-RGGDR..............
Q9L5V8_9BACT/892-1048AVIVDERHNG.......GG-----WLHDDLCTLLSGRQ.......Y-QSFVPRG....QF-IGWDP..............
RET3_HUMAN/742-918ALVIDLRYNP.......GS-----YSTAIPLLCSYFFE.......A-EPR.QHL....YS-VFDRA..............
Q9SVY2_ARATH/303-473SYILDLRNNPLLAIPYQGG-----LVRAGLDVAQLWLD......GD-ETLVYTI....DR-EGVTS..............
Q9A2X1_CAUCR/195-362GLILDLRNNP.......GG-----LLDQAVGVADVFLD.......G-GEVVSQR....GR-DPRNI..............
Q8R7P7_THETN/191-422YLIIDISGNE.......GG-----SSEYWIDAIVAPLI.......G-EKGF..R....YS-EDKNTWFYLSRKGKYTKKN
Y858_CHLTR/316-560ALIIDQTNNP.......GG-----SVLYLYALLSMLTD.......R-PLELPKH....RM-ILTQDEVVDALDWLTLLEN
Q8FYM8_BRUSU/181-348GYVLDLRLNP.......GG-----LLDQAVAVSDAFLD.......K-GEIVSTR....GR-DPQDV..............
Q8KAA8_CHLTE/214-383GIVLDLRGNP.......GG-----LLTSAVEVAGLFVE......KN-SRIVSTR....GR-AADSE..............
Q8ZXG0_PYRAE/836-991AFIIDVRYNR.......GG-----HTSGMLILRASVGI.......F-GRFLTRY....FK-PYPYP..............
Q7VFQ7_HELHP/223-383GIVLDLRNNP.......GG-----ALDQAVDLSRLFIK.......N-GVIVTQK....GR-NKNDN..............
Q8A3B9_BACTN/191-351DLILDLQGNG.......GG-----YLNAAIDLANEFLG......QK-ELIVYTE....GR-TAQRS..............
Q92UP4_RHIME/234-388GVVVDLRGRW.......GG-----GPPDAAELFVGDTP.......N-FRLISRS....GK-DMLAN..............
Q7VBS8_PROMA/229-390AYIIDVRGNP.......GG-----LLEASIDISRQLLD.......K-GVIVSTK....TK-DGITD..............
O23614_ARATH/320-483AFVLDLRDNS.......GG-----SFPEGIEIAKFWLD.......K-GVIVYIC....DS-RGVRD..............
Q879Y2_XYLFT/195-361GLLLDLRSNP.......GG-----LLTAAVQVADALLD.......K-GNIVSTR....GR-ISASD..............
RET3_XENLA/721-897SLIIDMRYNT.......GG-----YSTAIPIFCSYFFD.......P-EPL.QHL....YT-VYDRS..............
Q87CV7_XYLFT/204-366AIVLDLRDNT.......GG-----SSIAVPKLLAGFLA.......S-GTRIATE....IR-GKKTN..............
Q815H1_BACCR/212-374GLVIDVRGNP