Sequence alignment for CL0127

PF01972

Y137_METJA/3-286GEKMDPLSGFISSLIWWLLFFYLIMAPQIQYKQLQLARLKILRELSNKRNSTVITMIHRQESIGLFGIPV-YKFIT----
Y1495_METJA/9-292KIMGDEMTS..MDMFFFLFIFLLFIYPEMMMRYRIMKRLRCIREIERQRGTRVIAMIHRQEALTFLGIPI-YKFIT----
O29403_ARCFU/7-290VTYSDPMAS.LSGLFWILLFLYLIFAPQLKHQQLLAARRRAMRRIGMKRGSNVITMIHRQESIGFLGIPI-YRFID----
O66996_AQUAE/1-288MPYYDPFSY.LFSLLWFLLFVFILLSPWYKRMALIKAREDVIRKLEEKRKSRVITMIHRQEQIGFLGIPI-FRFMT----

PF00574

Q7XBR2_ORYSJ/73-254-----------------------------------------PGAG...AGGDVMGL.LLRERIVFLGNEI.EDFLA----
CLPP2_BORBU/6-189-----------------------------------------DNDAC.VLHDKSLKL.VLKSRSIVIAGEI.TKDVS----
CLPP1_BORBU/13-194-----------------------------------------GNYE...RVFDIYSR.LLRERIIFLSGEI.NDPKA----
CLPP1_CAEEL/34-215-----------------------------------------GKGE...RTYDIYSR.LLRDRIVCLMTPV.DDFIA----
CLPP4_ARATH/74-253-----------------------------------------RGAE.....SDVMGL.LLRERIVFLGSSI.DDFVA----
CLPP1_CHLTR/3-189-----------------------------------------EGEMM.HKLQDVIDRKLLDSRRIFFSEPV.TEKSA----
Q9CFR9_LACLA/7-176-----------------------------------------IKGD...VVDNSYGM.MYDWFGIDYTSPS.KVNDA----
CLPP1_PSEAE/28-209-----------------------------------------ARGE...RAYDIYSR.LLKERIIFLVGQV.EDYMA----
CLPP2_RHIME/20-201-----------------------------------------NRGE...RSYDIYSR.LLKERIIFLTGPV.EDHMA----
CLPP2_BACHD/13-194-----------------------------------------GLSE...RSYDIYSR.LLKDRIVFLGAAI.DDQIA----
CLPP_CAUCR/20-201-----------------------------------------SRGE...RAFDIFSR.LLKERIIFLTGPV.EDGMA----
CLPP5_ARATH/107-288-----------------------------------------MVQE...RFQSIISQ.LFQYRIIRCGGAV.DDDMA----
CLPP_MOUSE/63-244-----------------------------------------GRGE...RAYDIYSR.LLRERIVCVMGPI.DDSVA----
CLPP_CALS4/12-193-----------------------------------------NRGE...RAYDIFSR.LLKDRIVFLGDEI.NDTTA----
O97252_PLAF7/180-359-----------------------------------------IKDM....KKDVKLF.FFKKRIIYLTDEI.NKKTA----
CLPP1_AGRFC/16-197-----------------------------------------SRGE...RSFDIYSR.LLRERIIFLNGEV.DDTVS----
CLPP_XYLFA/19-200-----------------------------------------SRGE...RAYDIYSR.LLKERLIFLVGPI.DDYMA----
Q42886_SOLLC/95-274-----------------------------------------PVGA.....LDLSTV.LFRNRIIFIGQPV.NSAVA----
CLPP1_TREPA/17-198-----------------------------------------GGGE...RSYDIFSR.LLKDRIIFVDGEI.TDAVA----
CLPP2_MYCLE/27-207-----------------------------------------VKES......NPYNK.LFEERIIFLGVQV.DDASA----
CLPP_DEIRA/15-196-----------------------------------------GRGE...RSYDIYSR.LLKDRIIFVGTPV.ESQMA----
CLPP1_BACHD/12-193-----------------------------------------NRGE...RAYDIYSR.LLKDRIIMLGTAI.DDNVA----
CLPP_THEMA/21-202-----------------------------------------GRYE...RAYDIFSR.LLKDRIVFLGSPI.DDYVA----
CLPP2_TREPA/15-193-----------------------------------------SGES...VFFQ...K.FLETRQILLSGEI.SKDLA----
CLPP_CHLTE/37-218-----------------------------------------GRGE...RAFDIFSR.LLRERIIFLGSPI.DEHVA----
TEPA_BACHD/48-232-----------------------------------------EQSN..IHCITVVGQ.I..EGHMQLPPQN.KTTKY----
CLPP3_NOSS1/13-196-----------------------------------------PGGQF.TDWISIYDR.LYRERIIFLGRDV.DDEIA----
CLPP3_AGRFC/23-198-----------------------------------------GKET...EAN......LFKSRSIFIYGGI.TQELA----
CLPP1_RHILO/16-197-----------------------------------------SRGE...RAFDIFSR.LLRERIIFINGEI.NDDVS----
CLPP1_SYNE7/10-191-----------------------------------------GRGE...RAFDIYSR.LLRERIIFLGEPV.TSDVA----
CLPP_CLOPE/13-194-----------------------------------------SKGE...RSYDIFSR.LLKDRIIMLSGEV.NDVTA----
CLPP_RICPR/12-193-----------------------------------------SRGE...RAYDIYSR.LLKERIIFVCSTV.EDHMA----
CLPP2_CORGL/13-195-----------------------------------------QGGP..GFGNDVFDR.LLSERIIFLGSQV.DDEIA----
CLPP1_CORGL/24-204-----------------------------------------GTKE.....TNPYAK.LFEERIIFLGTQV.DDTSA----
CLPP5_STRCO/18-201-----------------------------------------SAGT...RTSDPYSK.LLQERIVFLGTPV.DETSA----
CLPP_CLOAB/12-193-----------------------------------------SRGE...RSYDIYSR.LLKDRVIFLGEEV.NDTTA----
CLPP_HAEIN/12-193-----------------------------------------SRGE...RSYDIYSR.LLKERVIFLSGEV.EDRMA----
CLPP_CHLRE/310-482-----------------------------------------SKALK.AYNYLDQGA.LNNES....GRSL.YRKQT----
CLPP1_STRCO/32-208-----------------------------------------LGDQ.......VYNR.LLGERIIFLGQPV.DDDIA----
CLPR2_ARATH/79-263-----------------------------------------NREEGTWQWVDIWNA.LYRERVIFIGQNI.DEEFS----
CLPP3_SYNY3/13-197-----------------------------------------PGSQY.ERWIDIYTR.LSQERIIFLGQEV.NDSIA----
CLPP4_STRCO/14-196-----------------------------------------PQGE...RSYDVFSR.LLSERIIFLGTEI.DDGVA----
CLPP2_PSEAE/13-193-----------------------------------------SHGA...IGAKLMEY.ALKVRKVFVTGGV.DEKMA----
CLPP_WHEAT/13-197-----------------------------------------PGDEE.ATWVDLYNV.MYRERTLFLGQEI.RCEIT----
CLPP2_STRCO/28-210-----------------------------------------SQGV...REYDPYAK.LFEERVIFLGVQI.DDASA----
CLPP_AQUAE/19-200-----------------------------------------PRGE...RAYDIYSR.LLQDRIVLLGSPI.DDHVA----
CLPP3_SYNE7/13-197-----------------------------------------PGSSF.ERWIDIYNR.LAMERIIFLGQEV.TDGLA----
CLPP1_NOSS1/11-192-----------------------------------------GRGE...RAFDIYSR.LLRERIVFLGQQV.DSNLA----
CLPP2_ARATH/41-222-----------------------------------------SRGE...RAYDIFSR.LLKERIICINGPI.NDDTS----
CLPP_RALSO/34-215-----------------------------------------GRGE...RAYDIYSR.LLKERVIFMVGEV.NDQTA----
CLPP2_SYNY3/32-213-----------------------------------------GMGE...RAFDIYSR.LLRERIIFLGTPV.DDQVA----
Q8ZQG9_SALTY/47-225-----------------------------------------SGAE...SWYTIRAA.ADNAADISIYDEIGGWGIS----
CLPP_CAMJE/11-192-----------------------------------------SRGE...RSYDIYSR.LLKDRIIMLSGEI.HDELA----
CLPP2_MYXXD/11-192-----------------------------------------HRGE...RAYDLYSR.LLKDRIIMLGTPV.NDDVA----
Q9VKY3_DROME/38-219-----------------------------------------GRGE...RAYDIFSR.LLKERIICLMGNI.TDDIS----
F2YGL7_CHLVA/18-193-----------------------------------------...A...QWVDLYNR.LYRERVLFLCQEL.DDELA----
G8AKT8_AZOBR/21-200-----------------------------------------.RGE...RAYDIYSR.LLKERIIFLIGGV.NDAVA----
M4CIZ3_BRARP/88-261-----------------------------------------.........LDTTNM.LLRQRIVFLGSQV.DDMTA----
CLPP1_MYCTU/18-192-----------------------------------------.........DSVYER.LLSERIIFLGSEV.NDEIA----
CLPP_STAA8/13-191-----------------------------------------.RGE...RAYDIYSR.LLKDRIIMLGSQI.DDNVA----
CLPP_BRUA2/21-200-----------------------------------------.RGE...RAYDIFSR.LLKERIIFVNGPV.EDGMS----
CLPP_NEIG1/17-198-----------------------------------------.RGE...RAFDIYSR.LLKERIVFLVGPV.TDESA----
CLPP_STRT2/10-192-----------------------------------------SRGE...RSYDIYSR.LLKDRIIMLTGPI.EDNMA----
CLPP1_BACAN/14-192-----------------------------------------..GE...RSYDIYSR.LLKDRIVIIGSEI.NDQVA----
Q8Y7Y1_LISMO/12-186-----------------------------------------.........NILTQK.LIDTRTVLIYGEI.NQELA----
CLPP_LISMO/12-192-----------------------------------------SRGE...RAYDIYSR.LLKDRIIMLGSAI.DDNVA----
W8JRT3_9CHLA/15-194-----------------------------------------.RGE...RAMDIYSR.LLKDRIVMIGQEI.TEPLA----
W8UFH3_YEREN/25-205-----------------------------------------SRGE...RSYDIFSR.LLKERIIFLTGQV.EDHMA----

PF00378

ECI1_MOUSE/39-287------------------------------------------------EGPAGVAV-------MKLRNP.PVNSLS----
MENB_BACSU/16-271------------------------------------------------ETYNGIAK-------ITINRPEVHNAFT----
PKSH_BACSU/12-259------------------------------------------------RFQASVCY-------ITFHRPEANNTIN----
PKSI_BACSU/10-249------------------------------------------------EIESAIIQ-------VKMQDRTHKNAFS----
CAID_ECOLI/8-261------------------------------------------------TRNGSILE-------ITLDRP.KANAID----
ECI1_HUMAN/52-302------------------------------------------------DAGAGVAV-------MKFKNP.PVNSLS----
ECHM_HUMAN/42-290------------------------------------------------GKNNTVGL-------IQLNRPKALNALC----
ECHM_CAEEL/40-288------------------------------------------------GEKQNVAL-------IKLNRPKALNALC----
ECHH_RHOCB/9-257------------------------------------------------EISEGLAV-------ITLDRPEVMNALN----

PF01343

Y651_METJA/110-263--------------------------------------------------------------------------------
SOHB_HAEIN/163-314--------------------------------------------------------------------------------
O26897_METTH/96-249--------------------------------------------------------------------------------
SPPA_HAEIN/387-539--------------------------------------------------------------------------------
SPPA_SYNY3/126-282--------------------------------------------------------------------------------
SPPA_BACSU/129-283--------------------------------------------------------------------------------
P95072_MYCTU/128-283--------------------------------------------------------------------------------
SPPA_ECOLI/140-296--------------------------------------------------------------------------------
SPPA_SYNY3/383-536--------------------------------------------------------------------------------
SPPA_ECOLI/391-543--------------------------------------------------------------------------------
P95072_MYCTU/402-555--------------------------------------------------------------------------------
SCAF_LAMBD/148-300--------------------------------------------------------------------------------
Y021_SYNY3/67-220--------------------------------------------------------------------------------
O25976_HELPY/103-256--------------------------------------------------------------------------------
SPPA_HAEIN/132-288--------------------------------------------------------------------------------
SOHB_ECOLI/161-310--------------------------------------------------------------------------------
Q0PC65_CAMJE/102-253--------------------------------------------------------------------------------

PF16113

D7SLU2_VITVI/50-384------------------------------------------------------------SRTAILNRPHVLNALN----
F6I042_VITVI/68-402------------------------------------------------------------SRIVTLNRPHVLNAVV----
HIBCH_CHICK/45-375------------------------------------------------------------AGIITLNRPKVLNALS----
HIBCH_SCHPO/66-398------------------------------------------------------------ARIFTLNRPKVLNAIN----
Q488V8_COLP3/18-356------------------------------------------------------------IGVLTLNSEKTLNALT----
C4KDL8_THASP/20-344------------------------------------------------------------VGVLTLNRPAVLNALD----
A5FW64_ACICJ/17-342------------------------------------------------------------VGRISLNRPRALNALT----
F5Z7N6_ALTSS/21-362------------------------------------------------------------IGVLTLNKPKALNALD----
Q8I523_PLAF7/190-524------------------------------------------------------------ICEIILNRPEKLNAIN----
E3FSI9_STIAD/13-346------------------------------------------------------------IGLVTLDRPRALNALD----
F0ZTV2_DICPU/166-501------------------------------------------------------------YKRAMLNNREKLNVLD----
G5BGL1_HETGA/35-365------------------------------------------------------------VGVLTLNRPGSLNTLT----
B6HLY2_PENCW/44-388------------------------------------------------------------LRSVELNRPKKLNSLN----
Q1LLS5_RALME/36-367------------------------------------------------------------VAYLTLTRPQALNALS----
F7QLT9_9BRAD/23-350------------------------------------------------------------AGILRLNRPKAINALT----
Q21WJ0_RHOFT/28-365------------------------------------------------------------VGFITLNRPKALNALS----
A0A016PD16_GIBZA/69-413------------------------------------------------------------LRTMMLNRPQKLNSLN----
I1G4V7_AMPQE/50-378------------------------------------------------------------YRLMTLNKPKTLNALS----
F6HIV7_VITVI/22-356------------------------------------------------------------VRKVILNRPHKLNSLT----
Q8ES26_OCEIH/14-345------------------------------------------------------------IGTIELNRPKAINSLS----
A7INC3_XANP2/15-342------------------------------------------------------------AGIITLNRPKALNALN----
F4PNE6_DICFS/76-406------------------------------------------------------------CTVISLNRPKQLNVLC----
I1BHM9_RHIO9/79-409------------------------------------------------------------VREVVLNRPKKLNALN----
C8X9E6_NAKMY/35-349------------------------------------------------------------LGRIMLNRPRQINALT----
I1KQ42_SOYBN/46-396------------------------------------------------------------VAVITLDRPKALNAMN----
Q13IB6_BURXL/22-355------------------------------------------------------------VGVVTLNRPKAHNALT----
E9SYN2_RHOHA/17-337------------------------------------------------------------LGRITLNRPKAINALN----
G2NK33_STREK/15-339------------------------------------------------------------TLHITLNRPRALNALT----
D7SV41_VITVI/52-386------------------------------------------------------------SRAAILNRPSDLNALT----
G7UPF5_PSEUP/25-367------------------------------------------------------------IGIATLNAPKTLNGLS----
A8LME8_DINSH/12-333------------------------------------------------------------AGRITLNRPRALNALT----
B2W7S4_PYRTR/68-416------------------------------------------------------------VRSIELNRPKKLNSLN----
B2IFQ5_BEII9/17-341------------------------------------------------------------AGVITLNRPQSLNALT----
E4XNE1_OIKDI/19-346------------------------------------------------------------VGIVTLNRPKALNALN----
A1SIK1_NOCSJ/14-329------------------------------------------------------------VGWIRLDRPEALNALT----
B0UJ66_METS4/21-343------------------------------------------------------------AGCLTLNRPQALNALD----
D3PW51_STANL/21-338------------------------------------------------------------LGRIRLHRPKAINALT----
Q084X0_SHEFN/18-357------------------------------------------------------------IGMVTLNIEKALNALT----
B2JKB1_BURP8/21-360------------------------------------------------------------IGFIELNRPKALNALS----
G2J3D7_PSEUL/18-358------------------------------------------------------------LGIATLNAGKTLNALT----
F4RGZ4_MELLP/11-358------------------------------------------------------------MRVLILNRPKVLNALT----
Q0C3Q9_HYPNA/20-349------------------------------------------------------------IGRITLTRPAALHALN----
F8J779_HYPSM/27-350------------------------------------------------------------LQTFTLNRPSSLNALD----
Q2SP84_HAHCH/24-363------------------------------------------------------------IGVITLNVEKSLNALK----
E1VLZ8_9GAMM/17-356------------------------------------------------------------IGIATLNAEKSLNSLS----
D2V7D6_NAEGR/73-426------------------------------------------------------------CLCITLNRPKSFNALS----
Q12MV4_SHEDO/18-360------------------------------------------------------------IGVVTLNVEKALNALN----
F5YTZ4_MYCSD/16-336------------------------------------------------------------IGLLTLNRPQAINSLN----
Q5WH10_BACSK/10-343------------------------------------------------------------VGVITLAREKALNSLS----
B8ESI3_METSB/13-334------------------------------------------------------------CGLITLNRPAALNSLN----
B9IB41_POPTR/22-356------------------------------------------------------------SKTLILNRPKQLNALS----
F0ZLP9_DICPU/30-365------------------------------------------------------------CLNVLLNRPKALNALN----
H2ZC72_CIOSA/54-386------------------------------------------------------------AGIITLNRPGALNALN----
Q2W460_MAGSA/13-341------------------------------------------------------------LGRIVLNRPKVLNALS----
B1LX53_METRJ/12-337------------------------------------------------------------LGRLRLNRPKALNALT----
D5GGY6_TUBMM/44-383------------------------------------------------------------VRTIELNRPGSLNALN----
A4SZ56_POLSQ/13-344------------------------------------------------------------LGLITLNRPKALNALN----
E9T596_RHOHA/14-336------------------------------------------------------------VAEIVLDRPRALNALD----
F4CYK1_PSEUX/14-333------------------------------------------------------------LGRLTLNRPRSLNAID----
Q5ZX62_LEGPH/13-340------------------------------------------------------------LGFITLNRPKALNALT----
B9RD44_RICCO/57-391------------------------------------------------------------SRTAILNRPSALNALN----
G0RME1_HYPJQ/43-386------------------------------------------------------------LRTVLLNRPKKLNSLN----
A9WQX7_RENSM/20-336------------------------------------------------------------LGVVILNRPKAGNALN----
H1VE28_COLHI/45-366------------------------------------------------------------LRSIQLNRSKKLNSLN----
G2IVT0_PSEUL/18-359------------------------------------------------------------IGVATLNAEKSLNALT----
E2BCN8_HARSA/46-370------------------------------------------------------------CGVIILNRPKVLNSLN----
C6W855_ACTMD/12-334------------------------------------------------------------LGRITLNRPGVINALN----
A0A088AET4_APIME/95-420------------------------------------------------------------KGIIILNRPKALNALN----
Q143S2_BURXL/33-374------------------------------------------------------------VAVITLNRPAALNALS----
F4S4Z1_MELLP/87-423------------------------------------------------------------MRIMTLNRPSVLNALN----
B9J934_AGRRK/15-342------------------------------------------------------------AGLIRLNRPQALNSLT----
F4Q929_DICFS/53-395------------------------------------------------------------CLKIILNREKALNSLT----
Q381D8_TRYB2/20-346------------------------------------------------------------TRLVTLNREKALNALN----
A1BAK1_PARDP/12-321------------------------------------------------------------AGRLTFNRPQALNALS----
G3WP62_SARHA/46-376------------------------------------------------------------AGVITLNRPKVLNSLN----
B2IDI2_BEII9/14-338------------------------------------------------------------CGIITLNRPKALNALD----
I1MM39_SOYBN/20-357------------------------------------------------------------ARVLTLNRTKQLNALS----
F6EFK8_AMYSD/12-332------------------------------------------------------------LGLITLNRPAAINSLN----
Q212Q2_RHOPB/18-345------------------------------------------------------------AGVIRLNRPKAINALT----
G8MC08_9BURK/24-360------------------------------------------------------------VAIITLDRPHALNALS----
A0JS02_ARTS2/30-352------------------------------------------------------------LGVITLNRPRAVNALT----
A8HXV6_AZOC5/51-378------------------------------------------------------------AGLITLNRPKALNALT----
HIBC8_ARATH/21-353------------------------------------------------------------VRLTTLNRPRQLNVIS----
B6Q688_PENMQ/41-385------------------------------------------------------------LRLIELNRPKKLNSLN----
A0C505_PARTE/18-343------------------------------------------------------------LAIAHFNRPEKLNAVH----
C1DFA4_AZOVD/17-349------------------------------------------------------------IGYLTLNRPANLNTLT----
G7Z662_AZOL4/15-341------------------------------------------------------------IGLVTLNRPKALNALT----
Q5QW21_IDILO/17-357------------------------------------------------------------IGVATLNSEKSLNALS----
C1DNT4_AZOVD/14-346------------------------------------------------------------IGHLTLNRPNGLNALS----
Q230X4_TETTS/30-358------------------------------------------------------------KAKVVLNKPKALNALD----
B9SXD3_RICCO/47-382------------------------------------------------------------SRTVILNRPHVLNALT----
Q5LRB7_RUEPO/12-333------------------------------------------------------------AGRITLTRPQALNAMS----
D6X3R7_TRICA/42-364------------------------------------------------------------KGVITLNRPKALNALN----
A1R246_ARTAT/18-336------------------------------------------------------------LGIVTLNRPKAVNALN----
D3BN96_POLPA/192-532------------------------------------------------------------YARAFLNNRKTLNAID----
B9SKJ5_RICCO/22-357------------------------------------------------------------ARTLILNRPKQLNALS----
B7G076_PHATC/15-365------------------------------------------------------------LFVLTLNNPKALHALS----
F4F5N6_VERMA/14-334------------------------------------------------------------LGHLTLNRPAAINALT----
A9PBA7_POPTR/21-353------------------------------------------------------------VRLITLNRPRQLNVIS----
G6DDP6_DANPL/16-332------------------------------------------------------------AGIITLNRPKALNSLN----
F8AY96_FRADG/12-334------------------------------------------------------------LGRITLNRPRAINALN----
H6N4E1_GORPV/12-333------------------------------------------------------------VGEIVLDRPKALNALD----
E0VLB5_PEDHC/53-383------------------------------------------------------------KGSFTLNRPKQLNTLN----
Q0A896_ALKEH/22-361------------------------------------------------------------IGVATLTAPRKLNALD----
D8SM52_SELML/13-356------------------------------------------------------------LAVLTLDRPKALNAMN----
D7AAE9_STAND/32-359------------------------------------------------------------LGLVTLDRPRALNALD----
D7MNH9_ARALL/19-353------------------------------------------------------------VRILTLNRPKQLNALS----
E3I3E7_RHOVT/14-335------------------------------------------------------------AGRITLNRPAAMNALT----
D0J4R8_COMT2/40-371------------------------------------------------------------LGMITLNRPKALNALS----
D5QAS0_KOMHA/14-335------------------------------------------------------------LGRITLDRPRALNALD----
F4NRB7_BATDJ/54-395------------------------------------------------------------IRKFELDRPAAMNALN----
G3QQM4_GORGO/20-355------------------------------------------------------------AGVITLNRPKFLNALT----
A1K1H9_AZOSB/18-358------------------------------------------------------------FGHATLNAERALNALS----
Q0IP17_ORYSJ/128-462------------------------------------------------------------TRTLVLNRPKQLNALS----
A1TSJ8_ACIAC/16-348------------------------------------------------------------VGFITLNRPRALNALS----
HIBCH_DICDI/33-370------------------------------------------------------------CLKVLLNRPKALNALN----
I1BZ13_RHIO9/189-518------------------------------------------------------------LGQIILNRPNKLNALN----
A9SUT7_PHYPA/29-361------------------------------------------------------------GRFATMNRPRVLNCIN----
D3HQR9_LEGLN/13-338------------------------------------------------------------LGVITLNRPGALNALT----
G4NGW1_MAGO7/67-414------------------------------------------------------------LRTIELNRPKKLNSLN----
A9RJN7_PHYPA/31-365------------------------------------------------------------AKAAILNRPRKLNSLN----
A9TYA6_PHYPA/60-394------------------------------------------------------------TKVAILNRPKKLNAVN----
E1VZ37_ARTAR/22-349------------------------------------------------------------IGHIELNRDAKLNALN----
Q4DMX8_TRYCC/74-400------------------------------------------------------------ARLLTLCRPAMLNALS----
Q6LIA0_PHOPR/19-359------------------------------------------------------------IGVAILENTASLNALT----
B7Q288_IXOSC/44-375------------------------------------------------------------KGVIILDRPKALNALS----
H3B677_LATCH/47-377------------------------------------------------------------AGIITLNRPKALNALN----
B4M5Z4_DROVI/22-343------------------------------------------------------------KGMIIINRPKALNAIN----
A7RHZ5_NEMVE/46-374------------------------------------------------------------AGIITMNRPKALNALN----
Q8FQY6_COREF/29-353------------------------------------------------------------TGVIELNRPKALNSLN----
E1VC38_HALED/19-356------------------------------------------------------------IGVARLNAPKALNALS----
Q11J99_CHESB/19-339------------------------------------------------------------AGLIALNRPSALNALN----
B0S642_DANRE/44-374------------------------------------------------------------AGVITLNRPKALNALT----
D7LRR5_ARALL/47-381------------------------------------------------------------SRTAILNRPPALNALT----
F8K1G3_STREN/18-341------------------------------------------------------------VGRLLLDRPAALNALD----
G2KLT0_MICAA/19-358------------------------------------------------------------VGFLTLDRPQALNALT----
B6JX18_SCHJY/32-363------------------------------------------------------------MRCFILNRPAKLNAIN----
I1M992_SOYBN/52-386------------------------------------------------------------SRAAILNRPSSLNSLN----
A8NEJ7_COPC7/45-386------------------------------------------------------------IRKFILNRPNKLNALD----
Q12AQ1_POLSJ/18-355------------------------------------------------------------FGLATLNAPATLNALS----
Q1QVU3_CHRSD/19-353------------------------------------------------------------IGVATLNAPDSLNALS----
I1JMV6_SOYBN/52-386------------------------------------------------------------SRMAILNRPSALNALN----
Q4JU31_CORJK/25-358------------------------------------------------------------VGVIELNRPKALNSLS----
Q2GA19_NOVAD/13-336------------------------------------------------------------AGILSLNRPKAIHALT----
Q2N893_ERYLH/16-341------------------------------------------------------------VGHISLNRPKALHALT----
Q16U65_AEDAE/33-352------------------------------------------------------------AGLITLNRPKALNAIN----
C6XIW5_HIRBI/14-333------------------------------------------------------------VGHITLNRPQALHALN----
C3PF62_CORA7/13-336------------------------------------------------------------AGVLTLNRPKAINALN----
D8IW53_HERSS/21-370------------------------------------------------------------IGIATLASEKTLHAIS----
C8WWK9_ALIAD/12-344------------------------------------------------------------VAWLGLNRPKQLNALS----
F0XEA1_GROCL/74-428------------------------------------------------------------LRTIELNRPRKFNSLN----
Q0BR39_GRABC/31-348------------------------------------------------------------TGWITLNRPSALNALN----
F2T0Y3_TRIRC/73-417------------------------------------------------------------VRLIELNRPKKLNSLN----
A1WLH8_VEREI/23-355------------------------------------------------------------VGFITLNRPRALNALS----
A9C200_DELAS/16-348------------------------------------------------------------MGMITLNRAKALNALS----
Q2L131_BORA1/18-371------------------------------------------------------------LGVATLNAPQTLNGLS----
F2R851_STRVP/13-333------------------------------------------------------------TGRLILNRPRALNALT----
D5BR70_PUNMI/19-347------------------------------------------------------------VGVITLARPKALNALS----
E1VS22_ARTAR/12-327------------------------------------------------------------LGLITLNRPKALNALN----
Q28R37_JANSC/11-334------------------------------------------------------------AGRITLNRPKALNAVT----
C3Z9L9_BRAFL/41-373------------------------------------------------------------VGVITLNRPKALNALN----
B3S7F3_TRIAD/23-347------------------------------------------------------------VGLITLNRPKALNVLS----
A5V401_SPHWW/17-339------------------------------------------------------------TGRIRLNRPKAIHALT----
E5SEM2_TRISP/42-371------------------------------------------------------------KLLVTLNRPTALNALN----
C0HHJ2_MAIZE/66-416------------------------------------------------------------VAVITLDRPKALNAMN----
B0CSR7_LACBS/50-391------------------------------------------------------------LRSYILDRPLKRNALD----
A4VIV7_PSEU5/16-354------------------------------------------------------------IAIATLDAPRQLNALS----
D4ZAM5_SHEVD/14-353------------------------------------------------------------IGVMTLNMEQALNAIN----
A7HX73_PARL1/15-335------------------------------------------------------------AGIVTLNRPKALNALT----
F4QC51_DICFS/178-513------------------------------------------------------------FSRALLNDRKTLNSLS----
Q7NWA8_CHRVO/15-354------------------------------------------------------------IAVATLNAEKSLNALT----
G0MPK6_CAEBE/44-375------------------------------------------------------------KKVVTLNRPKALNALN----
Q55GN0_DICDI/49-392------------------------------------------------------------CKRIILNRSEALNSLT----
C7RD63_ANAPD/10-343------------------------------------------------------------IGIIYLDRGEKINALN----
Q6CA37_YARLI/41-379------------------------------------------------------------TRTITLNRPKKLNALD----
A9V573_MONBE/16-343------------------------------------------------------------LTQMTLNRPKSLNALT----
A0BEK3_PARTE/25-354------------------------------------------------------------ALNIKLNRPSQLNALN----
F2R4L5_STRVP/18-338------------------------------------------------------------AGFITLHRPRAINALT----
HIBC5_ARATH/51-385------------------------------------------------------------SRAAILNNPSSLNALS----
E4N1A8_KITSK/18-339------------------------------------------------------------LGRITLNRPRALNSLT----
E5ASB4_BURRH/34-371------------------------------------------------------------VAVVTLNRPDALNALS----
H3FRY8_PRIPA/40-371------------------------------------------------------------KRVVTLNRPKQLNALN----
A9HE55_GLUDA/18-336------------------------------------------------------------LGRMTLNRPKALNALD----
F2IWL1_POLGS/13-333------------------------------------------------------------AGFITLNRSAALNALT----
Q7MDJ7_VIBVY/19-358------------------------------------------------------------IAVATLENPSALNALS----
D5UVM7_TSUPD/17-334------------------------------------------------------------TGHIELNRPAALNALT----
G8SEU3_ACTS5/15-332------------------------------------------------------------LGHLVLNRPRAINALT----
Q0VP05_ALCBS/18-356------------------------------------------------------------IARATLNAPKSLNALS----
B2UAB6_RALPJ/70-398------------------------------------------------------------IGWLTLNRPQALNALS----
A1S5D0_SHEAM/18-354------------------------------------------------------------IGVATLNVEAALNALD----
H8MVZ6_CORCM/13-341------------------------------------------------------------LGLVTLNRPKALNALS----
D5ATL9_RHOCB/13-333------------------------------------------------------------AGRITFNRPAALNALD----
B9RPB0_RICCO/58-404------------------------------------------------------------VAVITLDRPKALNAMN----
B6IMT6_RHOCS/17-352------------------------------------------------------------LGLVTLNRPKALNALT----
H6BSS6_EXODN/72-425------------------------------------------------------------VRTIELNRPKKLNSLN----
Q1GNL4_SPHAL/17-339------------------------------------------------------------IGRIALNRPKAIHALN----
E9IZM3_SOLIN/56-380------------------------------------------------------------SGVIVLNRPKALNALN----
Q6FM09_CANGA/43-400------------------------------------------------------------ARIVTLNRPKKLNALN----
E1SUP0_FERBD/18-358------------------------------------------------------------IGVATLNSEKSLNALS----
G4RGU8_PELHB/12-344------------------------------------------------------------CGIIRLTRPKAINALS----
G2P5N8_STRVO/31-352------------------------------------------------------------AGHLTLNRPRALNALT----
HIBC2_ARATH/15-349------------------------------------------------------------VRILTFNRPKQLNALS----
Q4Q4Q6_LEIMA/22-353------------------------------------------------------------CRTITLSRPDALNVMS----
G7DUF6_MIXOS/94-452------------------------------------------------------------LYTITLNRPKALNSLN----
C1DAN4_LARHH/20-362------------------------------------------------------------IATALLNSERTLNALT----
A1U6V2_MARHV/15-353------------------------------------------------------------IGLLTLNEPGTLNALT----
C7NJ16_KYTSD/22-350------------------------------------------------------------IARIHLNRPKALNALT----
D2VUW6_NAEGR/936-1276------------------------------------------------------------TRCLQINRPRESNRIT----
C4WVV0_ACYPI/36-362------------------------------------------------------------VGIVTLNRPKALNALN----
E9G4T3_DAPPU/56-370------------------------------------------------------------KCLITLNRPKALNALN----
C1EG25_MICSR/14-367------------------------------------------------------------VTVLTLNRPRQLNVLS----
F4GS44_PUSST/18-360------------------------------------------------------------VGLATLNSPQTLNGLS----
A4F9Q5_SACEN/15-334------------------------------------------------------------LGRITLNRPKALNALT----
G8RS69_MYCRN/28-352------------------------------------------------------------VGLITLNRPKAINSLT----
G3IHA0_CRIGR/18-348------------------------------------------------------------AGVITLNRPKFLNALS----
G2QR77_THITE/46-391------------------------------------------------------------LRSIELNRPKKLNALN----
B9TBM0_RICCO/16-343------------------------------------------------------------TGLIVLDRPKALNSLS----
Q4DMX9_TRYCC/20-346------------------------------------------------------------TRLITINREKALNSMD----
D7FIS1_ECTSI/31-370------------------------------------------------------------VAWLTLNKPEKLNALS----
E8NCI0_MICTS/19-345------------------------------------------------------------VGHLTLNRPRAINALG----
Q89N86_BRADU/17-344------------------------------------------------------------AGVIRLNRPKAINAVT----
E8RLF2_ASTEC/19-339------------------------------------------------------------VGRLTLNRPQALNALT----
F0M0J8_VIBFN/19-357------------------------------------------------------------IGIATLDNPASLNALS----
A1U2J0_MARHV/19-355------------------------------------------------------------IAVARLNSPRNLNSLS----
Q0RM03_FRAAA/66-391------------------------------------------------------------LGRLTLNRPRAINALT----
H3DE45_TETNG/45-375------------------------------------------------------------AGVITMNRPKVLNALN----
B4RB39_PHEZH/14-336------------------------------------------------------------VGRITLNRPQALHALT----
F0ZI93_DICPU/87-416------------------------------------------------------------TLVLTLNRPKSLNVLN----
G1X6E1_ARTOA/73-419------------------------------------------------------------VRTITLNRPQKLNALS----
A4G9P0_HERAR/23-358------------------------------------------------------------LGCLTLDRPQAMNSLS----
A0R2Y4_MYCS2/15-335------------------------------------------------------------VGILTLNRPKAINSLT----
D3B388_POLPA/36-371------------------------------------------------------------VINILLNRPEALNALS----
C6THR1_SOYBN/37-369------------------------------------------------------------VRVVTLNRPRQLNAIS----
D8RN96_SELML/20-345------------------------------------------------------------VRVMTLNRPQVLNCLN----
F6AA82_PSEF1/16-354------------------------------------------------------------IGIASLDAPASLNALS----
F8E0K2_CORRG/15-348------------------------------------------------------------TAIVELDRPRALNALD----
F2GC52_ALTMD/22-362------------------------------------------------------------IGRLTLNKPKALNALD----
A4I8I6_LEIIN/21-350------------------------------------------------------------.RHITLNRPNSLNALD----
A4VKU6_PSEU5/16-348------------------------------------------------------------VGHLTLNRPAGLNAVT----
A4XS22_PSEMY/16-354------------------------------------------------------------IGIASLDAEKSLNALT----
A8Q2H6_BRUMA/37-374------------------------------------------------------------..IVTLNRPRTLNALN----
B1MKI3_MYCA9/13-333------------------------------------------------------------VGLLTLNRPKAINSLT----
B1VV62_STRGG/15-334------------------------------------------------------------.GVVTLNRPKALNALT----
B4FIT7_MAIZE/26-359------------------------------------------------------------.RTLILNRPKQLNALS----
B9IL60_POPTR/51-383------------------------------------------------------------..AAILNRPASRNALT----
C1A226_RHOE4/16-335------------------------------------------------------------.GLITLNRPKAINALN----
C4R612_PICPG/39-387------------------------------------------------------------.RVISLNRSAKLNALS----
C5AQY8_METEA/35-359------------------------------------------------------------.GLITLTRPKALNALT----
C5CR27_VARPS/20-356------------------------------------------------------------.ATATLNAPASLNALS----
C5GL55_AJEDR/45-388------------------------------------------------------------.RNIELNRPKKLNALN----
C7JEY4_ACEP3/21-337------------------------------------------------------------.GRIILDRPKRLNAVD----
C8V2I5_EMENI/70-410------------------------------------------------------------VRLVELNRPKKLNSLN----
D9Q9E6_CORP2/23-349------------------------------------------------------------.GIIELNRPKALNSLN----
F6INA5_9SPHN/14-335------------------------------------------------------------.GHISLNRPKAIHALT----
F8Q7W3_SERL3/52-393------------------------------------------------------------.RTYVLNRPKKLNALN----
G8PLL8_PSEUV/25-348------------------------------------------------------------.GLIILNRPKALNALT----
M0YPS1_HORVD/57-387------------------------------------------------------------....VLNRPGHLNALT----
M1FH42_9ALTE/19-355------------------------------------------------------------IGVARLNAPRSLNSLS----
O53419_MYCTU/16-336------------------------------------------------------------VGFVTLNRPKAINSLN----
Q0K1Z5_CUPNH/27-360------------------------------------------------------------VGIATLNRPRQLNALS----
Q0K9D4_CUPNH/13-344------------------------------------------------------------IGYLTLNRPQALNALS----
Q13M23_BURXL/27-363------------------------------------------------------------VAIITLNRPAALNALS----
Q1D8V8_MYXXD/13-346------------------------------------------------------------VGVVTLNRPKALNALN----
HIBCH_XENTR/46-375------------------------------------------------------------.GVITLNRPKALNALN----
Q2RTB1_RHORT/15-345------------------------------------------------------------.GAITLNRPRALNALT----
Q2YNA1_BRUA2/20-339------------------------------------------------------------.GLVKLTRTAALNALT----
Q3J1K7_RHOS4/13-327------------------------------------------------------------.GRITLSRPAALNALT----
Q3SQN0_NITWN/20-346------------------------------------------------------------.GIVRLNRPRAINAVT----
Q5JMX9_ORYSJ/26-356------------------------------------------------------------.RVAILNRPRQLNVIS----
Q63MM8_BURPS/27-362------------------------------------------------------------.ALITLNRPAALNALS----
Q63TV7_BURPS/21-364------------------------------------------------------------IGFLELNRPQALNALS----
Q65IX3_BACLD/15-345------------------------------------------------------------.AAIVLNRPKALNSLT----
Q6N492_RHOPA/19-345------------------------------------------------------------.GVIRLNRPKAINALT----
Q6NI92_CORDI/19-346------------------------------------------------------------.GVLELNRPQALNSLT----
Q7APV2_MYCLE/16-336------------------------------------------------------------IGLITLNRPKAINSLN----
Q7VYA4_BORPE/19-371------------------------------------------------------------.GVATLNAPQTLNGLS----
Q83AM7_COXBU/43-368------------------------------------------------------------.GEITLNRPKALNALT----
Q87H46_VIBPA/18-356------------------------------------------------------------IGVLELDNPAALNALS----
Q87II2_VIBPA/19-358------------------------------------------------------------IGVATLDNTPSLNALT----
Q87YT7_PSESM/28-360------------------------------------------------------------IGHLTLNRPEGLNAID----
Q88H70_PSEPK/22-354------------------------------------------------------------IGHLTLNRPAGLNALT----
Q8NRX2_CORGL/14-334------------------------------------------------------------.GMVELNRPKALNSLN----
Q8XS34_RALSO/27-369------------------------------------------------------------.AILTLNRPSALNALS----
Q92TQ6_RHIME/18-338------------------------------------------------------------IGRLRLNRPRALNSLN----
Q983C3_RHILO/18-337------------------------------------------------------------.GVVTLTRPQALNAVT----
Q9A8K1_CAUCR/15-337------------------------------------------------------------VGRITLNRPKALHALT----
Q9I5I5_PSEAE/16-354------------------------------------------------------------IGIATLDAEKSLNALS----
U5FFA4_POPTR/23-356------------------------------------------------------------.KKVILNRPHKLNSLT----
U5G8W9_POPTR/30-363------------------------------------------------------------.KKIILNRPQKLNCIN----
V4KPJ6_9ACTN/14-339------------------------------------------------------------VGRITLNRPRALNALN----
V9XKW7_9NOCA/15-343------------------------------------------------------------.GEVQLDRPGALNALD----
V9XNE6_9NOCA/16-336------------------------------------------------------------IGRITLNRPKAINALN----
W4W6S1_ATTCE/168-489------------------------------------------------------------.GTIVLNRPKELNSIN----
W5JCR8_ANODA/20-341------------------------------------------------------------.GVITLNRPKALNAIN----
W5XRW0_9CORY/14-331------------------------------------------------------------.GIITLNRPKALNALD----

PF08496

Q3SFM4_THIDA/3-147--------------------------------------------------------------------------------
SOHB_ECOLI/2-158--------------------------------------------------------------------------------
Q5E611_VIBF1/2-162--------------------------------------------------------------------------------
U3U6L2_9ENTR/2-156--------------------------------------------------------------------------------
B8F6J6_HAEPS/4-160--------------------------------------------------------------------------------
M9WWT9_MANHA/4-159--------------------------------------------------------------------------------
A1WT84_HALHL/2-146--------------------------------------------------------------------------------
K6ZKA6_9ALTE/2-154--------------------------------------------------------------------------------
A6VW04_MARMS/3-155--------------------------------------------------------------------------------
A1U0U5_MARHV/2-161--------------------------------------------------------------------------------
Q6ML34_BDEBA/2-147--------------------------------------------------------------------------------
C4K721_HAMD5/2-157--------------------------------------------------------------------------------
Q5F7D2_NEIG1/4-160--------------------------------------------------------------------------------
C9R4B3_AGGAD/4-161--------------------------------------------------------------------------------
D4GFA3_PANAM/2-157--------------------------------------------------------------------------------
L0GQQ0_9GAMM/3-144--------------------------------------------------------------------------------
Q6D4V2_PECAS/4-159--------------------------------------------------------------------------------
E1VKB3_9GAMM/3-151--------------------------------------------------------------------------------
G4QLK8_GLANF/2-149--------------------------------------------------------------------------------
Q88G04_PSEPK/2-149--------------------------------------------------------------------------------
Q3JCU0_NITOC/3-143--------------------------------------------------------------------------------
Q4KAG4_PSEF5/2-152--------------------------------------------------------------------------------
F2JWF9_MARM1/2-145--------------------------------------------------------------------------------
W8L9B4_HALHR/2-153--------------------------------------------------------------------------------
E0WSD1_9ENTR/2-157--------------------------------------------------------------------------------
K0CD66_ALCDB/4-159--------------------------------------------------------------------------------
U5T5A0_9GAMM/2-148--------------------------------------------------------------------------------
Q9CN58_PASMU/4-161--------------------------------------------------------------------------------
Q6LPB4_PHOPR/2-162--------------------------------------------------------------------------------
K4KI74_SIMAS/2-171--------------------------------------------------------------------------------
Q9KT45_VIBCH/5-165--------------------------------------------------------------------------------
Q9I2R3_PSEAE/2-148--------------------------------------------------------------------------------
B2VKR2_ERWT9/2-158--------------------------------------------------------------------------------
B8GRY4_THISH/2-150--------------------------------------------------------------------------------
A6VNT8_ACTSZ/5-162--------------------------------------------------------------------------------
I3Y8M1_THIV6/9-152--------------------------------------------------------------------------------
Q15TT9_PSEA6/2-153--------------------------------------------------------------------------------
C5BJB2_TERTT/2-161--------------------------------------------------------------------------------
Q7N4B0_PHOLL/2-157--------------------------------------------------------------------------------
W0E0L9_MARPU/2-148--------------------------------------------------------------------------------
H2FWJ9_OCESG/3-149--------------------------------------------------------------------------------
C1DKS7_AZOVD/4-150--------------------------------------------------------------------------------
E1V393_HALED/3-148--------------------------------------------------------------------------------
SOHB_BUCBP/2-161--------------------------------------------------------------------------------
M4VAW8_9DELT/2-148--------------------------------------------------------------------------------
R5EC27_9GAMM/2-173--------------------------------------------------------------------------------
X2H295_9GAMM/2-181--------------------------------------------------------------------------------
A8GF70_SERP5/2-157--------------------------------------------------------------------------------
U3TWV0_9ENTR/2-157--------------------------------------------------------------------------------
Q21J53_SACD2/2-173--------------------------------------------------------------------------------
D3RTH4_ALLVD/10-153--------------------------------------------------------------------------------
L0E340_THIND/2-150--------------------------------------------------------------------------------
M1SGT4_MORMO/2-158--------------------------------------------------------------------------------
C7RA79_KANKD/2-191--------------------------------------------------------------------------------
Q486S9_COLP3/2-158--------------------------------------------------------------------------------
V4LD97_9GAMM/3-151--------------------------------------------------------------------------------
Q1QW68_CHRSD/3-155--------------------------------------------------------------------------------
Q7VMW6_HAEDU/4-160--------------------------------------------------------------------------------
Q12LC5_SHEDO/2-148--------------------------------------------------------------------------------
M1FK11_9ALTE/2-170--------------------------------------------------------------------------------
B3PHP3_CELJU/2-172--------------------------------------------------------------------------------
S6AL13_PSERE/2-151--------------------------------------------------------------------------------
A1SW75_PSYIN/13-168--------------------------------------------------------------------------------
Q83EG9_COXBU/8-154--------------------------------------------------------------------------------
D8MSU4_ERWBE/2-158--------------------------------------------------------------------------------
Q882A1_PSESM/2-148--------------------------------------------------------------------------------
C4LEI0_TOLAT/2-149--------------------------------------------------------------------------------
I2B860_SHIBC/2-158--------------------------------------------------------------------------------
Q2SJ39_HAHCH/2-155--------------------------------------------------------------------------------
Q080A4_SHEFN/6-151--------------------------------------------------------------------------------
F5Z7M4_ALTSS/2-152--------------------------------------------------------------------------------
D3SB45_THISK/2-168--------------------------------------------------------------------------------
W5X6P0_BDEBC/2-148--------------------------------------------------------------------------------
A4VLP8_PSEU5/22-167--------------------------------------------------------------------------------
SOHB_HAEIN/4-161--------------------------------------------------------------------------------
Q87N43_VIBPA/2-162--------------------------------------------------------------------------------
A3QFM5_SHELP/2-153--------------------------------------------------------------------------------
M4U4F5_9GAMM/2-157--------------------------------------------------------------------------------
Q7CIM0_YERPE/2-157--------------------------------------------------------------------------------
Q0VQ70_ALCBS/3-158--------------------------------------------------------------------------------
M5DSS1_9GAMM/2-160--------------------------------------------------------------------------------
SOHB_BUCAI/2-147--------------------------------------------------------------------------------
E1SNQ6_FERBD/2-150--------------------------------------------------------------------------------
F7YNU5_VIBA7/19-179--------------------------------------------------------------------------------
A0KMV5_AERHH/2-146--------------------------------------------------------------------------------
D3VGP7_XENNA/2-157--------------------------------------------------------------------------------
A4XVC0_PSEMY/2-147--------------------------------------------------------------------------------
A5EWW5_DICNV/5-147--------------------------------------------------------------------------------
R4I0F4_9ENTR/2-157--------------------------------------------------------------------------------
I0DNT2_PROSM/2-157--------------------------------------------------------------------------------
H2IX53_RAHAC/2-156--------------------------------------------------------------------------------
Q7MLX8_VIBVY/2-162--------------------------------------------------------------------------------
W0HSX4_9ENTR/2-157--------------------------------------------------------------------------------
C5BDW5_EDWI9/2-157--------------------------------------------------------------------------------
Q0ABV0_ALKEH/2-149--------------------------------------------------------------------------------
D4G886_RIEPU/2-151--------------------------------------------------------------------------------
Q3IL32_PSEHT/3-148--------------------------------------------------------------------------------
F9ZL28_ACICS/2-144--------------------------------------------------------------------------------
Q5QYQ0_IDILO/2-143--------------------------------------------------------------------------------
F4HAL3_GALAU/4-170--------------------------------------------------------------------------------
B4EW27_PROMH/2-157--------------------------------------------------------------------------------
B0UU39_HISS2/4-161--------------------------------------------------------------------------------
A3MY80_ACTP2/4-160--------------------------------------------------------------------------------
A7MN97_CROS8/2-158--------------------------------------------------------------------------------
A1S7G8_SHEAM/2-147--------------------------------------------------------------------------------
M4R4I6_BIBTR/4-160--------------------------------------------------------------------------------
D0L1Z6_HALNC/2-150--------------------------------------------------------------------------------

PF03255

D2UEG3_XANAP/5-148--------------------------------------------------------------YLDF--------------
ACCA_METCA/5-148--------------------------------------------------------------FLDF--------------
E3I8F4_RHOVT/21-165--------------------------------------------------------------YLDF--------------
D8PGA3_9BACT/4-146--------------------------------------------------------------YLDF--------------
R7MD99_9CLOT/4-147--------------------------------------------------------------ALDF--------------
F8EZE8_TRECH/5-136--------------------------------------------------------------....--------------
W0DRR8_9GAMM/5-148--------------------------------------------------------------FLDF--------------
A8LLX0_DINSH/4-147--------------------------------------------------------------YLDF--------------
ACCA_SYNWW/6-148--------------------------------------------------------------.FDY--------------
E0TDQ6_PARBH/4-147--------------------------------------------------------------YLEF--------------
R7GKD0_9CLOT/3-138--------------------------------------------------------------LEEN--------------
G2KND5_MICAA/4-146--------------------------------------------------------------.LDF--------------
Q2S032_SALRD/7-156--------------------------------------------------------------LLDF--------------
Q6AM83_DESPS/30-172--------------------------------------------------------------....--------------
Q311Q7_DESAG/25-171--------------------------------------------------------------...Q--------------
S6A148_9SPIO/4-140--------------------------------------------------------------....--------------
A0KHH9_AERHH/16-160--------------------------------------------------------------FLDF--------------
ACCA_PHOLL/5-151--------------------------------------------------------------FLEF--------------
ACCA_FLAPJ/3-147--------------------------------------------------------------YLDF--------------
G2TPG4_BACCO/5-147--------------------------------------------------------------.LEF--------------
D5EJ62_CORAD/7-150--------------------------------------------------------------TLEF--------------
B8D1K4_HALOH/6-149--------------------------------------------------------------ILDF--------------
ACCA_ROSDO/4-148--------------------------------------------------------------YMDF--------------
X2GZP6_9BACI/5-147--------------------------------------------------------------.LAF--------------
ACCA_RHIME/4-148--------------------------------------------------------------YLDF--------------
D7BGY4_MEISD/3-145--------------------------------------------------------------.LEF--------------
ACCA_MAGSA/3-146--------------------------------------------------------------ILEF--------------
I0AHK2_IGNAJ/5-146--------------------------------------------------------------ILDF--------------
G4REG5_PELHB/4-148--------------------------------------------------------------YLDF--------------
ACCA_CHLTE/6-163--------------------------------------------------------------VLDF--------------
ACCA_AGRFC/4-148--------------------------------------------------------------YLDF--------------
ACCA_ALKOO/4-147--------------------------------------------------------------FLES--------------
ACCA_MARMS/5-148--------------------------------------------------------------YLPF--------------
K6ZTQ8_9ALTE/5-150--------------------------------------------------------------FLEF--------------
C0QT26_PERMH/2-143--------------------------------------------------------------..DI--------------
Q2G730_NOVAD/6-148--------------------------------------------------------------YLEF--------------
V5SAJ3_9RHIZ/15-158--------------------------------------------------------------YLDF--------------
R7C0E0_9BURK/6-149--------------------------------------------------------------FLEF--------------
C6XFA8_LIBAP/4-148--------------------------------------------------------------YLDF--------------
ACCA_SYNE7/11-154--------------------------------------------------------------LLEF--------------
C1CYF8_DEIDV/5-142--------------------------------------------------------------....--------------
H6L155_SAPGL/3-146--------------------------------------------------------------FLDF--------------
R6L4F3_9FIRM/289-430--------------------------------------------------------------..EV--------------
D1B429_SULD5/5-141--------------------------------------------------------------.LDF--------------
D3UH38_HELM1/4-141--------------------------------------------------------------YLDF--------------
B9L7W0_NAUPA/3-140--------------------------------------------------------------VLDF--------------
ACCA_HELMI/5-146--------------------------------------------------------------.LDF--------------
D3SP93_THEAH/2-144--------------------------------------------------------------.LEI--------------
R7AXN0_9FIRM/3-137--------------------------------------------------------------LKEA--------------
C5CPW8_VARPS/6-149--------------------------------------------------------------FLDF--------------
W0E5D8_MARPU/5-148--------------------------------------------------------------FLDF--------------
ACCA_ALCBS/5-148--------------------------------------------------------------FLEF--------------
D9SFY0_GALCS/5-149--------------------------------------------------------------FLDF--------------
I1YEX9_METFJ/5-148--------------------------------------------------------------FLDY--------------
K4LHZ1_THEPS/6-149--------------------------------------------------------------LLDL--------------
E4TZ34_SULKY/5-141--------------------------------------------------------------.LDF--------------
D0LXB2_HALO1/14-155--------------------------------------------------------------ILEF--------------
C6WW95_METML/5-149--------------------------------------------------------------YLDF--------------
C7M555_CAPOD/3-147--------------------------------------------------------------YLDF--------------
ACCA_FRATT/3-144--------------------------------------------------------------YLDF--------------
H8KSG2_SOLCM/5-147--------------------------------------------------------------.FDF--------------
D1AII8_SEBTE/3-144--------------------------------------------------------------...I--------------
ACCA_CUPNH/5-148--------------------------------------------------------------FLDF--------------
ACCA_ERYLH/4-146--------------------------------------------------------------YLEF--------------
D2R421_PIRSD/12-153--------------------------------------------------------------.LDF--------------
D9QKB7_BRESC/5-147--------------------------------------------------------------YLEF--------------
R5DZV5_9BURK/6-150--------------------------------------------------------------YLEF--------------
Q0C318_HYPNA/4-148--------------------------------------------------------------YLEF--------------
I0IBV1_PHYMF/56-206--------------------------------------------------------------.LAF--------------
C6XPW8_HIRBI/7-150--------------------------------------------------------------FLDF--------------
ACCA_CHLPD/6-163--------------------------------------------------------------VLDF--------------
R6Z0L2_9CLOT/259-400--------------------------------------------------------------....--------------
D4JZM5_9FIRM/2-150--------------------------------------------------------------IKEL--------------
K9P1M5_CYAGP/6-149--------------------------------------------------------------LLEF--------------
D4G8D7_RIEPU/6-152--------------------------------------------------------------FLDF--------------
E8SIV5_STAPH/2-144--------------------------------------------------------------.LDF--------------
U5T6J3_9GAMM/8-151--------------------------------------------------------------FLEF--------------
W0JJL3_DESAE/4-146--------------------------------------------------------------.YDF--------------
F0P1A9_WEEVC/3-147--------------------------------------------------------------YLEF--------------
F8KU37_HELBC/4-141--------------------------------------------------------------YLDF--------------
G4QI06_GLANF/5-150--------------------------------------------------------------FLDF--------------
L0EG96_THECK/6-148--------------------------------------------------------------.LEF--------------
ACCA_IDILO/5-150--------------------------------------------------------------FLDF--------------
A0LCL9_MAGMM/15-158--------------------------------------------------------------FLEF--------------
W0E6N2_9FIRM/5-147--------------------------------------------------------------.FEF--------------
E6U0M3_BACCJ/6-148--------------------------------------------------------------.LPF--------------
ACCA_CAMHC/4-141--------------------------------------------------------------YLDF--------------
ACCA_HELPY/4-141--------------------------------------------------------------YLDF--------------
F8E5R1_FLESM/6-148--------------------------------------------------------------.LEF--------------
ACCA_LEGPH/5-148--------------------------------------------------------------FLEF--------------
ACCA_RHOBA/6-147--------------------------------------------------------------.LEF--------------
I0JPN9_HALH3/4-147--------------------------------------------------------------ILEF--------------
R6UTY3_9FIRM/3-138--------------------------------------------------------------IKEA--------------
R5QI57_9FIRM/286-429--------------------------------------------------------------....--------------
ACCA_RUBXD/2-142--------------------------------------------------------------.LDF--------------
R5NX12_9CLOT/2-140--------------------------------------------------------------IKEI--------------
D7CNC0_SYNLT/7-149--------------------------------------------------------------.LDF--------------
Q2JI82_SYNJB/9-151--------------------------------------------------------------LLEF--------------
A8J646_CHLRE/72-215--------------------------------------------------------------TLEF--------------
I2EZ83_EMTOG/4-147--------------------------------------------------------------LLDF--------------
ACCA_CHLCH/6-163--------------------------------------------------------------VLDF--------------
Q1MR33_LAWIP/27-171--------------------------------------------------------------....--------------
ACCA_ZYMMO/4-146--------------------------------------------------------------YLDF--------------
ACCA_PARUW/3-145--------------------------------------------------------------ILPH--------------
B1I3G8_DESAP/4-147--------------------------------------------------------------VFDF--------------
ACCA_XYLFA/5-148--------------------------------------------------------------YLDF--------------
ACCA_BRASO/8-150--------------------------------------------------------------YLDF--------------
ACCA_ACAM1/10-153--------------------------------------------------------------LLDF--------------
D3PKT0_MEIRD/3-145--------------------------------------------------------------.LEF--------------
B1ZYS7_OPITP/7-150--------------------------------------------------------------VLEF--------------
K9ZX35_DEIPD/3-142--------------------------------------------------------------....--------------
G8PGM3_PSEUV/4-148--------------------------------------------------------------YLEF--------------
D9QS74_ACEAZ/6-148--------------------------------------------------------------.LEF--------------
D3DFX7_HYDTT/3-145--------------------------------------------------------------.LEF--------------
ACCA_PELLD/6-163--------------------------------------------------------------VLDF--------------
ACCA_SORC5/5-147--------------------------------------------------------------ILPF--------------
W0J949_9BACT/7-150--------------------------------------------------------------TLEF--------------
ACCA_GEMAT/6-149--------------------------------------------------------------VLEF--------------
Q11UX8_CYTH3/2-145--------------------------------------------------------------YLDF--------------
ACCA_XANP2/4-148--------------------------------------------------------------YLDF--------------
C8X286_DESRD/27-171--------------------------------------------------------------....--------------
ACCA_WOLSU/4-141--------------------------------------------------------------YLDF--------------
D5XA35_THEPJ/4-147--------------------------------------------------------------VLEF--------------
ACCA_HELHP/4-141--------------------------------------------------------------YLDF--------------
ACCA_PELUB/4-149--------------------------------------------------------------YLNF--------------
ACCA_COXBU/5-148--------------------------------------------------------------YLDF--------------
L0K556_HALHC/4-147--------------------------------------------------------------YLEF--------------
A7HCR7_ANADF/7-150--------------------------------------------------------------ALDF--------------
D0KZU8_HALNC/5-148--------------------------------------------------------------YLDF--------------
E4U646_OCEP5/2-145--------------------------------------------------------------ALEF--------------
C5AV00_METEA/7-151--------------------------------------------------------------YLDF--------------
F3YX99_DESAF/28-171--------------------------------------------------------------....--------------
Q729X2_DESVH/28-170--------------------------------------------------------------....--------------
F2I397_PELSM/3-148--------------------------------------------------------------YLDF--------------
ACCA_STACT/2-144--------------------------------------------------------------.LDF--------------
ACCA_BLOFL/5-151--------------------------------------------------------------CLDF--------------
A5D053_PELTS/4-147--------------------------------------------------------------ILDF--------------
F2IGK6_FLUTR/4-148--------------------------------------------------------------YLDF--------------
ACCA_LARHH/5-148--------------------------------------------------------------FLDF--------------
ACCA_PARL1/4-148--------------------------------------------------------------YLDF--------------
D7CVI6_TRURR/3-145--------------------------------------------------------------.LPF--------------
K9RT78_SYNP3/9-152--------------------------------------------------------------LLEF--------------
ACCA_UNCTG/5-146--------------------------------------------------------------.FDF--------------
R5QLG5_9FIRM/3-135--------------------------------------------------------------LSQV--------------
D4LVS3_9FIRM/273-410--------------------------------------------------------------MKET--------------
A9RT89_PHYPA/97-240--------------------------------------------------------------TLPF--------------
ACCA_PELCD/4-146--------------------------------------------------------------YLDF--------------
E4TL55_MARTH/2-145--------------------------------------------------------------LLEF--------------
ACCA_PELPB/6-163--------------------------------------------------------------VLDF--------------
E1VNM7_9GAMM/16-159--------------------------------------------------------------YLEF--------------
K4AZH5_SOLLC/103-246--------------------------------------------------------------TLAF--------------
C6D8B9_PAESJ/6-149--------------------------------------------------------------MLPF--------------
K0J396_AMPXN/4-147--------------------------------------------------------------ILDF--------------
E8U5S6_DEIML/5-142--------------------------------------------------------------....--------------
ACCA_CAUCR/5-149--------------------------------------------------------------YLDF--------------
F2LWN6_HIPMA/3-146--------------------------------------------------------------LLDF--------------
G2LDZ5_CHLTF/6-153--------------------------------------------------------------...K--------------
E4TI62_CALNY/6-148--------------------------------------------------------------.LEF--------------
ACCA_PSEAE/5-148--------------------------------------------------------------FLDF--------------
D5SMU5_PLAL2/7-147--------------------------------------------------------------.LPF--------------
H8KZ76_FRAAD/5-148--------------------------------------------------------------FLDF--------------
L0G434_ECHVK/2-145--------------------------------------------------------------VLEF--------------
C7JEV8_ACEP3/4-146--------------------------------------------------------------FLDF--------------
U3U7V8_9ENTR/5-151--------------------------------------------------------------YPDF--------------
I4AJK8_FLELS/2-145--------------------------------------------------------------LLDF--------------
U6B8Z9_9RHIZ/4-148--------------------------------------------------------------YLDF--------------
I3THF2_TISMK/4-147--------------------------------------------------------------FLDF--------------
C7PMD3_CHIPD/3-146--------------------------------------------------------------FLDF--------------
D5BMW6_PUNMI/4-146--------------------------------------------------------------FLDF--------------
C6VWQ9_DYAFD/4-147--------------------------------------------------------------YLDF--------------
A0A068NX81_9BACT/5-153--------------------------------------------------------------HKEW--------------
K7S984_GLUOY/13-161--------------------------------------------------------------FLDF--------------
F2JNG5_CELLD/8-142--------------------------------------------------------------LEAI--------------
L0DWX9_THIND/5-148--------------------------------------------------------------FLDF--------------
K9Q7M9_9NOSO/10-153--------------------------------------------------------------LLDF--------------
ACCA_TRIEI/9-152--------------------------------------------------------------LLDF--------------
L0EVZ1_LIBCB/4-148--------------------------------------------------------------YLNF--------------
D4M3A9_9FIRM/275-407--------------------------------------------------------------MKEV--------------
ACCA_NITSB/4-141--------------------------------------------------------------YLDF--------------
R5QCK4_9BURK/6-152--------------------------------------------------------------FLEF--------------
R6P4G2_9CLOT/2-145--------------------------------------------------------------KLDF--------------
ACCA_CARHZ/6-148--------------------------------------------------------------.FEF--------------
ACCA_CELJU/5-148--------------------------------------------------------------YLDF--------------
G2ISU6_9SPHN/4-147--------------------------------------------------------------YLDF--------------
D4KAA0_9FIRM/2-148--------------------------------------------------------------IKDI--------------
F6IN39_9SPHN/4-146--------------------------------------------------------------YLDF--------------
D4Z3Q1_SPHJU/4-147--------------------------------------------------------------FLEF--------------
W0EXF5_9SPHI/9-152--------------------------------------------------------------FLDF--------------
I3ZX40_ORNRL/3-147--------------------------------------------------------------YLPF--------------
F0RKQ5_DEIPM/7-153--------------------------------------------------------------....--------------
E0UBA6_CYAP2/10-153--------------------------------------------------------------LLDF--------------
R5YAR4_9PROT/8-151--------------------------------------------------------------VLDF--------------
ACCA_ACICJ/4-146--------------------------------------------------------------FLDF--------------
K9SWQ9_9SYNE/7-150--------------------------------------------------------------LLDF--------------
ACCA_THET8/3-145--------------------------------------------------------------.LEF--------------
B8EN13_METSB/21-164--------------------------------------------------------------YLDF--------------
Q39833_SOYBN/90-233--------------------------------------------------------------TLDF--------------
E8RUB5_ASTEC/4-147--------------------------------------------------------------YLEF--------------
ACCA_TERTT/5-148--------------------------------------------------------------YLDF--------------
C6Y0P1_PEDHD/8-150--------------------------------------------------------------.FDF--------------
ACCA_CHLTR/3-146--------------------------------------------------------------LLPH--------------
ACCA_THICR/5-147--------------------------------------------------------------FLDF--------------
ACCA_ALKEH/5-148--------------------------------------------------------------FLDF--------------
ACCA_OCEIH/4-147--------------------------------------------------------------ILDF--------------
ACCA_WIGBR/5-149--------------------------------------------------------------FLDF--------------
Q1IN03_KORVE/6-146--------------------------------------------------------------..KA--------------
F4L135_HALH1/3-146--------------------------------------------------------------FLEF--------------
E1SU30_FERBD/5-150--------------------------------------------------------------FLEF--------------
E1X4H2_HALMS/9-151--------------------------------------------------------------TLEF--------------
F6DPP9_DESRL/2-145--------------------------------------------------------------ALDF--------------
K9SI36_9CYAN/7-154--------------------------------------------------------------LLDF--------------
D3PDG9_DEFDS/6-148--------------------------------------------------------------.LPF--------------
R6SFM1_9FIRM/263-401--------------------------------------------------------------...F--------------
D8TBU9_SELML/23-165--------------------------------------------------------------TLPF--------------
B4ETY2_PROMH/5-152--------------------------------------------------------------HLEF--------------
ACCA_THEYD/4-147--------------------------------------------------------------YLDF--------------
R5YCC5_9FIRM/275-410--------------------------------------------------------------MRST--------------
ACCA_RHILO/4-148--------------------------------------------------------------YLDF--------------
C0ZEF2_BREBN/2-145--------------------------------------------------------------SLDF--------------
C4L480_EXISA/3-141--------------------------------------------------------------....--------------
Q187P7_PEPD6/3-145--------------------------------------------------------------.ENN--------------
ACCA_AROAE/5-148--------------------------------------------------------------FLDF--------------
W8TMD3_EUBAC/5-147--------------------------------------------------------------.NEF--------------
R7I7W2_9BURK/5-149--------------------------------------------------------------FLDF--------------
C9RBG3_AMMDK/4-147--------------------------------------------------------------YLDF--------------
ACCA_ACTP2/5-149--------------------------------------------------------------YLDF--------------
W8EY50_9BACT/2-145--------------------------------------------------------------LLDF--------------
C8W257_DESAS/5-148--------------------------------------------------------------VLEF--------------
J9QYP7_RIEAN/3-148--------------------------------------------------------------YLDF--------------
ACCA_CAMJE/5-141--------------------------------------------------------------.LDF--------------
F0S695_PSESL/5-147--------------------------------------------------------------.FDF--------------
H2FXK3_OCESG/5-150--------------------------------------------------------------FLDF--------------
F0S0A5_DESTD/5-143--------------------------------------------------------------.FEF--------------
B3QS67_CHLT3/5-161--------------------------------------------------------------ILDF--------------
D7A5W6_STAND/4-148--------------------------------------------------------------YLDF--------------
F0LUJ9_VIBFN/5-151--------------------------------------------------------------FLEF--------------
ACCA_BACHD/5-147--------------------------------------------------------------.LDF--------------
R5EMT9_9GAMM/5-150--------------------------------------------------------------YLEF--------------
ACCA_PROA2/6-163--------------------------------------------------------------VLDF--------------
F0T0C4_SYNGF/2-144--------------------------------------------------------------.LEG--------------
H8GK81_METAL/5-148--------------------------------------------------------------FLDF--------------
D5WSS7_KYRT2/5-147--------------------------------------------------------------.LPF--------------
F6GHA4_LACS5/3-147--------------------------------------------------------------YLEF--------------
W8KT18_HALHR/5-148--------------------------------------------------------------FLEF--------------
ACCA_GEOMG/7-148--------------------------------------------------------------.LEF--------------
K9Z068_CYAAP/11-154--------------------------------------------------------------LLEF--------------
H1XP22_9BACT/9-151--------------------------------------------------------------ILEF--------------
H2IA21_FLACA/3-147--------------------------------------------------------------YLDF--------------
C8WRU9_ALIAD/5-147--------------------------------------------------------------.LDF--------------
F7XXZ5_MOREP/5-149--------------------------------------------------------------FLDF--------------
ACCA_BACSK/5-147--------------------------------------------------------------.QEF--------------
R5QM64_9PROT/6-149--------------------------------------------------------------YLDF--------------
B3ERA3_AMOA5/2-146--------------------------------------------------------------LLEF--------------
K4IV53_PSYTT/3-147--------------------------------------------------------------YLDF--------------
B2V9Z0_SULSY/2-143--------------------------------------------------------------..DI--------------
F5Y6P2_TREAZ/2-135--------------------------------------------------------------....--------------
ACCA_PARDP/3-147--------------------------------------------------------------YLEF--------------
ACCA_OLICO/8-150--------------------------------------------------------------YLDF--------------
D6Z010_DESAT/30-172--------------------------------------------------------------....--------------
ACCA_OCHA4/4-148--------------------------------------------------------------YLDF--------------
S0EW53_CHTCT/6-157--------------------------------------------------------------.LDF--------------
ACCA_COLP3/5-150--------------------------------------------------------------FLDF--------------
ACCA_ARCB4/5-141--------------------------------------------------------------.LEF--------------
ACCA_TOLAT/5-150--------------------------------------------------------------FLEF--------------
H6N9Y7_9BACL/6-147--------------------------------------------------------------..PF--------------
C7NC27_LEPBD/4-144--------------------------------------------------------------....--------------
ACCA_DEIRA/4-145--------------------------------------------------------------..TP--------------
R7GN66_9FIRM/3-139--------------------------------------------------------------LKEK--------------
G8R0N5_OWEHD/3-147--------------------------------------------------------------YLDF--------------
R5S9W6_9GAMM/4-147--------------------------------------------------------------VLDF--------------
R5RFQ5_9FIRM/9-143--------------------------------------------------------------....--------------
K0B3H8_CLOA9/4-147--------------------------------------------------------------SLDF--------------
E3HB41_ILYPC/2-143--------------------------------------------------------------..EF--------------
D6GQG0_FILAD/2-144--------------------------------------------------------------....--------------
K0P1U1_9BACT/2-146--------------------------------------------------------------LLDF--------------
F2J212_POLGS/4-148--------------------------------------------------------------YLEF--------------
U5QFX0_9CYAN/13-155--------------------------------------------------------------.IDF--------------
E8R5M4_ISOPI/5-159--------------------------------------------------------------.LPF--------------
R6J4C9_9PROT/8-151--------------------------------------------------------------VLDF--------------
S5RQ07_9PROT/5-148--------------------------------------------------------------FLNF--------------
ACCA_DICNV/5-148--------------------------------------------------------------YLDF--------------
ACCA_AQUAE/8-151--------------------------------------------------------------HLEF--------------
E8UCK2_TAYEM/5-148--------------------------------------------------------------FLEF--------------
B3DWQ6_METI4/5-148--------------------------------------------------------------YLDF--------------
B8DL69_DESVM/26-171--------------------------------------------------------------....--------------
C7R5W6_KANKD/5-148--------------------------------------------------------------FLDF--------------
I6ZWV1_MELRP/5-146--------------------------------------------------------------TLDF--------------
L0F5J8_DESDL/5-147--------------------------------------------------------------.FDF--------------
I0K7J9_9BACT/4-147--------------------------------------------------------------YLDF--------------
Q0BUI6_GRABC/12-154--------------------------------------------------------------FLEF--------------
U5LED4_9BACI/5-147--------------------------------------------------------------.LEF--------------
J7QSL5_METSZ/4-148--------------------------------------------------------------YLDF--------------
ACCA_BACAN/4-146--------------------------------------------------------------.LEF--------------
K4LJD9_9FIRM/2-144--------------------------------------------------------------.LER--------------
X2H0U8_9GAMM/4-150--------------------------------------------------------------FLEF--------------
ACCA_BAUCH/6-151--------------------------------------------------------------.IDF--------------
ACCA_STRMK/5-148--------------------------------------------------------------YLDF--------------
F8EKR1_RUNSL/4-147--------------------------------------------------------------YLDF--------------
G8T7C8_NIAKG/9-152--------------------------------------------------------------FLDF--------------
ACCA_CYAP4/9-152--------------------------------------------------------------LLEF--------------
ACCA_BEII9/4-148--------------------------------------------------------------YLDF--------------
J9Z203_9PROT/3-145--------------------------------------------------------------YLDF--------------
M1E6T6_9FIRM/9-151--------------------------------------------------------------YIDF--------------
ACCA_NITEU/5-148--------------------------------------------------------------FLDF--------------
C7RN27_ACCPU/5-148--------------------------------------------------------------FLDF--------------
F9ZM26_ACICS/5-145--------------------------------------------------------------YLDF--------------
K0C175_CYCSP/5-148--------------------------------------------------------------YLDF--------------
A5G4G6_GEOUR/6-148--------------------------------------------------------------YLEF--------------
E3F1D1_KETVY/3-147--------------------------------------------------------------YLDF--------------
Q3JCT5_NITOC/9-152--------------------------------------------------------------FLDF--------------
K9VDH0_9CYAN/10-153--------------------------------------------------------------LLDF--------------
ACCA_LISMO/5-147--------------------------------------------------------------.MEF--------------
A8FG56_BACP2/5-147--------------------------------------------------------------.LEF--------------
ACCA_RUTMC/5-145--------------------------------------------------------------YLDF--------------
Q2RXX2_RHORT/7-150--------------------------------------------------------------FLDF--------------
ACCA_PSEHT/5-150--------------------------------------------------------------YLDF--------------
E6W2T7_DESIS/5-148--------------------------------------------------------------ALEF--------------
D0MDD2_RHOM4/9-159--------------------------------------------------------------LLDF--------------
F8L7E7_SIMNZ/5-148--------------------------------------------------------------MLDH--------------
W0RIF3_9BACT/5-148--------------------------------------------------------------ALDF--------------
L0D934_SINAD/9-155--------------------------------------------------------------.LPF--------------
F2NQ24_MARHT/2-145--------------------------------------------------------------ALEF--------------
E6X0S5_NITSE/4-141--------------------------------------------------------------YLDF--------------
F4CCW2_SPHS2/4-147--------------------------------------------------------------TFDF--------------
D3ECM3_GEOS4/5-147--------------------------------------------------------------.LPF--------------
ACCA_SPHAL/4-147--------------------------------------------------------------FLDF--------------
Q0AMD1_MARMM/8-151--------------------------------------------------------------YLDF--------------
B3E7C0_GEOLS/6-146--------------------------------------------------------------YMEF--------------
Q1D555_MYXXD/8-151--------------------------------------------------------------VLEF--------------
ACCA_CHRSD/5-148--------------------------------------------------------------YLDF--------------
ACCA_EXIS2/3-143--------------------------------------------------------------..PF--------------
F8KZD1_PARAV/4-145--------------------------------------------------------------.LPH--------------
ACCA_FUSNN/2-143--------------------------------------------------------------..QF--------------
S6B4Y6_9PROT/5-148--------------------------------------------------------------FLDF--------------
B4U9A1_HYDS0/4-142--------------------------------------------------------------....--------------
ACCA_CHESB/4-148--------------------------------------------------------------YLDF--------------
A1AQQ7_PELPD/6-148--------------------------------------------------------------NLEF--------------
F8JC16_HYPSM/32-176--------------------------------------------------------------YLDF--------------
B9E7A5_MACCJ/2-145--------------------------------------------------------------VLDF--------------
D4H0L9_DENA2/5-148--------------------------------------------------------------TLDF--------------
F0SFK4_RUBBR/6-146--------------------------------------------------------------.LPF--------------
ACCA_SPHWW/4-147--------------------------------------------------------------YLEF--------------
F6CQZ6_DESK7/2-145--------------------------------------------------------------VYDF--------------
E8T4K6_THEA1/5-143--------------------------------------------------------------.YEF--------------
R5K1S9_9CLOT/3-142--------------------------------------------------------------.REI--------------
I4D4N6_DESAJ/5-147--------------------------------------------------------------.FDF--------------
D6YRI8_WADCW/23-165--------------------------------------------------------------ILPH--------------

PF01039

PCCB_SACEN/46-544---------------------------------------KQHAKGKRTARERIDMLLDEGS.FVELDEHARHRSTNFGM.
ACACB_HUMAN/1780-2334---------------------------------------QEYPEGRDVIVIGNDITFRIGS.FGPGEDLLYLRASEMAR.
PCCB_BACSU/26-505---------------------------------------QQRQKGKLTARERIIFLLDQDS.FIELHPFMESQVLTREQ.
YNGE_BACSU/27-509---------------------------------------SNREKGKLFVRERLSLLFDDDI...ELEDAFFAECMSDG..
ACACA_HUMAN/1669-2223---------------------------------------PEYPEGRDIIVIGNDITYRIGS.FGPQEDLLFLRASELAR.
PCCB_HUMAN/57-537---------------------------------------AQHKRGKLTARERISLLLDPGS.FVESDMFVEHRCADFGMA
Q9ZCU2_RICPR/30-512---------------------------------------AQHQKGKLTARERIEVLLDPNS.FTETGMFVSHRCDNFGMQ
ACC1_ARATH/1587-2139---------------------------------------PEFPMGRKLLVIANDVTFKAGS.FGPREDAFFLAVTELAC.
HFA1_YEAST/1619-2176---------------------------------------PEYPEGRNMIVISNDITYNIGS.FGPREDLFFDRVTNYAR.
O28066_ARCFU/27-514---------------------------------------RQHEQGKLTARERIELLLDPGS.FVEINPFVEKRNTDFGL.
O86318_MYCTU/45-527---------------------------------------RHHARGNLTPRERIELLVDPDSPFLELSPLAAY...GSNF.
Q20676_CAEEL/55-534---------------------------------------AQHARGKLTARERIDLLLDRNT.FREYDMFAEHTCNDFGMQ
O86517_STRCO/39-525---------------------------------------AQHAKGKLTARERIELLLDPGS.FREVEQLRRHRATGFGLE
PCCB_MYCLE/50-547---------------------------------------KVHAKGKFTARERIYALLDDDS.FVELDALARHRSTNFGLG
ACAC_YEAST/1574-2130---------------------------------------PEYPRGRQFVVVANDITFKIGS.FGPQEDEFFNKVTEYAR.
MCCB_ARATH/93-585---------------------------------------RNRSRNKLLPRERIDRLLDPGSSFLELSQLAGHELYEEPL.
ACAC_SCHPO/1615-2170---------------------------------------PEYPNGRKIIVVANDITFQIGS.FGPQEDEYFYKVTQLAR.
MCCB_CAEEL/119-606---------------------------------------LHRSRGKMLARERIDGIVDAGSPFIEFSQLAGYEMYGKEE.
GCDA_ACIFV/54-573---------------------------------------DVNKRGELTALQRIEKLVEPGS.WRPLNTLFNPQGNKNG..
B5YMF5_THAPS/1470-2012---------------------------------------PEYPEGREVVFISNDITVQSGS.FGVAEDEVFFKASKYAR.
D1BNG7_VEIPT/29-507---------------------------------------KQHAQGKMTARERLAKLFDDNS.FVELDQFVKHRCVNFGQ.
D7GFR7_PROFC/38-518---------------------------------------KQHSQGKQTARERLNNLLDPHS.FDEVGAFRKHRTTLFGM.
G5EAT9_EMENI/1606-2161---------------------------------------PEYPEGRRFIIVANDITFQIGS.FGPLEDKFFHKCTELAR.
M0WLS8_HORVD/1642-2195---------------------------------------PEYPNGRQIVVIANDITFRAGS.FGPREDAFFETVTNLAC.
ACCD_MYCTU/14-479---------------------------------------..LDRGSFVSWDSEPLAVPVAD...SYARELAAARAATG..
Q1DDA0_MYXXD/32-518---------------------------------------KQHESGKLTARERIDLLLDPGS.FCELDKFVTHRSSEFGMG
A0A0D1DYD5_USTMA/1546-2102---------------------------------------PEYPAGRKLVVIGNDVTIQAGS.FGPVEDRFFAAASKLAR.
Q8NSG7_CORGL/44-541---------------------------------------KVHAAGRLTARERLDYLLDEGS.FIETDQLARHRTTAFGL.
Q8NSG8_CORGL/38-535---------------------------------------KVHAAGRKTARERIEYLLDEGS.FVEIDALARHRSKNFGL.
Q8U305_PYRFU/28-520---------------------------------------KQHDKGKLTARERIELLLDPGS.FVEIGMFVKHRATEFGM.

PF06833

Q8P4U4_XANCP/5-230---------------------------------------------------------ALFDQLFPL--------------
Q89XP1_BRADU/5-233---------------------------------------------------------DIIASLFPD--------------
Q9I6S6_PSEAE/11-268---------------------------------------------------------AWFQALAGS--------------
Q89UY5_BRADU/5-233---------------------------------------------------------DILAGLFPN--------------
Q87V58_PSESM/9-266---------------------------------------------------------NWFNALSAD--------------
A6T8S0_KLEP7/11-266---------------------------------------------------------.WLNKLAPD--------------

PF03572

Q8CVF0_LEPIN/340-512-----------------------------------------------------------HIGYIKLTGFVKSEE......
CTPA_SYNP2/215-376-----------------------------------------------------------KVGYIRLNQF..SA.......
Q81R25_BACAN/181-400-----------------------------------------------------------DTLLITLTDFANIE.......
Q7UUN0_RHOBA/410-573-----------------------------------------------------------KIGYFRLTNF..QK.......
Q8Y2I4_RALSO/213-395-----------------------------------------------------------GIAWVRITSF..QE.......
Q8DII0_THEEB/215-376-----------------------------------------------------------TVGYIRLSQF..SA.......
Q8R712_CALS4/193-353-----------------------------------------------------------GIGYIKITEF..NE.......
Q87YB6_PSESM/365-539-----------------------------------------------------------KLGVIDIPAFYLDFKAYRA..
TRI_SULSO/887-1042-----------------------------------------------------------RLGYIHIPDM...........
Q7VMG7_HAEDU/365-546-----------------------------------------------------------NIAVIKIPAFYIGL.......
Q8R7P6_CALS4/299-499-----------------------------------------------------------KVAYLKIPEM....KMSQ...
Q8A406_BACTN/202-362-----------------------------------------------------------KVGYISLSTF..SG.......
Q7NKF3_GLOVI/143-304-----------------------------------------------------------GIAQVQLASI....G......
TRI_THEAC/878-1033-----------------------------------------------------------TIGYIHIPDM...........
O83301_TREPA/167-332-----------------------------------------------------------NIAYVRLIEF..NP.......
Q7TUF4_PROMP/222-383-----------------------------------------------------------TIGYLRITQF..SE.......
Q8R6Q0_CALS4/169-397-----------------------------------------------------------KVAYLKVYSF...LIDRHK..
Q87PB1_VIBPA/356-526-----------------------------------------------------------KIGVLEVPSFYVGL.......
Q8EDY9_SHEON/364-534-----------------------------------------------------------KVGVIQIPGFYMNL.......
Q97LQ5_CLOAB/210-372-----------------------------------------------------------EIGYMQVSMF..DE.......
O66985_AQUAE/192-355-----------------------------------------------------------GIGYIKISQF..TS.......
Q9RU43_DEIRA/206-370-----------------------------------------------------------NIGYVALNTFYNEQ.......
P73458_SYNY3/220-381-----------------------------------------------------------RVGYIRLNQF..SA.......
Q7UNS4_RHOBA/218-383-----------------------------------------------------------DIVYVRMTSF..GD.......
Q9RUS4_DEIRA/235-411-----------------------------------------------------------DVALIRIPTF...........
Q894Q8_CLOTE/197-416-----------------------------------------------------------DTAYIKINNF....YHY....
Q82BY0_STRAW/878-1033-----------------------------------------------------------RLGYLHVPDM...........
Q8YRM4_NOSS1/218-379-----------------------------------------------------------SFGYLRLTQF..NA.......
Q8CVF1_LEPIN/197-364-----------------------------------------------------------KLGYIKLNQFMGKE.......
Q8A5K0_BACTN/312-500-----------------------------------------------------------KIGYLVYSAF....E......
Q89KT1_BRADU/201-369-----------------------------------------------------------DIGYIRVTSF..NE.......
Q8ENJ3_OCEIH/223-384-----------------------------------------------------------LTGIIEITNF..SE.......
Q8XNN1_CLOPE/231-397-----------------------------------------------------------DIGYIEVLAF..DE.......
Q8P5D2_XANCP/126-301-----------------------------------------------------------DVGYVAVPGL....MTSS...
PRC_HAEIN/363-533-----------------------------------------------------------NIAVIKIPSFYIGL.......
Q8Y649_LISMO/229-395-----------------------------------------------------------KIAHVTISTF..SE.......
P75023_SYNY3/244-405-----------------------------------------------------------RVGYIRLDEF..SS.......
Q9A2X1_CAUCR/195-362-----------------------------------------------------------DYGYVRLPGF..NE.......
Q8R7P7_CALS4/191-422-----------------------------------------------------------KIAYLRVNSF...LIDKDQ..
Y858_CHLTR/316-560-----------------------------------------------------------KVGFLRIPTY.SWQDMEDF..
Q8KAA8_CHLTE/214-383-----------------------------------------------------------SSGYVQMNSF..SE.......
Q8ZXG0_PYRAE/836-991-----------------------------------------------------------AVGYIHIPDM...........
Q7VFQ7_HELHP/223-383-----------------------------------------------------------DFAYVRVASF..DK.......
Q8A3B9_BACTN/191-351-----------------------------------------------------------KIGYIRINRF..GA.......
Q7VBS8_PROMA/229-390-----------------------------------------------------------HFGYIRLKQF..SA.......
CTPA2_ARATH/320-483-----------------------------------------------------------KIGYIKLTTF..NQ.......
Q815H1_BACCR/212-374-----------------------------------------------------------DIGYMQITSF..AE.......
Q87UG9_PSESM/211-377-----------------------------------------------------------GYGYIRITQF..QV.......
Q7V214_PROMP/205-366-----------------------------------------------------------LIGYVRLKQF..NA.......
Q7NPI8_GLOVI/227-389-----------------------------------------------------------PIGYIRLSQF..NG.......
Q82H90_STRAW/894-1049-----------------------------------------------------------HCGYLHIPDM...........
Q9AAF2_CAUCR/247-457-----------------------------------------------------------DAAILTMPTW....GLY....
Q87Q24_VIBPA/260-446-----------------------------------------------------------KVGYLQYNSF....E......
RET3_HUMAN/438-617-----------------------------------------------------------NVGYLRFDSF....ADAS...
Q7UJ42_RHOBA/384-569-----------------------------------------------------------KLGYINLPSFYMDMEAARR..
Q8R7Q0_CALS4/178-406-----------------------------------------------------------KIAYLKIYSF...LIDYHK..
Q8R8M1_CALS4/207-366-----------------------------------------------------------KIGYIKITLF..DQ.......
Q8YPV0_NOSS1/193-349-----------------------------------------------------------KIGYVHIWSN...........
PRC_ECOLI/356-530-----------------------------------------------------------KVGVLDIPGFYVGL.......
Q892K7_CLOTE/192-411-----------------------------------------------------------DTCYVKIHTF....NHD....
Q834H3_ENTFA/208-374-----------------------------------------------------------QIGSIKITSF..GK.......
Q89X80_BRADU/202-369-----------------------------------------------------------DIAYIRITTF..NE.......
Q8DGJ2_THEEB/238-398-----------------------------------------------------------RVGYIRLSGF..NS.......
Q9CP01_PASMU/362-532-----------------------------------------------------------IVASIKIPSFYIGL.......
Q896W4_CLOTE/217-379-----------------------------------------------------------NIGYVHIKSF..GN.......
Q7MSB3_WOLSU/198-359-----------------------------------------------------------EMLYVRVTSF..DK.......
Q9WZK6_THEMA/203-364-----------------------------------------------------------SIGYVRITRF..GE.......
Q8YW78_NOSS1/226-387-----------------------------------------------------------RVGYIRLREF..SA.......
Q83BH0_COXBU/210-383-----------------------------------------------------------GYGYVRITFF..QG.......
Q7NSR6_CHRVO/194-376-----------------------------------------------------------GYGYVRIAQF..QE.......
Q9RUA1_DEIRA/235-408-----------------------------------------------------------RVAVIDLPSF...........
Q9A6Q6_CAUCR/254-429-----------------------------------------------------------DVGYLNVLTM..GAFARNA..
Q7MTT6_PORGI/195-361-----------------------------------------------------------SIAYVRIDSW..TG.......
Q9L1S8_STRCO/194-352-----------------------------------------------------------GLTVVKVTSF..TK.......
Q82PY7_STRAW/269-453-----------------------------------------------------------GTGYLRVSGF....GGYDG..
Q7MXF8_PORGI/163-329-----------------------------------------------------------RTGYIRLSRF..SR.......
Q8KDJ6_CHLTE/340-525-----------------------------------------------------------KIGVIVLPSFYLDFEGERQ..
Q8A1T1_BACTN/145-316-----------------------------------------------------------NIGYIRYESF....S......
Q7NGR6_GLOVI/216-377-----------------------------------------------------------RVGYIRLSQF..NA.......
Q8R640_FUSNN/203-364-----------------------------------------------------------GIGYLRLTQF..GD.......
Q82TT8_NITEU/202-384-----------------------------------------------------------GYAYVRITQF..QE.......
Q7NL17_GLOVI/226-387-----------------------------------------------------------KLGYIQLQQF..NA.......
Q8DZX2_STRA5/125-302-----------------------------------------------------------DILLITIPSI....S......
CTPA_SYNY3/218-379-----------------------------------------------------------SVGYIRLSQF..SA.......
O25905_HELPY/210-371-----------------------------------------------------------PYLYVRVSGF..DK.......
Q7U4U5_SYNPX/228-389-----------------------------------------------------------TLGYLRITQF..TD.......
Q7MUB1_PORGI/151-321-----------------------------------------------------------SIGYIVYESF....G......
CTPB_BACSU/213-375-----------------------------------------------------------SVGYIAISTF..SE.......
O84448_CHLTR/354-525-----------------------------------------------------------IIGKITLHSFYEGEN......
Q8DJ23_THEEB/220-381-----------------------------------------------------------PVGYIRLVTF..SS.......
Q8A7W6_BACTN/916-1071-----------------------------------------------------------RLGYVHIQSM...........
Q9KNC0_VIBCH/209-365-----------------------------------------------------------RLGYVHLAAM...........
Q7U711_SYNPX/231-392-----------------------------------------------------------KIGYIRLKQF..NA.......
Q8YU55_NOSS1/219-380-----------------------------------------------------------KVGYIRLNQF..SA.......
Q8KD83_CHLTE/187-349-----------------------------------------------------------RTGYIRISQF..VE.......
Q8EBT8_SHEON/888-1043-----------------------------------------------------------KIGYLHLYAM...........
Q7VS41_BORPE/198-377-----------------------------------------------------------NVAYLRIAQF..QE.......
CTPA_BACSU/201-363-----------------------------------------------------------NIGEIQITSF..SE.......
TRIC_SULTO/669-824-----------------------------------------------------------KLGYVHIPDM...........
Q9K6X5_BACHD/210-372-----------------------------------------------------------TIGMLEITSF..SE.......
Q7MVK0_PORGI/205-366-----------------------------------------------------------SIGYIRLNNF..TD.......
Q8P3J7_XANCP/253-471-----------------------------------------------------------RLAILRMPDW....ALY....
Q89ZW2_BACTN/204-370-----------------------------------------------------------DIGYVKVSKF..GR.......
Q8EKP4_SHEON/197-361-----------------------------------------------------------NIGYVRLSSF..QE.......
Q7TUQ0_PROMM/225-386-----------------------------------------------------------TLGYLRITQF..SE.......
Q890X6_CLOTE/207-369-----------------------------------------------------------DVALVQVTMF..DE.......
Q7NPD6_GLOVI/225-386-----------------------------------------------------------KVGYIRLAEF..SE.......
B2J2K4_NOSP7/217-378-----------------------------------------------------------KIGYIRLPEF..TQ.......
CTPA3_ARATH/310-472-----------------------------------------------------------KTGYVKLTAF..SQ.......
CTPA1_ARATH/307-467-----------------------------------------------------------.VGYIRLKEF..NA.......
G3WSG1_SARHA/36-212-----------------------------------------------------------NVGYLRVDYI.PGRDM.....
M0ZTS1_SOLTU/116-276-----------------------------------------------------------.VGYVRLKEF..NA.......
M3WLH1_FELCA/129-305-----------------------------------------------------------NVGYLRVDDI.PSQEV.....
Q1D0E2_MYXXD/209-374-----------------------------------------------------------.IGHVKVKNF..QD.......
Q2YLJ3_BRUA2/181-348-----------------------------------------------------------DVGYLRIISF..TE.......
CTPAL_STAEQ/226-389-----------------------------------------------------------NVGVLTINKF..QS.......
Q9PA16_XYLFA/231-394-----------------------------------------------------------.YGYIRISVF..QA.......
Q9PCF8_XYLFA/366-548-----------------------------------------------------------RIGIIKLPTF..YEDFEGRRR
Q9ZDU6_RICPR/189-355-----------------------------------------------------------NIAYIRITTF..NE.......

PF01972

Y137_METJA/3-286-------------------------------------------------------------------------IEDSEEI
Y1495_METJA/9-292-------------------------------------------------------------------------IEDSEEI
O29403_ARCFU/7-290-------------------------------------------------------------------------IDDSEKV
O66996_AQUAE/1-288-------------------------------------------------------------------------IEDSERV

PF00574

Q7XBR2_ORYSJ/73-254-------------------------------------------------------------------------DAVVS.Q
CLPP2_BORBU/6-189-------------------------------------------------------------------------RLFQE.K
CLPP1_BORBU/13-194-------------------------------------------------------------------------DTVIA.Q
CLPP1_CAEEL/34-215-------------------------------------------------------------------------SALIA.Q
CLPP4_ARATH/74-253-------------------------------------------------------------------------DAIMS.Q
CLPP1_CHLTR/3-189-------------------------------------------------------------------------TEAIK.K
Q9CFR9_LACLA/7-176-------------------------------------------------------------------------.......
CLPP1_PSEAE/28-209-------------------------------------------------------------------------NLVVA.Q
CLPP2_RHIME/20-201-------------------------------------------------------------------------TLVCA.Q
CLPP2_BACHD/13-194-------------------------------------------------------------------------NSIVA.Q
CLPP_CAUCR/20-201-------------------------------------------------------------------------SLICA.Q
CLPP5_ARATH/107-288-------------------------------------------------------------------------NIIVA.Q
CLPP_MOUSE/63-244-------------------------------------------------------------------------SLVIA.Q
CLPP_CALS4/12-193-------------------------------------------------------------------------SLVIA.Q
O97252_PLAF7/180-359-------------------------------------------------------------------------DELIS.Q
CLPP1_AGRFC/16-197-------------------------------------------------------------------------ALVCA.Q
CLPP_XYLFA/19-200-------------------------------------------------------------------------NLIVA.Q
Q42886_SOLLC/95-274-------------------------------------------------------------------------QKVIS.Q
CLPP1_TREPA/17-198-------------------------------------------------------------------------DLVVA.Q
CLPP2_MYCLE/27-207-------------------------------------------------------------------------NDIMA.Q
CLPP_DEIRA/15-196-------------------------------------------------------------------------NSIVA.Q
CLPP1_BACHD/12-193-------------------------------------------------------------------------NSIVA.Q
CLPP_THEMA/21-202-------------------------------------------------------------------------NLVIA.Q
CLPP2_TREPA/15-193-------------------------------------------------------------------------EGIVR.Q
CLPP_CHLTE/37-218-------------------------------------------------------------------------GLIIA.Q
TEPA_BACHD/48-232-------------------------------------------------------------------------EHIIP.Q
CLPP3_NOSS1/13-196-------------------------------------------------------------------------NQIIA.V
CLPP3_AGRFC/23-198-------------------------------------------------------------------------QKVCT.Q
CLPP1_RHILO/16-197-------------------------------------------------------------------------ALVCA.Q
CLPP1_SYNE7/10-191-------------------------------------------------------------------------NRIVA.Q
CLPP_CLOPE/13-194-------------------------------------------------------------------------NLVVA.Q
CLPP_RICPR/12-193-------------------------------------------------------------------------NLIVA.Q
CLPP2_CORGL/13-195-------------------------------------------------------------------------NKLCA.Q
CLPP1_CORGL/24-204-------------------------------------------------------------------------NDIMA.Q
CLPP5_STRCO/18-201-------------------------------------------------------------------------NDVTA.Q
CLPP_CLOAB/12-193-------------------------------------------------------------------------SLVVA.Q
CLPP_HAEIN/12-193-------------------------------------------------------------------------NLIVA.Q
CLPP_CHLRE/310-482-------------------------------------------------------------------------ERVI...
CLPP1_STRCO/32-208-------------------------------------------------------------------------NKITA.Q
CLPR2_ARATH/79-263-------------------------------------------------------------------------NQILA.T
CLPP3_SYNY3/13-197-------------------------------------------------------------------------NRIVA.F
CLPP4_STRCO/14-196-------------------------------------------------------------------------NVVIA.Q
CLPP2_PSEAE/13-193-------------------------------------------------------------------------KDVVQ.Q
CLPP_WHEAT/13-197-------------------------------------------------------------------------NHITG.L
CLPP2_STRCO/28-210-------------------------------------------------------------------------NDVMA.Q
CLPP_AQUAE/19-200-------------------------------------------------------------------------NLIVA.Q
CLPP3_SYNE7/13-197-------------------------------------------------------------------------NSIVA.Q
CLPP1_NOSS1/11-192-------------------------------------------------------------------------NLIVA.Q
CLPP2_ARATH/41-222-------------------------------------------------------------------------HVVVA.Q
CLPP_RALSO/34-215-------------------------------------------------------------------------NLVVA.Q
CLPP2_SYNY3/32-213-------------------------------------------------------------------------DSIVA.Q
Q8ZQG9_SALTY/47-225-------------------------------------------------------------------------AHWFAEE
CLPP_CAMJE/11-192-------------------------------------------------------------------------ASIVA.Q
CLPP2_MYXXD/11-192-------------------------------------------------------------------------NIIVA.Q
Q9VKY3_DROME/38-219-------------------------------------------------------------------------STVVA.Q
F2YGL7_CHLVA/18-193-------------------------------------------------------------------------NQLIG.I
G8AKT8_AZOBR/21-200-------------------------------------------------------------------------SLICS.Q
M4CIZ3_BRARP/88-261-------------------------------------------------------------------------DLVIS.Q
CLPP1_MYCTU/18-192-------------------------------------------------------------------------NRLCA.Q
CLPP_STAA8/13-191-------------------------------------------------------------------------NSIVS.Q
CLPP_BRUA2/21-200-------------------------------------------------------------------------MLVCA.Q
CLPP_NEIG1/17-198-------------------------------------------------------------------------NLVVA.Q
CLPP_STRT2/10-192-------------------------------------------------------------------------NSIIA.Q
CLPP1_BACAN/14-192-------------------------------------------------------------------------SSVVA.Q
Q8Y7Y1_LISMO/12-186-------------------------------------------------------------------------EDVSK.Q
CLPP_LISMO/12-192-------------------------------------------------------------------------NSIVS.Q
W8JRT3_9CHLA/15-194-------------------------------------------------------------------------NTVIA.Q
W8UFH3_YEREN/25-205-------------------------------------------------------------------------NLITA.Q

PF00378

ECI1_MOUSE/39-287-------------------------------------------------------------------------LECLTEF
MENB_BACSU/16-271-------------------------------------------------------------------------PKTVAEM
PKSH_BACSU/12-259-------------------------------------------------------------------------DTLIEEC
PKSI_BACSU/10-249-------------------------------------------------------------------------QELTDDL
CAID_ECOLI/8-261-------------------------------------------------------------------------AKTSFEM
ECI1_HUMAN/52-302-------------------------------------------------------------------------LEFLTEL
ECHM_HUMAN/42-290-------------------------------------------------------------------------DGLIDEL
ECHM_CAEEL/40-288-------------------------------------------------------------------------AQLMTEL
ECHH_RHOCB/9-257-------------------------------------------------------------------------AAMRHEL

PF01343

Y651_METJA/110-263--------------------------------------------------------------------------------
SOHB_HAEIN/163-314--------------------------------------------------------------------------------
O26897_METTH/96-249--------------------------------------------------------------------------------
SPPA_HAEIN/387-539--------------------------------------------------------------------------------
SPPA_SYNY3/126-282--------------------------------------------------------------------------------
SPPA_BACSU/129-283--------------------------------------------------------------------------------
P95072_MYCTU/128-283--------------------------------------------------------------------------------
SPPA_ECOLI/140-296--------------------------------------------------------------------------------
SPPA_SYNY3/383-536--------------------------------------------------------------------------------
SPPA_ECOLI/391-543--------------------------------------------------------------------------------
P95072_MYCTU/402-555--------------------------------------------------------------------------------
SCAF_LAMBD/148-300--------------------------------------------------------------------------------
Y021_SYNY3/67-220--------------------------------------------------------------------------------
O25976_HELPY/103-256--------------------------------------------------------------------------------
SPPA_HAEIN/132-288--------------------------------------------------------------------------------
SOHB_ECOLI/161-310--------------------------------------------------------------------------------
Q0PC65_CAMJE/102-253--------------------------------------------------------------------------------

PF16113

D7SLU2_VITVI/50-384-------------------------------------------------------------------------TSMGARL
F6I042_VITVI/68-402-------------------------------------------------------------------------TPMGVRL
HIBCH_CHICK/45-375-------------------------------------------------------------------------FKMIQQI
HIBCH_SCHPO/66-398-------------------------------------------------------------------------VDMIDSI
Q488V8_COLP3/18-356-------------------------------------------------------------------------LEMIDLM
C4KDL8_THASP/20-344-------------------------------------------------------------------------LATVRAL
A5FW64_ACICJ/17-342-------------------------------------------------------------------------HDMEVAI
F5Z7N6_ALTSS/21-362-------------------------------------------------------------------------LEMASLL
Q8I523_PLAF7/190-524-------------------------------------------------------------------------KDMINAL
E3FSI9_STIAD/13-346-------------------------------------------------------------------------LGMIRRI
F0ZTV2_DICPU/166-501-------------------------------------------------------------------------LSTLTSI
G5BGL1_HETGA/35-365-------------------------------------------------------------------------LHMIRQI
B6HLY2_PENCW/44-388-------------------------------------------------------------------------GSMARKI
Q1LLS5_RALME/36-367-------------------------------------------------------------------------LEMIRAI
F7QLT9_9BRAD/23-350-------------------------------------------------------------------------LDMTREI
Q21WJ0_RHOFT/28-365-------------------------------------------------------------------------LPMIRAL
A0A016PD16_GIBZA/69-413-------------------------------------------------------------------------SSMIRKM
I1G4V7_AMPQE/50-378-------------------------------------------------------------------------GNMIDLL
F6HIV7_VITVI/22-356-------------------------------------------------------------------------YEMISQI
Q8ES26_OCEIH/14-345-------------------------------------------------------------------------QRMIELI
A7INC3_XANP2/15-342-------------------------------------------------------------------------LAMVREI
F4PNE6_DICFS/76-406-------------------------------------------------------------------------TDIFVGL
I1BHM9_RHIO9/79-409-------------------------------------------------------------------------LPMVRSI
C8X9E6_NAKMY/35-349-------------------------------------------------------------------------LPMIDGI
I1KQ42_SOYBN/46-396-------------------------------------------------------------------------LDMDVKY
Q13IB6_BURXL/22-355-------------------------------------------------------------------------HAMVLAL
E9SYN2_RHOHA/17-337-------------------------------------------------------------------------HAMVRSM
G2NK33_STREK/15-339-------------------------------------------------------------------------HTMVRSI
D7SV41_VITVI/52-386-------------------------------------------------------------------------IPMVARL
G7UPF5_PSEUP/25-367-------------------------------------------------------------------------LEMTRLL
A8LME8_DINSH/12-333-------------------------------------------------------------------------YEMCLAI
B2W7S4_PYRTR/68-416-------------------------------------------------------------------------GSMARKI
B2IFQ5_BEII9/17-341-------------------------------------------------------------------------GPMVLAI
E4XNE1_OIKDI/19-346-------------------------------------------------------------------------HPIVKMM
A1SIK1_NOCSJ/14-329-------------------------------------------------------------------------LEMVTSM
B0UJ66_METS4/21-343-------------------------------------------------------------------------LGMVRRL
D3PW51_STANL/21-338-------------------------------------------------------------------------HAMIAAM
Q084X0_SHEFN/18-357-------------------------------------------------------------------------LDMVAAM
B2JKB1_BURP8/21-360-------------------------------------------------------------------------LDMMRAM
G2J3D7_PSEUL/18-358-------------------------------------------------------------------------LDMIRLL
F4RGZ4_MELLP/11-358-------------------------------------------------------------------------PQMLVSM
Q0C3Q9_HYPNA/20-349-------------------------------------------------------------------------TPMCAEI
F8J779_HYPSM/27-350-------------------------------------------------------------------------NEMCRAL
Q2SP84_HAHCH/24-363-------------------------------------------------------------------------LSMIESM
E1VLZ8_9GAMM/17-356-------------------------------------------------------------------------AEMVGLL
D2V7D6_NAEGR/73-426-------------------------------------------------------------------------LSMIRSL
Q12MV4_SHEDO/18-360-------------------------------------------------------------------------IDMVQAM
F5YTZ4_MYCSD/16-336-------------------------------------------------------------------------LPMVTAM
Q5WH10_BACSK/10-343-------------------------------------------------------------------------YDMVSGM
B8ESI3_METSB/13-334-------------------------------------------------------------------------IGMAQAI
B9IB41_POPTR/22-356-------------------------------------------------------------------------HQMVSRL
F0ZLP9_DICPU/30-365-------------------------------------------------------------------------PGMVKLL
H2ZC72_CIOSA/54-386-------------------------------------------------------------------------LNMIKKI
Q2W460_MAGSA/13-341-------------------------------------------------------------------------ARQYHDI
B1LX53_METRJ/12-337-------------------------------------------------------------------------HGMVGEI
D5GGY6_TUBMM/44-383-------------------------------------------------------------------------GSMARKI
A4SZ56_POLSQ/13-344-------------------------------------------------------------------------YSMIKLL
E9T596_RHOHA/14-336-------------------------------------------------------------------------GSMIRDM
F4CYK1_PSEUX/14-333-------------------------------------------------------------------------HEMVRLL
Q5ZX62_LEGPH/13-340-------------------------------------------------------------------------LTMIMAL
B9RD44_RICCO/57-391-------------------------------------------------------------------------TNMGARL
G0RME1_HYPJQ/43-386-------------------------------------------------------------------------GSMIRKI
A9WQX7_RENSM/20-336-------------------------------------------------------------------------VAMTEAM
H1VE28_COLHI/45-366-------------------------------------------------------------------------ASMIRKI
G2IVT0_PSEUL/18-359-------------------------------------------------------------------------LGMIRLL
E2BCN8_HARSA/46-370-------------------------------------------------------------------------LSMIKKI
C6W855_ACTMD/12-334-------------------------------------------------------------------------RGMVVEI
A0A088AET4_APIME/95-420-------------------------------------------------------------------------LSMVEKI
Q143S2_BURXL/33-374-------------------------------------------------------------------------HLMVRDL
F4S4Z1_MELLP/87-423-------------------------------------------------------------------------AEMIETI
B9J934_AGRRK/15-342-------------------------------------------------------------------------LPMIRAI
F4Q929_DICFS/53-395-------------------------------------------------------------------------LEMINHL
Q381D8_TRYB2/20-346-------------------------------------------------------------------------LEMVREM
A1BAK1_PARDP/12-321-------------------------------------------------------------------------HEMALAI
G3WP62_SARHA/46-376-------------------------------------------------------------------------LSMIRRI
B2IDI2_BEII9/14-338-------------------------------------------------------------------------TETILVF
I1MM39_SOYBN/20-357-------------------------------------------------------------------------FYMVSRL
F6EFK8_AMYSD/12-332-------------------------------------------------------------------------HDMVRDL
Q212Q2_RHOPB/18-345-------------------------------------------------------------------------LEMARGI
G8MC08_9BURK/24-360-------------------------------------------------------------------------HDMIALL
A0JS02_ARTS2/30-352-------------------------------------------------------------------------AGMAAAM
A8HXV6_AZOC5/51-378-------------------------------------------------------------------------HAMVQAI
HIBC8_ARATH/21-353-------------------------------------------------------------------------PEVVFKL
B6Q688_PENMQ/41-385-------------------------------------------------------------------------GSMCQQI
A0C505_PARTE/18-343-------------------------------------------------------------------------LEMCEDI
C1DFA4_AZOVD/17-349-------------------------------------------------------------------------LPVVCAL
G7Z662_AZOL4/15-341-------------------------------------------------------------------------LGMIRLF
Q5QW21_IDILO/17-357-------------------------------------------------------------------------LAMAEKL
C1DNT4_AZOVD/14-346-------------------------------------------------------------------------LPMVRLL
Q230X4_TETTS/30-358-------------------------------------------------------------------------LAMIRQI
B9SXD3_RICCO/47-382-------------------------------------------------------------------------TPMGVRL
Q5LRB7_RUEPO/12-333-------------------------------------------------------------------------YDMCMAI
D6X3R7_TRICA/42-364-------------------------------------------------------------------------LSMVNKL
A1R246_ARTAT/18-336-------------------------------------------------------------------------AGMVKTM
D3BN96_POLPA/192-532-------------------------------------------------------------------------ISTIDLL
B9SKJ5_RICCO/22-357-------------------------------------------------------------------------FKMISRL
B7G076_PHATC/15-365-------------------------------------------------------------------------LDMMHFF
F4F5N6_VERMA/14-334-------------------------------------------------------------------------AEMVTII
A9PBA7_POPTR/21-353-------------------------------------------------------------------------SKVVSLL
G6DDP6_DANPL/16-332-------------------------------------------------------------------------TSMVSKL
F8AY96_FRADG/12-334-------------------------------------------------------------------------HGMLRRI
H6N4E1_GORPV/12-333-------------------------------------------------------------------------QSMVDDM
E0VLB5_PEDHC/53-383-------------------------------------------------------------------------LCMVCQI
Q0A896_ALKEH/22-361-------------------------------------------------------------------------LGMIQAL
D8SM52_SELML/13-356-------------------------------------------------------------------------LDMDVAY
D7AAE9_STAND/32-359-------------------------------------------------------------------------HAMVRAM
D7MNH9_ARALL/19-353-------------------------------------------------------------------------FQMISRL
E3I3E7_RHOVT/14-335-------------------------------------------------------------------------WAMALRI
D0J4R8_COMT2/40-371-------------------------------------------------------------------------LGMVRDL
D5QAS0_KOMHA/14-335-------------------------------------------------------------------------IGMIEAI
F4NRB7_BATDJ/54-395-------------------------------------------------------------------------LDMVYAI
G3QQM4_GORGO/20-355-------------------------------------------------------------------------LNMIRQI
A1K1H9_AZOSB/18-358-------------------------------------------------------------------------LEMIDLL
Q0IP17_ORYSJ/128-462-------------------------------------------------------------------------SAMITCF
A1TSJ8_ACIAC/16-348-------------------------------------------------------------------------LGMVRDL
HIBCH_DICDI/33-370-------------------------------------------------------------------------PNMVKIL
I1BZ13_RHIO9/189-518-------------------------------------------------------------------------LSMVQMM
A9SUT7_PHYPA/29-361-------------------------------------------------------------------------LPMLEEI
D3HQR9_LEGLN/13-338-------------------------------------------------------------------------LTMILKM
G4NGW1_MAGO7/67-414-------------------------------------------------------------------------LSMIKKI
A9RJN7_PHYPA/31-365-------------------------------------------------------------------------ENMIDRL
A9TYA6_PHYPA/60-394-------------------------------------------------------------------------ENMIDRL
E1VZ37_ARTAR/22-349-------------------------------------------------------------------------LDMLNEL
Q4DMX8_TRYCC/74-400-------------------------------------------------------------------------LEMAQHM
Q6LIA0_PHOPR/19-359-------------------------------------------------------------------------FDMLVQL
B7Q288_IXOSC/44-375-------------------------------------------------------------------------LDMIRQI
H3B677_LATCH/47-377-------------------------------------------------------------------------LPMIRQI
B4M5Z4_DROVI/22-343-------------------------------------------------------------------------LEMVRKI
A7RHZ5_NEMVE/46-374-------------------------------------------------------------------------LPMIRKI
Q8FQY6_COREF/29-353-------------------------------------------------------------------------QEMVDLV
E1VC38_HALED/19-356-------------------------------------------------------------------------LEMIQLV
Q11J99_CHESB/19-339-------------------------------------------------------------------------HGMIRAL
B0S642_DANRE/44-374-------------------------------------------------------------------------LNMIRHI
D7LRR5_ARALL/47-381-------------------------------------------------------------------------THMGYRL
F8K1G3_STREN/18-341-------------------------------------------------------------------------LEMVRLL
G2KLT0_MICAA/19-358-------------------------------------------------------------------------LGMIRGI
B6JX18_SCHJY/32-363-------------------------------------------------------------------------RAITDFI
I1M992_SOYBN/52-386-------------------------------------------------------------------------ASMVARL
A8NEJ7_COPC7/45-386-------------------------------------------------------------------------TPMLELL
Q12AQ1_POLSJ/18-355-------------------------------------------------------------------------LPMVQAL
Q1QVU3_CHRSD/19-353-------------------------------------------------------------------------LTMIHAL
I1JMV6_SOYBN/52-386-------------------------------------------------------------------------TNMAATL
Q4JU31_CORJK/25-358-------------------------------------------------------------------------VEMIRLI
Q2GA19_NOVAD/13-336-------------------------------------------------------------------------LDMVHAM
Q2N893_ERYLH/16-341-------------------------------------------------------------------------LEMCHAM
Q16U65_AEDAE/33-352-------------------------------------------------------------------------LDMVRQI
C6XIW5_HIRBI/14-333-------------------------------------------------------------------------TMMCAQI
C3PF62_CORA7/13-336-------------------------------------------------------------------------QTMIDEM
D8IW53_HERSS/21-370-------------------------------------------------------------------------LEMVQLL
C8WWK9_ALIAD/12-344-------------------------------------------------------------------------LEMIRLL
F0XEA1_GROCL/74-428-------------------------------------------------------------------------GSMIRKI
Q0BR39_GRABC/31-348-------------------------------------------------------------------------GEMVRAI
F2T0Y3_TRIRC/73-417-------------------------------------------------------------------------GSMVRKI
A1WLH8_VEREI/23-355-------------------------------------------------------------------------LAMVRAL
A9C200_DELAS/16-348-------------------------------------------------------------------------LGMVRDL
Q2L131_BORA1/18-371-------------------------------------------------------------------------LGMVDLL
F2R851_STRVP/13-333-------------------------------------------------------------------------HAMVLRI
D5BR70_PUNMI/19-347-------------------------------------------------------------------------IEMVTVL
E1VS22_ARTAR/12-327-------------------------------------------------------------------------ADMCRTI
Q28R37_JANSC/11-334-------------------------------------------------------------------------YQMCLAI
C3Z9L9_BRAFL/41-373-------------------------------------------------------------------------LNMIRQI
B3S7F3_TRIAD/23-347-------------------------------------------------------------------------LNMINTI
A5V401_SPHWW/17-339-------------------------------------------------------------------------HPICTAM
E5SEM2_TRISP/42-371-------------------------------------------------------------------------INMAKMM
C0HHJ2_MAIZE/66-416-------------------------------------------------------------------------LEMDVRY
B0CSR7_LACBS/50-391-------------------------------------------------------------------------EQMLTLL
A4VIV7_PSEU5/16-354-------------------------------------------------------------------------LPMIEAL
D4ZAM5_SHEVD/14-353-------------------------------------------------------------------------LEMVQSM
A7HX73_PARL1/15-335-------------------------------------------------------------------------LGMVRAI
F4QC51_DICFS/178-513-------------------------------------------------------------------------DTTLRLI
Q7NWA8_CHRVO/15-354-------------------------------------------------------------------------LDMIRLL
G0MPK6_CAEBE/44-375-------------------------------------------------------------------------LNMVREF
Q55GN0_DICDI/49-392-------------------------------------------------------------------------MEMLKFL
C7RD63_ANAPD/10-343-------------------------------------------------------------------------LDMIYEI
Q6CA37_YARLI/41-379-------------------------------------------------------------------------DPMCRAI
A9V573_MONBE/16-343-------------------------------------------------------------------------LNMVRLM
A0BEK3_PARTE/25-354-------------------------------------------------------------------------LPMIAEL
F2R4L5_STRVP/18-338-------------------------------------------------------------------------HAMVLAV
HIBC5_ARATH/51-385-------------------------------------------------------------------------APMVGRL
E4N1A8_KITSK/18-339-------------------------------------------------------------------------RPMLETV
E5ASB4_BURRH/34-371-------------------------------------------------------------------------HSMVRTL
H3FRY8_PRIPA/40-371-------------------------------------------------------------------------LNMVREL
A9HE55_GLUDA/18-336-------------------------------------------------------------------------RTLFARI
F2IWL1_POLGS/13-333-------------------------------------------------------------------------LAMVRAM
Q7MDJ7_VIBVY/19-358-------------------------------------------------------------------------EEMLAAL
D5UVM7_TSUPD/17-334-------------------------------------------------------------------------TDMVHAI
G8SEU3_ACTS5/15-332-------------------------------------------------------------------------AGMVAIM
Q0VP05_ALCBS/18-356-------------------------------------------------------------------------LEMITLL
B2UAB6_RALPJ/70-398-------------------------------------------------------------------------LEMIRAM
A1S5D0_SHEAM/18-354-------------------------------------------------------------------------LDMVRAL
H8MVZ6_CORCM/13-341-------------------------------------------------------------------------LEMCHVM
D5ATL9_RHOCB/13-333-------------------------------------------------------------------------HDMAGAI
B9RPB0_RICCO/58-404-------------------------------------------------------------------------LDMDVKY
B6IMT6_RHOCS/17-352-------------------------------------------------------------------------LGMIRVL
H6BSS6_EXODN/72-425-------------------------------------------------------------------------GSMARKI
Q1GNL4_SPHAL/17-339-------------------------------------------------------------------------LAMCQAM
E9IZM3_SOLIN/56-380-------------------------------------------------------------------------LTMVQKI
Q6FM09_CANGA/43-400-------------------------------------------------------------------------EEMCSSI
E1SUP0_FERBD/18-358-------------------------------------------------------------------------LEMVDAL
G4RGU8_PELHB/12-344-------------------------------------------------------------------------AEMIAAV
G2P5N8_STRVO/31-352-------------------------------------------------------------------------PPMVTRI
HIBC2_ARATH/15-349-------------------------------------------------------------------------FHMVSRL
Q4Q4Q6_LEIMA/22-353-------------------------------------------------------------------------LPMVQDL
G7DUF6_MIXOS/94-452-------------------------------------------------------------------------LDMMNII
C1DAN4_LARHH/20-362-------------------------------------------------------------------------LDMIRLL
A1U6V2_MARHV/15-353-------------------------------------------------------------------------EEMVNQA
C7NJ16_KYTSD/22-350-------------------------------------------------------------------------HDMCAAM
D2VUW6_NAEGR/936-1276-------------------------------------------------------------------------SEVARDL
C4WVV0_ACYPI/36-362-------------------------------------------------------------------------TSMVVKI
E9G4T3_DAPPU/56-370-------------------------------------------------------------------------LNMIRKI
C1EG25_MICSR/14-367-------------------------------------------------------------------------VAVVQKL
F4GS44_PUSST/18-360-------------------------------------------------------------------------LDMCKLL
A4F9Q5_SACEN/15-334-------------------------------------------------------------------------LGMVRTM
G8RS69_MYCRN/28-352-------------------------------------------------------------------------HPMVNAI
G3IHA0_CRIGR/18-348-------------------------------------------------------------------------LNMIRQI
G2QR77_THITE/46-391-------------------------------------------------------------------------GSMIRKI
B9TBM0_RICCO/16-343-------------------------------------------------------------------------LDMVRAI
Q4DMX9_TRYCC/20-346-------------------------------------------------------------------------LEMVKAM
D7FIS1_ECTSI/31-370-------------------------------------------------------------------------LTMVRGM
E8NCI0_MICTS/19-345-------------------------------------------------------------------------LDMIRDL
Q89N86_BRADU/17-344-------------------------------------------------------------------------LEMFRDI
E8RLF2_ASTEC/19-339-------------------------------------------------------------------------TAMCRDM
F0M0J8_VIBFN/19-357-------------------------------------------------------------------------YNMLALL
A1U2J0_MARHV/19-355-------------------------------------------------------------------------MDMIRLL
Q0RM03_FRAAA/66-391-------------------------------------------------------------------------PTMVGLL
H3DE45_TETNG/45-375-------------------------------------------------------------------------LNMIRLI
B4RB39_PHEZH/14-336-------------------------------------------------------------------------TRMCRDI
F0ZI93_DICPU/87-416-------------------------------------------------------------------------THLFVNL
G1X6E1_ARTOA/73-419-------------------------------------------------------------------------ASMAGKI
A4G9P0_HERAR/23-358-------------------------------------------------------------------------LDMIRTM
A0R2Y4_MYCS2/15-335-------------------------------------------------------------------------EAMVAEI
D3B388_POLPA/36-371-------------------------------------------------------------------------LPMVRKL
C6THR1_SOYBN/37-369-------------------------------------------------------------------------PELVSQL
D8RN96_SELML/20-345-------------------------------------------------------------------------LSVVSRL
F6AA82_PSEF1/16-354-------------------------------------------------------------------------LPMIDAL
F8E0K2_CORRG/15-348-------------------------------------------------------------------------HTMILAL
F2GC52_ALTMD/22-362-------------------------------------------------------------------------LEMAGIM
A4I8I6_LEIIN/21-350-------------------------------------------------------------------------YGMIREL
A4VKU6_PSEU5/16-348-------------------------------------------------------------------------LEMVRLL
A4XS22_PSEMY/16-354-------------------------------------------------------------------------LPMIQAL
A8Q2H6_BRUMA/37-374-------------------------------------------------------------------------ISMVRKL
B1MKI3_MYCA9/13-333-------------------------------------------------------------------------YDMIAAM
B1VV62_STRGG/15-334-------------------------------------------------------------------------RTMVETI
B4FIT7_MAIZE/26-359-------------------------------------------------------------------------SEMIKGL
B9IL60_POPTR/51-383-------------------------------------------------------------------------IPMVARL
C1A226_RHOE4/16-335-------------------------------------------------------------------------HSMVKAM
C4R612_PICPG/39-387-------------------------------------------------------------------------TDMCHQI
C5AQY8_METEA/35-359-------------------------------------------------------------------------LPMVEAM
C5CR27_VARPS/20-356-------------------------------------------------------------------------VDMVRLL
C5GL55_AJEDR/45-388-------------------------------------------------------------------------GSMARKI
C7JEY4_ACEP3/21-337-------------------------------------------------------------------------ISMASGI
C8V2I5_EMENI/70-410-------------------------------------------------------------------------GSMVRKI
D9Q9E6_CORP2/23-349-------------------------------------------------------------------------QEMIDRI
F6INA5_9SPHN/14-335-------------------------------------------------------------------------LDMCRGM
F8Q7W3_SERL3/52-393-------------------------------------------------------------------------EEMLNTL
G8PLL8_PSEUV/25-348-------------------------------------------------------------------------HEMCVAM
M0YPS1_HORVD/57-387-------------------------------------------------------------------------TTMGARL
M1FH42_9ALTE/19-355-------------------------------------------------------------------------LEMIRLL
O53419_MYCTU/16-336-------------------------------------------------------------------------QTMVDLL
Q0K1Z5_CUPNH/27-360-------------------------------------------------------------------------YPMIVAL
Q0K9D4_CUPNH/13-344-------------------------------------------------------------------------LDMIRAI
Q13M23_BURXL/27-363-------------------------------------------------------------------------HAMVREL
Q1D8V8_MYXXD/13-346-------------------------------------------------------------------------LGMCRKL
HIBCH_XENTR/46-375-------------------------------------------------------------------------LGMIRLI
Q2RTB1_RHORT/15-345-------------------------------------------------------------------------LPKVERM
Q2YNA1_BRUA2/20-339-------------------------------------------------------------------------HNMILAL
Q3J1K7_RHOS4/13-327-------------------------------------------------------------------------CAMVQEI
Q3SQN0_NITWN/20-346-------------------------------------------------------------------------LDMFRGI
Q5JMX9_ORYSJ/26-356-------------------------------------------------------------------------DRVVYLL
Q63MM8_BURPS/27-362-------------------------------------------------------------------------HDMVREL
Q63TV7_BURPS/21-364-------------------------------------------------------------------------TDMIRAL
Q65IX3_BACLD/15-345-------------------------------------------------------------------------YDMVRLI
Q6N492_RHOPA/19-345-------------------------------------------------------------------------LEMAREL
Q6NI92_CORDI/19-346-------------------------------------------------------------------------HEMVNII
Q7APV2_MYCLE/16-336-------------------------------------------------------------------------QQMVDAL
Q7VYA4_BORPE/19-371-------------------------------------------------------------------------LEMVELL
Q83AM7_COXBU/43-368-------------------------------------------------------------------------GDMCRRL
Q87H46_VIBPA/18-356-------------------------------------------------------------------------YVMIEQL
Q87II2_VIBPA/19-358-------------------------------------------------------------------------FDMLLQL
Q87YT7_PSESM/28-360-------------------------------------------------------------------------LDMVRTL
Q88H70_PSEPK/22-354-------------------------------------------------------------------------LDMVRSL
Q8NRX2_CORGL/14-334-------------------------------------------------------------------------QEMIDLV
Q8XS34_RALSO/27-369-------------------------------------------------------------------------HGMVRQL
Q92TQ6_RHIME/18-338-------------------------------------------------------------------------RTMIRAI
Q983C3_RHILO/18-337-------------------------------------------------------------------------HRMVMAL
Q9A8K1_CAUCR/15-337-------------------------------------------------------------------------LGMCETM
Q9I5I5_PSEAE/16-354-------------------------------------------------------------------------LPMIEAL
U5FFA4_POPTR/23-356-------------------------------------------------------------------------YHMTCQM
U5G8W9_POPTR/30-363-------------------------------------------------------------------------HHMISEM
V4KPJ6_9ACTN/14-339-------------------------------------------------------------------------HAMVERI
V9XKW7_9NOCA/15-343-------------------------------------------------------------------------RSMIRDI
V9XNE6_9NOCA/16-336-------------------------------------------------------------------------HAMVLEM
W4W6S1_ATTCE/168-489-------------------------------------------------------------------------LSMIQKI
W5JCR8_ANODA/20-341-------------------------------------------------------------------------LDMVRII
W5XRW0_9CORY/14-331-------------------------------------------------------------------------LDMIRAM

PF08496

Q3SFM4_THIDA/3-147------------------------------------------------------------------------------DF
SOHB_ECOLI/2-158------------------------------------------------------------------------------EL
Q5E611_VIBF1/2-162------------------------------------------------------------------------------EF
U3U6L2_9ENTR/2-156------------------------------------------------------------------------------DV
B8F6J6_HAEPS/4-160------------------------------------------------------------------------------EI
M9WWT9_MANHA/4-159------------------------------------------------------------------------------EV
A1WT84_HALHL/2-146------------------------------------------------------------------------------..
K6ZKA6_9ALTE/2-154------------------------------------------------------------------------------DF
A6VW04_MARMS/3-155------------------------------------------------------------------------------EF
A1U0U5_MARHV/2-161------------------------------------------------------------------------------EF
Q6ML34_BDEBA/2-147------------------------------------------------------------------------------DA
C4K721_HAMD5/2-157------------------------------------------------------------------------------EL
Q5F7D2_NEIG1/4-160------------------------------------------------------------------------------EI
C9R4B3_AGGAD/4-161------------------------------------------------------------------------------EI
D4GFA3_PANAM/2-157------------------------------------------------------------------------------EL
L0GQQ0_9GAMM/3-144------------------------------------------------------------------------------DL
Q6D4V2_PECAS/4-159------------------------------------------------------------------------------EL
E1VKB3_9GAMM/3-151------------------------------------------------------------------------------EF
G4QLK8_GLANF/2-149------------------------------------------------------------------------------EF
Q88G04_PSEPK/2-149------------------------------------------------------------------------------EF
Q3JCU0_NITOC/3-143------------------------------------------------------------------------------EL
Q4KAG4_PSEF5/2-152------------------------------------------------------------------------------EF
F2JWF9_MARM1/2-145------------------------------------------------------------------------------EF
W8L9B4_HALHR/2-153------------------------------------------------------------------------------EF
E0WSD1_9ENTR/2-157------------------------------------------------------------------------------EL
K0CD66_ALCDB/4-159------------------------------------------------------------------------------DL
U5T5A0_9GAMM/2-148------------------------------------------------------------------------------EF
Q9CN58_PASMU/4-161------------------------------------------------------------------------------DI
Q6LPB4_PHOPR/2-162------------------------------------------------------------------------------EF
K4KI74_SIMAS/2-171------------------------------------------------------------------------------EF
Q9KT45_VIBCH/5-165------------------------------------------------------------------------------EF
Q9I2R3_PSEAE/2-148------------------------------------------------------------------------------EF
B2VKR2_ERWT9/2-158------------------------------------------------------------------------------EL
B8GRY4_THISH/2-150------------------------------------------------------------------------------EF
A6VNT8_ACTSZ/5-162------------------------------------------------------------------------------.I
I3Y8M1_THIV6/9-152------------------------------------------------------------------------------..
Q15TT9_PSEA6/2-153------------------------------------------------------------------------------EF
C5BJB2_TERTT/2-161------------------------------------------------------------------------------EF
Q7N4B0_PHOLL/2-157------------------------------------------------------------------------------EY
W0E0L9_MARPU/2-148------------------------------------------------------------------------------EL
H2FWJ9_OCESG/3-149------------------------------------------------------------------------------EF
C1DKS7_AZOVD/4-150------------------------------------------------------------------------------EF
E1V393_HALED/3-148------------------------------------------------------------------------------EW
SOHB_BUCBP/2-161------------------------------------------------------------------------------HF
M4VAW8_9DELT/2-148------------------------------------------------------------------------------EI
R5EC27_9GAMM/2-173------------------------------------------------------------------------------EF
X2H295_9GAMM/2-181------------------------------------------------------------------------------NW
A8GF70_SERP5/2-157------------------------------------------------------------------------------EF
U3TWV0_9ENTR/2-157------------------------------------------------------------------------------DL
Q21J53_SACD2/2-173------------------------------------------------------------------------------EF
D3RTH4_ALLVD/10-153------------------------------------------------------------------------------..
L0E340_THIND/2-150------------------------------------------------------------------------------EF
M1SGT4_MORMO/2-158------------------------------------------------------------------------------EF
C7RA79_KANKD/2-191------------------------------------------------------------------------------EF
Q486S9_COLP3/2-158------------------------------------------------------------------------------EF
V4LD97_9GAMM/3-151------------------------------------------------------------------------------EA
Q1QW68_CHRSD/3-155------------------------------------------------------------------------------EW
Q7VMW6_HAEDU/4-160------------------------------------------------------------------------------EI
Q12LC5_SHEDO/2-148------------------------------------------------------------------------------EF
M1FK11_9ALTE/2-170------------------------------------------------------------------------------EF
B3PHP3_CELJU/2-172------------------------------------------------------------------------------EF
S6AL13_PSERE/2-151------------------------------------------------------------------------------EF
A1SW75_PSYIN/13-168------------------------------------------------------------------------------EY
Q83EG9_COXBU/8-154------------------------------------------------------------------------------DF
D8MSU4_ERWBE/2-158------------------------------------------------------------------------------DL
Q882A1_PSESM/2-148------------------------------------------------------------------------------DF
C4LEI0_TOLAT/2-149------------------------------------------------------------------------------AF
I2B860_SHIBC/2-158------------------------------------------------------------------------------GV
Q2SJ39_HAHCH/2-155------------------------------------------------------------------------------DF
Q080A4_SHEFN/6-151------------------------------------------------------------------------------EF
F5Z7M4_ALTSS/2-152------------------------------------------------------------------------------EF
D3SB45_THISK/2-168------------------------------------------------------------------------------EL
W5X6P0_BDEBC/2-148------------------------------------------------------------------------------DA
A4VLP8_PSEU5/22-167------------------------------------------------------------------------------EF
SOHB_HAEIN/4-161------------------------------------------------------------------------------DI
Q87N43_VIBPA/2-162------------------------------------------------------------------------------EF
A3QFM5_SHELP/2-153------------------------------------------------------------------------------EF
M4U4F5_9GAMM/2-157------------------------------------------------------------------------------EF
Q7CIM0_YERPE/2-157------------------------------------------------------------------------------EL
Q0VQ70_ALCBS/3-158------------------------------------------------------------------------------AF
M5DSS1_9GAMM/2-160------------------------------------------------------------------------------EF
SOHB_BUCAI/2-147------------------------------------------------------------------------------NL
E1SNQ6_FERBD/2-150------------------------------------------------------------------------------EF
F7YNU5_VIBA7/19-179------------------------------------------------------------------------------EF
A0KMV5_AERHH/2-146------------------------------------------------------------------------------AF
D3VGP7_XENNA/2-157------------------------------------------------------------------------------EY
A4XVC0_PSEMY/2-147------------------------------------------------------------------------------EF
A5EWW5_DICNV/5-147------------------------------------------------------------------------------.F
R4I0F4_9ENTR/2-157------------------------------------------------------------------------------EF
I0DNT2_PROSM/2-157------------------------------------------------------------------------------EY
H2IX53_RAHAC/2-156------------------------------------------------------------------------------DL
Q7MLX8_VIBVY/2-162------------------------------------------------------------------------------EF
W0HSX4_9ENTR/2-157------------------------------------------------------------------------------EL
C5BDW5_EDWI9/2-157------------------------------------------------------------------------------EW
Q0ABV0_ALKEH/2-149------------------------------------------------------------------------------AG
D4G886_RIEPU/2-151------------------------------------------------------------------------------EF
Q3IL32_PSEHT/3-148------------------------------------------------------------------------------EF
F9ZL28_ACICS/2-144------------------------------------------------------------------------------..
Q5QYQ0_IDILO/2-143------------------------------------------------------------------------------DF
F4HAL3_GALAU/4-170------------------------------------------------------------------------------DI
B4EW27_PROMH/2-157------------------------------------------------------------------------------EY
B0UU39_HISS2/4-161------------------------------------------------------------------------------EL
A3MY80_ACTP2/4-160------------------------------------------------------------------------------EI
A7MN97_CROS8/2-158------------------------------------------------------------------------------NL
A1S7G8_SHEAM/2-147------------------------------------------------------------------------------EF
M4R4I6_BIBTR/4-160------------------------------------------------------------------------------EI
D0L1Z6_HALNC/2-150------------------------------------------------------------------------------EF

PF03255

D2UEG3_XANAP/5-148-------------------------------------------------------------------------EQPIADL
ACCA_METCA/5-148-------------------------------------------------------------------------EQPIAEL
E3I8F4_RHOVT/21-165-------------------------------------------------------------------------EKPIAEL
D8PGA3_9BACT/4-146-------------------------------------------------------------------------EKPIREL
R7MD99_9CLOT/4-147-------------------------------------------------------------------------EKPILEI
F8EZE8_TRECH/5-136-------------------------------------------------------------------------....TSI
W0DRR8_9GAMM/5-148-------------------------------------------------------------------------EQPIAEL
A8LLX0_DINSH/4-147-------------------------------------------------------------------------EKPLAEI
ACCA_SYNWW/6-148-------------------------------------------------------------------------EQKVQEI
E0TDQ6_PARBH/4-147-------------------------------------------------------------------------ERPIAEL
R7GKD0_9CLOT/3-138-------------------------------------------------------------------------ERKIEEL
G2KND5_MICAA/4-146-------------------------------------------------------------------------EKPVLEL
Q2S032_SALRD/7-156-------------------------------------------------------------------------EKPLVEL
Q6AM83_DESPS/30-172-------------------------------------------------------------------------...LEEF
Q311Q7_DESAG/25-171-------------------------------------------------------------------------EENIRLL
S6A148_9SPIO/4-140-------------------------------------------------------------------------.KEKNQI
A0KHH9_AERHH/16-160-------------------------------------------------------------------------EQPIAEL
ACCA_PHOLL/5-151-------------------------------------------------------------------------EQPIAEL
ACCA_FLAPJ/3-147-------------------------------------------------------------------------ELPIKEL
G2TPG4_BACCO/5-147-------------------------------------------------------------------------EKPVIEL
D5EJ62_CORAD/7-150-------------------------------------------------------------------------EKPLREL
B8D1K4_HALOH/6-149-------------------------------------------------------------------------EKPLLEL
ACCA_ROSDO/4-148-------------------------------------------------------------------------EKPLAEI
X2GZP6_9BACI/5-147-------------------------------------------------------------------------EEPVVQL
ACCA_RHIME/4-148-------------------------------------------------------------------------EKPISDL
D7BGY4_MEISD/3-145-------------------------------------------------------------------------EKPIFEL
ACCA_MAGSA/3-146-------------------------------------------------------------------------EKPIAEL
I0AHK2_IGNAJ/5-146-------------------------------------------------------------------------EKPIFEL
G4REG5_PELHB/4-148-------------------------------------------------------------------------EKPVAEL
ACCA_CHLTE/6-163-------------------------------------------------------------------------EKPLYEL
ACCA_AGRFC/4-148-------------------------------------------------------------------------EKPISDL
ACCA_ALKOO/4-147-------------------------------------------------------------------------EKAIHEL
ACCA_MARMS/5-148-------------------------------------------------------------------------EQPIAEL
K6ZTQ8_9ALTE/5-150-------------------------------------------------------------------------EKPIAEL
C0QT26_PERMH/2-143-------------------------------------------------------------------------DKEIQIL
Q2G730_NOVAD/6-148-------------------------------------------------------------------------EKPVAAL
V5SAJ3_9RHIZ/15-158-------------------------------------------------------------------------EKPIAEL
R7C0E0_9BURK/6-149-------------------------------------------------------------------------EKALGEI
C6XFA8_LIBAP/4-148-------------------------------------------------------------------------EEPISDL
ACCA_SYNE7/11-154-------------------------------------------------------------------------EKPLVEL
C1CYF8_DEIDV/5-142-------------------------------------------------------------------------..ILREL
H6L155_SAPGL/3-146-------------------------------------------------------------------------EQPLEEL
R6L4F3_9FIRM/289-430-------------------------------------------------------------------------KENVDTY
D1B429_SULD5/5-141-------------------------------------------------------------------------ENGIKQI
D3UH38_HELM1/4-141-------------------------------------------------------------------------EQKIKVL
B9L7W0_NAUPA/3-140-------------------------------------------------------------------------EKRIEEL
ACCA_HELMI/5-146-------------------------------------------------------------------------EKPLFEL
D3SP93_THEAH/2-144-------------------------------------------------------------------------EKDLEEL
R7AXN0_9FIRM/3-137-------------------------------------------------------------------------QQKINEI
C5CPW8_VARPS/6-149-------------------------------------------------------------------------EQPIAEL
W0E5D8_MARPU/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_ALCBS/5-148-------------------------------------------------------------------------EQPIADL
D9SFY0_GALCS/5-149-------------------------------------------------------------------------ESPIAEL
I1YEX9_METFJ/5-148-------------------------------------------------------------------------EQPIAEL
K4LHZ1_THEPS/6-149-------------------------------------------------------------------------EKDYQEI
E4TZ34_SULKY/5-141-------------------------------------------------------------------------EQNIRQI
D0LXB2_HALO1/14-155-------------------------------------------------------------------------ERPVFEL
C6WW95_METML/5-149-------------------------------------------------------------------------EQPIAQL
C7M555_CAPOD/3-147-------------------------------------------------------------------------EQPIKEL
ACCA_FRATT/3-144-------------------------------------------------------------------------ESKIKEI
H8KSG2_SOLCM/5-147-------------------------------------------------------------------------EKPIAIL
D1AII8_SEBTE/3-144-------------------------------------------------------------------------EAEMRDL
ACCA_CUPNH/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_ERYLH/4-146-------------------------------------------------------------------------EKPVAQL
D2R421_PIRSD/12-153-------------------------------------------------------------------------EQPLLEL
D9QKB7_BRESC/5-147-------------------------------------------------------------------------EKPIAEL
R5DZV5_9BURK/6-150-------------------------------------------------------------------------EKPVAQL
Q0C318_HYPNA/4-148-------------------------------------------------------------------------EKPIAEL
I0IBV1_PHYMF/56-206-------------------------------------------------------------------------EKPLIAL
C6XPW8_HIRBI/7-150-------------------------------------------------------------------------EKPLAEM
ACCA_CHLPD/6-163-------------------------------------------------------------------------EKPLFEL
R6Z0L2_9CLOT/259-400-------------------------------------------------------------------------...IDKI
D4JZM5_9FIRM/2-150-------------------------------------------------------------------------LEQLAPL
K9P1M5_CYAGP/6-149-------------------------------------------------------------------------EKPLVEL
D4G8D7_RIEPU/6-152-------------------------------------------------------------------------EKPIVQL
E8SIV5_STAPH/2-144-------------------------------------------------------------------------EKPIQDI
U5T6J3_9GAMM/8-151-------------------------------------------------------------------------ERPIAEL
W0JJL3_DESAE/4-146-------------------------------------------------------------------------ERPIYEI
F0P1A9_WEEVC/3-147-------------------------------------------------------------------------EQPIKDL
F8KU37_HELBC/4-141-------------------------------------------------------------------------ETRIKGL
G4QI06_GLANF/5-150-------------------------------------------------------------------------EQPIAEL
L0EG96_THECK/6-148-------------------------------------------------------------------------EKPLFEL
ACCA_IDILO/5-150-------------------------------------------------------------------------EQPIAEL
A0LCL9_MAGMM/15-158-------------------------------------------------------------------------ERPIGEL
W0E6N2_9FIRM/5-147-------------------------------------------------------------------------EKPILEL
E6U0M3_BACCJ/6-148-------------------------------------------------------------------------EKPIIEL
ACCA_CAMHC/4-141-------------------------------------------------------------------------EKSIKQI
ACCA_HELPY/4-141-------------------------------------------------------------------------ENHIKEI
F8E5R1_FLESM/6-148-------------------------------------------------------------------------ETPIFEL
ACCA_LEGPH/5-148-------------------------------------------------------------------------EQPIEEL
ACCA_RHOBA/6-147-------------------------------------------------------------------------ENEIADL
I0JPN9_HALH3/4-147-------------------------------------------------------------------------EKPVIEL
R6UTY3_9FIRM/3-138-------------------------------------------------------------------------ESSIAVL
R5QI57_9FIRM/286-429-------------------------------------------------------------------------SENISGL
ACCA_RUBXD/2-142-------------------------------------------------------------------------ERPIKEL
R5NX12_9CLOT/2-140-------------------------------------------------------------------------DERIAEI
D7CNC0_SYNLT/7-149-------------------------------------------------------------------------ERDYLEL
Q2JI82_SYNJB/9-151-------------------------------------------------------------------------EQPVAAL
A8J646_CHLRE/72-215-------------------------------------------------------------------------EKPLLEL
I2EZ83_EMTOG/4-147-------------------------------------------------------------------------EKPIAEL
ACCA_CHLCH/6-163-------------------------------------------------------------------------EKPLFEL
Q1MR33_LAWIP/27-171-------------------------------------------------------------------------.KVIELL
ACCA_ZYMMO/4-146-------------------------------------------------------------------------EKPVAEL
ACCA_PARUW/3-145-------------------------------------------------------------------------EKQIHEY
B1I3G8_DESAP/4-147-------------------------------------------------------------------------ERPISEL
ACCA_XYLFA/5-148-------------------------------------------------------------------------EQPIADL
ACCA_BRASO/8-150-------------------------------------------------------------------------EKPVAEL
ACCA_ACAM1/10-153-------------------------------------------------------------------------EKPLAEL
D3PKT0_MEIRD/3-145-------------------------------------------------------------------------EKPIEEL
B1ZYS7_OPITP/7-150-------------------------------------------------------------------------EKPLRDL
K9ZX35_DEIPD/3-142-------------------------------------------------------------------------EASLQGL
G8PGM3_PSEUV/4-148-------------------------------------------------------------------------EKPVADL
D9QS74_ACEAZ/6-148-------------------------------------------------------------------------EKPLLEL
D3DFX7_HYDTT/3-145-------------------------------------------------------------------------EKEHLEL
ACCA_PELLD/6-163-------------------------------------------------------------------------ERPVVEL
ACCA_SORC5/5-147-------------------------------------------------------------------------EKPVAEL
W0J949_9BACT/7-150-------------------------------------------------------------------------EKPLRDL
ACCA_GEMAT/6-149-------------------------------------------------------------------------ERPIADL
Q11UX8_CYTH3/2-145-------------------------------------------------------------------------EKPIADL
ACCA_XANP2/4-148-------------------------------------------------------------------------EKPVAEL
C8X286_DESRD/27-171-------------------------------------------------------------------------.ANVKLL
ACCA_WOLSU/4-141-------------------------------------------------------------------------EQKIKNI
D5XA35_THEPJ/4-147-------------------------------------------------------------------------EKPLVEL
ACCA_HELHP/4-141-------------------------------------------------------------------------EQKIKNL
ACCA_PELUB/4-149-------------------------------------------------------------------------ETDIKNL
ACCA_COXBU/5-148-------------------------------------------------------------------------EQPIAEL
L0K556_HALHC/4-147-------------------------------------------------------------------------EKPLIEL
A7HCR7_ANADF/7-150-------------------------------------------------------------------------ERPLIAL
D0KZU8_HALNC/5-148-------------------------------------------------------------------------EQPIAEL
E4U646_OCEP5/2-145-------------------------------------------------------------------------EQPILEL
C5AV00_METEA/7-151-------------------------------------------------------------------------EKPVAEL
F3YX99_DESAF/28-171-------------------------------------------------------------------------..NMAML
Q729X2_DESVH/28-170-------------------------------------------------------------------------..NIELL
F2I397_PELSM/3-148-------------------------------------------------------------------------EKELEQL
ACCA_STACT/2-144-------------------------------------------------------------------------EKPLFEI
ACCA_BLOFL/5-151-------------------------------------------------------------------------EQPILKI
A5D053_PELTS/4-147-------------------------------------------------------------------------EKPIQEL
F2IGK6_FLUTR/4-148-------------------------------------------------------------------------EEPLKAL
ACCA_LARHH/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_PARL1/4-148-------------------------------------------------------------------------EKPIAEL
D7CVI6_TRURR/3-145-------------------------------------------------------------------------EKPIDEL
K9RT78_SYNP3/9-152-------------------------------------------------------------------------EKPLVEL
ACCA_UNCTG/5-146-------------------------------------------------------------------------EKPIAEI
R5QLG5_9FIRM/3-135-------------------------------------------------------------------------EKEIEKL
D4LVS3_9FIRM/273-410-------------------------------------------------------------------------LGKILEM
A9RT89_PHYPA/97-240-------------------------------------------------------------------------ERPIVDL
ACCA_PELCD/4-146-------------------------------------------------------------------------EKPLVEL
E4TL55_MARTH/2-145-------------------------------------------------------------------------EQPIVEL
ACCA_PELPB/6-163-------------------------------------------------------------------------EKPLFEL
E1VNM7_9GAMM/16-159-------------------------------------------------------------------------EQPIAEL
K4AZH5_SOLLC/103-246-------------------------------------------------------------------------EKPLVNL
C6D8B9_PAESJ/6-149-------------------------------------------------------------------------EKPISDL
K0J396_AMPXN/4-147-------------------------------------------------------------------------EKPIYEL
E8U5S6_DEIML/5-142-------------------------------------------------------------------------..VLTQL
ACCA_CAUCR/5-149-------------------------------------------------------------------------ERPIADL
F2LWN6_HIPMA/3-146-------------------------------------------------------------------------EKPIYEI
G2LDZ5_CHLTF/6-153-------------------------------------------------------------------------AAQIKLM
E4TI62_CALNY/6-148-------------------------------------------------------------------------EVPIYEL
ACCA_PSEAE/5-148-------------------------------------------------------------------------EQPIADL
D5SMU5_PLAL2/7-147-------------------------------------------------------------------------ERPIFQL
H8KZ76_FRAAD/5-148-------------------------------------------------------------------------EKPIADL
L0G434_ECHVK/2-145-------------------------------------------------------------------------EKPIADL
C7JEV8_ACEP3/4-146-------------------------------------------------------------------------EKPVAEL
U3U7V8_9ENTR/5-151-------------------------------------------------------------------------EKPIAEL
I4AJK8_FLELS/2-145-------------------------------------------------------------------------EKPIFEL
U6B8Z9_9RHIZ/4-148-------------------------------------------------------------------------EKPISDI
I3THF2_TISMK/4-147-------------------------------------------------------------------------EKPIAEL
C7PMD3_CHIPD/3-146-------------------------------------------------------------------------EKPIEDL
D5BMW6_PUNMI/4-146-------------------------------------------------------------------------EKPIASL
C6VWQ9_DYAFD/4-147-------------------------------------------------------------------------EKPMAEL
A0A068NX81_9BACT/5-153-------------------------------------------------------------------------EKPLAEL
K7S984_GLUOY/13-161-------------------------------------------------------------------------EKSVAEL
F2JNG5_CELLD/8-142-------------------------------------------------------------------------EGAITHL
L0DWX9_THIND/5-148-------------------------------------------------------------------------EQPIVEL
K9Q7M9_9NOSO/10-153-------------------------------------------------------------------------EKPLAEL
ACCA_TRIEI/9-152-------------------------------------------------------------------------EKPLAEL
L0EVZ1_LIBCB/4-148-------------------------------------------------------------------------EKPISDL
D4M3A9_9FIRM/275-407-------------------------------------------------------------------------LGQILKM
ACCA_NITSB/4-141-------------------------------------------------------------------------EQKIKEI
R5QCK4_9BURK/6-152-------------------------------------------------------------------------EHDIEAL
R6P4G2_9CLOT/2-145-------------------------------------------------------------------------EKPITKI
ACCA_CARHZ/6-148-------------------------------------------------------------------------EKPLVEL
ACCA_CELJU/5-148-------------------------------------------------------------------------EQPIAEL
G2ISU6_9SPHN/4-147-------------------------------------------------------------------------EKPVAAL
D4KAA0_9FIRM/2-148-------------------------------------------------------------------------LQQLAPL
F6IN39_9SPHN/4-146-------------------------------------------------------------------------EKPIAAL
D4Z3Q1_SPHJU/4-147-------------------------------------------------------------------------EKPIAEL
W0EXF5_9SPHI/9-152-------------------------------------------------------------------------EKPIKDL
I3ZX40_ORNRL/3-147-------------------------------------------------------------------------EEPIKDL
F0RKQ5_DEIPM/7-153-------------------------------------------------------------------------..LIRDL
E0UBA6_CYAP2/10-153-------------------------------------------------------------------------EKPLYEL
R5YAR4_9PROT/8-151-------------------------------------------------------------------------EKDILEI
ACCA_ACICJ/4-146-------------------------------------------------------------------------EKPVAEL
K9SWQ9_9SYNE/7-150-------------------------------------------------------------------------EKPIVEL
ACCA_THET8/3-145-------------------------------------------------------------------------EKPILEL
B8EN13_METSB/21-164-------------------------------------------------------------------------EKPVAEL
Q39833_SOYBN/90-233-------------------------------------------------------------------------EKPLVDL
E8RUB5_ASTEC/4-147-------------------------------------------------------------------------ERPIADL
ACCA_TERTT/5-148-------------------------------------------------------------------------EQPIAVL
C6Y0P1_PEDHD/8-150-------------------------------------------------------------------------EKPIAEL
ACCA_CHLTR/3-146-------------------------------------------------------------------------EKQVVEY
ACCA_THICR/5-147-------------------------------------------------------------------------EQPIAEL
ACCA_ALKEH/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_OCEIH/4-147-------------------------------------------------------------------------EKPIVNL
ACCA_WIGBR/5-149-------------------------------------------------------------------------EQPIADL
Q1IN03_KORVE/6-146-------------------------------------------------------------------------QQELERI
F4L135_HALH1/3-146-------------------------------------------------------------------------EKPLEIL
E1SU30_FERBD/5-150-------------------------------------------------------------------------EHPIAEL
E1X4H2_HALMS/9-151-------------------------------------------------------------------------EKPVRDL
F6DPP9_DESRL/2-145-------------------------------------------------------------------------EKPLLEL
K9SI36_9CYAN/7-154-------------------------------------------------------------------------EKPLAEL
D3PDG9_DEFDS/6-148-------------------------------------------------------------------------ETQIFEL
R6SFM1_9FIRM/263-401-------------------------------------------------------------------------VDQIVER
D8TBU9_SELML/23-165-------------------------------------------------------------------------EKPIIDL
B4ETY2_PROMH/5-152-------------------------------------------------------------------------EKPIVEL
ACCA_THEYD/4-147-------------------------------------------------------------------------EKPIQEL
R5YCC5_9FIRM/275-410-------------------------------------------------------------------------LSKILDM
ACCA_RHILO/4-148-------------------------------------------------------------------------EKPVQDL
C0ZEF2_BREBN/2-145-------------------------------------------------------------------------EGPIIEL
C4L480_EXISA/3-141-------------------------------------------------------------------------.DPIKEV
Q187P7_PEPD6/3-145-------------------------------------------------------------------------SEKIKVL
ACCA_AROAE/5-148-------------------------------------------------------------------------EQPVADL
W8TMD3_EUBAC/5-147-------------------------------------------------------------------------DGPVLQL
R7I7W2_9BURK/5-149-------------------------------------------------------------------------EKDIEAL
C9RBG3_AMMDK/4-147-------------------------------------------------------------------------ERPLVEL
ACCA_ACTP2/5-149-------------------------------------------------------------------------ELPIAEL
W8EY50_9BACT/2-145-------------------------------------------------------------------------EQPIAAL
C8W257_DESAS/5-148-------------------------------------------------------------------------EKPILEL
J9QYP7_RIEAN/3-148-------------------------------------------------------------------------ETPIKEL
ACCA_CAMJE/5-141-------------------------------------------------------------------------EKNIQQI
F0S695_PSESL/5-147-------------------------------------------------------------------------EKPIAEL
H2FXK3_OCESG/5-150-------------------------------------------------------------------------EQPIAEL
F0S0A5_DESTD/5-143-------------------------------------------------------------------------EKKVDRL
B3QS67_CHLT3/5-161-------------------------------------------------------------------------EKPLVEL
D7A5W6_STAND/4-148-------------------------------------------------------------------------EKPVAEL
F0LUJ9_VIBFN/5-151-------------------------------------------------------------------------EKPIVEL
ACCA_BACHD/5-147-------------------------------------------------------------------------EKPIRDL
R5EMT9_9GAMM/5-150-------------------------------------------------------------------------EQPIADL
ACCA_PROA2/6-163-------------------------------------------------------------------------EKPLFEL
F0T0C4_SYNGF/2-144-------------------------------------------------------------------------EKNIREL
H8GK81_METAL/5-148-------------------------------------------------------------------------EQPIAEL
D5WSS7_KYRT2/5-147-------------------------------------------------------------------------EKPLLEL
F6GHA4_LACS5/3-147-------------------------------------------------------------------------ELPIKEL
W8KT18_HALHR/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_GEOMG/7-148-------------------------------------------------------------------------EKPVFEL
K9Z068_CYAAP/11-154-------------------------------------------------------------------------EKPLVEL
H1XP22_9BACT/9-151-------------------------------------------------------------------------EKPIVNL
H2IA21_FLACA/3-147-------------------------------------------------------------------------ELPIKEL
C8WRU9_ALIAD/5-147-------------------------------------------------------------------------ERPIAEL
F7XXZ5_MOREP/5-149-------------------------------------------------------------------------EQPIADI
ACCA_BACSK/5-147-------------------------------------------------------------------------EKPVIEL
R5QM64_9PROT/6-149-------------------------------------------------------------------------EKPIAEL
B3ERA3_AMOA5/2-146-------------------------------------------------------------------------EKPIALL
K4IV53_PSYTT/3-147-------------------------------------------------------------------------ELPIKAL
B2V9Z0_SULSY/2-143-------------------------------------------------------------------------NQELQSL
F5Y6P2_TREAZ/2-135-------------------------------------------------------------------------..EIQAI
ACCA_PARDP/3-147-------------------------------------------------------------------------EKPLADL
ACCA_OLICO/8-150-------------------------------------------------------------------------EKPVAEL
D6Z010_DESAT/30-172-------------------------------------------------------------------------...LPAL
ACCA_OCHA4/4-148-------------------------------------------------------------------------EKPVADL
S0EW53_CHTCT/6-157-------------------------------------------------------------------------EKPISEL
ACCA_COLP3/5-150-------------------------------------------------------------------------EQPIAEL
ACCA_ARCB4/5-141-------------------------------------------------------------------------EEKIKKI
ACCA_TOLAT/5-150-------------------------------------------------------------------------EQPIAEL
H6N9Y7_9BACL/6-147-------------------------------------------------------------------------EQPLVEL
C7NC27_LEPBD/4-144-------------------------------------------------------------------------KDEIKEL
ACCA_DEIRA/4-145-------------------------------------------------------------------------ADALREL
R7GN66_9FIRM/3-139-------------------------------------------------------------------------EEKIAEL
G8R0N5_OWEHD/3-147-------------------------------------------------------------------------EKPIQEL
R5S9W6_9GAMM/4-147-------------------------------------------------------------------------EKPIVEI
R5RFQ5_9FIRM/9-143-------------------------------------------------------------------------..KIKEI
K0B3H8_CLOA9/4-147-------------------------------------------------------------------------EKPIVEL
E3HB41_ILYPC/2-143-------------------------------------------------------------------------EKDILEL
D6GQG0_FILAD/2-144-------------------------------------------------------------------------...IQEL
K0P1U1_9BACT/2-146-------------------------------------------------------------------------EKPIVKL
F2J212_POLGS/4-148-------------------------------------------------------------------------EKPVADI
U5QFX0_9CYAN/13-155-------------------------------------------------------------------------EREIREL
E8R5M4_ISOPI/5-159-------------------------------------------------------------------------EAPIYEM
R6J4C9_9PROT/8-151-------------------------------------------------------------------------EKNIVEI
S5RQ07_9PROT/5-148-------------------------------------------------------------------------EEPIIKL
ACCA_DICNV/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_AQUAE/8-151-------------------------------------------------------------------------EKELLEI
E8UCK2_TAYEM/5-148-------------------------------------------------------------------------EKPIEEL
B3DWQ6_METI4/5-148-------------------------------------------------------------------------EKPIVDL
B8DL69_DESVM/26-171-------------------------------------------------------------------------NENIALL
C7R5W6_KANKD/5-148-------------------------------------------------------------------------ERPIAEL
I6ZWV1_MELRP/5-146-------------------------------------------------------------------------EKPIVEL
L0F5J8_DESDL/5-147-------------------------------------------------------------------------EKPILEL
I0K7J9_9BACT/4-147-------------------------------------------------------------------------EKPLADL
Q0BUI6_GRABC/12-154-------------------------------------------------------------------------EKPIAEL
U5LED4_9BACI/5-147-------------------------------------------------------------------------EKPVVEL
J7QSL5_METSZ/4-148-------------------------------------------------------------------------EKPVAEL
ACCA_BACAN/4-146-------------------------------------------------------------------------EKPVVEL
K4LJD9_9FIRM/2-144-------------------------------------------------------------------------EKELAEL
X2H0U8_9GAMM/4-150-------------------------------------------------------------------------EKPIAEL
ACCA_BAUCH/6-151-------------------------------------------------------------------------EQPIADI
ACCA_STRMK/5-148-------------------------------------------------------------------------EQPIADL
F8EKR1_RUNSL/4-147-------------------------------------------------------------------------EKPVSDL
G8T7C8_NIAKG/9-152-------------------------------------------------------------------------EKPIKDL
ACCA_CYAP4/9-152-------------------------------------------------------------------------EKPLAEL
ACCA_BEII9/4-148-------------------------------------------------------------------------EKPVAEL
J9Z203_9PROT/3-145-------------------------------------------------------------------------EEKLEKL
M1E6T6_9FIRM/9-151-------------------------------------------------------------------------EKPIIDL
ACCA_NITEU/5-148-------------------------------------------------------------------------EKGIEEF
C7RN27_ACCPU/5-148-------------------------------------------------------------------------EQPIADL
F9ZM26_ACICS/5-145-------------------------------------------------------------------------EQSVAEL
K0C175_CYCSP/5-148-------------------------------------------------------------------------EQPIVEL
A5G4G6_GEOUR/6-148-------------------------------------------------------------------------EKPLADL
E3F1D1_KETVY/3-147-------------------------------------------------------------------------EKPLAEI
Q3JCT5_NITOC/9-152-------------------------------------------------------------------------EQPIAEL
K9VDH0_9CYAN/10-153-------------------------------------------------------------------------EKPLAEL
ACCA_LISMO/5-147-------------------------------------------------------------------------EKPILEL
A8FG56_BACP2/5-147-------------------------------------------------------------------------EKPVIEL
ACCA_RUTMC/5-145-------------------------------------------------------------------------EQPIVEL
Q2RXX2_RHORT/7-150-------------------------------------------------------------------------EKPIAEL
ACCA_PSEHT/5-150-------------------------------------------------------------------------ELPIAEL
E6W2T7_DESIS/5-148-------------------------------------------------------------------------ERPIVEL
D0MDD2_RHOM4/9-159-------------------------------------------------------------------------EKPIAEL
F8L7E7_SIMNZ/5-148-------------------------------------------------------------------------EKQIRDY
W0RIF3_9BACT/5-148-------------------------------------------------------------------------EKPIADL
L0D934_SINAD/9-155-------------------------------------------------------------------------EAQIYEM
F2NQ24_MARHT/2-145-------------------------------------------------------------------------ERPIIEL
E6X0S5_NITSE/4-141-------------------------------------------------------------------------EKPIEAI
F4CCW2_SPHS2/4-147-------------------------------------------------------------------------EKPIADL
D3ECM3_GEOS4/5-147-------------------------------------------------------------------------EMPLAEM
ACCA_SPHAL/4-147-------------------------------------------------------------------------EKQVAAL
Q0AMD1_MARMM/8-151-------------------------------------------------------------------------ERPLAEL
B3E7C0_GEOLS/6-146-------------------------------------------------------------------------EKPIAEL
Q1D555_MYXXD/8-151-------------------------------------------------------------------------ERPLIEL
ACCA_CHRSD/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_EXIS2/3-143-------------------------------------------------------------------------DQPVIAL
F8KZD1_PARAV/4-145-------------------------------------------------------------------------EKQINEY
ACCA_FUSNN/2-143-------------------------------------------------------------------------EFQIEEL
S6B4Y6_9PROT/5-148-------------------------------------------------------------------------EQPIAEL
B4U9A1_HYDS0/4-142-------------------------------------------------------------------------.KDVQEL
ACCA_CHESB/4-148-------------------------------------------------------------------------EKPVADL
A1AQQ7_PELPD/6-148-------------------------------------------------------------------------EKPIVEL
F8JC16_HYPSM/32-176-------------------------------------------------------------------------EKPILEL
B9E7A5_MACCJ/2-145-------------------------------------------------------------------------EQPIRDI
D4H0L9_DENA2/5-148-------------------------------------------------------------------------EAPILEI
F0SFK4_RUBBR/6-146-------------------------------------------------------------------------ERNIHEL
ACCA_SPHWW/4-147-------------------------------------------------------------------------EKPIAEL
F6CQZ6_DESK7/2-145-------------------------------------------------------------------------ERPIIEL
E8T4K6_THEA1/5-143-------------------------------------------------------------------------ENKVEKL
R5K1S9_9CLOT/3-142-------------------------------------------------------------------------DERIRAI
I4D4N6_DESAJ/5-147-------------------------------------------------------------------------EKPILEL
D6YRI8_WADCW/23-165-------------------------------------------------------------------------EKQIFEY

PF01039

PCCB_SACEN/46-544.DADRPYGDGVVTGWGTVDGRRVCVFSQDFTVFGGSLGEVFGEK...IVKVMDLAMKT...............GCPLVGI
ACACB_HUMAN/1780-2334..AEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISSLNSVHC...KHIEEGGESRYMI
PCCB_BACSU/26-505..R..MLGDGVVTGYGTIDGRSVYVFAQDFTVYGGALGETHARK...ICALMDLAAKN...............KAPIIGL
YNGE_BACSU/27-509.....LPADGVVTAIGKIGGQTVCVMANDSTVKAGSWGAKTVEK...IIRIQEIAEKL...............NCPLIYL
ACACA_HUMAN/1669-2223..AEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHC...EHVEDEGESRYKI
PCCB_HUMAN/57-537ADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQK...ICKIMDQAITV...............GAPVIGL
Q9ZCU2_RICPR/30-512NKK..FLGDGVVTGYGTINGRLVFIYSQDFTVLGGSLGEYHAKK...ICDIIDQAIAT...............GAPVIGI
ACC1_ARATH/1587-2139..AKKLPLIYLAANSGARLGVAEEVKACFKVGWSDEISPENGFQYIYLSPEDHERIGSSVIAH....EVKLSSGETRWVI
HFA1_YEAST/1619-2176..ERGIPRIYLAANSGAKLGIAEELIPLFRVAWNDPSDPTKGFQYLYLAPKDMQLLKDSGKGNSVVVEHKMVYGEERYII
O28066_ARCFU/27-514.DKMDLPADGVVTGYGTVDGRPVAVFAQDFTVMGGSLGEMHGFK...IAYILDFAMKL...............GIPVVGL
O86318_MYCTU/45-527.Q....IGASLVTGIGAVCGVECMIVANDPTVKGGTSNPWTLRK...ILRANQIAFEN...............RLPVISL
Q20676_CAEEL/55-534KEK..YPGDSVVTGRGEINGRTVFVFSQDFTVFGGSLSSIHAKK...IVKIMREAMLV...............GAPVIGL
O86517_STRCO/39-525AKKP..YTDGVITGWGTVEGRTVFVYAHDFRIFGGALGEAHATK...IHKIMDMAIAA...............GAPLVSL
PCCB_MYCLE/50-547ENRP..VGDGVVTGYGTIDGRDVCIFSQDVTVFGGSLGEVYGEK...IVKVQELAIKT...............GRPLIGI
ACAC_YEAST/1574-2130..KRGIPRIYLAANSGARIGMAEEIVPLFQVAWNDAANPDKGFQYLYLTSEGMETLKKFDKENSVLTERTVINGEERFVI
MCCB_ARATH/93-585......PSGGIITGIGPIHGRICMFMANDPTVKGGTYYPITIKK...HLRAQEIAARC...............RLPCIYL
ACAC_SCHPO/1615-2170..QRGIPRIYLAANSGARIGVADEIVPLFNIAWVDPDSPEKGFDYIYLTPEAYERLQKENPNILTTEEVVTETGELRHKI
MCCB_CAEEL/119-606.V....PSGGILTGVGIVSGRVCVIVANDATVKGGTYYPITVKK...HLRAQEIAREN...............KLPCIYL
GCDA_ACIFV/54-573.......SVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPGQAEC...LLRASDTAKTL...............HVPLVYV
B5YMF5_THAPS/1470-2012..EHKLPRVYISCNSGARIGLVEDLKPKFKIKFVDEASPSKGFE...YLYLDDETYKTLPEGS.....VNVREVPEGWAI
D1BNG7_VEIPT/29-507.EKKELPGEGVVTGYGTIDGRLVYAFAQDFTVEGGSLGEMHAAK...IVKVQRLAMKM...............GAPIVGI
D7GFR7_PROFC/38-518.DKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTK...VVETMEQALLT...............GTPFLFF
G5EAT9_EMENI/1606-2161..KLGIPRVYLSANSGARIGMADELIPYFSVAWNDPAKPEAGFKYLYLTPEVKKKFDASKQKEVI.TELIHDEGEERHKI
M0WLS8_HORVD/1642-2195..ERKLPLIYLAANSGARIGIADEVKSCFRVGWSDDGSPERGFQYIYLTEEDHARISASVIAH....KMQLDNGEVRWVI
ACCD_MYCTU/14-479......ADESVQTGEGRVFGRRVAVVACEFDFLGGSIGVAAAER...ITAAVERATAE...............RLPLLAS
Q1DDA0_MYXXD/32-518.DKK.IPGDGVVTGYGTVEGRKVFVFAQDFTVFGGSLSGAYAQK...ICKIMDLATRV...............GAPVIGL
A0A0D1DYD5_USTMA/1546-2102..ELGVPRLYISANSGARIGLATEALDLFKVKFVGD.DPAKGFEYIYLDDESLQAVQAKAPNSVMTKPVQAADGSVHNII
Q8NSG7_CORGL/44-541.GAKRPATDGIVTGWGTIDGREVCIFSQDGTVFGGALGEVYGEK...MIKIMELAIDT...............GRPLIGL
Q8NSG8_CORGL/38-535.DAKRPVTDGVVTGYGTIDGRKVCVFSQDGAVFGGALGEVYGEK...IVKVMDLAIKT...............GVPLIGI
Q8U305_PYRFU/28-520.DKRELPADGVITGYGTIDGRLVFVYAQDFTVMGGSLGEMHAMK...IKRIMELALEA...............GAPVIGL

PF06833

Q8P4U4_XANCP/5-230-------------------------------------------------------------------------...GHAI
Q89XP1_BRADU/5-233-------------------------------------------------------------------------...GHEV
Q9I6S6_PSEAE/11-268-------------------------------------------------------------------------LAPRPGD
Q89UY5_BRADU/5-233-------------------------------------------------------------------------...GRKI
Q87V58_PSESM/9-266-------------------------------------------------------------------------ASEVTGL
A6T8S0_KLEP7/11-266-------------------------------------------------------------------------APLMSGL

PF03572

Q8CVF0_LEPIN/340-512....G--------------------------------------------------------------------PSVDREI
CTPA_SYNP2/215-376.....--------------------------------------------------------------------.NAKTEI
Q81R25_BACAN/181-400.....--------------------------------------------------------------------.AINKLL
Q7UUN0_RHOBA/410-573.....--------------------------------------------------------------------.STPAEV
Q8Y2I4_RALSO/213-395.....--------------------------------------------------------------------.RTVPDL
Q8DII0_THEEB/215-376.....--------------------------------------------------------------------.MAPTEM
Q8R712_CALS4/193-353.....--------------------------------------------------------------------.NTTANL
Q87YB6_PSESM/365-539GDPEY--------------------------------------------------------------------KSTTRDV
TRI_SULSO/887-1042.....--------------------------------------------------------------------..MYQGF
Q7VMG7_HAEDU/365-546.....--------------------------------------------------------------------...ANDM
Q8R7P6_CALS4/299-499..NDI--------------------------------------------------------------------KKDGKEI
Q8A406_BACTN/202-362.....--------------------------------------------------------------------.NPSKDF
Q7NKF3_GLOVI/143-304.....--------------------------------------------------------------------FGSASQV
TRI_THEAC/878-1033.....--------------------------------------------------------------------..GMMGL
O83301_TREPA/167-332.....--------------------------------------------------------------------.VTATRM
Q7TUF4_PROMP/222-383.....--------------------------------------------------------------------.SVPKKI
Q8R6Q0_CALS4/169-397GEEEY--------------------------------------------------------------------KKEKEKI
Q87PB1_VIBPA/356-526.....--------------------------------------------------------------------...SQDT
Q8EDY9_SHEON/364-534.....--------------------------------------------------------------------...SQDV
Q97LQ5_CLOAB/210-372.....--------------------------------------------------------------------.NTGNNF
O66985_AQUAE/192-355.....--------------------------------------------------------------------.GTSKSL
Q9RU43_DEIRA/206-370.....--------------------------------------------------------------------..ASAQF
P73458_SYNY3/220-381.....--------------------------------------------------------------------.QASEEM
Q7UNS4_RHOBA/218-383.....--------------------------------------------------------------------.KTVSEL
Q9RUS4_DEIRA/235-411.....--------------------------------------------------------------------.LTGGGV
Q894Q8_CLOTE/197-416...NI--------------------------------------------------------------------ANDKDKL
Q82BY0_STRAW/878-1033.....--------------------------------------------------------------------..VGSGW
Q8YRM4_NOSS1/218-379.....--------------------------------------------------------------------.NASMEL
Q8CVF1_LEPIN/197-364.....--------------------------------------------------------------------.NTLSEF
Q8A5K0_BACTN/312-500.....--------------------------------------------------------------------SGFDQEL
Q89KT1_BRADU/201-369.....--------------------------------------------------------------------.QTTDGL
Q8ENJ3_OCEIH/223-384.....--------------------------------------------------------------------.KTGDEF
Q8XNN1_CLOPE/231-397.....--------------------------------------------------------------------.GTAKDF
Q8P5D2_XANCP/126-301.SDVR--------------------------------------------------------------------GDYQRAL
PRC_HAEIN/363-533.....--------------------------------------------------------------------...TEDV
Q8Y649_LISMO/229-395.....--------------------------------------------------------------------.TTYDEL
P75023_SYNY3/244-405.....--------------------------------------------------------------------.HSAEQM
Q9A2X1_CAUCR/195-362.....--------------------------------------------------------------------.KATDAL
Q8R7P7_CALS4/191-422NSKNY--------------------------------------------------------------------REEKKEI
Y858_CHLTR/316-560.DPSG--------------------------------------------------------------------PPPWEEF
Q8KAA8_CHLTE/214-383.....--------------------------------------------------------------------.HSREEL
Q8ZXG0_PYRAE/836-991.....--------------------------------------------------------------------..GPAGY
Q7VFQ7_HELHP/223-383.....--------------------------------------------------------------------.NVTRNV
Q8A3B9_BACTN/191-351.....--------------------------------------------------------------------.TTAEEF
Q7VBS8_PROMA/229-390.....--------------------------------------------------------------------.NAAKEM
CTPA2_ARATH/320-483.....--------------------------------------------------------------------.NASSAV
Q815H1_BACCR/212-374.....--------------------------------------------------------------------.NTAKEF
Q87UG9_PSESM/211-377.....--------------------------------------------------------------------.KTGDEV
Q7V214_PROMP/205-366.....--------------------------------------------------------------------.NASREM
Q7NPI8_GLOVI/227-389.....--------------------------------------------------------------------.NAAQQV
Q82H90_STRAW/894-1049.....--------------------------------------------------------------------..GGSGW
Q9AAF2_CAUCR/247-457..NSK--------------------------------------------------------------------WDWRGWL
Q87Q24_VIBPA/260-446.....--------------------------------------------------------------------PSAQTPL
RET3_HUMAN/438-617..VLG--------------------------------------------------------------------VLAPYVL
Q7UJ42_RHOBA/384-569NETDY--------------------------------------------------------------------RSSTRDV
Q8R7Q0_CALS4/178-406DGEGY--------------------------------------------------------------------KKERDMI
Q8R8M1_CALS4/207-366.....--------------------------------------------------------------------.STSSDF
Q8YPV0_NOSS1/193-349.....--------------------------------------------------------------------.AADPYQ
PRC_ECOLI/356-530.....--------------------------------------------------------------------...TDDV
Q892K7_CLOTE/192-411...FV--------------------------------------------------------------------KINTDKL
Q834H3_ENTFA/208-374.....--------------------------------------------------------------------.KTYQEL
Q89X80_BRADU/202-369.....--------------------------------------------------------------------.QTTEGL
Q8DGJ2_THEEB/238-398.....--------------------------------------------------------------------.RSQQQM
Q9CP01_PASMU/362-532.....--------------------------------------------------------------------...TQDV
Q896W4_CLOTE/217-379.....--------------------------------------------------------------------.KTPELF
Q7MSB3_WOLSU/198-359.....--------------------------------------------------------------------.KVGKRV
Q9WZK6_THEMA/203-364.....--------------------------------------------------------------------.KADSDM
Q8YW78_NOSS1/226-387.....--------------------------------------------------------------------.HAAEQM
Q83BH0_COXBU/210-383.....--------------------------------------------------------------------.PVENQL
Q7NSR6_CHRVO/194-376.....--------------------------------------------------------------------.HTAEDL
Q9RUA1_DEIRA/235-408.....--------------------------------------------------------------------.LSTDTA
Q9A6Q6_CAUCR/254-429APDDP--------------------------------------------------------------------RPLDAVL
Q7MTT6_PORGI/195-361.....--------------------------------------------------------------------.TTHAEF
Q9L1S8_STRCO/194-352.....--------------------------------------------------------------------.GVGEQV
Q82PY7_STRAW/269-453DSPAY--------------------------------------------------------------------ARNSAVL
Q7MXF8_PORGI/163-329.....--------------------------------------------------------------------.TTYDEF
Q8KDJ6_CHLTE/340-525QKHNY--------------------------------------------------------------------ASTTKDV
Q8A1T1_BACTN/145-316....S--------------------------------------------------------------------GVGDGNL
Q7NGR6_GLOVI/216-377.....--------------------------------------------------------------------.YAAKDM
Q8R640_FUSNN/203-364.....--------------------------------------------------------------------.NVYPDM
Q82TT8_NITEU/202-384.....--------------------------------------------------------------------.RTGENL
Q7NL17_GLOVI/226-387.....--------------------------------------------------------------------.KAGREV
Q8DZX2_STRA5/125-302.....--------------------------------------------------------------------KLDKRSI
CTPA_SYNY3/218-379.....--------------------------------------------------------------------.NAYKEV
O25905_HELPY/210-371.....--------------------------------------------------------------------.NVTKSV
Q7U4U5_SYNPX/228-389.....--------------------------------------------------------------------.GVPEQV
Q7MUB1_PORGI/151-321....K--------------------------------------------------------------------PISNSNI
CTPB_BACSU/213-375.....--------------------------------------------------------------------.HTAEDF
O84448_CHLTR/354-525....Q--------------------------------------------------------------------VSSEQDL
Q8DJ23_THEEB/220-381.....--------------------------------------------------------------------.NAAGEM
Q8A7W6_BACTN/916-1071.....--------------------------------------------------------------------..GDGSF
Q9KNC0_VIBCH/209-365.....--------------------------------------------------------------------..DAASF
Q7U711_SYNPX/231-392.....--------------------------------------------------------------------.NASREM
Q8YU55_NOSS1/219-380.....--------------------------------------------------------------------.NASKEM
Q8KD83_CHLTE/187-349.....--------------------------------------------------------------------.TTGSEF
Q8EBT8_SHEON/888-1043.....--------------------------------------------------------------------..GGGDI
Q7VS41_BORPE/198-377.....--------------------------------------------------------------------.KTGPDL
CTPA_BACSU/201-363.....--------------------------------------------------------------------.TTAKEL
TRIC_SULTO/669-824.....--------------------------------------------------------------------..MYQGF
Q9K6X5_BACHD/210-372.....--------------------------------------------------------------------.DTADRF
Q7MVK0_PORGI/205-366.....--------------------------------------------------------------------.KSAEEV
Q8P3J7_XANCP/253-471..DSQ--------------------------------------------------------------------WDWRGFL
Q89ZW2_BACTN/204-370.....--------------------------------------------------------------------.TSHVEL
Q8EKP4_SHEON/197-361.....--------------------------------------------------------------------.DSTEDM
Q7TUQ0_PROMM/225-386.....--------------------------------------------------------------------.GVPEQV
Q890X6_CLOTE/207-369.....--------------------------------------------------------------------.NTAKNF
Q7NPD6_GLOVI/225-386.....--------------------------------------------------------------------.KAPNEM
B2J2K4_NOSP7/217-378.....--------------------------------------------------------------------.TAPAQM
CTPA3_ARATH/310-472.....--------------------------------------------------------------------.TAASDM
CTPA1_ARATH/307-467.....--------------------------------------------------------------------.LARKDL
G3WSG1_SARHA/36-212...IE--------------------------------------------------------------------EVGEFLV
M0ZTS1_SOLTU/116-276.....--------------------------------------------------------------------.LARKDL
M3WLH1_FELCA/129-305...VS--------------------------------------------------------------------KLGGFLV
Q1D0E2_MYXXD/209-374.....--------------------------------------------------------------------.RTDLYL
Q2YLJ3_BRUA2/181-348.....--------------------------------------------------------------------.QTSEDL
CTPAL_STAEQ/226-389.....--------------------------------------------------------------------.NTSGEL
Q9PA16_XYLFA/231-394.....--------------------------------------------------------------------.DTGNDF
Q9PCF8_XYLFA/366-548NVANY--------------------------------------------------------------------TSATRDV
Q9ZDU6_RICPR/189-355.....--------------------------------------------------------------------.STISEL

PF01972

Y137_METJA/3-286LR--------A---IRA-A---PKDKPIDLII----------------------------------------------HT
Y1495_METJA/9-292LR--------A---IRL-T---PEDMPIDLII----------------------------------------------HT
O29403_ARCFU/7-290LR--------A---IRS-T---PKDKPIDLII----------------------------------------------HT
O66996_AQUAE/1-288LR--------A---IRM-T---PDDMPIDLII----------------------------------------------HT

PF00574

Q7XBR2_ORYSJ/73-254LL--------L---LDA-V---DPNSDIRLFV----------------------------------------------NS
CLPP2_BORBU/6-189IL--------L---LEA-L---DFKKPIFVYI----------------------------------------------DS
CLPP1_BORBU/13-194LL--------F---LES-E---DSSKDIYLYL----------------------------------------------NS
CLPP1_CAEEL/34-215LL--------F---LQS-E---SGKKPIHMYI----------------------------------------------NS
CLPP4_ARATH/74-253LL--------L---LDA-K---DPKKDIKLFI----------------------------------------------NS
CLPP1_CHLTR/3-189LW--------Y---LEL-T---NPGQPIVFVI----------------------------------------------NS
Q9CFR9_LACLA/7-176..--------.---L.V-N---ADDEEIVLNI----------------------------------------------AS
CLPP1_PSEAE/28-209LL--------F---LEA-E---NPEKDIHLYI----------------------------------------------NS
CLPP2_RHIME/20-201LL--------F---LEA-E---NPKKEVALYI----------------------------------------------NS
CLPP2_BACHD/13-194LL--------F---LEA-E---NPKKDIYLYI----------------------------------------------NS
CLPP_CAUCR/20-201LL--------F---LES-E---NPKKEIAMYI----------------------------------------------NS
CLPP5_ARATH/107-288LL--------Y---LDA-V---DPTKDIVMYV----------------------------------------------NS
CLPP_MOUSE/63-244LL--------F---LQS-E---SNKKPIHMYI----------------------------------------------NS
CLPP_CALS4/12-193ML--------F---LEA-E---DPDKDIWLYI----------------------------------------------NS
O97252_PLAF7/180-359LL--------Y---LDN-I---NHN.DIKIYI----------------------------------------------NS
CLPP1_AGRFC/16-197LL--------F---LEA-E---NPKKPIHLYI----------------------------------------------NS
CLPP_XYLFA/19-200LL--------F---LEA-E---NPEKDINIYI----------------------------------------------NS
Q42886_SOLLC/95-274LV--------T---LAT-I---DENADILIYL----------------------------------------------NC
CLPP1_TREPA/17-198LL--------F---LES-Q---NPDKDISLYI----------------------------------------------NS
CLPP2_MYCLE/27-207LL--------V---LES-L---DPDRDITMYI----------------------------------------------NS
CLPP_DEIRA/15-196LL--------L---LDS-Q---NPEQEIQMYI----------------------------------------------NC
CLPP1_BACHD/12-193LL--------F---LQA-E---DPDKDISLYI----------------------------------------------NS
CLPP_THEMA/21-202LL--------F---LEA-E---DPDKDVYLYI----------------------------------------------NS
CLPP2_TREPA/15-193LF--------V---LES-L---SVSKPIYMYV----------------------------------------------DS
CLPP_CHLTE/37-218LI--------F---LES-E---DPERDIYIYI----------------------------------------------NS
TEPA_BACHD/48-232LV--------A---AEQ-N---KKIEGLLIIL----------------------------------------------NT
CLPP3_NOSS1/13-196ML--------Y---LDS-E---DPGKDIYLYI----------------------------------------------NS
CLPP3_AGRFC/23-198LV--------A---L.A-A---ASDDDIRVYV----------------------------------------------NS
CLPP1_RHILO/16-197LL--------S---LES-D---NPDKEISLYI----------------------------------------------NS
CLPP1_SYNE7/10-191LL--------F---LEA-E---DPEKDIYLYI----------------------------------------------NS
CLPP_CLOPE/13-194LL--------F---LES-E---DPDKDIHLYI----------------------------------------------NS
CLPP_RICPR/12-193LL--------F---LEA-E---NPKKDIYMYI----------------------------------------------NS
CLPP2_CORGL/13-195IL--------L---LSA-E---DPTRDISLYI----------------------------------------------NS
CLPP1_CORGL/24-204LL--------V---LEG-M---DPDRDITLYI----------------------------------------------NS
CLPP5_STRCO/18-201LM--------Y---LEH-Q---APDRDIELYV----------------------------------------------NS
CLPP_CLOAB/12-193LL--------F---LES-E---DPDKDIYLYI----------------------------------------------NS
CLPP_HAEIN/12-193LL--------F---LES-E---DPTKDINIYI----------------------------------------------NS
CLPP_CHLRE/310-482..--------.---..Q-E---EESKKVFMII----------------------------------------------NS
CLPP1_STRCO/32-208LL--------L---L.A-S---DPDKDIFLYI----------------------------------------------NS
CLPR2_ARATH/79-263ML--------Y---LDT-L---DDSRRIYMYL----------------------------------------------NG
CLPP3_SYNY3/13-197LL--------Y---LDS-D---DPSKPIYLYI----------------------------------------------NS
CLPP4_STRCO/14-196LL--------H---LES-S---APESEIAVYI----------------------------------------------NS
CLPP2_PSEAE/13-193LH--------I---L.A-S---ISDDPIYMFV----------------------------------------------NS
CLPP_WHEAT/13-197MV--------Y---LSI-E---DGISDIFLFI----------------------------------------------NS
CLPP2_STRCO/28-210LL--------C---LES-M---DPDRDISVYI----------------------------------------------NS
CLPP_AQUAE/19-200LL--------F---LES-Q---DPDKDIYLYI----------------------------------------------NS
CLPP3_SYNE7/13-197LL--------Y---LDS-E---DSSKPIYLYI----------------------------------------------NS
CLPP1_NOSS1/11-192LL--------F---LDA-E---DPEKDIYLYI----------------------------------------------NS
CLPP2_ARATH/41-222LL--------Y---LES-E---NPSKPIHMYL----------------------------------------------NS
CLPP_RALSO/34-215LL--------F---LES-E---NPDKDISLYI----------------------------------------------NS
CLPP2_SYNY3/32-213LL--------F---LDA-E---DPEKDIQLYI----------------------------------------------NS
Q8ZQG9_SALTY/47-225LV--------A---L..-.---GSITQINLHI----------------------------------------------HS
CLPP_CAMJE/11-192LL--------F---LEA-E---DPTKDIYLYI----------------------------------------------NS
CLPP2_MYXXD/11-192LL--------F---LES-E---DPDKGINLYI----------------------------------------------NS
Q9VKY3_DROME/38-219LL--------F---LQS-E---NVNKPIHLYI----------------------------------------------NS
F2YGL7_CHLVA/18-193ML--------Y---LNA-E---EQNKGLYIYI----------------------------------------------NS
G8AKT8_AZOBR/21-200LL--------F---LES-E---NPSKDIALYI----------------------------------------------NS
M4CIZ3_BRARP/88-261LL--------L---LDA-Q---DSERDITLFI----------------------------------------------NS
CLPP1_MYCTU/18-192IL--------L---LAA-E---DASKDISLYI----------------------------------------------NS
CLPP_STAA8/13-191LL--------F---LQA-Q---DSEKDIYLYI----------------------------------------------NS
CLPP_BRUA2/21-200LL--------F---LEA-E---NPKKEINMYI----------------------------------------------NS
CLPP_NEIG1/17-198LL--------F---LES-E---NPDKDIFFYI----------------------------------------------NS
CLPP_STRT2/10-192LL--------F---LDA-Q---DNTKDIYLYV----------------------------------------------NT
CLPP1_BACAN/14-192LL--------F---LEA-E---DAEKDIFLYI----------------------------------------------NS
Q8Y7Y1_LISMO/12-186LL--------L---LES-I---SND.PITIFI----------------------------------------------NS
CLPP_LISMO/12-192LL--------F---LDA-Q---DPEKDIFLYI----------------------------------------------NS
W8JRT3_9CHLA/15-194LL--------F---LMS-E---DPKKDIQIFI----------------------------------------------NS
W8UFH3_YEREN/25-205ML--------F---LEA-E---NPEKDIFLYI----------------------------------------------NS

PF00378

ECI1_MOUSE/39-287TI--------S---LEK-L---ENDKSIRGVILTSE-------CPG----IFSAGLDLLEMYGRNP..----------AH
MENB_BACSU/16-271ID--------A---FAD-A---RDDQNVGVIVLAGA-------GDK----AFCSGGDQKVRGHGGY.V----------GD
PKSH_BACSU/12-259LQ--------V---LNQ-C---ETS.TVTVVVLEG.-------LPE----VFCFGADFQEIYQEMKRG----------RK
PKSI_BACSU/10-249IQ--------A---FEY-I---RQNPKYKAVILTG.-------YDN----YFASGGTQEGLLR.....----------IQ
CAID_ECOLI/8-261GE--------V---FLN-F---RDDPQLRVAIITGA-------GEK----FFSAGWDLKAAAEGE...----------AP
ECI1_HUMAN/52-302VI--------S---LEK-L---ENDKSFRGVILTSD-------RPG----VFSAGLDLTEMCGRSP..----------AH
ECHM_HUMAN/42-290NQ--------A---LKT-F---EEDPAVGAIVLTG.-------GDK----AFAAGADIKEMQNL....----------SF
ECHM_CAEEL/40-288AD--------A---LEV-L---DTDKSVGAIVITG.-------SER----AFAAGADIKEMTNN....----------EF
ECHH_RHOCB/9-257TA--------A---LHR-A---RGE..ARAIVLTG.-------SGR----AFCSGQDLGDGAAEGL..----------NL

PF01343

Y651_METJA/110-263---------------EE-L---AKKKPVVVYV----------------------------------------------EG
SOHB_HAEIN/163-314---------------RL-K---QKGIKLTVAV----------------------------------------------DK
O26897_METTH/96-249---------------AI-N---KSEKPVVSWI----------------------------------------------SD
SPPA_HAEIN/387-539---------------NL-Q---KIGKPVIVSM----------------------------------------------GA
SPPA_SYNY3/126-282---------------KF-K---QSGKKIVAYG----------------------------------------------LN
SPPA_BACSU/129-283---------------IK-K---ETKKPIYVSM----------------------------------------------GS
P95072_MYCTU/128-283---------------AA-F---SAVKPSLAWA----------------------------------------------ET
SPPA_ECOLI/140-296---------------EF-R---DSGKPVYAVG----------------------------------------------EN
SPPA_SYNY3/383-536---------------EL-L---QAQKPVIISM----------------------------------------------GN
SPPA_ECOLI/391-543---------------AA-R---AAGKPVVVSM----------------------------------------------GG
P95072_MYCTU/402-555---------------RA-R---DRGKPVVASM----------------------------------------------GA
SCAF_LAMBD/148-300---------------AR-V---RDIKPVWALA----------------------------------------------ND
Y021_SYNY3/67-220---------------KQ-L---SEKIKVVASF----------------------------------------------GN
O25976_HELPY/103-256---------------AD-L---KQKMPVLAYA----------------------------------------------RG
SPPA_HAEIN/132-288---------------HF-K---DAGKPVIAYA----------------------------------------------DN
SOHB_ECOLI/161-310---------------.L-R---DKNIPLTVTV----------------------------------------------DK
Q0PC65_CAMJE/102-253---------------.D-L---KIKKPVLVYA----------------------------------------------SG

PF16113

D7SLU2_VITVI/50-384QN--------L---YKS.W...EENPDIGFVVM.KG.S.....G.R....AFCAGGDIVGLYNL.INK..........GR
F6I042_VITVI/68-402IE--------L---YES.W...EKDPHFGFVVI.KG.S.....G.K....AFSAGGDVVCLYQF.MDE..........GR
HIBCH_CHICK/45-375YP--------Q---IKA.W...EQDPETFLIII.KG.T.....GEK....AFCAGGDVRAIADA.GKAG.......DTMT
HIBCH_SCHPO/66-398LP--------K---LVS.L...EESNLAKVIIL.KG.......NGR....SFSSGGDIKAAALS.IQD..........GK
Q488V8_COLP3/18-356SA--------Q---LQQ.W...QTNDKIAAVFI.QG.A.....GEK....AFCAGGDVQALYKS.SIE..........QP
C4KDL8_THASP/20-344TR--------Q---LDA.W...AHDPAIRAVLL.RG.S.....GER....AFCAGGDVRALYEL.QRQ..........GA
A5FW64_ACICJ/17-342DA--------A---LLR.W...ADDPSVAFVMV.DG.R.....GER....GLCAGGDIRALYDA.AKS..........GG
F5Z7N6_ALTSS/21-362LD--------A---LQA.W...ENRSDLVCVVL.KA.A.....GEK....AFCAGGDIVSMYNA.MLE..........SN
Q8I523_PLAF7/190-524LN--------I---IKS.L...DNDERCFMVII.RS.T.....NSN....CFSSGSDVKYVVEN.KEQ............
E3FSI9_STIAD/13-346HP--------Q---LEA.W...AREPAVKAVVI.RG.A.....GGK....AFCAGGDVRAVAAS.LGTPVPE..GQSPLV
F0ZTV2_DICPU/166-501EH--------F---IKT.Q...VANDIVGSYSIHTT.T.....PGA....IQSSGIDFVNLYES.NQN..........RK
G5BGL1_HETGA/35-365HL--------Q---IKK.W...EQDPETYLIII.KG.A.....GGK....AFCAGGDVRVISEA.AKAK.......QELP
B6HLY2_PENCW/44-388LP--------R---LKE.W...EKSHLANMILI.SG.A.....GTK....ALCAGGDVAALALQ.NESGV......EGQK
Q1LLS5_RALME/36-367TG--------A---LQS.W...ENDPAVHAMVV.AG.A.....GGK....AFCAGGDIRWFYQA.HQA..........ND
F7QLT9_9BRAD/23-350VA--------A---LDE.F...ESDPGVSLVLL.EG.A.....GER....GLCAGGDIRGLYES.AKA..........G.
Q21WJ0_RHOFT/28-365TQ--------C---LLA.W...RGDARVKAVAI.RG.N.....SKTGPFGAFCAGGDIRFFHQA.ALA..........GD
A0A016PD16_GIBZA/69-413VP--------R---LVE.W...EKSDLANVVVL.KG.A.....GHK....ALCAGGDVAALAEM.NQQNE......TGWM
I1G4V7_AMPQE/50-378TT--------D---MKS.V...VPDNSINFMLV.RG.......GEK....AFCAGGDIRRVTEA.GKT..........GS
F6HIV7_VITVI/22-356LR--------N---LEV.Y...EKDPMVKLLIL.KG.Q.....G.K....AFCAGGDVVGMVLS.INE..........GH
Q8ES26_OCEIH/14-345HQ--------Q---LTA.W...KNDSNIKFILF.SG.N.....GPK....GFCAGGDIKTLYQA.KEN.........ESK
A7INC3_XANP2/15-342LP--------R---LRA.W...AKDPAITRVII.KG.A.....GEK....AFCAGGDVRSIYDL.GLSGR......AEEA
F4PNE6_DICFS/76-406NR--------K---LLN.Y...VHNDNLHLLIL.KG.S.....GNK....AYCAGGDIKELTSN.TRK..........LS
I1BHM9_RHIO9/79-409TP--------Q---LQA.W...EKSDLAKIIIL.KH.S.....GGK....GFCAGGDVKTVVDL.AEA..........KD
C8X9E6_NAKMY/35-349RA--------A---LAG.W...ADDPAVDVVLI.DG.A.....GER....GLCAGADIRALRQS.ILD..........G.
I1KQ42_SOYBN/46-396KS--------Y---LDE.W...ESDPRVKCVLV.DS.S.....SPR....AFCAGMDIKGVVAE.IQKDK......NTPL
Q13IB6_BURXL/22-355TE--------R---LSQ.W...KDDPAIYGVVI.RG.A.....GDR....AFCAGGDIRALYQS.YRD..........GS
E9SYN2_RHOHA/17-337AA--------A---LLE.W...ADDDAVDAVLL.TG.A.....GER....GLCAGGDIVSIYHD.ARD..........G.
G2NK33_STREK/15-339DE--------A---LTQ.A...EADASVVAVVI.SG.A.....GER....GLCAGGDIRSIYQD.ARA..........G.
D7SV41_VITVI/52-386KR--------L---YES.W...EENSDLGFVIM.KG.S.....G.R....ALCSGGDVVALNQL.INE..........GK
G7UPF5_PSEUP/25-367DA--------Q---LRR.W...ADDAAIACVVL.QG.A.....GEK....AFCAGGDLHALYRS.MRE..........YR
A8LME8_DINSH/12-333DA--------A---LRA.W...AEDPEVALVLI.EG.A.....GEK....AFSAGGDIVEMYET.GTR..........GD
B2W7S4_PYRTR/68-416IP--------R---LQE.W...AKSELAGVVII.KG.N.....G.R....AFCAGGDVAALAKW.NQQGP......KGQQ
B2IFQ5_BEII9/17-341SD--------Q---LKI.W...ADDPAVRVIIL.TG.A.....GER....GLCAGGDIRALCNS.GKA..........G.
E4XNE1_OIKDI/19-346RP--------Q---LKT.W....EESGIDRVIL.KA.E.....GGK....AFCAGGDIKDLTLP.TYNGD......YDSG
A1SIK1_NOCSJ/14-329RA--------A---LAH.W...ETDPQIDSYLV.TG.......EGR....AFCAGGDVRWIVEE.IAE..........RP
B0UJ66_METS4/21-343RA--------A---LDA.W...LADPGVTRIVL.RG.......AGR....AFCAGGDIRHLHDE.ARAR.......GPRA
D3PW51_STANL/21-338LA--------Q---LDD.W...ASDASVRAVVI.DG.E.....GER....GLCAGGDVRQLREA.ILH..........EV
Q084X0_SHEFN/18-357QA--------Q---LTK.W...QQDDSIACVVL.DG.A.....GEK....AFCAGGDVRAIYHA.SVA..........NP
B2JKB1_BURP8/21-360QA--------A---LDQ.W...RDEPGVLAVVV.RS.T.....SER....AFCAGGDIRYLYDA.FRR..........GD
G2J3D7_PSEUL/18-358QQ--------R---LSA.W...EADLGLVAVVL.RG.A.....GDK....AFCAGGDVRSLRRA.LLD..........DS
F4RGZ4_MELLP/11-358TS--------C---LVD.W...ENSEEVDLVIL.KS.......SSG....VFCAGGDLIPLMQP.ASSDV......PDTT
Q0C3Q9_HYPNA/20-349LA--------A---LQA.W...KADSAIHLVWIDHQ.E.....GTR....GFCSGGDIRMLAES.GAGD.......ASEA
F8J779_HYPSM/27-350LS--------A---IPR.V...ARNPDVYIVAL.VS.S.....SPK....AFCAGGDVVALSAA.AKS..........DI
Q2SP84_HAHCH/24-363YS--------V---MQE.W...RLDDKIVAVFM.QG.A.....GDK....AFCAGGDIVQMYES.ICE..........AN
E1VLZ8_9GAMM/17-356RA--------V---LEN.W...QKNDRVVCVFL.QG.A.....GEK....AFCAGGDVRKVYDS.ILA..........CG
D2V7D6_NAEGR/73-426RR--------I---LEQ.A...LSDTKVHFVIL.QS.A.....SDK....AFCAGGDIKDLRRG.FEY............
Q12MV4_SHEDO/18-360NA--------Q---LKK.W...QSDDNVACVML.EG.S.....GEK....AFCAGGDVRAIYQA.SIE..........NP
F5YTZ4_MYCSD/16-336TA--------A---LST.W...ADDPAVAAVVL.SG.A.....GER....GLCAGGDVVAIYHS.AKA..........D.
Q5WH10_BACSK/10-343LA--------Q---LQQ.W...KQDDEVALVLL.EG.A.....GSK....AFCAGGDIKALYSA.RDS.........KNG
B8ESI3_METSB/13-334AA--------A---LDR.W...RTDAAVGCVAI.RG.A.....GGR....AFCAGADIRALYEL.GKSGR......GDEQ
B9IB41_POPTR/22-356LE--------L---FLA.Y...EKDPNVKLLLL.KG.S.....G.R....AFCAGGDVAAVVRD.IRE..........AH
F0ZLP9_DICPU/30-365TP--------K---YQE.M...KNMKDGDMVLIMKG.S.....GEK....AFCAGGDIKAIYDY.KKGVAP....STENI
H2ZC72_CIOSA/54-386FP--------K---IKE.W...EEDPTTTMIIM.KG.A.....GGK....AFCAGGDIRTITDE.GSKGN......FEAG
Q2W460_MAGSA/13-341TA--------C---LVS.W...ESDPDVAVILI.EG.E.....GER....AFCAGGDIRMVWDA.ARRGD......SEFS
B1LX53_METRJ/12-337DR--------A---LDQ.F...SADPGIAAVLL.TG.E.....GER....GLCAGGDLRSLYD...NP..........G.
D5GGY6_TUBMM/44-383VP--------R---LRE.W...EKSQMANIIIL.KG.A.....G.R....ALCSGGDVAALVESIKGEGP......IGVQ
A4SZ56_POLSQ/13-344HQ--------T---LKI.W...ADDSEVLAVLI.QG.E.....GEK....AFCAGGDIRSIYES.ITS..........GG
E9T596_RHOHA/14-336YA--------A---LTK.W...RDDDAITAVLV.TS.A.....SER....AFCAGGDIKSVRQS.ALDRD......HNAV
F4CYK1_PSEUX/14-333AD--------A---LDD.F...EHDDGVRAVAI.DG.A.....GER....GLSAGGDVRFLVAD.AAE..........G.
Q5ZX62_LEGPH/13-340QK--------Q---LSI.W...KEDNSIKAVVV.QA.V.....PGN....AFCAGGDIRWLYNA.GRSK.......DSEQ
B9RD44_RICCO/57-391LK--------L---YKS.W...EENPDVGFVMM.KG.S.....G.R....AFCAGGDIVTLYNL.VKK..........GK
G0RME1_HYPJQ/43-386VP--------R---LIE.W...EKSDMANVIVM.KG.A.....GEK....ALCAGGDVAELAKY.NQESP......DGWK
A9WQX7_RENSM/20-336LG--------Q---LQL.W...AVDDAVQTVLV.YG.N.....GDR....GLCAGGDITAIYND.IPA..........G.
H1VE28_COLHI/45-366LP--------R---LLE.W...EKSDLANVVVM.KG.A.....GDK....AFCAGGDVAELAKY.NQESE......DGWK
G2IVT0_PSEUL/18-359NA--------Q---LQR.W...AADDTIACVLL.RG.A.....GER....AFCAGGDVRAVRDA.ILA..........HH
E2BCN8_HARSA/46-370HP--------I---LKQ.W.....ESSKRLVMI.EG.A.....GDK....AFCAGGDVKSITTV.LHEPN.....GETFG
C6W855_ACTMD/12-334HA--------A---LTR.W...ADDDSVRAVLL.DG.A.....GER....GLCAGGHIRSVHDD.ARA..........G.
A0A088AET4_APIME/95-420YP--------V---LKK.W.....ESSKKLVII.EG.A.....GDK....AFCAGGDIKSIGIE.IKNTG.....NKALA
Q143S2_BURXL/33-374AN--------L---LER.V...RNDDRIVALVL.RG.G.....DPK....GFCAGGDVRALYQL.ARR..........GE
F4S4Z1_MELLP/87-423TS--------R---LIE.W...ENSKEANLIIL.KS.......NGR....AFCAGGDVVSMTEA.VASGD......PKKE
B9J934_AGRRK/15-342AT--------A---LDD.F...AADPSIASVII.KG.E.....GER....AFCAGGDIRLLHQS.GKE..........K.
F4Q929_DICFS/53-395LN--------L---LKK.Y...ENDKRVTFVLV.VG.A.....GDR....AYCSGGDLLEFSSS.VEM..........S.
Q381D8_TRYB2/20-346SL--------A---YFH.E...HHPKGDNALFVVKG.M.....GEK....SFCAGGDIVMITTD.NSV............
A1BAK1_PARDP/12-321DA--------A---LQE.W...RDDPEVALVVI.DA.E.....GER....AFCSGGDIAAVYRA.GLE..........GD
G3WP62_SARHA/46-376YS--------Q---LKK.W...EQEPETSLIII.KG.A.....GGK....AFCAGGDIKAISEA.GKAK.......QKLA
B2IDI2_BEII9/14-338NQ--------A---LDT.L...ERESGVKTVVV.RG.A.....GGK....AFCAGGDMKFIYEL.GKAGR......HAEQ
I1MM39_SOYBN/20-357LE--------I---FSE.D...EKDSDIKLVVV.KG.N.....G.R....AFCAGGDVAAVARD.GSK..........GD
F6EFK8_AMYSD/12-332AA--------A---LAS.W...EHDDSVRAVAI.TG.A.....GER....GLCAGGDIVAIHRD.AQG..........D.
Q212Q2_RHOPB/18-345DA--------A---LDV.F...AADPDVALVLL.EG.A.....GER....GLCAGGDIRTLYNS.ARQ..........G.
G8MC08_9BURK/24-360AD--------R---FAT.C...AEDDAILAVVL.RG.S.....GDK....AFCAGGDVRKLYHA.ARN..........DP
A0JS02_ARTS2/30-352LG--------Q---LTA.W...ADDDGVATVLV.HG.A.....GDR....GLCAGGDIVAIYED.MLA..........G.
A8HXV6_AZOC5/51-378DP--------R---LRA.W...ARDPGVTRVIL.KA.A.....GER....AFCAGGDVRQIYDL.GRAGR......QAEA
HIBC8_ARATH/21-353AE--------Y---LEL.W...EKDDQTKLILI.KG.T.....G.R....AFSAGGDLKVFYHG.QES..........K.
B6Q688_PENMQ/41-385IP--------R---LLE.W...EKSQLANIIMI.SG.R.....GEK....ALCAGGDVAALAIN.NQEGP......EGVK
A0C505_PARTE/18-343LE--------S---TKL.W.....NEHAVVTIL.QG.......NGR....AFSVGGDLKHVFNI.SQRKN......DEPS
C1DFA4_AZOVD/17-349QR--------Q---LEA.W...AADPTILAVVL.RG.A.....GDK....AFCAGGDIRALYDS.FRA..........GD
G7Z662_AZOL4/15-341DP--------Q---LRA.W...NADPEVKAVVI.RG.A.....GEK....AFCAGGDVVSLYEA.GKAAKEG.RGDTTPV
Q5QW21_IDILO/17-357LP--------Q---LKK.W...AEDDKVACVWL.QG.A.....GEK....AFCAGGDIVAMYKA.MQA..........EP
C1DNT4_AZOVD/14-346HR--------Q---LQA.W...ADDPQILAVVL.RG.A.....GEK....AFCAGGDIRWLYES.YKK..........AD
Q230X4_TETTS/30-358QG--------R---IVP.W...T.QEGIKAVWI.NG.A.....GGK....AFCAGGDIKSLYDA.KKS..........GK
B9SXD3_RICCO/47-382TE--------L---YQS.W...EKDPLVGFVVL.KG.N.....G.R....AFCAGGDVVKLYQL.ITE..........GR
Q5LRB7_RUEPO/12-333DA--------A---LRN.W...REDDDVALVII.DA.E.....GDK....AFCAGGDIAELYDT.GTK..........GN
D6X3R7_TRICA/42-364YP--------T---LVQ.W.....ESEKSLVII.KG.A.....GGK....AFCAGGDVKSIALA.GMKG.......EKLG
A1R246_ARTAT/18-336LS--------Q---LTD.W...AADDAVATVLV.RG.A.....GDR....GLCAGGDIVAIYKD.MLH..........G.
D3BN96_POLPA/192-532EE--------F---VKD.K...IKDDTITSFSIHTS.T.....PGV....IHSAGTDFVTLFEK.RNT..........EL
B9SKJ5_RICCO/22-357LD--------L---FLA.Y...EEDPNVKFLVL.KG.N.....G.R....AFCAGGDVSAVVRD.IRE..........GN
B7G076_PHATC/15-365QD--------I---LKE.C...YADDSVGALLV.KS.NTTGMKT.K....AFCAGGDVKRVYRS.CLE..........EQ
F4F5N6_VERMA/14-334RR--------T---LAM.W...AASDRVRTVLV.SG.A.....GGR....GLCAGGDIRAIHAD.AVS..........G.
A9PBA7_POPTR/21-353AD--------F---LEK.L...EKDDNTKLILI.KG.A.....G.R....AFSAGGDLRMFYDG.RTS..........K.
G6DDP6_DANPL/16-332LP--------Q---LSE.W.....ENSKQLVII.KG.A.....GDK....AFCAGGDVKAAIDR.EEG............
F8AY96_FRADG/12-334AD--------A---LTA.W...EHDERIRAVLI.DG.A.....GER....GLCAGGDIRSIYDD.VSS..........G.
H6N4E1_GORPV/12-333YD--------V---LLR.W...ADDDDIETVML.TS.G.....TDR....AFCAGGDIRAIRDS.ALADD......TESI
E0VLB5_PEDHC/53-383RP--------T---LIS.W...SQDK..YLILM.KG.A.....GEK....AFCAGGDVVSVVKD.KTG..........ET
Q0A896_ALKEH/22-361SR--------Q---LEA.W...ARDPAVACVVL.EG.E.....GER....AFCAGGDVRAVAEA.LRG..........NR
D8SM52_SELML/13-356KN--------Y---LDE.W...AANPAVKAVLV.ES.S.....SSR....AFSAGMDVKWLAAT.LKDDI......HSPL
D7AAE9_STAND/32-359RA--------Q---LDA.W...IADDSVAHVVL.RS.A.....HER....AFCVGGDVRAMATL.GREGR......KEEA
D7MNH9_ARALL/19-353LQ--------L---FLA.F...EEDSSVKLVIL.KG.N.....G.R....AFCAGGDVAAVVRD.IEQ..........GN
E3I3E7_RHOVT/14-335EQ--------A---LDK.W...EHDSGVDVVVV.DA.A.....GEK....AFCAGGDIADLYKK.GRA..........GD
D0J4R8_COMT2/40-371LG--------T---LLA.W...QKDDSILGVAI.RG.S.....NKEGVFGAFCAGGDIRFLHAA.GSS..........GN
D5QAS0_KOMHA/14-335AA--------C---LAR.W...REDREVRTIVI.DS.T.....SSR....AFCAGADLRALITL.LRA.........QGA
F4NRB7_BATDJ/54-395TS--------Q---LKT.W...KDSDLCKVIVL.ANVE.....GSR....AFCAGGDVKTLVLK.ASS..........GK
G3QQM4_GORGO/20-355YP--------Q---LKK.W...EQDPETFLIII.KG.A.....GGK....AFCAGGDIRVINYT.SPAPI......LTAP
A1K1H9_AZOSB/18-358AP--------Q---LDA.W...AADPDIVGVVL.DG.S.....GDK....AFCAGGDVAALYRA.LRA..........HD
Q0IP17_ORYSJ/128-462LR--------C---FTA.Y...EEDDGVKLLIV.KG.K.....G.R....AFCAGGDVAAVVRS.INN..........DS
A1TSJ8_ACIAC/16-348ME--------A---LLR.W...RSDPAVHAVAI.RG.T.....NKEGAFGAFCAGGDIRFLHQA.GST..........GN
HIBCH_DICDI/33-370TP--------K---YLE.M...KTKKDGEGVIVMKG.A.....GEK....AFCAGGDIRAIYDY.KQLNEEQKSKTNDIG
I1BZ13_RHIO9/189-518TP--------Q---IKA.W...EKSEMIDVILL.KH.S.....GGK....GFCAGGDVKMVVDL.AKA..........KD
A9SUT7_PHYPA/29-361AE--------A---YEQ.W...EEDDSVGFIVL.KG.A.....G.R....VFCAGGDLKTFYGL.GKS..........D.
D3HQR9_LEGLN/13-338QW--------Q---LSL.W...KEDDTVHAVVV.RA.A.....SGN....AFCAGGDIRSLYFS.GQIN.......DAEQ
G4NGW1_MAGO7/67-414TP--------R---LLE.W...EKSDMANVIVM.KG.A.....GDK....AFCAGGDVAALAEA.NVKGK......QGVQ
A9RJN7_PHYPA/31-365LE--------L---YMK.W...EKDERVRMVII.AG.A.....G.R....GFCAGGDVAVVYLL.GKS..........GD
A9TYA6_PHYPA/60-394LE--------L---YVK.W...ENDKHVRMVIL.AG.A.....G.R....GFCAGGDVATVYHL.GKA..........GQ
E1VZ37_ARTAR/22-349SR--------V---LRA.W...AQDSSISLVLL.TG.R.....GQR....AFCAGGDIADFHAA.ITT..........GR
Q4DMX8_TRYCC/74-400LW--------L---HLK.R..PHPSLPRSAIYILKG.A.....GNK....SFCAGGDVRSIVAH.GTL............
Q6LIA0_PHOPR/19-359KD--------K---LMT.W...QDDEHIVSVFL.DG.A.....GEK....AFCAGGDVRSMYHA.MES..........ET
B7Q288_IXOSC/44-375YP--------T---LKK.W...DTDPDMKMVII.KAKK.....DSK....AFCSGGDVKAIAQT.KGQD.......TNLR
H3B677_LATCH/47-377YP--------Q---LKK.W...EQDAETSLVII.KG.A.....GGK....AFCAGGDIRAVTEA.GKVG.......DKLS
B4M5Z4_DROVI/22-343YK--------H---LKK.C.....EKSKSLMII.KG.T.....GDK....AFCAGGDVRALVDA.GPT.........DES
A7RHZ5_NEMVE/46-374YP--------Q---LKQ.W...DMDPNIGVILI.KG.T.....GDK....AFCAGGDVRAIAEA.GLRG.......EDLT
Q8FQY6_COREF/29-353QE--------A---LDK.W...IDDDAVHRVLI.YS.T.....TDR....AFCAGGDVRAVREA.VLG..........GN
E1VC38_HALED/19-356AD--------K---LDA.W...AVDPGVVAVWL.EG.S.....GDK....AFCAGGDVVALYRA.LQE..........TS
Q11J99_CHESB/19-339SR--------T---LSQ.W...EADSSIRFVVI.MG.......EGR....AFSAGGDIVDVYRA.GLAGK......ASPA
B0S642_DANRE/44-374YP--------Q---LKK.W...DKNSETDVVII.KG.A.....GEK....AFCAGGDIRAIAEA.GKAG.......DSLS
D7LRR5_ARALL/47-381QK--------L---YKN.W...EEDPNIGFVMM.KG.S.....G.R....AFCAGGDIVSLYHL.RKR..........GS
F8K1G3_STREN/18-341TA--------A---LDR.W...RDDDSVHAVVI.AS.T.....SPK....AFCAGGDIRAVREA.ALRGD......LAAV
G2KLT0_MICAA/19-358HA--------A---LEA.W...RDDDGIRAIII.RG.A.....GDR....AFCAGGDVKAVYEA.GVNVT......DPDA
B6JX18_SCHJY/32-363HP--------R---LIK.Y...EKSDMTKLIVF.RG.......VGR....AFSSGGDVKAGAIN.IKK..........GR
I1M992_SOYBN/52-386KR--------L---YDS.W...EENSDIGFVLM.KG.S.....G.R....AFCSGADVVRLYQS.LNE..........GN
A8NEJ7_COPC7/45-386RP--------K---ILE.W...NSSDLCGAIVG.TG.......AGR....AFCAGGDVATVVEN.ASDPT......TRPL
Q12AQ1_POLSJ/18-355TP--------A---LRA.W...AADPGMAGVVL.QA.S.....GDK....AFCAGGDLRELYQS.MRD..........CG
Q1QVU3_CHRSD/19-353HA--------R---LEA.W...AQAPAVHAVWL.QG.A.....GGK....AFCAGGDVVALYHA.MRG..........AH
I1JMV6_SOYBN/52-386HK--------L---YRS.W...EEDPDIGFVML.KG.S.....G.R....AFAAGGDIVALYHL.INK..........GN
Q4JU31_CORJK/25-358RE--------A---VDR.W...ADDDWIRFIVI.KS.S.....SDR....AFCAGGDVRYVRMR.DMK..........RM
Q2GA19_NOVAD/13-336TA--------S---LLQ.W...RGDASVGVVLIDHA.......EGR....GFCAGGDIAFLRNS.ALNDG......GTSG
Q2N893_ERYLH/16-341SA--------A---LAD.W...ADDDEVEAIILDHA.......EGR....GFCAGGDIAFLRNS.ALNDG......GVSG
Q16U65_AEDAE/33-352YG--------A---MKN.W......QDKSLVIV.KG.A.....GEK....SFCAGGDVRAVVEN....GP......IDSS
C6XIW5_HIRBI/14-333SN--------A---LSD.W...KINNEVKLIVIDHA.E.....GTR....GFCAGGDIKPMAES.GQGD.......GVDV
C3PF62_CORA7/13-336TA--------V---LQE.W...QDDDRVKLVIL.RG.A.....GER....GLCAGGDVAALYHD.ALE..........GG
D8IW53_HERSS/21-370TP--------Q---LQH.W...QADPEVAMVVL.QA.Q.....GEK....AFCAGGDLQQLYRS.MRE..........HH
C8WWK9_ALIAD/12-344RR--------H---LDE.M...AQDPSVELVVL.YG.E.....GDR....AFCAGGDIRALYDA.KDEPN......LETA
F0XEA1_GROCL/74-428VP--------R---LLE.W...ERSDMANVVVL.KG.A.....GDK....ALCAGGDVAALAAA.NRGGP......AGQQ
Q0BR39_GRABC/31-348QQ--------T---LNL.W...RDDPAVTAIIL.QG.T.....GR.....AFCAGADVRRLREA.VLA..........DD
F2T0Y3_TRIRC/73-417LP--------R---LQE.W...EKSQLANIVMI.SG.A.....GTK....AFCAGGDVAELAKQ.NTEGV......SGQQ
A1WLH8_VEREI/23-355MR--------I---LLA.W...QSDAQVHAVAI.RG.S.....SKDGPFGAFCAGGDIRFLHQA.GSQ..........GD
A9C200_DELAS/16-348LA--------T---LLA.W...QKDEQVLAVAI.RG.M.....GKEGVFGAFCAGGDIRFLHGA.GST..........GN
Q2L131_BORA1/18-371NA--------R---LNA.W...AQNPAVALVVL.QG.A.....GGK....AFCAGGDLHGLYAS.MRE..........HR
F2R851_STRVP/13-333EE--------A---LTA.W...RDDPAVEAVVI.SG.A.....GER....GLCAGGDIRAIHED.ARN..........G.
D5BR70_PUNMI/19-347HD--------Q---LAA.W...DQDDTVSHVIL.KS.S.....APR....AFCAGGDVRLARTL.MTE..........DP
E1VS22_ARTAR/12-327LD--------A---LLE.W...KDDPNIAQVAV.MG.A.....GER....GLCAGGDIVAIHRD.ILD..........RS
Q28R37_JANSC/11-334EA--------A---LDA.W...AGDDAVDLVMI.DA.A.....GER....AFSAGGDIQEMYDT.GMA..........GD
C3Z9L9_BRAFL/41-373YP--------K---LKE.W...EDNDDTTMIII.KG.A.....GDK....AFCAGGDIRAVTEA.GKTG.......DRLA
B3S7F3_TRIAD/23-347YP--------I---MME.W...DKDPNVQVIVM.KG.A.....GEK....AFCAGGDVKSLV......GN......RPLS
A5V401_SPHWW/17-339IG--------A---LTA.W...ATDDAVDLVMIDHA.......EGR....GFCAGGDIRHIAES.AKGD.......GSEG
E5SEM2_TRISP/42-371FE--------K---LKK.T...NTDNSTKMVIL.KG.A.....GNK....AFCAGGDIRALALS.IKNN.......DGLV
C0HHJ2_MAIZE/66-416KA--------L---LDE.W...ETNPSVKCILV.ES.S.....SSR....AFSAGMDIKGVAVE.IQKDK......KTPL
B0CSR7_LACBS/50-391RP--------K---IEE.W...SASDLCGTIVG.RG.......SGP....VFCSGGDVASVVQN.AADPA......TRPK
A4VIV7_PSEU5/16-354LD--------Q---FNR.W...ATDPAVVCVLL.RG.N.....GPK....AFCAGGDVRKLAEA.CRS..........EP
D4ZAM5_SHEVD/14-353LA--------Q---LMR.W...QDDDAIAMVML.DG.A.....GEK....AFCAGGDVRAIYHA.SVA..........TP
A7HX73_PARL1/15-335HP--------Q---LAA.W...AEEPNVQCVVI.EA.A.....GEK....AFCAGGDIRALYDW.GQAGD......RTAL
F4QC51_DICFS/178-513DE--------Y---LKE.V...IINERISCFSLHTS.T.....PGL....IQSAGTDFVAMFEK.RNT..........EY
Q7NWA8_CHRVO/15-354DA--------R---LTI.W...ERDEGIVAVVL.RG.A.....GER....AFCAGGDVRGLREK.LVS..........EP
G0MPK6_CAEBE/44-375YP--------K---LQE.W...NSSADVDLVIL.KG.S.....GDK....AFCAGGDVLAVVRS.YKDAQEG..KDCTMH
Q55GN0_DICDI/49-392SE--------K---LKE.F...NNDDNCKFVII.NS.S.....TEK....SFCSGGDIKEFSQL.SRS..........SA
C7RD63_ANAPD/10-343YD--------I---LEK.W...KDDGRIRAVLF.DS.L.....AEK....GFCAGGDLKEVYED.YLTND......DEED
Q6CA37_YARLI/41-379FP--------R---LKE.W...LKSDSANVVLF.KG.S.....GNK....AFCAGGDVATLAKQ.NAA..........GA
A9V573_MONBE/16-343QD--------E---LQR.F...QASSDTDVMVL.VG.A.....GEK....AFCAGGDVVQVAKS.AKG..........QL
A0BEK3_PARTE/25-354NQ--------I---LDQ.......ANSASCIIL.SG.E.....GGK....AFCAGGDIKTLYFA.KTQPS......EQNP
F2R4L5_STRVP/18-338DA--------A---LDA.W...EHDPAVTTVVI.EG.A.....GDR....GLCAGGDIRAIHDD.ARA..........G.
HIBC5_ARATH/51-385KR--------L---YES.W...EENPAISFVLM.KG.S.....G.K....TFCSGADVLSLYHS.INE..........GN
E4N1A8_KITSK/18-339RA--------A---LDG.W...ADDDRVSAVLL.SG.A.....GER....GLCAGADIRAVHDD.AKL..........G.
E5ASB4_BURRH/34-371AQ--------W---VEQ.C...RADDRILTLVL.RG.A.....GDK....GFCAGGDVRALYQL.ASA..........GE
H3FRY8_PRIPA/40-371YP--------L---MKK.W...DDGGHVSMVIV.KG.A.....GGK....AFCAGGDVLAVTKS.AQDAKAG..GESTLH
A9HE55_GLUDA/18-336AA--------C---LAD.W...REDPSVETVLI.DS.S.....SPR....AFCAGGDLRAIHAT.LGA.........AGP
F2IWL1_POLGS/13-333AE--------R---LDA.W...ARDDSIAHVVV.RG.A.....GGK....AFCAGGDIRRIYEM.GKAGD......PHQV
Q7MDJ7_VIBVY/19-358KN--------S---LEK.W...HEDEQIICVIL.KG.A.....GEK....AFCAGGDVRAMHHV.MSS..........ES
D5UVM7_TSUPD/17-334DA--------A---LQA.W...ESDDAVTRVLI.TS.A.....SPK....AYCAGGDIRAIRDQ.VVAGE......DFTP
G8SEU3_ACTS5/15-332RR--------A---LAG.W...AASDTVRAVLI.TG.A.....GER....GLCAGGDIRAIHAD.AVS..........G.
Q0VP05_ALCBS/18-356SE--------K---LDA.W...EQRSDIVAIWL.DG.A.....GDK....ALCAGGDIVQMHKS.MVK..........HA
B2UAB6_RALPJ/70-398SH--------A---LLA.W...QHDPEVHAVIL.RG.E.....GGK....ALCAGGDIRFFYRA.ATA..........GD
A1S5D0_SHEAM/18-354SA--------Q---LKA.W...QADSNIAMVLL.DG.A.....GDK....AFCAGGDVRALYQA.SKD..........AP
H8MVZ6_CORCM/13-341HP--------R---LDA.W...AADPSVKAVVI.RG.A.....GGR....AFCAGGDVRAVASS.VARSD......ASLS
D5ATL9_RHOCB/13-333EA--------A---LEG.W...RHDPAVEVVII.DA.V.....GER....AFCAGGDIATIYHL.GKE..........GD
B9RPB0_RICCO/58-404KS--------F---LDE.W...ESDPRVKCVLV.EG.S.....SPR....AFCAGGDVKAITSK.NQL..........SH
B6IMT6_RHOCS/17-352DP--------Q---LQA.W...ARDPAVTAVLI.RG.A.....GDR....AFCAGGDVRAVHDD.GLAWKKG.ESDGALT
H6BSS6_EXODN/72-425LP--------R---LRE.W...EKSQIANIVMI.SG.A.....GPK....AFCAGGDVAELANQ.NRQGP......EGQK
Q1GNL4_SPHAL/17-339ID--------A---LLK.W...RADDGIEAVTIEHS.......EGR....GFCAGGDIRMLAES.GAKD.......GVEA
E9IZM3_SOLIN/56-380YS--------T---LKQ.W.....EPSKKLVII.EG.A.....GEK....AFCAGGDVKSLVLA.LNEPK.....GELLG
Q6FM09_CANGA/43-400FN--------T---LTE.Y...SKSDAANLILI.KSNN.....SPR....SLCAGGDVASVAQS.NLDKN......FESS
E1SUP0_FERBD/18-358HA--------Q---LLS.W...QADDNVVCVWL.QG.A.....GEK....AFCAGGDIRAMHQA.AAD..........HP
G4RGU8_PELHB/12-344RY--------A---LDE.W...DENEAVRTVLI.EG.E.....GEK....GLCAGGDVRRTREM.AMA..........GE
G2P5N8_STRVO/31-352AE--------A---LTD.W...ERDPAVQAVVI.GG.A.....GER....GLCAGGDIRMIHRD.VTS..........GG
HIBC2_ARATH/15-349LQ--------L---FLA.Y...EEDPSVKLVVL.KG.Q.....G.R....AFSAGGDIPPIVRD.ILQ..........GK
Q4Q4Q6_LEIMA/22-353HR--------L---YIT.....EPHPNEDAVYVVRG.D.....GRR....SFCAGGDLKALTGP.ERD..........TH
G7DUF6_MIXOS/94-452KP--------A---LRR.W...KDKQECKLVLI.KG.......AGR....AFCAGGDVVAIVQG.AKEPA......GRAQ
C1DAN4_LARHH/20-362AE--------R---LTR.W...QHDPDIALIVL.AG.S.....GDK....AFCAGGDIRALRRQ.LVE..........EP
A1U6V2_MARHV/15-353QQ--------A---LAQ.W...AEDSRICLVVL.QG.A.....GDR....AFCAGGNIRALYPA.LTG..........DG
C7NJ16_KYTSD/22-350LG--------Q---LRE.WDAAEGEQRPRAVVV.SG.E.....GEK....GLCAGGDIKVLREA.ATS..........GE
D2VUW6_NAEGR/936-1276LH--------Q---FKV.M...DTNPIINLITL.SG.I.....GNG....FLSAGYDFRELQNL.MDK..........GD
C4WVV0_ACYPI/36-362KP--------K---LKE.Y.....ESLVRMVII.QG.A.....GGK....AFCAGGDVKSITEN.GPGAK......SLEL
E9G4T3_DAPPU/56-370TP--------A---LKQ.W....ENEEKVLIII.HG.T.....GGK....AFCAGGDVRSIIET.RNQPT......STLS
C1EG25_MICSR/14-367LE--------V---YAK.S...ESDPGVKAIVV.QG.......SSEARVPCLCAGGDVKRIYEM.RLHSK......PEQH
F4GS44_PUSST/18-360AA--------Q---LRQ.W...EDDTQIAMVVL.RG.A.....GDR....AFCAGGDLHGIYKG.MQD..........NS
A4F9Q5_SACEN/15-334SE--------T---LCR.W...RDAEHIEAVLI.DG.A.....GER....GLCAGGDIRALYDA.AKA..........GD
G8RS69_MYCRN/28-352AP--------V---LDD.W...ADNDDIHTVLV.DG.A.....GDR....GLCAGGDLVALYHS.ARA..........E.
G3IHA0_CRIGR/18-348YP--------Q---LKK.W...EQDPETFLIII.KG.A.....GGK....AFCAGGDIKAISEA.KNTR.......QNLT
G2QR77_THITE/46-391VP--------R---LLE.W...SKSDMANVIVM.KG.A.....GDK....AFCAGGDVAQLAQW.NKEGP......EGQK
B9TBM0_RICCO/16-343TR--------A---LLD.W...RDDERVAAVLV.RS.S.....SEK....AFCAGGDIRFFYEA.GRSTP......QGGS
Q4DMX9_TRYCC/20-346QR--------A---YVH.E...PHAKGDSALFVVKG.A.....GNK....SFCAGGDIVSLKDR.YDV............
D7FIS1_ECTSI/31-370SA--------A---IEEHW...SVDQVPKLLVL.RG.S.....GGK....AFCAGGDVKAVAQS.ERRGL......GVSG
E8NCI0_MICTS/19-345AA--------A---LDR.W...QDDTDIELILL.DG.A.....GER....GFCAGGDVRALHGL.VVE..........GR
Q89N86_BRADU/17-344ET--------A---LDR.F...ETDAAVAVIVL.EG.A.....GER....GLCAGGDIRTLWES.SKV..........H.
E8RLF2_ASTEC/19-339AH--------T---LSQ.W...AADDRVRYVVLDHS........GR....AFCAGGDVRAAARS.GRAD.......GEAA
F0M0J8_VIBFN/19-357FD--------Q---LKQ.W...QDDEQLMCVIL.EG.G.....GEK....AFCAGGDVRTMHNV.MRD..........KC
A1U2J0_MARHV/19-355KP--------Q---LQR.W...ADDDSVCAVWL.EA.E.....GDK....AFCAGGDIVSLYRS.MTE..........PG
Q0RM03_FRAAA/66-391DA--------A---LRD.W...ADDPTVAVVVL.DG.A.....GER....GLCAGGDIRAIREA.VLA..........GA
H3DE45_TETNG/45-375YP--------Q---LKK.W...EDEEDTGLVLI.KS.V.....GGK....AFCAGGDIRAVTEA.GKVG.......DSLS
B4RB39_PHEZH/14-336TD--------A---LLG.W...KDDPAVELVLLDHS.......GER....GFCAGGDIRMLAES.GQGD.......GSAA
F0ZI93_DICPU/87-416NK--------K---FQY.F...RDDPKLSLMII.KG.N.....G.R....AYCAGGDIKELSIQ.TRD..........IG
G1X6E1_ARTOA/73-419LP--------R---LLE.W...QKSQMANVVVI.KG.T.....GDR....AFCAGGDVAVLAEQ.NRMGP......AGQQ
A4G9P0_HERAR/23-358SQ--------A---LSA.W...RTDENVHAALI.NS.S.....TPK....AFCAGGDIRFFYDV.GIAGL......RGGS
A0R2Y4_MYCS2/15-335GK--------A---LHA.W...ENDDSVHTVLL.TG.A.....GER....GLCAGGDVVALYHS.AKA..........G.
D3B388_POLPA/36-371TP--------L---YQR.L...HQSKDGDAVVVMKG.A.....GGK....AFCAGGDIRSIYDT.NNPKTRNPSVRPDDT
C6THR1_SOYBN/37-369AT--------Y---LEK.W...EKDEKAELVII.KG.A.....G.R....AFCAGGDLRVFYDG.RKI..........K.
D8RN96_SELML/20-345AE--------L---FEQ.W...ERDESVELIII.KA.......AGK....VFSAGGDLRMFYDH.RKD..........ES
F6AA82_PSEF1/16-354QD--------R---LRA.W...AEDADIACVLL.RG.N.....GSK....AFCAGGDVVQLAKK.CLA..........SP
F8E0K2_CORRG/15-348HE--------A---FSQ.Y...EADDSVGQYII.RS.T.....SSR....AYCAGGDVRWVREQ.DLA..........DN
F2GC52_ALTMD/22-362LD--------A---LRQ.W...QARSDIVAVVI.DA.A.....GEK....AFCAGGDIVSMYNS.MVE..........AH
A4I8I6_LEIIN/21-350HR--------L---YVT.....EPAPPSSLYIL.TG.A.....GTK....AFCAGGDVIGLATN.NPP..........GC
A4VKU6_PSEU5/16-348HQ--------Q---LSA.W...AADPQIHAVVL.RA.N.....GEK....AFCAGGDIRSLYDS.FQR..........GD
A4XS22_PSEMY/16-354DA--------R---LQA.W...AEDPTIACVML.RG.N.....GPK....AFCAGGDVVQLVQQ.CRE..........HP
A8Q2H6_BRUMA/37-374YP--------M---LKK.C...DSDSSVPFIFV.KG.T.....GGK....AFCAGGDIVAVSRS.AQA..........ND
B1MKI3_MYCA9/13-333NA--------V---LAE.W...EADDAVRVVVL.SG.A.....GER....GLCAGGDVVAVHDS.AKI..........DG
B1VV62_STRGG/15-334AA--------A---LDR.W...EHDHGVATVVI.TG.A.....GER....GLCAGGDIRSIHED.AKA..........GG
B4FIT7_MAIZE/26-359LW--------Y---FTA.F...EKDDGVRLLIM.KG.N......RR....VFCSGGDIAQCARC.LYN..........GN
B9IL60_POPTR/51-383KR--------L---YES.W...EENHDIGFVLM.KG.S.....G.K....AFCSGSDVVSLCEL.LNE..........GK
C1A226_RHOE4/16-335AK--------A---LAE.W...KSDDDVKAVVL.TG.A.....GER....GLCAGGDIVSIYHD.AKD..........GK
C4R612_PICPG/39-387VP--------R---LLE.Y...SKSDSNNLIVL.RS.D.....EPR....AFCSGGDVVQCAKD.NLA..........GQ
C5AQY8_METEA/35-359HR--------Q---LRA.W...AGDARVSRIVV.RG.S.....GGR....AFCAGGDIRQIQAL.GKA..........GR
C5CR27_VARPS/20-356TP--------K---LRE.W...AADDGIIGVLL.QA.A.....GEK....AFCAGGDLRQLYQT.LLECG......PAR.
C5GL55_AJEDR/45-388TP--------R---LKE.W...EKSELANIIII.SG.A.....GSK....AFCAGGDVAALAEQ.CAEG.......PEGQ
C7JEY4_ACEP3/21-337KA--------A---LQT.W...RDDPSIHTILL.ES.S.....STR....AFCAGGDLRAIHDC.LKA..........QG
C8V2I5_EMENI/70-410LP--------R---LKE.W...EKSQLANIIMV.AG.A.....GTK....ALCAGGDVAALALQ.NEKG.......PEG.
D9Q9E6_CORP2/23-349DQ--------A---LDA.W...WDDDAVHRVIV.CS.T.....SEK....AFCAGGDVRTSREQ.ILA..........GK
F6INA5_9SPHN/14-335SS--------A---LAD.W...ADDDNIGAIMI.DH.S.....EGR....GFCSGGDINLLRKS.ALN..........DG
F8Q7W3_SERL3/52-393RP--------Q---IEE.W...TKSDLCKVIVG.TG.L.....G.R....AFCAGGDVANVLQD.SLH..........ND
G8PLL8_PSEUV/25-348HR--------Q---LER.W...LIDDAVHHVLI.KS.N.....SEK....AFCAGGDIRQVAEN.GPE..........NI
M0YPS1_HORVD/57-387NK--------F---YES.W...EDSPDIGFVMM.KG.S.....G.R....AFCAGGDVVGLRQL.INE..........GK
M1FH42_9ALTE/19-355TP--------Q---LKA.W...AEDERICAVWL.EA.E.....GDK....AFCAGGDIVALYRS.MTE..........AG
O53419_MYCTU/16-336AT--------V---LMS.W...EHEDAVHAVVL.SG.A.....GER....GLCAGGDVVAVYHS.ARK..........DG
Q0K1Z5_CUPNH/27-360GA--------Q---MEA.W...ARDDAVRAVVL.RG.A.....GPK....AFCAGGDIRALTDS.YRD..........GT
Q0K9D4_CUPNH/13-344TQ--------A---LQT.W...AAAPEVAAVVV.AG.A.....GGK....AFCAGGDIRYFHKA.AHE..........GD
Q13M23_BURXL/27-363AV--------L---VEH.C...RTDDGIVALVL.KG.A.....GTK....GFCAGGDVREVQRL.AKN..........GD
Q1D8V8_MYXXD/13-346HP--------A---LDA.W...AADPSIQAVVI.RG.A.....GGR....AFCAGGDVRAVALS.VGDA.......SAE.
HIBCH_XENTR/46-375YP--------Q---LGL.W...EEDPETYLVII.KG.V.....GGK....AFCAGGDIRAVTDA.GKA..........GD
Q2RTB1_RHORT/15-345DR--------A---LRA.W...ATDKTVGVVTV.EG.S.....GGR....AFCAGGDVRALAEV.GKN..........GA
Q2YNA1_BRUA2/20-339DR--------A---LQA.W...EDDPEVACVIL.EG.E.....G.R....AFCAGGDVVAAFKA.GQA..........GT
Q3J1K7_RHOS4/13-327DA--------A---LRG.W...IGDPEVELVVI.DA.E.....GPR....AFCAGGDIAELHGR.GVA..........GD
Q3SQN0_NITWN/20-346HK--------A---LDE.F...EADPEVGLILI.EG.A.....GER....GLCAGGDIRSLWES.ANA..........GG
Q5JMX9_ORYSJ/26-356AQ--------F---LES.W...EKDEDAKLVIF.KG.A.....G.R....AFSAGGDLKMFYEG.KSD..........DS
Q63MM8_BURPS/27-362AA--------W---LER.C...RDDRSIVAVVL.RG.A.....GDK....GFCAGGDVRALYRM.AKA..........PG
Q63TV7_BURPS/21-364HR--------A---LDA.W...RDDADVLAVVI.HS.P.....HPR....AFCAGGDVRFFHDA.HRR..........GD
Q65IX3_BACLD/15-345GE--------K---LNE.W...ETDQNVSIVVI.KG.A.....GPK....GLCAGGDIKALYEA.RSS..........KQ
Q6N492_RHOPA/19-345DR--------A---LDT.F...AADPDVALILV.EG.A.....GER....GLCAGGDIVGLYNS.ARE..........GG
Q6NI92_CORDI/19-346DQ--------A---LDQ.W...WDDDAVHRVLV.YS.N.....SPK....AFCAGGDVRAAREA.IQA..........GR
Q7APV2_MYCLE/16-336TA--------I---LTS.W...ADDDAVRAVVL.SG.A.....GER....GLCAGGDVVAIYHS.ALK..........DG
Q7VYA4_BORPE/19-371DA--------R---LRA.W...AADAAVAMVIL.QG.A.....GEK....AFCAGGDLHGLYRS.MRENTG...GDPWA.
Q83AM7_COXBU/43-368HE--------Q---LLG.W...ESDRTIKAVVI.KG.A.....GDR....AFCAGGDIRTLYMN.GKE..........HL
Q87H46_VIBPA/18-356YK--------Q---LNE.W...QMDDSIVAVFL.HA.K.....GDK....AFCAGGDIQAIYRA.LEN..........KE
Q87II2_VIBPA/19-358HD--------Q---LIK.W...QHDPHVVCVVL.SG.A.....GEK....AFCAGGDVRAMYHV.MHN..........ES
Q87YT7_PSESM/28-360RQ--------Q---LDL.W...ADDASVHAVVL.RG.A.....GGK....AFCAGGDIRSLYES.HKN..........GQ
Q88H70_PSEPK/22-354RQ--------H---LDQ.W...ADNPQVRAVVL.RG.E.....GPK....GFCAGGDIRSLYDS.FKA..........GD
Q8NRX2_CORGL/14-334QE--------A---LTT.W...ADDDQVQQVLI.YS.S.....SER....AFCAGGDVRAVRES.VLE..........GD
Q8XS34_RALSO/27-369SA--------L---LAQ.C...RDDPRIAAVVL.RG.A.....GEK....GFCAGGDVRALYRL.ARQ..........GQ
Q92TQ6_RHIME/18-338AA--------A---LTE.F...ERNPEIAAVLV.TG.E.....GER....GLCAGGDIRMIYES.GRE..........RP
Q983C3_RHILO/18-337GV--------A---LRA.W...ERDDGVDVVVV.KA.E.....G.R....AFSAGGDILHIYEA.GRA..........GK
Q9A8K1_CAUCR/15-337IG--------A---LLD.W...QDDPEVYMVLI.DH.T.....GER....GFCAGGDIRMLADS.GAK..........DG
Q9I5I5_PSEAE/16-354AA--------K---LDA.W...AEDAGIACVLL.RG.N.....GAK....AFCAGGDVRKLVDA.CRE..........QP
U5FFA4_POPTR/23-356IK--------E---LKA.Y...EVDPKVKIVIL.KG.N.....G.K....AFCAGGDVLASYTC.MVA..........GH
U5G8W9_POPTR/30-363TK--------K---LKV.Y...EIDPEVKVVVL.KG.N.....G.K....AFCAGGDVVASYIY.MVA..........GH
V4KPJ6_9ACTN/14-339AQ--------A---LDA.W...EHDPAVTTVVV.DG.A.....GER....GLCAGGDVRAIRED.ALR..........GE
V9XKW7_9NOCA/15-343RS--------S---LLA.W...RDDPAVTAVLV.TS.T.....SDR....AFCAGGDVKPVREL.ALE..........GR
V9XNE6_9NOCA/16-336SK--------A---LSA.W...ENDDSVRAVLV.RG.A.....GER....GLCAGGDIVSIYHD.AKD..........GG
W4W6S1_ATTCE/168-489DS--------I---LKQ.W...ESSK..KLVII.EG.I.....GEK....AFCVGGDVKALVLS.LNE..........SA
W5JCR8_ANODA/20-341YG--------A---MKS.W...ETSK..SLVIV.KS.V.....GEK....AFCAGGDVRAITET.SNV..........DL
W5XRW0_9CORY/14-331TK--------T---LKA.W...ESDDSVALVIV.RG.A.....GDR....AFCAGGDIAALYAD.AEV..........GP

PF08496

Q3SFM4_THIDA/3-147VA--------R---YFL-F---LAEAATLVLAV-----------------TGAI.AALIAVARR--------------RS
SOHB_ECOLI/2-158LS--------E---YGL-F---LAKIVTVVLAI-----------------AAIA.AIIVNVAQR--------------NK
Q5E611_VIBF1/2-162LF--------D---YGL-F---LAKIATVVVSI-----------------IAIL.VAAKAVGGK--------------ST
U3U6L2_9ENTR/2-156IS--------N---YGL-F---LAKSITTIFTI-----------------AIIL.MLINNTLRK--------------RQ
B8F6J6_HAEPS/4-160LL--------N---YGI-F---LLELLTVFGIV-----------------AVVI.MLI..LESR--------------KQ
M9WWT9_MANHA/4-159LL--------N---YGI-F---LLELLTVFGII-----------------AVVV.MLI..LESK--------------KQ
A1WT84_HALHL/2-146LN--------E---YLL-F---LAQTATVVLAI-----------------LLVL....TAVVRL--------------RQ
K6ZKA6_9ALTE/2-154LY--------E---YGL-F---IAKAITIVVAI-----------------LLAL.GGIIALFSK--------------QK
A6VW04_MARMS/3-155LT--------D---YVG-F---LLKLVSVALVI-----------------GVLL.AALSSGKRK--------------SQ
A1U0U5_MARHV/2-161LT--------E---YGL-F---LAKVATFVVAA-----------------IVLV.SIIVSATQK--------------DR
Q6ML34_BDEBA/2-147LQ--------S---IGV-F---AAQTFMILFAV-----------------LAVI.LVIALLAAK--------------AS
C4K721_HAMD5/2-157LS--------L---YGL-F---LAKMITILGAF-----------------AVFA.VLIIHIRQR--------------KS
Q5F7D2_NEIG1/4-160LL--------N---YGI-F---LLELLTVFGAI-----------------ALIV.LAI..VQSK--------------KQ
C9R4B3_AGGAD/4-161FI--------G---YGV-F---LLEVITLLLVI-----------------AAVV.AMIIAIKQK--------------KA
D4GFA3_PANAM/2-157LL--------N---YGL-F---LAKAVTVVIAI-----------------AAIV.MIVVNAAQR--------------KR
L0GQQ0_9GAMM/3-144LS--------D---YGL-F---LAKTVTLVLAI-----------------AIPL...LLLMRSR--------------AT
Q6D4V2_PECAS/4-159LS--------L---YGL-F---LAKALTIVVAI-----------------GALV.VLAFGMTQR--------------KR
E1VKB3_9GAMM/3-151FT--------E---YGM-F---LAKTITVVVAF-----------------MMLF.GTLASFSAR--------------NR
G4QLK8_GLANF/2-149LF--------V---YGL-F---LAKAITIVVAI-----------------VVVV.GFIVGMAAK--------------QK
Q88G04_PSEPK/2-149LA--------E---YAS-F---LAKTATLVIAI-----------------LVVL.SAIAGLRGK--------------GR
Q3JCU0_NITOC/3-143LS--------E---YGL-F---LAKTLTIVILI-----------------ALLI...RSSISSK--------------SR
Q4KAG4_PSEF5/2-152IA--------E---YAS-F---LAKTVTLVVAI-----------------LVVL.ITAAALRSK--------------GR
F2JWF9_MARM1/2-145LT--------E---YAG-F---LVRILTVIVLF-----------------ALVL.VLLTAGKSK--------------KN
W8L9B4_HALHR/2-153IY--------D---FAI-F---LAKVLTIVVAI-----------------LVVL.GSLASTAAS--------------AR
E0WSD1_9ENTR/2-157IY--------L---YVL-F---LAKMVTIVTAI-----------------GALV.FIVFYIGQH--------------QS
K0CD66_ALCDB/4-159IS--------E---YGM-F---LAKVATLVVAI-----------------LFVI.GGIATAAAR--------------NR
U5T5A0_9GAMM/2-148VQ--------D---YAS-F---LARVLTLLVAF-----------------GVLL.GMIGGMSNR--------------RR
Q9CN58_PASMU/4-161AT--------G---YGL-F---ILEILTILLVI-----------------AGIA.FMIVTLKQH--------------KA
Q6LPB4_PHOPR/2-162LF--------D---YGL-F---LAKIATVVIAL-----------------VGIL.VLAKGLNGR--------------HG
K4KI74_SIMAS/2-171LT--------D---YGL-F---LAKTLTLVVAV-----------------VLVI.GFAVAAGMK--------------NK
Q9KT45_VIBCH/5-165LL--------D---YGL-F---LAKIVTVVVAL-----------------VAVL.VIVKSLGGR--------------SG
Q9I2R3_PSEAE/2-148IA--------E---YAG-F---LARTVTVLAAI-----------------IVVL.VVIVALRGR--------------GR
B2VKR2_ERWT9/2-158LS--------Y---YGL-F---LAKTVTVVVAI-----------------AAIA.LIMTHLALR--------------KR
B8GRY4_THISH/2-150IQ--------D---YGL-F---LAKTLTLLFAA-----------------LVLF.GTLVALATR--------------GR
A6VNT8_ACTSZ/5-162AV--------G---YGI-F---ILEILTILLVV-----------------AGIV.AMIFAFKQR--------------QP
I3Y8M1_THIV6/9-152LF--------D---YGL-F---LAKTLTLVLGI-----------------AVLL...ILALRAR--------------QE
Q15TT9_PSEA6/2-153LY--------E---YGL-F---IAKAVTIVIAI-----------------LLVV.GGVVGLISK--------------QK
C5BJB2_TERTT/2-161LY--------E---YGL-F---FAKALTVVVAF-----------------GAVV.AIIAAAGMR--------------QQ
Q7N4B0_PHOLL/2-157LS--------L---YGL-F---LAKVVTLVLAI-----------------IALA.ILGIGIGMR--------------KS
W0E0L9_MARPU/2-148LF--------D---YGL-F---LAKTLTLLLAF-----------------AALL...LILARAR--------------GA
H2FWJ9_OCESG/3-149LY--------E---YGL-F---AAKALTWVAAV-----------------AVII.ALVAGVAAR--------------QK
C1DKS7_AZOVD/4-150FL--------D---YAG-F---LAQTVTVVVAV-----------------LVIL.VAIAVLRSR--------------SR
E1V393_HALED/3-148LS--------E---LGM-F---LAQLLIVAVVV-----------------ALAL....VMVVRA--------------RS
SOHB_BUCBP/2-161IY--------D---CSL-F---LFKIVIVIFFI-----------------IFVS.SIILKISRK--------------KN
M4VAW8_9DELT/2-148LQ--------H---ILL-F---FSQALIIVVSV-----------------IAVL.ITIATLVAK--------------AK
R5EC27_9GAMM/2-173LY--------S---LAL-Y---SSKLVVTVALI-----------------LFGLITLLMAVKGL--------------KS
X2H295_9GAMM/2-181FS--------Q---YAL-F---LAETATVVIAI-----------------LSIL.IFILSQRRK--------------LS
A8GF70_SERP5/2-157IS--------V---YGL-F---LAKVATVVIAI-----------------AALA.LLAVSLGQR--------------KN
U3TWV0_9ENTR/2-157LS--------S---YGL-F---LAKAVTVVVAI-----------------AAIV.LIVLNAALR--------------KR
Q21J53_SACD2/2-173LS--------E---YGL-F---LAKTVTFVIAF-----------------AAIV.VVIVSAGSK--------------GQ
D3RTH4_ALLVD/10-153.I--------D---YLF-F---LAKTLTLLTGI-----------------AVLI...VLALRVR--------------SS
L0E340_THIND/2-150LQ--------E---YGL-F---LLKGLTILALT-----------------LGLF.GAVIAGTTR--------------GR
M1SGT4_MORMO/2-158LS--------Q---YGL-F---LAETVTIVLAI-----------------IAIV.VFFVMLSIR--------------KG
C7RA79_KANKD/2-191LS--------E---YGL-F---LLKTATIAVVV-----------------IIII.SMLISEGQR--------------QR
Q486S9_COLP3/2-158LY--------E---YGL-F---LAKAITFVLAV-----------------IAII.IAIAGAATK--------------QQ
V4LD97_9GAMM/3-151LI--------D---YAL-F---AAKSFTVIAFI-----------------GLIM..LLLVRARR--------------QT
Q1QW68_CHRSD/3-155IA--------E---YAL-F---AAKLATLVVAV-----------------GVLV.GLVVTLKQR--------------AS
Q7VMW6_HAEDU/4-160LL--------N---YGI-F---LLELLTIFGII-----------------AMVI.MLM..LADR--------------KN
Q12LC5_SHEDO/2-148LY--------E---YGL-F---LAKAVTILLSV-----------------LAVI.TMVLMSAIK--------------QK
M1FK11_9ALTE/2-170LA--------D---YGL-F---LAKAVTLVLAV-----------------VVII.TLIISAAQR--------------EK
B3PHP3_CELJU/2-172LA--------E---YGL-F---LAKTVTFVVAV-----------------FVII.SLAVSLGGR--------------NK
S6AL13_PSERE/2-151FA--------E---YAG-F---LARIVTLVVAI-----------------LVVL.VAIAALRGR--------------NR
A1SW75_PSYIN/13-168VI--------E---YGL-F---FAKIVTFAIAI-----------------IAVV.AAVIALVSK--------------QK
Q83EG9_COXBU/8-154LA--------N---YGL-F---LAKLISLVLAI-----------------AVVL.FIFFGLIAH--------------AK
D8MSU4_ERWBE/2-158LS--------Y---YGL-F---LAKTVTVVVAI-----------------AAIA.ILITNLAMR--------------KR
Q882A1_PSESM/2-148VV--------D---YAS-F---LAKTVTLVIAI-----------------VVVL.VAIAAVRGK--------------GR
C4LEI0_TOLAT/2-149IY--------D---YGL-F---AAKSITLVTVI-----------------ALGV.ITIIAAIAR--------------NK
I2B860_SHIBC/2-158IA--------D---YGL-F---LAKVATFLVAI-----------------AVLV.VVVINAAQR--------------KR
Q2SJ39_HAHCH/2-155LT--------D---YGA-F---LAKTVTLVAAI-----------------LFVV.GTIIALSQR--------------GK
Q080A4_SHEFN/6-151LY--------E---YGL-F---LAKAVTIVVAI-----------------LAVV.IFVLAASMK--------------NK
F5Z7M4_ALTSS/2-152LY--------E---YGL-F---VAKAVTLVIAF-----------------IIVV.STIVGVASK--------------QK
D3SB45_THISK/2-168LQ--------E---YGL-F---FAKLVTALVVV-----------------LIFV.SAVAGVVAK--------------SR
W5X6P0_BDEBC/2-148LQ--------S---IGV-F---AAQTFLIVFAI-----------------VAII.LVIAMVASR--------------KA
A4VLP8_PSEU5/22-167LV--------D---YAS-F---LAKTVTLVVAI-----------------VIVL.IALASMRRG--------------RS
SOHB_HAEIN/4-161LT--------G---YGI-F---ILEILTILLLI-----------------LAVV.GLIISYRQH--------------NK
Q87N43_VIBPA/2-162LL--------D---YGL-F---LAKIVTVVAAI-----------------IVIL.ILVKSVGSK--------------SG
A3QFM5_SHELP/2-153LY--------E---YGL-F---LAKAVTIVVAI-----------------VAVV.VLVLASAVK--------------QK
M4U4F5_9GAMM/2-157LF--------D---FGL-F---LAKAVTIVVAI-----------------IAVI.GTVVALGSK--------------QK
Q7CIM0_YERPE/2-157IS--------L---YGL-F---LAKVVTIVVAI-----------------GAVV.LLVVSQGMR--------------RQ
Q0VQ70_ALCBS/3-158LM--------E---YGM-F---LAKVATLVVAI-----------------LFIF.GGIAAAASR--------------SR
M5DSS1_9GAMM/2-160LA--------E---YGS-F---LLKVVTLVVAV-----------------LILV.GGIVSIAAR--------------NK
SOHB_BUCAI/2-147LL--------N---YEL-F---LAKIITFIIIS-----------------ISIL.ILFYTIIKR--------------KK
E1SNQ6_FERBD/2-150LY--------E---YGL-F---LAKAVTLVAAV-----------------VAII.VAAAAANRA--------------GK
F7YNU5_VIBA7/19-179LL--------D---YGL-F---LAKIATIVVAL-----------------VVLL.VIVKSVGGK--------------NS
A0KMV5_AERHH/2-146LT--------E---YGL-F---LAKTLTLLLAI-----------------GAVI.LMVVS.SRQ--------------PK
D3VGP7_XENNA/2-157LS--------L---YGL-F---LAKVLTVVLSI-----------------VILA.VVCIGLGVR--------------KT
A4XVC0_PSEMY/2-147LS--------E---YAS-F---LAKTLTLVVAI-----------------VLVL.VALAATRGK--------------GR
A5EWW5_DICNV/5-147FA--------E---YAL-F---FAKMVTVVLAI-----------------LAVI.ATISLMKKS--------------KD
R4I0F4_9ENTR/2-157IS--------V---YSL-F---LAKITTVVIAI-----------------SALV.LLAASLGQR--------------KN
I0DNT2_PROSM/2-157FS--------L---YGL-F---LAKVVTIVVAI-----------------IALA.VFVFGVGMR--------------RQ
H2IX53_RAHAC/2-156LS--------L---YGL-F---LAKVVTVVIAI-----------------GALV.VLFVGLRQR--------------KS
Q7MLX8_VIBVY/2-162LL--------D---YGL-F---LAKVVTFIVAV-----------------VVLL.ILAKSVSGK--------------SS
W0HSX4_9ENTR/2-157IS--------L---YGL-F---LAKTLTVVLAI-----------------GALL.LLVFGLRMR--------------SR
C5BDW5_EDWI9/2-157LS--------L---YSL-F---LAKAATLVVVV-----------------AAVV.LLVVGLRQR--------------QG
Q0ABV0_ALKEH/2-149LE--------E---YLL-F---LAKGLTVVALV-----------------VAAV.GMILNSLRW--------------ER
D4G886_RIEPU/2-151FL--------S---YGL-F---LSKIITVFVGI-----------------VLLI.PIILSIGNK--------------KK
Q3IL32_PSEHT/3-148LY--------E---YGL-F---FAKTVTFVIAI-----------------AIIL.MLIVGAAVK--------------PK
F9ZL28_ACICS/2-144LT--------H---YLV-F---LAETATIVLAL-----------------LILAGGLIFLGRKG--------------MR
Q5QYQ0_IDILO/2-143VA--------D---IGG-F---LLKAAIIVVAV-----------------GFIV.GLIAQAAQK--------------QK
F4HAL3_GALAU/4-170LT--------N---YSV-F---ILELITLVAVI-----------------AVVF.GIIVTMKQK--------------NL
B4EW27_PROMH/2-157IL--------Q---YGL-F---LAEIATVVVAI-----------------IAIV.SFFVVIGSK--------------KQ
B0UU39_HISS2/4-161LI--------G---YGL-F---ILEILTILLIV-----------------AGIV.MMIMTLKER--------------KS
A3MY80_ACTP2/4-160LL--------N---YGI-F---LLELLTLFGIV-----------------AVVV.MLI..LEAR--------------KQ
A7MN97_CROS8/2-158LA--------E---YGL-F---LAKIVTVVVAI-----------------AIVI.ALIANLTQR--------------KK
A1S7G8_SHEAM/2-147LY--------E---YGL-F---LAKAVTVVAAI-----------------GAIL.VMVFAGAAR--------------GK
M4R4I6_BIBTR/4-160LL--------N---YGI-F---LLELLTVFGVI-----------------AVVV.MMI..LDAR--------------KQ
D0L1Z6_HALNC/2-150LS--------D---YGL-F---LAKTLTFVFAV-----------------LFLL.AGLTALRQR--------------QK

PF03255

D2UEG3_XANAP/5-148EA--------K...IQE-----.LRSA......STG--------------.........TAVN.----------------
ACCA_METCA/5-148EA--------K...IEE-----.LRHV......GFD--------------.........NEIN.----------------
E3I8F4_RHOVT/21-165ES--------K...IAE-----.LSALG.....EGE--------------.........SGVS.----------------
D8PGA3_9BACT/4-146EE--------K...IEK-----.LAS.......AES--------------.........PKSG.----------------
R7MD99_9CLOT/4-147QE--------K...IEE-----.LKKM......SLE--------------.........SGMD.----------------
F8EZE8_TRECH/5-136TK--------K...IEE-----.LKKL......AEA--------------.........SGID.----------------
W0DRR8_9GAMM/5-148EA--------K...IDE-----.LRHL......EGN--------------.........QDFD.----------------
A8LLX0_DINSH/4-147EG--------K...AEE-----.LRAVA.....RKS--------------.........GKMD.----------------
ACCA_SYNWW/6-148RE--------K...LEE-----.LNNL......SSN--------------.........MEFD.----------------
E0TDQ6_PARBH/4-147EG--------K...IDD-----.LRAL......AGD--------------.........QKVD.----------------
R7GKD0_9CLOT/3-138ES--------K...LIS-----..............--------------..........LDP.----------------
G2KND5_MICAA/4-146EA--------K...IAE-----.LRNT......SSS--------------.........TSVN.----------------
Q2S032_SALRD/7-156ED--------K...LTE-----.MREL......NAE--------------.........TQDD.----------------
Q6AM83_DESPS/30-172KA--------G...CES-----IKNSI......YDF--------------.........TAEE.----------------
Q311Q7_DESAG/25-171ES--------K...LNE-----LMLRE......KHL--------------.........SASE.----------------
S6A148_9SPIO/4-140EQ--------KEL.LNE-----.LQDI......ADK--------------.........YGLD.----------------
A0KHH9_AERHH/16-160QA--------Q...IDE-----.LRHV......SEG--------------N........HAVD.----------------
ACCA_PHOLL/5-151EA--------K...IDS-----.LTAV......SRQ--------------GEK......LDIN.----------------
ACCA_FLAPJ/3-147LE--------Q...LDK-----.CQII......GTE--------------.........SNVD.----------------
G2TPG4_BACCO/5-147KR--------K...IAE-----.LKEF......TKQ--------------.........SDVD.----------------
D5EJ62_CORAD/7-150QK--------Q...LDT-----.LQTV......SQE--------------.........SKVD.----------------
B8D1K4_HALOH/6-149KD--------K...IEE-----.LQSF......MDE--------------.........KGID.----------------
ACCA_ROSDO/4-148EG--------K...AEE-----.LRALA.....RAN--------------.........EEMD.----------------
X2GZP6_9BACI/5-147RE--------K...IDE-----.LKTI......AAD--------------.........ADVD.----------------
ACCA_RHIME/4-148EG--------K...ILE-----.LKKLA.....SED--------------.........ESVN.----------------
D7BGY4_MEISD/3-145QA--------K...IAE-----.LEAA......AKQ--------------.........SGVD.----------------
ACCA_MAGSA/3-146EG--------K...IEE-----.LRHL......SDG--------------.........GDVN.----------------
I0AHK2_IGNAJ/5-146EQ--------K...LEE-----.MRKF........S--------------.........DRLD.----------------
G4REG5_PELHB/4-148EG--------K...IAE-----.LKNLA.....QTD--------------.........EAVS.----------------
ACCA_CHLTE/6-163EE--------K...LNE-----.MRVY......LKS--------------.........GEVDS----------------
ACCA_AGRFC/4-148EG--------K...IIE-----.LKKLA.....DED--------------.........ESID.----------------
ACCA_ALKOO/4-147EG--------K...IIE-----.LINF......ADK--------------.........NKVD.----------------
ACCA_MARMS/5-148EQ--------K...IEE-----.LRLV......GND--------------.........NELN.----------------
K6ZTQ8_9ALTE/5-150EA--------K...IEE-----.LRLV......NQG--------------.GE......FDLN.----------------
C0QT26_PERMH/2-143SD--------K...IKI-----.LRQE......LKK--------------.........GNRS.----------------
Q2G730_NOVAD/6-148EA--------R...IAE-----.LRET......AQN--------------.........GDID.----------------
V5SAJ3_9RHIZ/15-158ES--------K...VTE-----.LKTL......ESG--------------.........EGVS.----------------
R7C0E0_9BURK/6-149DA--------Q...IEK-----.LEND......AME--------------.........NGTE.----------------
C6XFA8_LIBAP/4-148EA--------K...IHE-----.LKKLS.....RED--------------.........INED.----------------
ACCA_SYNE7/11-154EE--------R...ITQ-----.IRTL......AAD--------------.........NQVD.----------------
C1CYF8_DEIDV/5-142EA--------R...VHD-----.LEDT......ARR--------------.........TGQN.----------------
H6L155_SAPGL/3-146HN--------K...MEA-----.LRER......QDL--------------.........TEEE.----------------
R6L4F3_9FIRM/289-430QS--------NSDIMKK-----YLEYL......DNI--------------..............----------------
D1B429_SULD5/5-141DE--------D...IST-----............AK--------------.........IKGD.----------------
D3UH38_HELM1/4-141QD--------E...IEM-----............AI--------------.........IRGD.----------------
B9L7W0_NAUPA/3-140KE--------Q...IDV-----............AK--------------.........IKGD.----------------
ACCA_HELMI/5-146ET--------K...IDE-----.LRTF......SQE--------------.........KDLD.----------------
D3SP93_THEAH/2-144AQ--------K...ILQ-----.LKKL......LQL--------------.........GERH.----------------
R7AXN0_9FIRM/3-137KI--------QQMQIDE-----..............--------------..............----------------
C5CPW8_VARPS/6-149ET--------K...IEE-----.LRYV......QTE--------------.........SAVD.----------------
W0E5D8_MARPU/5-148EA--------K...IEE-----.LRLV......GHD--------------.........NELN.----------------
ACCA_ALCBS/5-148EA--------K...IEE-----.LRLV......GSG--------------.........SDIN.----------------
D9SFY0_GALCS/5-149ED--------K...IEQ-----.LRDV......HDD--------------..T......AALD.----------------
I1YEX9_METFJ/5-148EA--------K...IDE-----.LRYM......SND--------------.........TDLN.----------------
K4LHZ1_THEPS/6-149KK--------K...LNE-----.FKEL......SER--------------.........IDMD.----------------
E4TZ34_SULKY/5-141QE--------E...IIA-----............AE--------------.........VRYD.----------------
D0LXB2_HALO1/14-155ER--------K...IEE-----.LRGM......SS.--------------.........EQVD.----------------
C6WW95_METML/5-149EA--------K...IES-----.LRSS......HDD--------------..H......DNLD.----------------
C7M555_CAPOD/3-147EE--------Q...MEK-----.CQVI......GNE--------------.........SDVD.----------------
ACCA_FRATT/3-144ED--------K...ITS-----.LSHV......FED--------------EK............----------------
H8KSG2_SOLCM/5-147ME--------E...LEK-----.VKQA......QEK--------------.........TKVD.----------------
D1AII8_SEBTE/3-144ES--------K...IEE-----.LKKF......SKE--------------.........QKID.----------------
ACCA_CUPNH/5-148EA--------K...IEE-----.LRFV......QDD--------------.........SAVD.----------------
ACCA_ERYLH/4-146EA--------R...IAE-----.LRSA......AEG--------------.........DEVD.----------------
D2R421_PIRSD/12-153EA--------RRRALEQ-----.LTTR.........--------------..............----------------
D9QKB7_BRESC/5-147EA--------K...IEE-----.LGLL......AAT--------------.........SGS..----------------
R5DZV5_9BURK/6-150EE--------K...IQE-----.LRDM......SSG--------------..S......EGLD.----------------
Q0C318_HYPNA/4-148DA--------K...IAE-----.LEALA.....ARK--------------.........DGPL.----------------
I0IBV1_PHYMF/56-206ER--------Q...IEE-----.LEAQ......ADP--------------.........DRSAV----------------
C6XPW8_HIRBI/7-150EK--------K...IAE-----.LEAA......AAE--------------.........GGAS.----------------
ACCA_CHLPD/6-163EA--------K...LEE-----.MRVY......LRN--------------.........SSRDQ----------------
R6Z0L2_9CLOT/259-400VE--------RKD.MKE-----TL............--------------..............----------------
D4JZM5_9FIRM/2-150DA--------Q...IAA-----.LRGG......AQD--------------EESQMA...AITA.----------------
K9P1M5_CYAGP/6-149EE--------Q...IEQ-----.IRQL......ARD--------------.........SEVD.----------------
D4G8D7_RIEPU/6-152EK--------K...IDM-----.LRSSD.....FSN--------------KY.......RKSE.----------------
E8SIV5_STAPH/2-144QT--------K...IES-----.LKET......QAK--------------.........NDVD.----------------
U5T6J3_9GAMM/8-151EA--------K...IEE-----.LHYV......NDD--------------.........AEIN.----------------
W0JJL3_DESAE/4-146EE--------E...IEN-----.LRQM......AQN--------------.........SSID.----------------
F0P1A9_WEEVC/3-147ME--------Q...LKS-----.CQIV......GEE--------------.........SGVN.----------------
F8KU37_HELBC/4-141QD--------E...IEM-----............AT--------------.........IRGD.----------------
G4QI06_GLANF/5-150EA--------K...IEE-----.LRIV......NQG--------------.GE......FDVS.----------------
L0EG96_THECK/6-148RN--------K...IDE-----.LRKF......AEE--------------.........RGFD.----------------
ACCA_IDILO/5-150EA--------Q...IEE-----.LKSV......GNR--------------.GQ......LDLN.----------------
A0LCL9_MAGMM/15-158MA--------K...VDE-----.LRHL......SSN--------------.........SDIN.----------------
W0E6N2_9FIRM/5-147EQ--------K...IAE-----.LQAF......SRE--------------.........KEID.----------------
E6U0M3_BACCJ/6-148KT--------K...IAE-----.LKEF......TAE--------------.........KGID.----------------
ACCA_CAMHC/4-141DD--------D...ISS-----............AK--------------.........IRGD.----------------
ACCA_HELPY/4-141QN--------E...IEL-----............AL--------------.........IRGD.----------------
F8E5R1_FLESM/6-148EK--------K...IDE-----.LKNM......SSL--------------.........SDQD.----------------
ACCA_LEGPH/5-148NQ--------K...IEA-----.LRMV......GSD--------------.........NEVN.----------------
ACCA_RHOBA/6-147EE--------Q...IAS-----.LERN.........--------------..............----------------
I0JPN9_HALH3/4-147RE--------K...IAE-----.LRRM......TEN--------------.........SEMD.----------------
R6UTY3_9FIRM/3-138EA--------E...LAK-----.LDAM.........--------------..............----------------
R5QI57_9FIRM/286-429QD--------K...INK-----.LACD......NSD--------------EGRREQ........----------------
ACCA_RUBXD/2-142EE--------R...IAE-----.LHRL......AGE--------------SEG...........----------------
R5NX12_9CLOT/2-140DK--------E...IEE-----IMASD......LVD--------------..............----------------
D7CNC0_SYNLT/7-149KA--------K...LEE-----.LKDI......AEQ--------------.........KNID.----------------
Q2JI82_SYNJB/9-151EQ--------R...IQE-----.IRAL......AEE--------------.........NDID.----------------
A8J646_CHLRE/72-215DK--------R...IKE-----.VRKV......AEE--------------.........NGVD.----------------
I2EZ83_EMTOG/4-147ES--------K...LED-----.MKRL......ADE--------------.........NSVD.----------------
ACCA_CHLCH/6-163EA--------K...LHE-----.MREC......LRN--------------.........TTRDQ----------------
Q1MR33_LAWIP/27-171QG--------R...LAT-----FTNRT......NGE--------------.........TQQD.----------------
ACCA_ZYMMO/4-146QT--------R...IAE-----.LRK.......ATS--------------.........DEMD.----------------
ACCA_PARUW/3-145IK--------T...IEH-----.LKKQ......SQD--------------.........NPIF.----------------
B1I3G8_DESAP/4-147ET--------K...IEE-----.LKQF......SAE--------------.........KGLD.----------------
ACCA_XYLFA/5-148EA--------K...IQE-----.LHTA......SMG--------------.........PSIN.----------------
ACCA_BRASO/8-150DS--------K...VDE-----.LRAMA.....ASG--------------.........T..D.----------------
ACCA_ACAM1/10-153ED--------R...IEQ-----.IRSL......SEQ--------------.........NGVD.----------------
D3PKT0_MEIRD/3-145EA--------K...IAE-----.LEGF......ATS--------------.........SGVD.----------------
B1ZYS7_OPITP/7-150AR--------E...FDA-----.LHQK......SLE--------------.........QKVN.----------------
K9ZX35_DEIPD/3-142ER--------Q...IVD-----.LERL......ARE--------------.........TGEN.----------------
G8PGM3_PSEUV/4-148EG--------K...VQE-----.LKILA.....EGG--------------.........EAVD.----------------
D9QS74_ACEAZ/6-148ED--------K...IKE-----.LKQF......MEE--------------.........KDID.----------------
D3DFX7_HYDTT/3-145YQ--------K...IDQ-----.LRRL......YQL--------------.........GEKD.----------------
ACCA_PELLD/6-163EA--------K...LNE-----.MREC......LRS--------------.........SSREQ----------------
ACCA_SORC5/5-147IE--------K...VRE-----.LRAL.........--------------.........AAAD.----------------
W0J949_9BACT/7-150SA--------Q...LEQ-----.LRQQ......SLE--------------.........NNLD.----------------
ACCA_GEMAT/6-149EK--------Q...IEE-----.LKRL......AAD--------------.........RSLD.----------------
Q11UX8_CYTH3/2-145ET--------N...LAE-----.MKQV......ASE--------------.........SEVD.----------------
ACCA_XANP2/4-148EA--------K...VEE-----.LRALA.....SAG--------------.........DGVT.----------------
C8X286_DESRD/27-171ES--------K...LSD-----FKAKE......HQL--------------.........DVHQ.----------------
ACCA_WOLSU/4-141QD--------E...IES-----............SI--------------.........VKGD.----------------
D5XA35_THEPJ/4-147EA--------K...IEE-----.LKNF......SNE--------------.........KGID.----------------
ACCA_HELHP/4-141QD--------D...IES-----............AI--------------.........ISGD.----------------
ACCA_PELUB/4-149EI--------E...IDK-----.LKDP......YNQ--------------DGL......SEVD.----------------
ACCA_COXBU/5-148QA--------K...IDE-----.LRRV......GTS--------------.........QEIN.----------------
L0K556_HALHC/4-147EE--------K...INE-----.LNSF......MQD--------------.........KDID.----------------
A7HCR7_ANADF/7-150ES--------K...IAE-----.LKEL......SGG--------------.........ARVD.----------------
D0KZU8_HALNC/5-148DA--------K...IRE-----.LRLM......DNE--------------.........AGLN.----------------
E4U646_OCEP5/2-145ES--------R...IRE-----.LREY......AQE--------------.........KGVD.----------------
C5AV00_METEA/7-151EA--------K...LEE-----.LKALG.....QRD--------------.........GAVS.----------------
F3YX99_DESAF/28-171ES--------K...LGE-----FLAKE......KDL--------------.........TIPE.----------------
Q729X2_DESVH/28-170AT--------R...LAE-----FSQRD......TG.--------------.........AQGE.----------------
F2I397_PELSM/3-148DS--------N...IEN-----.LKNP......FEN--------------TGL......SSLN.----------------
ACCA_STACT/2-144KN--------K...IDA-----.LKES......QEK--------------.........NDVD.----------------
ACCA_BLOFL/5-151ES--------K...IHS-----.LMKL......IHH--------------DKK......LAIN.----------------
A5D053_PELTS/4-147EL--------K...ISE-----.LRNF......SRE--------------.........KGID.----------------
F2IGK6_FLUTR/4-148ED--------Q...IEQ-----.TREI......GNS--------------.........TGVD.----------------
ACCA_LARHH/5-148EN--------K...IEE-----.LRYV......QDD--------------.........SVLD.----------------
ACCA_PARL1/4-148EG--------K...VQE-----.LKLLA.....QED--------------.........PSVS.----------------
D7CVI6_TRURR/3-145AA--------R...IQD-----.MRAY......ARE--------------.........QEID.----------------
K9RT78_SYNP3/9-152EA--------Q...IQQ-----.VRDK......SSE--------------.........LGVD.----------------
ACCA_UNCTG/5-146NN--------R...IDD-----.LKES......SRV--------------.........GNID.----------------
R5QLG5_9FIRM/3-135QK--------E...LLD-----..............--------------..............----------------
D4LVS3_9FIRM/273-410HE--------VSGSSDD-----..............--------------..............----------------
A9RT89_PHYPA/97-240EN--------K...IDE-----.VREL......ANK--------------.........TGMD.----------------
ACCA_PELCD/4-146EQ--------K...LSE-----.LRDY......ST.--------------.........DEVD.----------------
E4TL55_MARTH/2-145EN--------K...LAG-----.MKTL......AEE--------------.........SDVD.----------------
ACCA_PELPB/6-163EA--------K...LDE-----.MRQC......LRN--------------.........STREQ----------------
E1VNM7_9GAMM/16-159ES--------K...IEE-----.LQSV......VSD--------------.........ANLN.----------------
K4AZH5_SOLLC/103-246EK--------Q...LIE-----.VRRM......AED--------------.........TGLD.----------------
C6D8B9_PAESJ/6-149RE--------K...IAT-----.LKTL......AES--------------.........NGMD.----------------
K0J396_AMPXN/4-147KD--------K...IAE-----.LKQM......AEE--------------.........SELD.----------------
E8U5S6_DEIML/5-142EA--------R...IRD-----.LEGL......ARD--------------.........TGQD.----------------
ACCA_CAUCR/5-149ES--------K...IEE-----.LSRL......SET--------------.........AGPGA----------------
F2LWN6_HIPMA/3-146EE--------Q...IEN-----.LKKM......ALE--------------.........RGLD.----------------
G2LDZ5_CHLTF/6-153ES--------Q...LAQ-----.LSAA......PHT--------------.........PAQD.----------------
E4TI62_CALNY/6-148EK--------K...LEE-----.LKSI......SEV--------------.........VDKD.----------------
ACCA_PSEAE/5-148QA--------K...IEE-----.LRLV......GND--------------.........NALN.----------------
D5SMU5_PLAL2/7-147ED--------Q...LSQ-----.LESQ.........--------------..............----------------
H8KZ76_FRAAD/5-148DA--------K...IEE-----.LRST......SDG--------------.........QAFN.----------------
L0G434_ECHVK/2-145EL--------K...LQE-----.MKEL......AKG--------------.........KQID.----------------
C7JEV8_ACEP3/4-146EN--------K...IDE-----.LRQM......TDP--------------.........NGVN.----------------
U3U7V8_9ENTR/5-151EE--------K...IDS-----.LRSI......SRQ--------------DKQ......YDIN.----------------
I4AJK8_FLELS/2-145EE--------K...LQE-----.TKGL......AAQ--------------.........NNMD.----------------
U6B8Z9_9RHIZ/4-148EA--------K...IHE-----.LKKIS.....NGE--------------.........EDCD.----------------
I3THF2_TISMK/4-147EG--------K...IKE-----.LRHL......SGE--------------.........TGVN.----------------
C7PMD3_CHIPD/3-146YD--------Q...LAK-----.LKEN......GAK--------------.........SGVD.----------------
D5BMW6_PUNMI/4-146EG--------K...VEE-----.LRHM......TTD--------------.........GNIN.----------------
C6VWQ9_DYAFD/4-147ER--------K...LEE-----.MKTL......ANE--------------.........NNVD.----------------
A0A068NX81_9BACT/5-153EE--------G...IAK-----.LREL.........--------------.........ARKEN----------------
K7S984_GLUOY/13-161ET--------K...IDE-----.LRQMGSQEKDSGT--------------.........SGIN.----------------
F2JNG5_CELLD/8-142KT--------....LEQ-----...........TPD--------------..............----------------
L0DWX9_THIND/5-148EA--------R...IQD-----.LRFV......GDD--------------.........AEVN.----------------
K9Q7M9_9NOSO/10-153SN--------R...IEQ-----.IRQL......AEE--------------.........NGVD.----------------
ACCA_TRIEI/9-152EN--------R...INQ-----.IREL......AKD--------------C........SSVD.----------------
L0EVZ1_LIBCB/4-148EG--------R...IHE-----.LKKLV.....MED--------------.........KSAN.----------------
D4M3A9_9FIRM/275-407HT--------VTDEKKE-----..............--------------..............----------------
ACCA_NITSB/4-141EN--------E...LEA-----............AK--------------.........ARGD.----------------
R5QCK4_9BURK/6-152EK--------K...IDD-----.LREL......DES--------------EAG......HAVS.----------------
R6P4G2_9CLOT/2-145EE--------K...IEE-----.LKKM......SEE--------------.........SGMD.----------------
ACCA_CARHZ/6-148EN--------K...ISD-----.LKKF......AEE--------------.........KNID.----------------
ACCA_CELJU/5-148EG--------K...IEE-----.LQLV......GNS--------------.........SDVN.----------------
G2ISU6_9SPHN/4-147QA--------R...IDE-----.LRET......ADS--------------.........GAID.----------------
D4KAA0_9FIRM/2-148DE--------K...IAA-----.LRGD......PAD--------------E..NMT...DITN.----------------
F6IN39_9SPHN/4-146EA--------R...IHE-----.LRST......ADT--------------.........GGLD.----------------
D4Z3Q1_SPHJU/4-147EA--------R...IIE-----.LRAT......ANA--------------.........GDID.----------------
W0EXF5_9SPHI/9-152IE--------E...IEL-----.TKER......SEK--------------.........TKID.----------------
I3ZX40_ORNRL/3-147QE--------Q...YVK-----.CALV......GEQ--------------.........SGVD.----------------
F0RKQ5_DEIPM/7-153EH--------K...VRD-----.LEQT......ARK--------------.........TGQN.----------------
E0UBA6_CYAP2/10-153QA--------R...INQ-----.IRQL......AEE--------------.........NDVD.----------------
R5YAR4_9PROT/8-151EE--------K...IEH-----.LKLL......AKD--------------.........EDMD.----------------
ACCA_ACICJ/4-146EA--------K...IEE-----.LRRM......TDP--------------.........GELN.----------------
K9SWQ9_9SYNE/7-150EN--------R...IDQ-----.IRNL......AKE--------------.........NGVD.----------------
ACCA_THET8/3-145ER--------R...IAE-----.LKET......AKA--------------.........TGVD.----------------
B8EN13_METSB/21-164EA--------K...VQE-----.LRSLA.....ADG--------------.........EGVQ.----------------
Q39833_SOYBN/90-233QK--------K...IID-----.VQKM......ANE--------------.........TGLD.----------------
E8RUB5_ASTEC/4-147EA--------K...IEE-----.LSAL......SSS--------------.........GGAN.----------------
ACCA_TERTT/5-148EG--------K...IQE-----.LQLV......GTD--------------.........NDLN.----------------
C6Y0P1_PEDHD/8-150EQ--------Q...IEK-----.VKQV......ADK--------------.........TKVD.----------------
ACCA_CHLTR/3-146EK--------T...IAE-----.FKEK......NKE--------------.........NSLL.----------------
ACCA_THICR/5-147EA--------K...IDE-----.LRHL......DG.--------------.........QDMD.----------------
ACCA_ALKEH/5-148EA--------K...IEE-----.LRHV......GHD--------------.........AEVN.----------------
ACCA_OCEIH/4-147KE--------K...IVE-----.LKSF......TEN--------------.........SEID.----------------
ACCA_WIGBR/5-149ES--------K...INS-----.LVEL......SQR--------------..D......KTLN.----------------
Q1IN03_KORVE/6-146EK--------Q...IAE-----.LEKA......AGD--------------.........NQA..----------------
F4L135_HALH1/3-146YE--------Q...LEK-----.LKEI......GAS--------------.........GEID.----------------
E1SU30_FERBD/5-150QA--------K...IDE-----.LKNV......SQN--------------.GD......LDLD.----------------
E1X4H2_HALMS/9-151EN--------Q...IKE-----.LQEA......SLR--------------.........PEID.----------------
F6DPP9_DESRL/2-145EA--------K...INE-----.LKHF......TNE--------------.........KGID.----------------
K9SI36_9CYAN/7-154EN--------R...IDQ-----.VRNL......AKE--------------.........NGIEA----------------
D3PDG9_DEFDS/6-148EK--------K...IEE-----.LKKV......SEL--------------.........SDQS.----------------
R6SFM1_9FIRM/263-401QQ--------MRQTLEK-----ILKMH......QTG--------------N.............----------------
D8TBU9_SELML/23-165EA--------R...IEE-----.VRDL......ANK--------------.........TGVD.----------------
B4ETY2_PROMH/5-152DE--------K...IDA-----.LLAF......KQS--------------QDET.....TAVD.----------------
ACCA_THEYD/4-147EI--------K...IEE-----.LKKL......SDG--------------.........SDID.----------------
R5YCC5_9FIRM/275-410HI--------T...KTE-----..............--------------..............----------------
ACCA_RHILO/4-148EL--------K...ILE-----.LKKLA.....ENG--------------.........EAVD.----------------
C0ZEF2_BREBN/2-145KE--------K...IDE-----.LQKY......MEK--------------.........NDLD.----------------
C4L480_EXISA/3-141TE--------Q...LNK-----.LRET......AET--------------.........KGID.----------------
Q187P7_PEPD6/3-145EN--------D...IKQ-----.LITI......SKA--------------.........NNID.----------------
ACCA_AROAE/5-148EA--------K...IEK-----.LRFV......QDD--------------.........SAVD.----------------
W8TMD3_EUBAC/5-147EE--------K...IKE-----.LKTL......VEE--------------.........TGVD.----------------
R7I7W2_9BURK/5-149DE--------K...IDE-----.LRSM......QES--------------D........PSMD.----------------
C9RBG3_AMMDK/4-147EE--------K...IAE-----.LTSF......SQE--------------.........KGLD.----------------
ACCA_ACTP2/5-149EA--------K...IES-----.LRAV......SEQ--------------D........GKID.----------------
W8EY50_9BACT/2-145EG--------K...LRE-----.MQQL......ALD--------------.........SQVD.----------------
C8W257_DESAS/5-148VE--------K...ISE-----.LKNF......SSQ--------------.........TGID.----------------
J9QYP7_RIEAN/3-148ME--------Q...YEK-----.CSLV......GEE--------------.........SGVD.----------------
ACCA_CAMJE/5-141DE--------D...IIN-----............AQ--------------.........IKGD.----------------
F0S695_PSESL/5-147QQ--------Q...VEK-----.VNQI......AEK--------------.........TKVD.----------------
H2FXK3_OCESG/5-150QA--------Q...IEE-----.LRHV......GEG--------------DG.......LDID.----------------
F0S0A5_DESTD/5-143RK--------K...IEE-----.LKSM.........--------------..........GRF.----------------
B3QS67_CHLT3/5-161EE--------K...LNE-----.MRRY......LVS--------------.........GEEKN----------------
D7A5W6_STAND/4-148EA--------K...LEE-----.LRAMA.....AQG--------------.........DAVS.----------------
F0LUJ9_VIBFN/5-151EA--------K...IQA-----.LRDV......SRH--------------GGG......TSVD.----------------
ACCA_BACHD/5-147KG--------K...IEE-----.LRTF......TEE--------------.........KEID.----------------
R5EMT9_9GAMM/5-150LA--------H...IEE-----.LKRL......SAD--------------.SN......SGVD.----------------
ACCA_PROA2/6-163EE--------K...LDE-----.MRVC......LKK--------------.........SARDH----------------
F0T0C4_SYNGF/2-144KN--------K...IGE-----.LEKM......AEE--------------.........KQID.----------------
H8GK81_METAL/5-148EA--------K...IRE-----.LRNV......EFD--------------.........NDIN.----------------
D5WSS7_KYRT2/5-147ER--------K...IEE-----.LKCF......TET--------------.........QQID.----------------
F6GHA4_LACS5/3-147EE--------Q...LDK-----.CQVI......GEE--------------.........SDVD.----------------
W8KT18_HALHR/5-148EA--------K...IEE-----.LRFV......GDD--------------.........AEVN.----------------
ACCA_GEOMG/7-148EQ--------K...IQE-----.LADI......AG.--------------.........DNVE.----------------
K9Z068_CYAAP/11-154QA--------R...IDQ-----.IREL......GEE--------------.........KQLD.----------------
H1XP22_9BACT/9-151EQ--------K...IAE-----.MREY......AAA--------------.........SHLD.----------------
H2IA21_FLACA/3-147EE--------Q...IEK-----.CQLI......GED--------------.........TQVD.----------------
C8WRU9_ALIAD/5-147KA--------K...IAE-----.LKAF......MEK--------------.........NEID.----------------
F7XXZ5_MOREP/5-149EA--------Q...IDL-----.LTTV......NPQ--------------..I......LDLN.----------------
ACCA_BACSK/5-147RQ--------K...IAD-----.LRAF......AME--------------.........RDMD.----------------
R5QM64_9PROT/6-149ES--------K...IEG-----.LRHL......SSA--------------.........DGVS.----------------
B3ERA3_AMOA5/2-146EE--------K...LAA-----.MKAK......AAQ--------------.........RKASK----------------
K4IV53_PSYTT/3-147QE--------Q...FEK-----.ACEI......GQD--------------.........SEVD.----------------
B2V9Z0_SULSY/2-143QD--------Q...IEI-----.LRER......VKK--------------.........GEHH.----------------
F5Y6P2_TREAZ/2-135EK--------K...VAE-----.LKKL......IKE--------------.........SGLN.----------------
ACCA_PARDP/3-147EG--------K...AEE-----.LRALA.....RKG--------------.........EGVD.----------------
ACCA_OLICO/8-150DS--------K...IDE-----.LRALA.....ANG--------------.........S..D.----------------
D6Z010_DESAT/30-172QE--------K...LQS-----LRDAF......YEH--------------.........SHEH.----------------
ACCA_OCHA4/4-148EG--------Q...ILE-----.LKKLA.....QEQ--------------.........GSVE.----------------
S0EW53_CHTCT/6-157DA--------N...IAE-----.LKRI......AAD--------------PVLRKDALDRGID.----------------
ACCA_COLP3/5-150DA--------K...IEE-----.LQLV......NNG--------------.QE......LDLD.----------------
ACCA_ARCB4/5-141EE--------D...IIV-----............AK--------------.........TKAD.----------------
ACCA_TOLAT/5-150LA--------Q...IEE-----.LKHV......SEH--------------VG.......SSVD.----------------
H6N9Y7_9BACL/6-147RA--------K...IEE-----.LRKF......SSD--------------.........KQID.----------------
C7NC27_LEPBD/4-144EE--------A...ISE-----.LKSF......SDE--------------.........KNID.----------------
ACCA_DEIRA/4-145EA--------R...VRD-----.LEAT......AER--------------.........TGQN.----------------
R7GN66_9FIRM/3-139EK--------K...LAV-----.IKND.........--------------..............----------------
G8R0N5_OWEHD/3-147EE--------Q...LEK-----.TRNL......EQE--------------.........TQVD.----------------
R5S9W6_9GAMM/4-147QK--------K...IDE-----.LKKM......SEA--------------.........SGMD.----------------
R5RFQ5_9FIRM/9-143EL--------E...LLK-----.LKDD......QE.--------------...........ID.----------------
K0B3H8_CLOA9/4-147ED--------K...IRE-----.IETF......AKE--------------.........SDVD.----------------
E3HB41_ILYPC/2-143EK--------K...IVE-----.LKEF......SEA--------------.........KNID.----------------
D6GQG0_FILAD/2-144EK--------K...IEC-----.LQKE......IER--------------IREEDS...QLLP.----------------
K0P1U1_9BACT/2-146EE--------K...LVK-----.MQEA......AKA--------------.........QNAPA----------------
F2J212_POLGS/4-148EG--------K...VQE-----.LRALA.....ASG--------------.........EAVD.----------------
U5QFX0_9CYAN/13-155QE--------R...IAQ-----.IRRL......AAE--------------.........NNVD.----------------
E8R5M4_ISOPI/5-159EA--------R...LTE-----.LELQ......SQR--------------AGGSSTSGEETAD.----------------
R6J4C9_9PROT/8-151EA--------K...IEG-----.LKLL......AKD--------------.........EDVD.----------------
S5RQ07_9PROT/5-148EK--------K...IEK-----.LRSL......QFS--------------.........SNID.----------------
ACCA_DICNV/5-148EY--------K...LNE-----.LKQF......SEQ--------------.........SKVD.----------------
ACCA_AQUAE/8-151KE--------K...IDR-----.LLGL......YRL--------------.........GKEE.----------------
E8UCK2_TAYEM/5-148EQ--------K...IEQ-----.LRNV......STE--------------.........DVID.----------------
B3DWQ6_METI4/5-148LQ--------R...LEL-----.LKTD......KSL--------------.........SAQE.----------------
B8DL69_DESVM/26-171DS--------K...LQE-----FNLRL......SEG--------------.........AISD.----------------
C7R5W6_KANKD/5-148EA--------Q...IDE-----.LRMM......GED--------------.........TEIN.----------------
I6ZWV1_MELRP/5-146EN--------K...IDE-----.MKKY........E--------------.........GQLD.----------------
L0F5J8_DESDL/5-147EK--------K...IAE-----.LQDF......SKE--------------.........KDIN.----------------
I0K7J9_9BACT/4-147EG--------R...LDE-----.LKRL......GET--------------.........SKVD.----------------
Q0BUI6_GRABC/12-154EG--------K...IEE-----.LRRM......SEP--------------.........DGIN.----------------
U5LED4_9BACI/5-147KK--------K...IAE-----.LKDF......TKD--------------.........AEVD.----------------
J7QSL5_METSZ/4-148ET--------K...VDE-----.LRALA.....ENG--------------.........EAVS.----------------
ACCA_BACAN/4-146RN--------K...IRE-----.LKDY......TKN--------------.........SQMD.----------------
K4LJD9_9FIRM/2-144NN--------K...LSD-----.LRKL......AED--------------.........KQAD.----------------
X2H0U8_9GAMM/4-150EA--------K...INS-----.LKNI......DSQ--------------QVE......LDLN.----------------
ACCA_BAUCH/6-151EA--------K...IES-----.LTSI......SSI--------------DKT......CDTN.----------------
ACCA_STRMK/5-148EA--------K...IQE-----.LRNA......SAG--------------.........PAVN.----------------
F8EKR1_RUNSL/4-147ES--------K...LIE-----.LKKL......AET--------------.........TQVD.----------------
G8T7C8_NIAKG/9-152FD--------D...IEG-----.LKQK......AEK--------------.........SKLD.----------------
ACCA_CYAP4/9-152EA--------Q...INQ-----.VRQK......SAE--------------.........LGVD.----------------
ACCA_BEII9/4-148EA--------K...IDE-----.LRTLN.....AQE--------------.........DTPA.----------------
J9Z203_9PROT/3-145ES--------E...KKS-----.LQKA......SEE--------------.........SGID.----------------
M1E6T6_9FIRM/9-151YN--------K...IEE-----.LKRV......SAE--------------.........TGVD.----------------
ACCA_NITEU/5-148EA--------K...IEQ-----.LRFA......QDN--------------.........SALD.----------------
C7RN27_ACCPU/5-148EG--------K...IEA-----.LRLA......QDD--------------.........SALD.----------------
F9ZM26_ACICS/5-145EG--------K...VEE-----.LRAL.........--------------.........NQPG.----------------
K0C175_CYCSP/5-148EE--------K...LEE-----.LRRV......GSD--------------.........NEID.----------------
A5G4G6_GEOUR/6-148ER--------K...IEE-----.LQEL......SS.--------------.........DTLD.----------------
E3F1D1_KETVY/3-147EG--------K...AEE-----.LRAMA.....RAN--------------.........PEMD.----------------
Q3JCT5_NITOC/9-152EA--------K...IEE-----.LRFV......GDD--------------.........AKLN.----------------
K9VDH0_9CYAN/10-153ET--------R...IHQ-----.IREL......AEE--------------.........NSVD.----------------
ACCA_LISMO/5-147KS--------K...IAD-----.LKEY......NET--------------.........SDVD.----------------
A8FG56_BACP2/5-147RA--------K...IDE-----.LKKF......TQN--------------.........SEMD.----------------
ACCA_RUTMC/5-145EE--------K...IQA-----.LDNI........K--------------.........DKAD.----------------
Q2RXX2_RHORT/7-150EG--------K...IEE-----.LRHL......SDA--------------.........DGIN.----------------
ACCA_PSEHT/5-150EV--------K...IEE-----.LQNV......SRA--------------.GE......LDLE.----------------
E6W2T7_DESIS/5-148EK--------K...IED-----.LEKF......ASQ--------------.........EGLN.----------------
D0MDD2_RHOM4/9-159EE--------K...LDE-----.MRALM.....AEN--------------.........PEVD.----------------
F8L7E7_SIMNZ/5-148ER--------T...IAQ-----.LKEQ......NKV--------------.........NGIW.----------------
W0RIF3_9BACT/5-148ER--------R...IDE-----.LKRL......AAE--------------.........QSVD.----------------
L0D934_SINAD/9-155EA--------R...LAE-----.MEVG.........--------------....YSKNRTGVD.----------------
F2NQ24_MARHT/2-145EN--------R...IKE-----.LEAY......AAE--------------.........KGLD.----------------
E6X0S5_NITSE/4-141QK--------D...IES-----............AK--------------.........ARGD.----------------
F4CCW2_SPHS2/4-147LM--------Q...IEK-----.VNQV......AEK--------------.........TKVD.----------------
D3ECM3_GEOS4/5-147RK--------K...IDE-----.LKQF......GQE--------------.........KGID.----------------
ACCA_SPHAL/4-147DR--------Q...IAE-----.LREM......GDD--------------.........PTLD.----------------
Q0AMD1_MARMM/8-151EA--------K...IEE-----.LESL......AGE--------------.........DSPD.----------------
B3E7C0_GEOLS/6-146EK--------K...IEE-----.LRAL.........--------------.........GAGE.----------------
Q1D555_MYXXD/8-151EK--------K...IDE-----.LKVL......STS--------------.........GTVD.----------------
ACCA_CHRSD/5-148EA--------K...IEE-----.LRLV......GND--------------.........SGIS.----------------
ACCA_EXIS2/3-143RK--------K...ILE-----.LHDM......AET--------------.........QGLD.----------------
F8KZD1_PARAV/4-145IK--------T...IEH-----.LKKQ......NQD--------------.........NPLF.----------------
ACCA_FUSNN/2-143EH--------K...IEE-----.LKKF......AEE--------------.........KEVD.----------------
S6B4Y6_9PROT/5-148EA--------R...IEE-----.LRFV......QDD--------------.........SAVD.----------------
B4U9A1_HYDS0/4-142KT--------K...IDQ-----.LKIL......YKQ--------------.........GKTD.----------------
ACCA_CHESB/4-148EG--------K...ILE-----.LKKLS.....ESG--------------.........EAVD.----------------
A1AQQ7_PELPD/6-148EQ--------K...IEE-----.LNQL......SR.--------------.........EGLD.----------------
F8JC16_HYPSM/32-176EN--------K...VAE-----.LKALQ.....TDG--------------.........KGPQ.----------------
B9E7A5_MACCJ/2-145EK--------K...IQD-----.IEQY......MKA--------------.........SDVD.----------------
D4H0L9_DENA2/5-148ES--------R...IDE-----.IKNV......SGI--------------.........GSGD.----------------
F0SFK4_RUBBR/6-146EQ--------H...LET-----.LEMQ.........--------------..............----------------
ACCA_SPHWW/4-147QA--------R...IAE-----.LRST......ADA--------------.........GSLD.----------------
F6CQZ6_DESK7/2-145EE--------K...IAE-----.LQRF......ASE--------------.........KGID.----------------
E8T4K6_THEA1/5-143RK--------K...IEE-----.LKKL.........--------------..........GKH.----------------
R5K1S9_9CLOT/3-142DT--------E...IEE-----.LSAK......TDD--------------YA............----------------
I4D4N6_DESAJ/5-147EQ--------K...ITE-----.LQKF......SAE--------------.........KDID.----------------
D6YRI8_WADCW/23-165IK--------T...IDH-----.LKKQ......NQN--------------.........NPLF.----------------

PF01039

PCCB_SACEN/46-544NDSGGA....R---IQE-----GVAALGLYAEIFKR--------------NTHASG.VIPQISL----------------
ACACB_HUMAN/1780-2334TDIIGKDDG..---..L-----GVENLRGSGMIAGE--------------SSLAYE.EIVTISL----------------
PCCB_BACSU/26-505NDSGGA....R---IQE-----GVLSLDGYGHIFYR--------------NVLYSG.VIPQISV----------------
YNGE_BACSU/27-509VDSAGARIT.D---QIN-----VFPGRRGAGRIFYN--------------QVKLSG.RIPQICL----------------
ACACA_HUMAN/1669-2223TDIIGKEEG..---..I-----GPENLRGSGMIAGE--------------SSLAYN.EIITISL----------------
PCCB_HUMAN/57-537NDSGGA....R---IQE-----GVESLAGYADIFLR--------------NVTASG.VIPQISL----------------
Q9ZCU2_RICPR/30-512NDSGGA....R---IQE-----GVDALAGYGELFQR--------------NVLASG.VIPQITL----------------
ACC1_ARATH/1587-2139DTIVGKEDG..---..I-----GVENLTGSGAIAGA--------------YSKAYN.ETFTLTF----------------
HFA1_YEAST/1619-2176KAIVGFEEG..---..L-----GVECLQGSGLIAGA--------------TSKAYR.DIFTITA----------------
O28066_ARCFU/27-514NDSGGA....R---IQE-----GVDALKGYGDIFYR--------------NTLASG.VIPQISV----------------
O86318_MYCTU/45-527VESGGA.DLPT---QKE-----IFIPG...GQMFRD--------------LTRLSAAGIPTIAL----------------
Q20676_CAEEL/55-534NDSGGA....R---IQE-----GVESLAGYADIFQE--------------NVMASG.VVPQISM----------------
O86517_STRCO/39-525NDGAGA....R---IQE-----GVSALAGYGGIFQR--------------NTKASG.VIPQISV----------------
PCCB_MYCLE/50-547NDGAGA....R---IQE-----GVVSLGLYSRIFRN--------------NILASG.VIPQISL----------------
ACAC_YEAST/1574-2130KTIIGSEDG..---..L-----GVECLRGSGLIAGA--------------TSRAYH.DIFTITL----------------
MCCB_ARATH/93-585VDSGGA.YLPK---QAE-----VFPDKENFGRVFYN--------------ESVMSSDGIPQIAI----------------
ACAC_SCHPO/1615-2170TTIIGSSEG..---..L-----GVECLRGSGLIAGV--------------TSRAYN.DIFTCTL----------------
MCCB_CAEEL/119-606VDSGGA.NLPR---QAD-----IFADSQHFGRIFYN--------------QATMSSEGIPQLAV----------------
GCDA_ACIFV/54-573LNCSGVKFD.E---QEK-----VYPNRRGGGTPFFR--------------NAELNQLGIPVIVG----------------
B5YMF5_THAPS/1470-2012TDIIGTNEG..---..I-----GVENLQGSGKIAGE--------------TSRAYD.EIFTLSY----------------
D1BNG7_VEIPT/29-507NDSGGA....R---IQE-----AVDALAGYGKIFFE--------------NTNASG.VIPQISV----------------
D7GFR7_PROFC/38-518YDSGGA....R---IQE-----GIDSLSGYGKMFFA--------------NVKLSG.VVPQIAI----------------
G5EAT9_EMENI/1606-2161TTIIGAKDG..---..L-----GVECLKGSGLIAGA--------------TSRAYE.DIFTITL----------------
M0WLS8_HORVD/1642-2195DSVVGKEDG..---..L-----GVENIHGSAAIASA--------------YSRAYE.ETFTLTF----------------
ACCD_MYCTU/14-479PSSGGT....R---MQE-----GTVAFLQMVKIAAA--------------IQLHNQARLPYLVY----------------
Q1DDA0_MYXXD/32-518NDSGGA....R---IQE-----GVESLAGYADIFVR--------------NTLASG.VVPQISL----------------
A0A0D1DYD5_USTMA/1546-2102TDIIGKPQG..---.GL-----GVECLSGSGLIAGE--------------TSRAKD.QIFTATI----------------
Q8NSG7_CORGL/44-541YEGAGA....R---IQD-----GAVSLDFISQTFYQ--------------NIQASG.VIPQISV----------------
Q8NSG8_CORGL/38-535NEGAGA....R---IQE-----GVVSLGLYSQIFYR--------------NTQASG.VIPQISL----------------
Q8U305_PYRFU/28-520NDSGGA....R---IQE-----GVDSLKGYGEIFKM--------------NTILSG.VVPQITA----------------

PF06833

Q8P4U4_XANCP/5-230AC--------HDDVLTG-----SATT.AAGEVTVIG--------------TAN.......KLEV----------------
Q89XP1_BRADU/5-233SN--------DNGVLHG-----SATLRSGGTMLVIG--------------IAN.......RTAL----------------
Q9I6S6_PSEAE/11-268PA--------SLRVADA-----ELDGYPVRFLAVVP--------------DPDNPFPRARQGEV----------------
Q89UY5_BRADU/5-233ET--------TGAMIAG-----QATLPDGGPIHVLG--------------ITQ.......GQPL----------------
Q87V58_PSESM/9-266PA--------SLKVADG-----LLGEQPVRFVAVIA--------------DTNNRFPRARQGEV----------------
A6T8S0_KLEP7/11-266CP--------SVQVTDG-----QINGESVRFIAVVP--------------DANNHYPRAAGGEV----------------

PF03572

Q8CVF0_LEPIN/340-512IE--------K---YKE-----LDKEAQAKGTRLKA-----------------------LILD-----------------
CTPA_SYNP2/215-376IK--------S---LNQ-----LQK......QGADR-----------------------YVLD-----------------
Q81R25_BACAN/181-400DS--------H---KNE-----LN........SFQN-----------------------LIID-----------------
Q7UUN0_RHOBA/410-573EK--------A---LWA-----LSR......QGMRS-----------------------LIID-----------------
Q8Y2I4_RALSO/213-395AK--------K---LND-----LAHQ....DARLKG-----------------------VILD-----------------
Q8DII0_THEEB/215-376RK--------A---IQI-----LEQ......QGAEE-----------------------YILD-----------------
Q8R712_CALS4/193-353TK--------A---LLF-----MDK......NNVKK-----------------------LILD-----------------
Q87YB6_PSESM/365-539KK--------L---LTE-----LQA......EKVDG-----------------------VVLD-----------------
TRI_SULSO/887-1042AE--------F---YRL-----FMS.....EFHREG-----------------------LVVD-----------------
Q7VMG7_HAEDU/365-546HK--------L---LAK-----IKT......KKIEG-----------------------LIVD-----------------
Q8R7P6_CALS4/299-499YS--------F---FKE-----IK........DYPY-----------------------LIID-----------------
Q8A406_BACTN/202-362KK--------A---LLD-----LKK......QGATS-----------------------LVID-----------------
Q7NKF3_GLOVI/143-304SQ--------A---LHQ-----AD........HSRG-----------------------VILD-----------------
TRI_THEAC/878-1033NE--------F---YRL-----FIN.....ESSYQG-----------------------LIVD-----------------
O83301_TREPA/167-332VE--------T---VTE-----LRR......QGCDR-----------------------LILD-----------------
Q7TUF4_PROMP/222-383EE--------A---LQE-----LKD......KEVEG-----------------------VILD-----------------
Q8R6Q0_CALS4/169-397YD--------F---LKG-----IK........DYPY-----------------------LVID-----------------
Q87PB1_VIBPA/356-526DK--------L---LND-----LKA......KNVDG-----------------------IIVD-----------------
Q8EDY9_SHEON/364-534EK--------E---LLK-----LNE......AKVEG-----------------------VVID-----------------
Q97LQ5_CLOAB/210-372NK--------K---IDE-----LKQ......QGMKG-----------------------LILD-----------------
O66985_AQUAE/192-355EK--------A---ILE-----LEN......QNVKG-----------------------FIID-----------------
Q9RU43_DEIRA/206-370RA--------A---IAD-----MKK......ANVQK-----------------------LILD-----------------
P73458_SYNY3/220-381RQ--------A---VQK-----LEK......ENVVG-----------------------YIFD-----------------
Q7UNS4_RHOBA/218-383RS--------V---LSR-----LMP.....KPDVSG-----------------------FVLD-----------------
Q9RUS4_DEIRA/235-411AQ--------R---VHD-----LVNQA..ERVGAQG-----------------------VIVD-----------------
Q894Q8_CLOTE/197-416IN--------F---YRK-----NS........DKKN-----------------------LVID-----------------
Q82BY0_STRAW/878-1033AQ--------L---HRD-----LRI.....EVARQG-----------------------LVVD-----------------
Q8YRM4_NOSS1/218-379AH--------A---ISS-----LEK......KGAAA-----------------------YILD-----------------
Q8CVF1_LEPIN/197-364KK--------E---LNS-----LKE......KGAEG-----------------------LILD-----------------
Q8A5K0_BACTN/312-500FD--------V---FKE-----FKS......QNITE-----------------------LILD-----------------
Q89KT1_BRADU/201-369KK--------A---IAA-----ISREI..PQEKLAG-----------------------YVMD-----------------
Q8ENJ3_OCEIH/223-384DQ--------Q---LTE-----LEN......QGIEG-----------------------LVID-----------------
Q8XNN1_CLOPE/231-397ET--------Q---LKA-----LEE......KGMKG-----------------------LILD-----------------
Q8P5D2_XANCP/126-301SA--------A---LDG-----MAS......QARCG-----------------------WIID-----------------
PRC_HAEIN/363-533KK--------L---LVK-----LEN......QKAEA-----------------------LIVD-----------------
Q8Y649_LISMO/229-395EK--------A---LKS-----LEK......DGMKG-----------------------LVLD-----------------
P75023_SYNY3/244-405EK--------A---ITE-----LNK......SRISG-----------------------YVLD-----------------
Q9A2X1_CAUCR/195-362AS--------S---VSE-----LKSK....NPKMKG-----------------------LILD-----------------
Q8R7P7_CALS4/191-422YN--------F---LKT-----IK........DYPY-----------------------LIID-----------------
Y858_CHLTR/316-560AK--------I---IQV-----FS.......SNTEA-----------------------LIID-----------------
Q8KAA8_CHLTE/214-383SA--------A---IRK-----IRQEAAKNRVVLNG-----------------------IVLD-----------------
Q8ZXG0_PYRAE/836-991AE--------F---FKS-----LNA.....EGDKEA-----------------------FIID-----------------
Q7VFQ7_HELHP/223-383LS--------S---LKQ-----MG........KVKG-----------------------IVLD-----------------
Q8A3B9_BACTN/191-351KK--------A---MKD-----LQK......QGMKD-----------------------LILD-----------------
Q7VBS8_PROMA/229-390RK--------A---LIS-----LER......NDPDA-----------------------YIID-----------------
CTPA2_ARATH/320-483RE--------A---IET-----LRG......NNVNA-----------------------FVLD-----------------
Q815H1_BACCR/212-374KD--------Q---LKE-----LEK......KNIKG-----------------------LVID-----------------
Q87UG9_PSESM/211-377GK--------A---LAK-----FRKD...NGKKMSG-----------------------LILD-----------------
Q7V214_PROMP/205-366KD--------T---LKD-----LEI......KKVSG-----------------------YVLD-----------------
Q7NPI8_GLOVI/227-389RQ--------A---IEK-----LEA......QDAAG-----------------------YILD-----------------
Q82H90_STRAW/894-1049AQ--------F---NRD-----LRM.....EVSRPA-----------------------LIVD-----------------
Q9AAF2_CAUCR/247-457DR--------E---IDA-----LIT......QNVPR-----------------------LIID-----------------
Q87Q24_VIBPA/260-446ID--------A---FNK-----LAE......AQVDE-----------------------IVID-----------------
RET3_HUMAN/438-617RQ--------V---WEP-----LQ........DTEH-----------------------LIMD-----------------
Q7UJ42_RHOBA/384-569ER--------I---LRD-----FKS......QNVGG-----------------------VVLD-----------------
Q8R7Q0_CALS4/178-406YD--------F---LRN-----IK........DYPY-----------------------LVID-----------------
Q8R8M1_CALS4/207-366KK--------A---LER-----LKK......DGMKG-----------------------LIID-----------------
Q8YPV0_NOSS1/193-349QE--------L---QNE-----LIYG...RLRNADG-----------------------LILD-----------------
PRC_ECOLI/356-530KV--------Q---LQK-----LEK......QNVSS-----------------------VIID-----------------
Q892K7_CLOTE/192-411LN--------F---YKE-----NA........NKKN-----------------------LVID-----------------
Q834H3_ENTFA/208-374KE--------T---ITN-----LRD......KGAKS-----------------------FVID-----------------
Q89X80_BRADU/202-369KR--------E---VAN-----LSNQ...IGDKLKG-----------------------YIID-----------------
Q8DGJ2_THEEB/238-398QE--------A---IEI-----LQR......EKVQG-----------------------FILD-----------------
Q9CP01_PASMU/362-532RK--------L---LAE-----MKT......KKAKA-----------------------LIID-----------------
Q896W4_CLOTE/217-379KK--------R---IEN-----LLN......SNIEN-----------------------LVVD-----------------
Q7MSB3_WOLSU/198-359AE--------E---LKK-----AS........WAKG-----------------------VVLD-----------------
Q9WZK6_THEMA/203-364KN--------A---LDK-----IFE......KGVKG-----------------------LIID-----------------
Q8YW78_NOSS1/226-387AR--------A---IRN-----LNG......QKVDS-----------------------YVLD-----------------
Q83BH0_COXBU/210-383RD--------A---IDK-----LKKE...SQGPLKG-----------------------LVLD-----------------
Q7NSR6_CHRVO/194-376AA--------G---LQK-----LYQE...NKQPLKG-----------------------LVLD-----------------
Q9RUA1_DEIRA/235-408AA--------F---LAQ-----VRQL...QAAGVRS-----------------------LIVD-----------------
Q9A6Q6_CAUCR/254-429DE--------A---LSA-----FV........GAKA-----------------------VVVD-----------------
Q7MTT6_PORGI/195-361IE--------A---LGR-----LRK......KGATS-----------------------LILD-----------------
Q9L1S8_STRCO/194-352RE--------A---VAR-----VP........SGAG-----------------------VVLD-----------------
Q82PY7_STRAW/269-453DE--------T---LSQ-----VIR......PGLRG-----------------------LVLD-----------------
Q7MXF8_PORGI/163-329AE--------G---IAL-----LRG......RGMQQ-----------------------LVLD-----------------
Q8KDJ6_CHLTE/340-525AR--------I---INE-----LKQ......ENVEG-----------------------IIVD-----------------
Q8A1T1_BACTN/145-316DE--------I---LVY-----LA........TCNG-----------------------LIID-----------------
Q7NGR6_GLOVI/216-377GN--------A---VAK-----LTR......EQADG-----------------------FILD-----------------
Q8R640_FUSNN/203-364KK--------A---LED-----LQA......KGMKG-----------------------LIFD-----------------
Q82TT8_NITEU/202-384AE--------A---ITK-----LYSG...SKVPMKG-----------------------LILD-----------------
Q7NL17_GLOVI/226-387RA--------A---LDV-----LGG......EGARG-----------------------WILD-----------------
Q8DZX2_STRA5/125-302SH--------Y---SGK-----LQNIL..MEKSYKG-----------------------LILD-----------------
CTPA_SYNY3/218-379AH--------A---LHQ-----LEE......QGADG-----------------------YILD-----------------
O25905_HELPY/210-371LE--------G---LKA-----NP........KAKG-----------------------IVLD-----------------
Q7U4U5_SYNPX/228-389QQ--------A---LEE-----LQD......KNIEG-----------------------LVLD-----------------
Q7MUB1_PORGI/151-321SG--------M---LSR-----LT........ECKA-----------------------LIID-----------------
CTPB_BACSU/213-375AK--------A---LRE-----LEK......KEIEG-----------------------LVID-----------------
O84448_CHLTR/354-525RK--------A---IRE-----LQE......KNLLG-----------------------LVLD-----------------
Q8DJ23_THEEB/220-381RA--------A---IRE-----LEK......QGVEG-----------------------YVLD-----------------
Q8A7W6_BACTN/916-1071RT--------V---YSD-----ILGK....YNNCDG-----------------------IVID-----------------
Q9KNC0_VIBCH/209-365EQ--------M---QND-----MFGL....EKDKLG-----------------------LVVD-----------------
Q7U711_SYNPX/231-392RA--------A---IQD-----LDE......QGAQG-----------------------YVLD-----------------
Q8YU55_NOSS1/219-380QE--------A---IKN-----LEK......QQVAG-----------------------YILD-----------------
Q8KD83_CHLTE/187-349HN--------A---VQK-----LRD......KGMRK-----------------------LIID-----------------
Q8EBT8_SHEON/888-1043ES--------F---ARE-----FYT.....NYDKDG-----------------------LIID-----------------
Q7VS41_BORPE/198-377AR--------H---LKE-----LGA.....KGAPKS-----------------------LVLD-----------------
CTPA_BACSU/201-363TD--------A---IDS-----LEK......KGAKG-----------------------YILD-----------------
TRIC_SULTO/669-824AE--------F---YRL-----FLS.....EFHREG-----------------------LIVD-----------------
Q9K6X5_BACHD/210-372EE--------G---LAQ-----LEG......EGIDG-----------------------LIID-----------------
Q7MVK0_PORGI/205-366RT--------A---LLD-----LRD.....KQGAKG-----------------------LILD-----------------
Q8P3J7_XANCP/253-471AQ--------S---FST-----LAA......RKVPA-----------------------LVID-----------------
Q89ZW2_BACTN/204-370LN--------A---LAQ-----LNH......KKCKG-----------------------LIID-----------------
Q8EKP4_SHEON/197-361VR--------T---LSQ-----WQG......TQLTG-----------------------LILD-----------------
Q7TUQ0_PROMM/225-386KE--------A---LQE-----LSE......KEIEG-----------------------LVLD-----------------
Q890X6_CLOTE/207-369KS--------E---LDK-----LKS......QGMKG-----------------------LVLD-----------------
Q7NPD6_GLOVI/225-386QR--------A---FAK-----LSE......AGVQG-----------------------WVLD-----------------
B2J2K4_NOSP7/217-378HR--------A---IEA-----LEK......QQVQG-----------------------YVLD-----------------
CTPA3_ARATH/310-472EN--------A---VHE-----MEN......QDVQS-----------------------YILD-----------------
CTPA1_ARATH/307-467VI--------A---MKR-----LLD......KGASY-----------------------FVMD-----------------
G3WSG1_SARHA/36-212ND--------I---WKK-----VM........ETSS-----------------------LVLD-----------------
M0ZTS1_SOLTU/116-276VT--------A---IKR-----LEG......MGASS-----------------------FVLD-----------------
M3WLH1_FELCA/129-305AS--------V---WRK-----LM........GTSA-----------------------LVLD-----------------
Q1D0E2_MYXXD/209-374RK--------E---LDR-----LRALN..GGKELRG-----------------------LVLD-----------------
Q2YLJ3_BRUA2/181-348KK--------A---IKD-----IQEKV..PADKLKG-----------------------YVLD-----------------
CTPAL_STAEQ/226-389KS--------A---IIK-----AHK......QGIRH-----------------------IILD-----------------
Q9PA16_XYLFA/231-394HK--------H---LGQ-----LKQQ...AGGKLRG-----------------------LLLD-----------------
Q9PCF8_XYLFA/366-548AK--------L---LIN-----FKT......DKVDG-----------------------VVLD-----------------
Q9ZDU6_RICPR/189-355KA--------A---VKK-----LKTE...SKDNLKG-----------------------IILD-----------------

PF01972

Y137_METJA/3-286PGG---------------------LVLAATQIAKAL-KAH-PA--ETRVIVP-H--------------------------