Sequence alignment for CL0127

PF01972

Y137_METJA/3-286GEKMDPLSGFISSLIWWLLFFYLIMAPQIQYKQLQLARLKILRELSNKRNSTVITMIHRQESIGLF--------------
Y1495_METJA/9-292KIMGDEMTS..MDMFFFLFIFLLFIYPEMMMRYRIMKRLRCIREIERQRGTRVIAMIHRQEALTFL--------------
O29403_ARCFU/7-290VTYSDPMAS.LSGLFWILLFLYLIFAPQLKHQQLLAARRRAMRRIGMKRGSNVITMIHRQESIGFL--------------
O66996_AQUAE/1-288MPYYDPFSY.LFSLLWFLLFVFILLSPWYKRMALIKAREDVIRKLEEKRKSRVITMIHRQEQIGFL--------------

PF00574

Q7XBR2_ORYSJ/73-254-----------------------------------------PGAG...AGGDVMGL.LLRERIVFL--------------
CLPP2_BORBU/6-189-----------------------------------------DNDAC.VLHDKSLKL.VLKSRSIVI--------------
CLPP1_BORBU/13-194-----------------------------------------GNYE...RVFDIYSR.LLRERIIFL--------------
CLPP1_CAEEL/34-215-----------------------------------------GKGE...RTYDIYSR.LLRDRIVCL--------------
CLPP4_ARATH/74-253-----------------------------------------RGAE.....SDVMGL.LLRERIVFL--------------
CLPP1_CHLTR/3-189-----------------------------------------EGEMM.HKLQDVIDRKLLDSRRIFF--------------
Q9CFR9_LACLA/7-176-----------------------------------------IKGD...VVDNSYGM.MYDWFGIDY--------------
CLPP1_PSEAE/28-209-----------------------------------------ARGE...RAYDIYSR.LLKERIIFL--------------
CLPP2_RHIME/20-201-----------------------------------------NRGE...RSYDIYSR.LLKERIIFL--------------
CLPP2_BACHD/13-194-----------------------------------------GLSE...RSYDIYSR.LLKDRIVFL--------------
CLPP_CAUCR/20-201-----------------------------------------SRGE...RAFDIFSR.LLKERIIFL--------------
CLPP5_ARATH/107-288-----------------------------------------MVQE...RFQSIISQ.LFQYRIIRC--------------
CLPP_MOUSE/63-244-----------------------------------------GRGE...RAYDIYSR.LLRERIVCV--------------
CLPP_CALS4/12-193-----------------------------------------NRGE...RAYDIFSR.LLKDRIVFL--------------
O97252_PLAF7/180-359-----------------------------------------IKDM....KKDVKLF.FFKKRIIYL--------------
CLPP1_AGRFC/16-197-----------------------------------------SRGE...RSFDIYSR.LLRERIIFL--------------
CLPP_XYLFA/19-200-----------------------------------------SRGE...RAYDIYSR.LLKERLIFL--------------
Q42886_SOLLC/95-274-----------------------------------------PVGA.....LDLSTV.LFRNRIIFI--------------
CLPP1_TREPA/17-198-----------------------------------------GGGE...RSYDIFSR.LLKDRIIFV--------------
CLPP2_MYCLE/27-207-----------------------------------------VKES......NPYNK.LFEERIIFL--------------
CLPP_DEIRA/15-196-----------------------------------------GRGE...RSYDIYSR.LLKDRIIFV--------------
CLPP1_BACHD/12-193-----------------------------------------NRGE...RAYDIYSR.LLKDRIIML--------------
CLPP_THEMA/21-202-----------------------------------------GRYE...RAYDIFSR.LLKDRIVFL--------------
CLPP2_TREPA/15-193-----------------------------------------SGES...VFFQ...K.FLETRQILL--------------
CLPP_CHLTE/37-218-----------------------------------------GRGE...RAFDIFSR.LLRERIIFL--------------
TEPA_BACHD/48-232-----------------------------------------EQSN..IHCITVVGQ.I..EGHMQL--------------
CLPP3_NOSS1/13-196-----------------------------------------PGGQF.TDWISIYDR.LYRERIIFL--------------
CLPP3_AGRFC/23-198-----------------------------------------GKET...EAN......LFKSRSIFI--------------
CLPP1_RHILO/16-197-----------------------------------------SRGE...RAFDIFSR.LLRERIIFI--------------
CLPP1_SYNE7/10-191-----------------------------------------GRGE...RAFDIYSR.LLRERIIFL--------------
CLPP_CLOPE/13-194-----------------------------------------SKGE...RSYDIFSR.LLKDRIIML--------------
CLPP_RICPR/12-193-----------------------------------------SRGE...RAYDIYSR.LLKERIIFV--------------
CLPP2_CORGL/13-195-----------------------------------------QGGP..GFGNDVFDR.LLSERIIFL--------------
CLPP1_CORGL/24-204-----------------------------------------GTKE.....TNPYAK.LFEERIIFL--------------
CLPP5_STRCO/18-201-----------------------------------------SAGT...RTSDPYSK.LLQERIVFL--------------
CLPP_CLOAB/12-193-----------------------------------------SRGE...RSYDIYSR.LLKDRVIFL--------------
CLPP_HAEIN/12-193-----------------------------------------SRGE...RSYDIYSR.LLKERVIFL--------------
CLPP_CHLRE/310-482-----------------------------------------SKALK.AYNYLDQGA.LNNES....--------------
CLPP1_STRCO/32-208-----------------------------------------LGDQ.......VYNR.LLGERIIFL--------------
CLPR2_ARATH/79-263-----------------------------------------NREEGTWQWVDIWNA.LYRERVIFI--------------
CLPP3_SYNY3/13-197-----------------------------------------PGSQY.ERWIDIYTR.LSQERIIFL--------------
CLPP4_STRCO/14-196-----------------------------------------PQGE...RSYDVFSR.LLSERIIFL--------------
CLPP2_PSEAE/13-193-----------------------------------------SHGA...IGAKLMEY.ALKVRKVFV--------------
CLPP_WHEAT/13-197-----------------------------------------PGDEE.ATWVDLYNV.MYRERTLFL--------------
CLPP2_STRCO/28-210-----------------------------------------SQGV...REYDPYAK.LFEERVIFL--------------
CLPP_AQUAE/19-200-----------------------------------------PRGE...RAYDIYSR.LLQDRIVLL--------------
CLPP3_SYNE7/13-197-----------------------------------------PGSSF.ERWIDIYNR.LAMERIIFL--------------
CLPP1_NOSS1/11-192-----------------------------------------GRGE...RAFDIYSR.LLRERIVFL--------------
CLPP2_ARATH/41-222-----------------------------------------SRGE...RAYDIFSR.LLKERIICI--------------
CLPP_RALSO/34-215-----------------------------------------GRGE...RAYDIYSR.LLKERVIFM--------------
CLPP2_SYNY3/32-213-----------------------------------------GMGE...RAFDIYSR.LLRERIIFL--------------
Q8ZQG9_SALTY/47-225-----------------------------------------SGAE...SWYTIRAA.ADNAADISI--------------
CLPP_CAMJE/11-192-----------------------------------------SRGE...RSYDIYSR.LLKDRIIML--------------
CLPP2_MYXXD/11-192-----------------------------------------HRGE...RAYDLYSR.LLKDRIIML--------------
Q9VKY3_DROME/38-219-----------------------------------------GRGE...RAYDIFSR.LLKERIICL--------------
F2YGL7_CHLVA/18-193-----------------------------------------...A...QWVDLYNR.LYRERVLFL--------------
G8AKT8_AZOBR/21-200-----------------------------------------.RGE...RAYDIYSR.LLKERIIFL--------------
M4CIZ3_BRARP/88-261-----------------------------------------.........LDTTNM.LLRQRIVFL--------------
CLPP1_MYCTU/18-192-----------------------------------------.........DSVYER.LLSERIIFL--------------
CLPP_STAA8/13-191-----------------------------------------.RGE...RAYDIYSR.LLKDRIIML--------------
CLPP_BRUA2/21-200-----------------------------------------.RGE...RAYDIFSR.LLKERIIFV--------------
CLPP_NEIG1/17-198-----------------------------------------.RGE...RAFDIYSR.LLKERIVFL--------------
CLPP_STRT2/10-192-----------------------------------------SRGE...RSYDIYSR.LLKDRIIML--------------
CLPP1_BACAN/14-192-----------------------------------------..GE...RSYDIYSR.LLKDRIVII--------------
Q8Y7Y1_LISMO/12-186-----------------------------------------.........NILTQK.LIDTRTVLI--------------
CLPP_LISMO/12-192-----------------------------------------SRGE...RAYDIYSR.LLKDRIIML--------------
W8UFH3_YEREN/25-205-----------------------------------------SRGE...RSYDIFSR.LLKERIIFL--------------

PF00378

ECI1_MOUSE/39-287------------------------------------------------EGPAGVAV-------MKL--------------
MENB_BACSU/16-271------------------------------------------------ETYNGIAK-------ITI--------------
PKSH_BACSU/12-259------------------------------------------------RFQASVCY-------ITF--------------
PKSI_BACSU/10-249------------------------------------------------EIESAIIQ-------VKM--------------
CAID_ECOLI/8-261------------------------------------------------TRNGSILE-------ITL--------------
ECI1_HUMAN/52-302------------------------------------------------DAGAGVAV-------MKF--------------
ECHM_HUMAN/42-290------------------------------------------------GKNNTVGL-------IQL--------------
ECHM_CAEEL/40-288------------------------------------------------GEKQNVAL-------IKL--------------
ECHH_RHOCB/9-257------------------------------------------------EISEGLAV-------ITL--------------

PF01343

Y651_METJA/110-263--------------------------------------------------------------------------------
SOHB_HAEIN/163-314--------------------------------------------------------------------------------
O26897_METTH/96-249--------------------------------------------------------------------------------
SPPA_HAEIN/387-539--------------------------------------------------------------------------------
SPPA_SYNY3/126-282--------------------------------------------------------------------------------
SPPA_BACSU/129-283--------------------------------------------------------------------------------
P95072_MYCTU/128-283--------------------------------------------------------------------------------
SPPA_ECOLI/140-296--------------------------------------------------------------------------------
SPPA_SYNY3/383-536--------------------------------------------------------------------------------
SPPA_ECOLI/391-543--------------------------------------------------------------------------------
P95072_MYCTU/402-555--------------------------------------------------------------------------------
SCAF_LAMBD/148-300--------------------------------------------------------------------------------
Y021_SYNY3/67-220--------------------------------------------------------------------------------
O25976_HELPY/103-256--------------------------------------------------------------------------------
SPPA_HAEIN/132-288--------------------------------------------------------------------------------
SOHB_ECOLI/161-310--------------------------------------------------------------------------------
Q0PC65_CAMJE/102-253--------------------------------------------------------------------------------

PF08496

Q3SFM4_THIDA/3-147--------------------------------------------------------DFVARYFLFL--------------
SOHB_ECOLI/2-158--------------------------------------------------------ELLSEYGLFL--------------
Q5E611_VIBF1/2-162--------------------------------------------------------EFLFDYGLFL--------------
U3U6L2_9ENTR/2-156--------------------------------------------------------DVISNYGLFL--------------
B8F6J6_HAEPS/4-160--------------------------------------------------------EILLNYGIFL--------------
M9WWT9_MANHA/4-159--------------------------------------------------------EVLLNYGIFL--------------
A1WT84_HALHL/2-146--------------------------------------------------------..LNEYLLFL--------------
K6ZKA6_9ALTE/2-154--------------------------------------------------------DFLYEYGLFI--------------
A6VW04_MARMS/3-155--------------------------------------------------------EFLTDYVGFL--------------
A1U0U5_MARHV/2-161--------------------------------------------------------EFLTEYGLFL--------------
Q6ML34_BDEBA/2-147--------------------------------------------------------DALQSIGVFA--------------
C4K721_HAMD5/2-157--------------------------------------------------------ELLSLYGLFL--------------
Q5F7D2_NEIG1/4-160--------------------------------------------------------EILLNYGIFL--------------
C9R4B3_AGGAD/4-161--------------------------------------------------------EIFIGYGVFL--------------
D4GFA3_PANAM/2-157--------------------------------------------------------ELLLNYGLFL--------------
L0GQQ0_9GAMM/3-144--------------------------------------------------------DLLSDYGLFL--------------
Q6D4V2_PECAS/4-159--------------------------------------------------------ELLSLYGLFL--------------
E1VKB3_9GAMM/3-151--------------------------------------------------------EFFTEYGMFL--------------
G4QLK8_GLANF/2-149--------------------------------------------------------EFLFVYGLFL--------------
Q88G04_PSEPK/2-149--------------------------------------------------------EFLAEYASFL--------------
Q3JCU0_NITOC/3-143--------------------------------------------------------ELLSEYGLFL--------------
Q4KAG4_PSEF5/2-152--------------------------------------------------------EFIAEYASFL--------------
F2JWF9_MARM1/2-145--------------------------------------------------------EFLTEYAGFL--------------
W8L9B4_HALHR/2-153--------------------------------------------------------EFIYDFAIFL--------------
E0WSD1_9ENTR/2-157--------------------------------------------------------ELIYLYVLFL--------------
K0CD66_ALCDB/4-159--------------------------------------------------------DLISEYGMFL--------------
U5T5A0_9GAMM/2-148--------------------------------------------------------EFVQDYASFL--------------
Q9CN58_PASMU/4-161--------------------------------------------------------DIATGYGLFI--------------
Q6LPB4_PHOPR/2-162--------------------------------------------------------EFLFDYGLFL--------------
K4KI74_SIMAS/2-171--------------------------------------------------------EFLTDYGLFL--------------
Q9KT45_VIBCH/5-165--------------------------------------------------------EFLLDYGLFL--------------
Q9I2R3_PSEAE/2-148--------------------------------------------------------EFIAEYAGFL--------------
B2VKR2_ERWT9/2-158--------------------------------------------------------ELLSYYGLFL--------------
B8GRY4_THISH/2-150--------------------------------------------------------EFIQDYGLFL--------------
A6VNT8_ACTSZ/5-162--------------------------------------------------------.IAVGYGIFI--------------
I3Y8M1_THIV6/9-152--------------------------------------------------------..LFDYGLFL--------------
Q15TT9_PSEA6/2-153--------------------------------------------------------EFLYEYGLFI--------------
C5BJB2_TERTT/2-161--------------------------------------------------------EFLYEYGLFF--------------
Q7N4B0_PHOLL/2-157--------------------------------------------------------EYLSLYGLFL--------------
W0E0L9_MARPU/2-148--------------------------------------------------------ELLFDYGLFL--------------
H2FWJ9_OCESG/3-149--------------------------------------------------------EFLYEYGLFA--------------
C1DKS7_AZOVD/4-150--------------------------------------------------------EFFLDYAGFL--------------
E1V393_HALED/3-148--------------------------------------------------------EWLSELGMFL--------------
SOHB_BUCBP/2-161--------------------------------------------------------HFIYDCSLFL--------------
M4VAW8_9DELT/2-148--------------------------------------------------------EILQHILLFF--------------
R5EC27_9GAMM/2-173--------------------------------------------------------EFLYSLALYS--------------
X2H295_9GAMM/2-181--------------------------------------------------------NWFSQYALFL--------------
A8GF70_SERP5/2-157--------------------------------------------------------EFISVYGLFL--------------
U3TWV0_9ENTR/2-157--------------------------------------------------------DLLSSYGLFL--------------
Q21J53_SACD2/2-173--------------------------------------------------------EFLSEYGLFL--------------
D3RTH4_ALLVD/10-153--------------------------------------------------------...IDYLFFL--------------
L0E340_THIND/2-150--------------------------------------------------------EFLQEYGLFL--------------
M1SGT4_MORMO/2-158--------------------------------------------------------EFLSQYGLFL--------------
C7RA79_KANKD/2-191--------------------------------------------------------EFLSEYGLFL--------------
Q486S9_COLP3/2-158--------------------------------------------------------EFLYEYGLFL--------------
V4LD97_9GAMM/3-151--------------------------------------------------------EALIDYALFA--------------
Q1QW68_CHRSD/3-155--------------------------------------------------------EWIAEYALFA--------------
Q7VMW6_HAEDU/4-160--------------------------------------------------------EILLNYGIFL--------------
Q12LC5_SHEDO/2-148--------------------------------------------------------EFLYEYGLFL--------------
M1FK11_9ALTE/2-170--------------------------------------------------------EFLADYGLFL--------------
B3PHP3_CELJU/2-172--------------------------------------------------------EFLAEYGLFL--------------
S6AL13_PSERE/2-151--------------------------------------------------------EFFAEYAGFL--------------
A1SW75_PSYIN/13-168--------------------------------------------------------EYVIEYGLFF--------------
Q83EG9_COXBU/8-154--------------------------------------------------------DFLANYGLFL--------------
D8MSU4_ERWBE/2-158--------------------------------------------------------DLLSYYGLFL--------------
Q882A1_PSESM/2-148--------------------------------------------------------DFVVDYASFL--------------
C4LEI0_TOLAT/2-149--------------------------------------------------------AFIYDYGLFA--------------
I2B860_SHIBC/2-158--------------------------------------------------------GVIADYGLFL--------------
Q2SJ39_HAHCH/2-155--------------------------------------------------------DFLTDYGAFL--------------
Q080A4_SHEFN/6-151--------------------------------------------------------EFLYEYGLFL--------------
F5Z7M4_ALTSS/2-152--------------------------------------------------------EFLYEYGLFV--------------
D3SB45_THISK/2-168--------------------------------------------------------ELLQEYGLFF--------------
W5X6P0_BDEBC/2-148--------------------------------------------------------DALQSIGVFA--------------
A4VLP8_PSEU5/22-167--------------------------------------------------------EFLVDYASFL--------------
SOHB_HAEIN/4-161--------------------------------------------------------DILTGYGIFI--------------
Q87N43_VIBPA/2-162--------------------------------------------------------EFLLDYGLFL--------------
A3QFM5_SHELP/2-153--------------------------------------------------------EFLYEYGLFL--------------
M4U4F5_9GAMM/2-157--------------------------------------------------------EFLFDFGLFL--------------
Q7CIM0_YERPE/2-157--------------------------------------------------------ELISLYGLFL--------------
Q0VQ70_ALCBS/3-158--------------------------------------------------------AFLMEYGMFL--------------
M5DSS1_9GAMM/2-160--------------------------------------------------------EFLAEYGSFL--------------
SOHB_BUCAI/2-147--------------------------------------------------------NLLLNYELFL--------------
E1SNQ6_FERBD/2-150--------------------------------------------------------EFLYEYGLFL--------------
F7YNU5_VIBA7/19-179--------------------------------------------------------EFLLDYGLFL--------------
A0KMV5_AERHH/2-146--------------------------------------------------------AFLTEYGLFL--------------
D3VGP7_XENNA/2-157--------------------------------------------------------EYLSLYGLFL--------------
A4XVC0_PSEMY/2-147--------------------------------------------------------EFLSEYASFL--------------
A5EWW5_DICNV/5-147--------------------------------------------------------.FFAEYALFF--------------
R4I0F4_9ENTR/2-157--------------------------------------------------------EFISVYSLFL--------------
I0DNT2_PROSM/2-157--------------------------------------------------------EYFSLYGLFL--------------
H2IX53_RAHAC/2-156--------------------------------------------------------DLLSLYGLFL--------------
Q7MLX8_VIBVY/2-162--------------------------------------------------------EFLLDYGLFL--------------
W0HSX4_9ENTR/2-157--------------------------------------------------------ELISLYGLFL--------------
C5BDW5_EDWI9/2-157--------------------------------------------------------EWLSLYSLFL--------------
Q0ABV0_ALKEH/2-149--------------------------------------------------------AGLEEYLLFL--------------
D4G886_RIEPU/2-151--------------------------------------------------------EFFLSYGLFL--------------
Q3IL32_PSEHT/3-148--------------------------------------------------------EFLYEYGLFF--------------
F9ZL28_ACICS/2-144--------------------------------------------------------..LTHYLVFL--------------
Q5QYQ0_IDILO/2-143--------------------------------------------------------DFVADIGGFL--------------
F4HAL3_GALAU/4-170--------------------------------------------------------DILTNYSVFI--------------
B4EW27_PROMH/2-157--------------------------------------------------------EYILQYGLFL--------------
B0UU39_HISS2/4-161--------------------------------------------------------ELLIGYGLFI--------------
A3MY80_ACTP2/4-160--------------------------------------------------------EILLNYGIFL--------------
A7MN97_CROS8/2-158--------------------------------------------------------NLLAEYGLFL--------------
A1S7G8_SHEAM/2-147--------------------------------------------------------EFLYEYGLFL--------------
M4R4I6_BIBTR/4-160--------------------------------------------------------EILLNYGIFL--------------
D0L1Z6_HALNC/2-150--------------------------------------------------------EFLSDYGLFL--------------

PF16113

B4M5Z4_DROVI/58-379------------------------------------------------------------KGMIII--------------
D7SLU2_VITVI/50-384------------------------------------------------------------SRTAIL--------------
F6I042_VITVI/68-402------------------------------------------------------------SRIVTL--------------
HIBCH_CHICK/45-375------------------------------------------------------------AGIITL--------------
HIBCH_SCHPO/66-398------------------------------------------------------------ARIFTL--------------
Q488V8_COLP3/18-356------------------------------------------------------------IGVLTL--------------
C4KDL8_THASP/20-344------------------------------------------------------------VGVLTL--------------
A5FW64_ACICJ/17-342------------------------------------------------------------VGRISL--------------
F5Z7N6_ALTSS/21-362------------------------------------------------------------IGVLTL--------------
Q8I523_PLAF7/190-524------------------------------------------------------------ICEIIL--------------
E3FSI9_STIAD/13-346------------------------------------------------------------IGLVTL--------------
F0ZTV2_DICPU/166-501------------------------------------------------------------YKRAML--------------
G5BGL1_HETGA/35-365------------------------------------------------------------VGVLTL--------------
B6HLY2_PENRW/44-388------------------------------------------------------------LRSVEL--------------
Q1LLS5_CUPMC/36-367------------------------------------------------------------VAYLTL--------------
F7QLT9_9BRAD/23-350------------------------------------------------------------AGILRL--------------
Q21WJ0_RHOFT/28-365------------------------------------------------------------VGFITL--------------
A0A016PD16_GIBZA/69-413------------------------------------------------------------LRTMML--------------
I1G4V7_AMPQE/50-378------------------------------------------------------------YRLMTL--------------
F6HIV7_VITVI/22-356------------------------------------------------------------VRKVIL--------------
Q8ES26_OCEIH/14-345------------------------------------------------------------IGTIEL--------------
A7INC3_XANP2/15-342------------------------------------------------------------AGIITL--------------
F4PNE6_DICFS/76-406------------------------------------------------------------CTVISL--------------
I1BHM9_RHIO9/79-409------------------------------------------------------------VREVVL--------------
C8X9E6_NAKMY/35-349------------------------------------------------------------LGRIML--------------
I1KQ42_SOYBN/46-396------------------------------------------------------------VAVITL--------------
Q13IB6_BURXL/22-355------------------------------------------------------------VGVVTL--------------
E9SYN2_RHOHA/17-337------------------------------------------------------------LGRITL--------------
G2NK33_STREK/15-339------------------------------------------------------------TLHITL--------------
D7SV41_VITVI/52-386------------------------------------------------------------SRAAIL--------------
G7UPF5_PSEUP/25-367------------------------------------------------------------IGIATL--------------
A8LME8_DINSH/12-333------------------------------------------------------------AGRITL--------------
B2W7S4_PYRTR/68-416------------------------------------------------------------VRSIEL--------------
B2IFQ5_BEII9/17-341------------------------------------------------------------AGVITL--------------
E4XNE1_OIKDI/19-346------------------------------------------------------------VGIVTL--------------
A1SIK1_NOCSJ/14-329------------------------------------------------------------VGWIRL--------------
B0UJ66_METS4/21-343------------------------------------------------------------AGCLTL--------------
D3PW51_STANL/21-338------------------------------------------------------------LGRIRL--------------
Q084X0_SHEFN/18-357------------------------------------------------------------IGMVTL--------------
B2JKB1_BURP8/21-360------------------------------------------------------------IGFIEL--------------
G2J3D7_PSEUL/18-358------------------------------------------------------------LGIATL--------------
F4RGZ4_MELLP/11-358------------------------------------------------------------MRVLIL--------------
Q0C3Q9_HYPNA/20-349------------------------------------------------------------IGRITL--------------
F8J779_HYPSM/27-350------------------------------------------------------------LQTFTL--------------
Q2SP84_HAHCH/24-363------------------------------------------------------------IGVITL--------------
E1VLZ8_9GAMM/17-356------------------------------------------------------------IGIATL--------------
D2V7D6_NAEGR/73-426------------------------------------------------------------CLCITL--------------
Q12MV4_SHEDO/18-360------------------------------------------------------------IGVVTL--------------
F5YTZ4_MYCSD/16-336------------------------------------------------------------IGLLTL--------------
Q5WH10_BACSK/10-343------------------------------------------------------------VGVITL--------------
B8ESI3_METSB/13-334------------------------------------------------------------CGLITL--------------
B9IB41_POPTR/22-356------------------------------------------------------------SKTLIL--------------
F0ZLP9_DICPU/30-365------------------------------------------------------------CLNVLL--------------
H2ZC72_CIOSA/54-386------------------------------------------------------------AGIITL--------------
Q2W460_MAGSA/13-341------------------------------------------------------------LGRIVL--------------
B1LX53_METRJ/12-337------------------------------------------------------------LGRLRL--------------
D5GGY6_TUBMM/44-383------------------------------------------------------------VRTIEL--------------
A4SZ56_POLSQ/13-344------------------------------------------------------------LGLITL--------------
E9T596_RHOHA/14-336------------------------------------------------------------VAEIVL--------------
F4CYK1_PSEUX/14-333------------------------------------------------------------LGRLTL--------------
Q5ZX62_LEGPH/13-340------------------------------------------------------------LGFITL--------------
B9RD44_RICCO/57-391------------------------------------------------------------SRTAIL--------------
G0RME1_HYPJQ/43-386------------------------------------------------------------LRTVLL--------------
A9WQX7_RENSM/20-336------------------------------------------------------------LGVVIL--------------
H1VE28_COLHI/45-366------------------------------------------------------------LRSIQL--------------
G2IVT0_PSEUL/18-359------------------------------------------------------------IGVATL--------------
E2BCN8_HARSA/46-370------------------------------------------------------------CGVIIL--------------
C6W855_ACTMD/12-334------------------------------------------------------------LGRITL--------------
A0A088AET4_APIME/95-420------------------------------------------------------------KGIIIL--------------
Q143S2_BURXL/33-374------------------------------------------------------------VAVITL--------------
F4S4Z1_MELLP/87-423------------------------------------------------------------MRIMTL--------------
B9J934_AGRRK/15-342------------------------------------------------------------AGLIRL--------------
F4Q929_DICFS/53-395------------------------------------------------------------CLKIIL--------------
Q381D8_TRYB2/20-346------------------------------------------------------------TRLVTL--------------
A1BAK1_PARDP/12-321------------------------------------------------------------AGRLTF--------------
G3WP62_SARHA/46-376------------------------------------------------------------AGVITL--------------
B2IDI2_BEII9/14-338------------------------------------------------------------CGIITL--------------
I1MM39_SOYBN/20-357------------------------------------------------------------ARVLTL--------------
F6EFK8_AMYSD/12-332------------------------------------------------------------LGLITL--------------
Q212Q2_RHOPB/18-345------------------------------------------------------------AGVIRL--------------
G8MC08_9BURK/24-360------------------------------------------------------------VAIITL--------------
A0JS02_ARTS2/30-352------------------------------------------------------------LGVITL--------------
A8HXV6_AZOC5/51-378------------------------------------------------------------AGLITL--------------
HIBC8_ARATH/21-353------------------------------------------------------------VRLTTL--------------
B6Q688_TALMQ/41-385------------------------------------------------------------LRLIEL--------------
A0C505_PARTE/18-343------------------------------------------------------------LAIAHF--------------
C1DFA4_AZOVD/17-349------------------------------------------------------------IGYLTL--------------
G7Z662_AZOL4/15-341------------------------------------------------------------IGLVTL--------------
Q5QW21_IDILO/17-357------------------------------------------------------------IGVATL--------------
C1DNT4_AZOVD/14-346------------------------------------------------------------IGHLTL--------------
Q230X4_TETTS/30-358------------------------------------------------------------KAKVVL--------------
B9SXD3_RICCO/47-382------------------------------------------------------------SRTVIL--------------
Q5LRB7_RUEPO/12-333------------------------------------------------------------AGRITL--------------
D6X3R7_TRICA/42-364------------------------------------------------------------KGVITL--------------
A1R246_ARTAT/18-336------------------------------------------------------------LGIVTL--------------
D3BN96_POLPA/192-532------------------------------------------------------------YARAFL--------------
B9SKJ5_RICCO/22-357------------------------------------------------------------ARTLIL--------------
B7G076_PHATC/15-365------------------------------------------------------------LFVLTL--------------
F4F5N6_VERMA/14-334------------------------------------------------------------LGHLTL--------------
A9PBA7_POPTR/21-353------------------------------------------------------------VRLITL--------------
G6DDP6_DANPL/16-332------------------------------------------------------------AGIITL--------------
F8AY96_FRADG/12-334------------------------------------------------------------LGRITL--------------
H6N4E1_GORPV/12-333------------------------------------------------------------VGEIVL--------------
E0VLB5_PEDHC/53-383------------------------------------------------------------KGSFTL--------------
Q0A896_ALKEH/22-361------------------------------------------------------------IGVATL--------------
D8SM52_SELML/13-356------------------------------------------------------------LAVLTL--------------
D7AAE9_STAND/32-359------------------------------------------------------------LGLVTL--------------
D7MNH9_ARALL/19-353------------------------------------------------------------VRILTL--------------
E3I3E7_RHOVT/14-335------------------------------------------------------------AGRITL--------------
D0J4R8_COMT2/40-371------------------------------------------------------------LGMITL--------------
D5QAS0_KOMHA/14-335------------------------------------------------------------LGRITL--------------
F4NRB7_BATDJ/54-395------------------------------------------------------------IRKFEL--------------
G3QQM4_GORGO/20-355------------------------------------------------------------AGVITL--------------
A1K1H9_AZOSB/18-358------------------------------------------------------------FGHATL--------------
Q0IP17_ORYSJ/128-462------------------------------------------------------------TRTLVL--------------
A1TSJ8_ACIAC/16-348------------------------------------------------------------VGFITL--------------
HIBCH_DICDI/33-370------------------------------------------------------------CLKVLL--------------
I1BZ13_RHIO9/189-518------------------------------------------------------------LGQIIL--------------
A9SUT7_PHYPA/29-361------------------------------------------------------------GRFATM--------------
D3HQR9_LEGLN/13-338------------------------------------------------------------LGVITL--------------
G4NGW1_MAGO7/67-414------------------------------------------------------------LRTIEL--------------
A9RJN7_PHYPA/31-365------------------------------------------------------------AKAAIL--------------
A9TYA6_PHYPA/60-394------------------------------------------------------------TKVAIL--------------
E1VZ37_ARTAR/22-349------------------------------------------------------------IGHIEL--------------
Q4DMX8_TRYCC/74-400------------------------------------------------------------ARLLTL--------------
Q6LIA0_PHOPR/19-359------------------------------------------------------------IGVAIL--------------
B7Q288_IXOSC/44-375------------------------------------------------------------KGVIIL--------------
H3B677_LATCH/47-377------------------------------------------------------------AGIITL--------------
A7RHZ5_NEMVE/46-374------------------------------------------------------------AGIITM--------------
Q8FQY6_COREF/29-353------------------------------------------------------------TGVIEL--------------
E1VC38_HALED/19-356------------------------------------------------------------IGVARL--------------
Q11J99_CHESB/19-339------------------------------------------------------------AGLIAL--------------
B0S642_DANRE/44-374------------------------------------------------------------AGVITL--------------
D7LRR5_ARALL/47-381------------------------------------------------------------SRTAIL--------------
F8K1G3_STREN/18-341------------------------------------------------------------VGRLLL--------------
G2KLT0_MICAA/19-358------------------------------------------------------------VGFLTL--------------
B6JX18_SCHJY/32-363------------------------------------------------------------MRCFIL--------------
I1M992_SOYBN/52-386------------------------------------------------------------SRAAIL--------------
A8NEJ7_COPC7/45-386------------------------------------------------------------IRKFIL--------------
Q12AQ1_POLSJ/18-355------------------------------------------------------------FGLATL--------------
Q1QVU3_CHRSD/19-353------------------------------------------------------------IGVATL--------------
I1JMV6_SOYBN/52-386------------------------------------------------------------SRMAIL--------------
Q4JU31_CORJK/25-358------------------------------------------------------------VGVIEL--------------
Q2GA19_NOVAD/13-336------------------------------------------------------------AGILSL--------------
Q2N893_ERYLH/16-341------------------------------------------------------------VGHISL--------------
Q16U65_AEDAE/33-352------------------------------------------------------------AGLITL--------------
C6XIW5_HIRBI/14-333------------------------------------------------------------VGHITL--------------
C3PF62_CORA7/13-336------------------------------------------------------------AGVLTL--------------
D8IW53_HERSS/21-370------------------------------------------------------------IGIATL--------------
C8WWK9_ALIAD/12-344------------------------------------------------------------VAWLGL--------------
F0XEA1_GROCL/74-428------------------------------------------------------------LRTIEL--------------
Q0BR39_GRABC/31-348------------------------------------------------------------TGWITL--------------
F2T0Y3_TRIRC/73-417------------------------------------------------------------VRLIEL--------------
A1WLH8_VEREI/23-355------------------------------------------------------------VGFITL--------------
A9C200_DELAS/16-348------------------------------------------------------------MGMITL--------------
Q2L131_BORA1/18-371------------------------------------------------------------LGVATL--------------
F2R851_STRVP/13-333------------------------------------------------------------TGRLIL--------------
D5BR70_PUNMI/19-347------------------------------------------------------------VGVITL--------------
E1VS22_ARTAR/12-327------------------------------------------------------------LGLITL--------------
Q28R37_JANSC/11-334------------------------------------------------------------AGRITL--------------
C3Z9L9_BRAFL/41-373------------------------------------------------------------VGVITL--------------
B3S7F3_TRIAD/23-347------------------------------------------------------------VGLITL--------------
A5V401_SPHWW/17-339------------------------------------------------------------TGRIRL--------------
E5SEM2_TRISP/42-371------------------------------------------------------------KLLVTL--------------
C0HHJ2_MAIZE/66-416------------------------------------------------------------VAVITL--------------
B0CSR7_LACBS/50-391------------------------------------------------------------LRSYIL--------------
A4VIV7_PSEU5/16-354------------------------------------------------------------IAIATL--------------
D4ZAM5_SHEVD/14-353------------------------------------------------------------IGVMTL--------------
A7HX73_PARL1/15-335------------------------------------------------------------AGIVTL--------------
F4QC51_DICFS/178-513------------------------------------------------------------FSRALL--------------
Q7NWA8_CHRVO/15-354------------------------------------------------------------IAVATL--------------
G0MPK6_CAEBE/44-375------------------------------------------------------------KKVVTL--------------
Q55GN0_DICDI/49-392------------------------------------------------------------CKRIIL--------------
C7RD63_ANAPD/10-343------------------------------------------------------------IGIIYL--------------
Q6CA37_YARLI/41-379------------------------------------------------------------TRTITL--------------
A9V573_MONBE/16-343------------------------------------------------------------LTQMTL--------------
A0BEK3_PARTE/25-354------------------------------------------------------------ALNIKL--------------
F2R4L5_STRVP/18-338------------------------------------------------------------AGFITL--------------
HIBC5_ARATH/51-385------------------------------------------------------------SRAAIL--------------
E4N1A8_KITSK/18-339------------------------------------------------------------LGRITL--------------
E5ASB4_BURRH/34-371------------------------------------------------------------VAVVTL--------------
H3FRY8_PRIPA/40-371------------------------------------------------------------KRVVTL--------------
A9HE55_GLUDA/18-336------------------------------------------------------------LGRMTL--------------
F2IWL1_POLGS/13-333------------------------------------------------------------AGFITL--------------
Q7MDJ7_VIBVY/19-358------------------------------------------------------------IAVATL--------------
D5UVM7_TSUPD/17-334------------------------------------------------------------TGHIEL--------------
G8SEU3_ACTS5/15-332------------------------------------------------------------LGHLVL--------------
Q0VP05_ALCBS/18-356------------------------------------------------------------IARATL--------------
B2UAB6_RALPJ/70-398------------------------------------------------------------IGWLTL--------------
A1S5D0_SHEAM/18-354------------------------------------------------------------IGVATL--------------
H8MVZ6_CORCM/13-341------------------------------------------------------------LGLVTL--------------
D5ATL9_RHOCB/13-333------------------------------------------------------------AGRITF--------------
B9RPB0_RICCO/58-404------------------------------------------------------------VAVITL--------------
B6IMT6_RHOCS/17-352------------------------------------------------------------LGLVTL--------------
H6BSS6_EXODN/72-425------------------------------------------------------------VRTIEL--------------
Q1GNL4_SPHAL/17-339------------------------------------------------------------IGRIAL--------------
E9IZM3_SOLIN/56-380------------------------------------------------------------SGVIVL--------------
Q6FM09_CANGA/43-400------------------------------------------------------------ARIVTL--------------
E1SUP0_FERBD/18-358------------------------------------------------------------IGVATL--------------
G4RGU8_PELHB/12-344------------------------------------------------------------CGIIRL--------------
G2P5N8_STRVO/31-352------------------------------------------------------------AGHLTL--------------
HIBC2_ARATH/15-349------------------------------------------------------------VRILTF--------------
Q4Q4Q6_LEIMA/22-353------------------------------------------------------------CRTITL--------------
G7DUF6_MIXOS/94-452------------------------------------------------------------LYTITL--------------
C1DAN4_LARHH/20-362------------------------------------------------------------IATALL--------------
A1U6V2_MARHV/15-353------------------------------------------------------------IGLLTL--------------
C7NJ16_KYTSD/22-350------------------------------------------------------------IARIHL--------------
D2VUW6_NAEGR/936-1276------------------------------------------------------------TRCLQI--------------
C4WVV0_ACYPI/36-362------------------------------------------------------------VGIVTL--------------
E9G4T3_DAPPU/56-370------------------------------------------------------------KCLITL--------------
C1EG25_MICSR/14-367------------------------------------------------------------VTVLTL--------------
F4GS44_PUSST/18-360------------------------------------------------------------VGLATL--------------
A4F9Q5_SACEN/15-334------------------------------------------------------------LGRITL--------------
G8RS69_MYCRN/28-352------------------------------------------------------------VGLITL--------------
G3IHA0_CRIGR/18-348------------------------------------------------------------AGVITL--------------
G2QR77_THITE/46-391------------------------------------------------------------LRSIEL--------------
B9TBM0_RICCO/16-343------------------------------------------------------------TGLIVL--------------
Q4DMX9_TRYCC/20-346------------------------------------------------------------TRLITI--------------
D7FIS1_ECTSI/31-370------------------------------------------------------------VAWLTL--------------
E8NCI0_MICTS/19-345------------------------------------------------------------VGHLTL--------------
Q89N86_BRADU/17-344------------------------------------------------------------AGVIRL--------------
E8RLF2_ASTEC/19-339------------------------------------------------------------VGRLTL--------------
F0M0J8_VIBFN/19-357------------------------------------------------------------IGIATL--------------
A1U2J0_MARHV/19-355------------------------------------------------------------IAVARL--------------
Q0RM03_FRAAA/66-391------------------------------------------------------------LGRLTL--------------
H3DE45_TETNG/45-375------------------------------------------------------------AGVITM--------------
B4RB39_PHEZH/14-336------------------------------------------------------------VGRITL--------------
F0ZI93_DICPU/87-416------------------------------------------------------------TLVLTL--------------
G1X6E1_ARTOA/73-419------------------------------------------------------------VRTITL--------------
A4G9P0_HERAR/23-358------------------------------------------------------------LGCLTL--------------
A0R2Y4_MYCS2/15-335------------------------------------------------------------VGILTL--------------
D3B388_POLPA/36-371------------------------------------------------------------VINILL--------------
C6THR1_SOYBN/37-369------------------------------------------------------------VRVVTL--------------
D8RN96_SELML/20-345------------------------------------------------------------VRVMTL--------------
F6AA82_PSEF1/16-354------------------------------------------------------------IGIASL--------------
F8E0K2_CORRG/15-348------------------------------------------------------------TAIVEL--------------
F2GC52_ALTMD/22-362------------------------------------------------------------IGRLTL--------------
A4I8I6_LEIIN/21-350------------------------------------------------------------.RHITL--------------
A4VKU6_PSEU5/16-348------------------------------------------------------------VGHLTL--------------
A4XS22_PSEMY/16-354------------------------------------------------------------IGIASL--------------
A0A0K0J9E9_BRUMA/37-374------------------------------------------------------------..IVTL--------------
B1MKI3_MYCA9/13-333------------------------------------------------------------VGLLTL--------------
B1VV62_STRGG/15-334------------------------------------------------------------.GVVTL--------------
B4FIT7_MAIZE/26-359------------------------------------------------------------.RTLIL--------------
B9IL60_POPTR/51-383------------------------------------------------------------..AAIL--------------
C1A226_RHOE4/16-335------------------------------------------------------------.GLITL--------------
C4R612_PICPG/39-387------------------------------------------------------------.RVISL--------------
C5AQY8_METEA/35-359------------------------------------------------------------.GLITL--------------
C5CR27_VARPS/20-356------------------------------------------------------------.ATATL--------------
C5GL55_AJEDR/45-388------------------------------------------------------------.RNIEL--------------
C7JEY4_ACEP3/21-337------------------------------------------------------------.GRIIL--------------
C8V2I5_EMENI/70-410------------------------------------------------------------VRLVEL--------------
D9Q9E6_CORP2/23-349------------------------------------------------------------.GIIEL--------------
F6INA5_9SPHN/14-335------------------------------------------------------------.GHISL--------------
F8Q7W3_SERL3/52-393------------------------------------------------------------.RTYVL--------------
G8PLL8_PSEUV/25-348------------------------------------------------------------.GLIIL--------------
M0YPS1_HORVD/57-387------------------------------------------------------------....VL--------------
M1FH42_9ALTE/19-355------------------------------------------------------------IGVARL--------------
O53419_MYCTU/16-336------------------------------------------------------------VGFVTL--------------
Q0K1Z5_CUPNH/27-360------------------------------------------------------------VGIATL--------------
Q0K9D4_CUPNH/13-344------------------------------------------------------------IGYLTL--------------
Q13M23_BURXL/27-363------------------------------------------------------------VAIITL--------------
Q1D8V8_MYXXD/13-346------------------------------------------------------------VGVVTL--------------
HIBCH_XENTR/46-375------------------------------------------------------------.GVITL--------------
Q2RTB1_RHORT/15-345------------------------------------------------------------.GAITL--------------
Q2YNA1_BRUA2/20-339------------------------------------------------------------.GLVKL--------------
Q3J1K7_RHOS4/13-327------------------------------------------------------------.GRITL--------------
Q3SQN0_NITWN/20-346------------------------------------------------------------.GIVRL--------------
Q5JMX9_ORYSJ/26-356------------------------------------------------------------.RVAIL--------------
Q63MM8_BURPS/27-362------------------------------------------------------------.ALITL--------------
Q63TV7_BURPS/21-364------------------------------------------------------------IGFLEL--------------
Q65IX3_BACLD/15-345------------------------------------------------------------.AAIVL--------------
Q6N492_RHOPA/19-345------------------------------------------------------------.GVIRL--------------
Q6NI92_CORDI/19-346------------------------------------------------------------.GVLEL--------------
Q7APV2_MYCLE/16-336------------------------------------------------------------IGLITL--------------
Q7VYA4_BORPE/19-371------------------------------------------------------------.GVATL--------------
Q83AM7_COXBU/43-368------------------------------------------------------------.GEITL--------------
Q87H46_VIBPA/18-356------------------------------------------------------------IGVLEL--------------
Q87II2_VIBPA/19-358------------------------------------------------------------IGVATL--------------
Q87YT7_PSESM/28-360------------------------------------------------------------IGHLTL--------------
Q88H70_PSEPK/22-354------------------------------------------------------------IGHLTL--------------
Q8NRX2_CORGL/14-334------------------------------------------------------------.GMVEL--------------
Q8XS34_RALSO/27-369------------------------------------------------------------.AILTL--------------
Q92TQ6_RHIME/18-338------------------------------------------------------------IGRLRL--------------
Q983C3_RHILO/18-337------------------------------------------------------------.GVVTL--------------
Q9A8K1_CAUCR/15-337------------------------------------------------------------VGRITL--------------
Q9I5I5_PSEAE/16-354------------------------------------------------------------IGIATL--------------
U5FFA4_POPTR/23-356------------------------------------------------------------.KKVIL--------------
U5G8W9_POPTR/30-363------------------------------------------------------------.KKIIL--------------
V4KPJ6_9ACTN/14-339------------------------------------------------------------VGRITL--------------
V9XKW7_9NOCA/15-343------------------------------------------------------------.GEVQL--------------
V9XNE6_9NOCA/16-336------------------------------------------------------------IGRITL--------------
W4W6S1_ATTCE/168-489------------------------------------------------------------.GTIVL--------------
W5JCR8_ANODA/20-341------------------------------------------------------------.GVITL--------------
W5XRW0_9CORY/14-331------------------------------------------------------------.GIITL--------------

PF03255

D2UEG3_XANAP/5-148--------------------------------------------------------------YLDF--------------
ACCA_METCA/5-148--------------------------------------------------------------FLDF--------------
E3I8F4_RHOVT/21-165--------------------------------------------------------------YLDF--------------
D8PGA3_9BACT/4-146--------------------------------------------------------------YLDF--------------
R7MD99_9CLOT/4-147--------------------------------------------------------------ALDF--------------
F8EZE8_TRECH/5-136--------------------------------------------------------------....--------------
W0DRR8_9GAMM/5-148--------------------------------------------------------------FLDF--------------
A8LLX0_DINSH/4-147--------------------------------------------------------------YLDF--------------
ACCA_SYNWW/6-148--------------------------------------------------------------.FDY--------------
E0TDQ6_PARBH/4-147--------------------------------------------------------------YLEF--------------
R7GKD0_9CLOT/3-138--------------------------------------------------------------LEEN--------------
G2KND5_MICAA/4-146--------------------------------------------------------------.LDF--------------
Q2S032_SALRD/7-156--------------------------------------------------------------LLDF--------------
Q6AM83_DESPS/30-172--------------------------------------------------------------....--------------
Q311Q7_DESAG/25-171--------------------------------------------------------------...Q--------------
S6A148_9SPIO/4-140--------------------------------------------------------------....--------------
A0KHH9_AERHH/16-160--------------------------------------------------------------FLDF--------------
ACCA_PHOLL/5-151--------------------------------------------------------------FLEF--------------
ACCA_FLAPJ/3-147--------------------------------------------------------------YLDF--------------
G2TPG4_BACCO/5-147--------------------------------------------------------------.LEF--------------
D5EJ62_CORAD/7-150--------------------------------------------------------------TLEF--------------
B8D1K4_HALOH/6-149--------------------------------------------------------------ILDF--------------
ACCA_ROSDO/4-148--------------------------------------------------------------YMDF--------------
X2GZP6_9BACI/5-147--------------------------------------------------------------.LAF--------------
ACCA_RHIME/4-148--------------------------------------------------------------YLDF--------------
D7BGY4_MEISD/3-145--------------------------------------------------------------.LEF--------------
ACCA_MAGSA/3-146--------------------------------------------------------------ILEF--------------
I0AHK2_IGNAJ/5-146--------------------------------------------------------------ILDF--------------
G4REG5_PELHB/4-148--------------------------------------------------------------YLDF--------------
ACCA_CHLTE/6-163--------------------------------------------------------------VLDF--------------
ACCA_AGRFC/4-148--------------------------------------------------------------YLDF--------------
ACCA_ALKOO/4-147--------------------------------------------------------------FLES--------------
ACCA_MARMS/5-148--------------------------------------------------------------YLPF--------------
K6ZTQ8_9ALTE/5-150--------------------------------------------------------------FLEF--------------
C0QT26_PERMH/2-143--------------------------------------------------------------..DI--------------
Q2G730_NOVAD/6-148--------------------------------------------------------------YLEF--------------
V5SAJ3_9RHIZ/15-158--------------------------------------------------------------YLDF--------------
R7C0E0_9BURK/6-149--------------------------------------------------------------FLEF--------------
C6XFA8_LIBAP/4-148--------------------------------------------------------------YLDF--------------
ACCA_SYNE7/11-154--------------------------------------------------------------LLEF--------------
C1CYF8_DEIDV/5-142--------------------------------------------------------------....--------------
H6L155_SAPGL/3-146--------------------------------------------------------------FLDF--------------
R6L4F3_9FIRM/289-430--------------------------------------------------------------..EV--------------
D1B429_SULD5/5-141--------------------------------------------------------------.LDF--------------
D3UH38_HELM1/4-141--------------------------------------------------------------YLDF--------------
B9L7W0_NAUPA/3-140--------------------------------------------------------------VLDF--------------
ACCA_HELMI/5-146--------------------------------------------------------------.LDF--------------
D3SP93_THEAH/2-144--------------------------------------------------------------.LEI--------------
R7AXN0_9FIRM/3-137--------------------------------------------------------------LKEA--------------
C5CPW8_VARPS/6-149--------------------------------------------------------------FLDF--------------
W0E5D8_MARPU/5-148--------------------------------------------------------------FLDF--------------
ACCA_ALCBS/5-148--------------------------------------------------------------FLEF--------------
D9SFY0_GALCS/5-149--------------------------------------------------------------FLDF--------------
I1YEX9_METFJ/5-148--------------------------------------------------------------FLDY--------------
K4LHZ1_THEPS/6-149--------------------------------------------------------------LLDL--------------
E4TZ34_SULKY/5-141--------------------------------------------------------------.LDF--------------
D0LXB2_HALO1/14-155--------------------------------------------------------------ILEF--------------
C6WW95_METML/5-149--------------------------------------------------------------YLDF--------------
C7M555_CAPOD/3-147--------------------------------------------------------------YLDF--------------
ACCA_FRATT/3-144--------------------------------------------------------------YLDF--------------
H8KSG2_SOLCM/5-147--------------------------------------------------------------.FDF--------------
D1AII8_SEBTE/3-144--------------------------------------------------------------...I--------------
ACCA_CUPNH/5-148--------------------------------------------------------------FLDF--------------
ACCA_ERYLH/4-146--------------------------------------------------------------YLEF--------------
D2R421_PIRSD/12-153--------------------------------------------------------------.LDF--------------
D9QKB7_BRESC/5-147--------------------------------------------------------------YLEF--------------
R5DZV5_9BURK/6-150--------------------------------------------------------------YLEF--------------
Q0C318_HYPNA/4-148--------------------------------------------------------------YLEF--------------
I0IBV1_PHYMF/56-206--------------------------------------------------------------.LAF--------------
C6XPW8_HIRBI/7-150--------------------------------------------------------------FLDF--------------
ACCA_CHLPD/6-163--------------------------------------------------------------VLDF--------------
R6Z0L2_9CLOT/259-400--------------------------------------------------------------....--------------
D4JZM5_9FIRM/2-150--------------------------------------------------------------IKEL--------------
K9P1M5_CYAGP/6-149--------------------------------------------------------------LLEF--------------
D4G8D7_RIEPU/6-152--------------------------------------------------------------FLDF--------------
E8SIV5_STAPH/2-144--------------------------------------------------------------.LDF--------------
U5T6J3_9GAMM/8-151--------------------------------------------------------------FLEF--------------
W0JJL3_DESAE/4-146--------------------------------------------------------------.YDF--------------
F0P1A9_WEEVC/3-147--------------------------------------------------------------YLEF--------------
F8KU37_HELBC/4-141--------------------------------------------------------------YLDF--------------
G4QI06_GLANF/5-150--------------------------------------------------------------FLDF--------------
L0EG96_THECK/6-148--------------------------------------------------------------.LEF--------------
ACCA_IDILO/5-150--------------------------------------------------------------FLDF--------------
A0LCL9_MAGMM/15-158--------------------------------------------------------------FLEF--------------
W0E6N2_9FIRM/5-147--------------------------------------------------------------.FEF--------------
E6U0M3_BACCJ/6-148--------------------------------------------------------------.LPF--------------
ACCA_CAMHC/4-141--------------------------------------------------------------YLDF--------------
ACCA_HELPY/4-141--------------------------------------------------------------YLDF--------------
F8E5R1_FLESM/6-148--------------------------------------------------------------.LEF--------------
ACCA_LEGPH/5-148--------------------------------------------------------------FLEF--------------
ACCA_RHOBA/6-147--------------------------------------------------------------.LEF--------------
I0JPN9_HALH3/4-147--------------------------------------------------------------ILEF--------------
R6UTY3_9FIRM/3-138--------------------------------------------------------------IKEA--------------
R5QI57_9FIRM/286-429--------------------------------------------------------------....--------------
ACCA_RUBXD/2-142--------------------------------------------------------------.LDF--------------
R5NX12_9CLOT/2-140--------------------------------------------------------------IKEI--------------
D7CNC0_SYNLT/7-149--------------------------------------------------------------.LDF--------------
Q2JI82_SYNJB/9-151--------------------------------------------------------------LLEF--------------
A8J646_CHLRE/72-215--------------------------------------------------------------TLEF--------------
I2EZ83_EMTOG/4-147--------------------------------------------------------------LLDF--------------
ACCA_CHLCH/6-163--------------------------------------------------------------VLDF--------------
Q1MR33_LAWIP/27-171--------------------------------------------------------------....--------------
ACCA_ZYMMO/4-146--------------------------------------------------------------YLDF--------------
ACCA_PARUW/3-145--------------------------------------------------------------ILPH--------------
B1I3G8_DESAP/4-147--------------------------------------------------------------VFDF--------------
ACCA_XYLFA/5-148--------------------------------------------------------------YLDF--------------
ACCA_BRASO/8-150--------------------------------------------------------------YLDF--------------
ACCA_ACAM1/10-153--------------------------------------------------------------LLDF--------------
D3PKT0_MEIRD/3-145--------------------------------------------------------------.LEF--------------
B1ZYS7_OPITP/7-150--------------------------------------------------------------VLEF--------------
K9ZX35_DEIPD/3-142--------------------------------------------------------------....--------------
G8PGM3_PSEUV/4-148--------------------------------------------------------------YLEF--------------
D9QS74_ACEAZ/6-148--------------------------------------------------------------.LEF--------------
D3DFX7_HYDTT/3-145--------------------------------------------------------------.LEF--------------
ACCA_CHLL7/6-163--------------------------------------------------------------VLDF--------------
ACCA_SORC5/5-147--------------------------------------------------------------ILPF--------------
W0J949_9BACT/7-150--------------------------------------------------------------TLEF--------------
ACCA_GEMAT/6-149--------------------------------------------------------------VLEF--------------
Q11UX8_CYTH3/2-145--------------------------------------------------------------YLDF--------------
ACCA_XANP2/4-148--------------------------------------------------------------YLDF--------------
C8X286_DESRD/27-171--------------------------------------------------------------....--------------
ACCA_WOLSU/4-141--------------------------------------------------------------YLDF--------------
D5XA35_THEPJ/4-147--------------------------------------------------------------VLEF--------------
ACCA_HELHP/4-141--------------------------------------------------------------YLDF--------------
ACCA_PELUB/4-149--------------------------------------------------------------YLNF--------------
ACCA_COXBU/5-148--------------------------------------------------------------YLDF--------------
L0K556_HALHC/4-147--------------------------------------------------------------YLEF--------------
A7HCR7_ANADF/7-150--------------------------------------------------------------ALDF--------------
D0KZU8_HALNC/5-148--------------------------------------------------------------YLDF--------------
E4U646_OCEP5/2-145--------------------------------------------------------------ALEF--------------
C5AV00_METEA/7-151--------------------------------------------------------------YLDF--------------
F3YX99_DESAF/28-171--------------------------------------------------------------....--------------
Q729X2_DESVH/28-170--------------------------------------------------------------....--------------
F2I397_PELSM/3-148--------------------------------------------------------------YLDF--------------
ACCA_STACT/2-144--------------------------------------------------------------.LDF--------------
ACCA_BLOFL/5-151--------------------------------------------------------------CLDF--------------
A5D053_PELTS/4-147--------------------------------------------------------------ILDF--------------
F2IGK6_FLUTR/4-148--------------------------------------------------------------YLDF--------------
ACCA_LARHH/5-148--------------------------------------------------------------FLDF--------------
ACCA_PARL1/4-148--------------------------------------------------------------YLDF--------------
D7CVI6_TRURR/3-145--------------------------------------------------------------.LPF--------------
K9RT78_SYNP3/9-152--------------------------------------------------------------LLEF--------------
ACCA_UNCTG/5-146--------------------------------------------------------------.FDF--------------
R5QLG5_9FIRM/3-135--------------------------------------------------------------LSQV--------------
D4LVS3_9FIRM/273-410--------------------------------------------------------------MKET--------------
A9RT89_PHYPA/97-240--------------------------------------------------------------TLPF--------------
ACCA_PELCD/4-146--------------------------------------------------------------YLDF--------------
E4TL55_MARTH/2-145--------------------------------------------------------------LLEF--------------
ACCA_PELPB/6-163--------------------------------------------------------------VLDF--------------
E1VNM7_9GAMM/16-159--------------------------------------------------------------YLEF--------------
K4AZH5_SOLLC/103-246--------------------------------------------------------------TLAF--------------
C6D8B9_PAESJ/6-149--------------------------------------------------------------MLPF--------------
K0J396_AMPXN/4-147--------------------------------------------------------------ILDF--------------
E8U5S6_DEIML/5-142--------------------------------------------------------------....--------------
ACCA_CAUCR/5-149--------------------------------------------------------------YLDF--------------
F2LWN6_HIPMA/3-146--------------------------------------------------------------LLDF--------------
G2LDZ5_CHLTF/6-153--------------------------------------------------------------...K--------------
E4TI62_CALNY/6-148--------------------------------------------------------------.LEF--------------
ACCA_PSEAE/5-148--------------------------------------------------------------FLDF--------------
D5SMU5_PLAL2/7-147--------------------------------------------------------------.LPF--------------
H8KZ76_FRAAD/5-148--------------------------------------------------------------FLDF--------------
L0G434_ECHVK/2-145--------------------------------------------------------------VLEF--------------
C7JEV8_ACEP3/4-146--------------------------------------------------------------FLDF--------------
U3U7V8_9ENTR/5-151--------------------------------------------------------------YPDF--------------
I4AJK8_FLELS/2-145--------------------------------------------------------------LLDF--------------
U6B8Z9_9RHIZ/4-148--------------------------------------------------------------YLDF--------------
I3THF2_TISMK/4-147--------------------------------------------------------------FLDF--------------
C7PMD3_CHIPD/3-146--------------------------------------------------------------FLDF--------------
D5BMW6_PUNMI/4-146--------------------------------------------------------------FLDF--------------
C6VWQ9_DYAFD/4-147--------------------------------------------------------------YLDF--------------
A0A068NX81_9BACT/5-153--------------------------------------------------------------HKEW--------------
K7S984_GLUOY/13-161--------------------------------------------------------------FLDF--------------
F2JNG5_CELLD/8-142--------------------------------------------------------------LEAI--------------
L0DWX9_THIND/5-148--------------------------------------------------------------FLDF--------------
K9Q7M9_9NOSO/10-153--------------------------------------------------------------LLDF--------------
ACCA_TRIEI/9-152--------------------------------------------------------------LLDF--------------
L0EVZ1_LIBCB/4-148--------------------------------------------------------------YLNF--------------
D4M3A9_9FIRM/275-407--------------------------------------------------------------MKEV--------------
ACCA_NITSB/4-141--------------------------------------------------------------YLDF--------------
R5QCK4_9BURK/6-152--------------------------------------------------------------FLEF--------------
R6P4G2_9CLOT/2-145--------------------------------------------------------------KLDF--------------
ACCA_CARHZ/6-148--------------------------------------------------------------.FEF--------------
ACCA_CELJU/5-148--------------------------------------------------------------YLDF--------------
G2ISU6_9SPHN/4-147--------------------------------------------------------------YLDF--------------
D4KAA0_9FIRM/2-148--------------------------------------------------------------IKDI--------------
F6IN39_9SPHN/4-146--------------------------------------------------------------YLDF--------------
D4Z3Q1_SPHJU/4-147--------------------------------------------------------------FLEF--------------
W0EXF5_9SPHI/9-152--------------------------------------------------------------FLDF--------------
I3ZX40_ORNRL/3-147--------------------------------------------------------------YLPF--------------
F0RKQ5_DEIPM/7-153--------------------------------------------------------------....--------------
E0UBA6_CYAP2/10-153--------------------------------------------------------------LLDF--------------
R5YAR4_9PROT/8-151--------------------------------------------------------------VLDF--------------
ACCA_ACICJ/4-146--------------------------------------------------------------FLDF--------------
K9SWQ9_9SYNE/7-150--------------------------------------------------------------LLDF--------------
ACCA_THET8/3-145--------------------------------------------------------------.LEF--------------
B8EN13_METSB/21-164--------------------------------------------------------------YLDF--------------
Q39833_SOYBN/90-233--------------------------------------------------------------TLDF--------------
E8RUB5_ASTEC/4-147--------------------------------------------------------------YLEF--------------
ACCA_TERTT/5-148--------------------------------------------------------------YLDF--------------
C6Y0P1_PEDHD/8-150--------------------------------------------------------------.FDF--------------
ACCA_CHLTR/3-146--------------------------------------------------------------LLPH--------------
ACCA_THICR/5-147--------------------------------------------------------------FLDF--------------
ACCA_ALKEH/5-148--------------------------------------------------------------FLDF--------------
ACCA_OCEIH/4-147--------------------------------------------------------------ILDF--------------
ACCA_WIGBR/5-149--------------------------------------------------------------FLDF--------------
Q1IN03_KORVE/6-146--------------------------------------------------------------..KA--------------
F4L135_HALH1/3-146--------------------------------------------------------------FLEF--------------
E1SU30_FERBD/5-150--------------------------------------------------------------FLEF--------------
E1X4H2_HALMS/9-151--------------------------------------------------------------TLEF--------------
F6DPP9_DESRL/2-145--------------------------------------------------------------ALDF--------------
K9SI36_9CYAN/7-154--------------------------------------------------------------LLDF--------------
D3PDG9_DEFDS/6-148--------------------------------------------------------------.LPF--------------
R6SFM1_9FIRM/263-401--------------------------------------------------------------...F--------------
D8TBU9_SELML/23-165--------------------------------------------------------------TLPF--------------
B4ETY2_PROMH/5-152--------------------------------------------------------------HLEF--------------
ACCA_THEYD/4-147--------------------------------------------------------------YLDF--------------
R5YCC5_9FIRM/275-410--------------------------------------------------------------MRST--------------
ACCA_RHILO/4-148--------------------------------------------------------------YLDF--------------
C0ZEF2_BREBN/2-145--------------------------------------------------------------SLDF--------------
C4L480_EXISA/3-141--------------------------------------------------------------....--------------
Q187P7_PEPD6/3-145--------------------------------------------------------------.ENN--------------
ACCA_AROAE/5-148--------------------------------------------------------------FLDF--------------
W8TMD3_EUBAC/5-147--------------------------------------------------------------.NEF--------------
R7I7W2_9BURK/5-149--------------------------------------------------------------FLDF--------------
C9RBG3_AMMDK/4-147--------------------------------------------------------------YLDF--------------
ACCA_ACTP2/5-149--------------------------------------------------------------YLDF--------------
W8EY50_9BACT/2-145--------------------------------------------------------------LLDF--------------
C8W257_DESAS/5-148--------------------------------------------------------------VLEF--------------
J9QYP7_RIEAN/3-148--------------------------------------------------------------YLDF--------------
ACCA_CAMJE/5-141--------------------------------------------------------------.LDF--------------
F0S695_PSESL/5-147--------------------------------------------------------------.FDF--------------
H2FXK3_OCESG/5-150--------------------------------------------------------------FLDF--------------
F0S0A5_DESTD/5-143--------------------------------------------------------------.FEF--------------
B3QS67_CHLT3/5-161--------------------------------------------------------------ILDF--------------
D7A5W6_STAND/4-148--------------------------------------------------------------YLDF--------------
F0LUJ9_VIBFN/5-151--------------------------------------------------------------FLEF--------------
ACCA_BACHD/5-147--------------------------------------------------------------.LDF--------------
R5EMT9_9GAMM/5-150--------------------------------------------------------------YLEF--------------
ACCA_PROA2/6-163--------------------------------------------------------------VLDF--------------
F0T0C4_SYNGF/2-144--------------------------------------------------------------.LEG--------------
H8GK81_METAL/5-148--------------------------------------------------------------FLDF--------------
D5WSS7_KYRT2/5-147--------------------------------------------------------------.LPF--------------
F6GHA4_LACS5/3-147--------------------------------------------------------------YLEF--------------
W8KT18_HALHR/5-148--------------------------------------------------------------FLEF--------------
ACCA_GEOMG/7-148--------------------------------------------------------------.LEF--------------
K9Z068_CYAAP/11-154--------------------------------------------------------------LLEF--------------
H1XP22_9BACT/9-151--------------------------------------------------------------ILEF--------------
H2IA21_FLACA/3-147--------------------------------------------------------------YLDF--------------
C8WRU9_ALIAD/5-147--------------------------------------------------------------.LDF--------------
F7XXZ5_MOREP/5-149--------------------------------------------------------------FLDF--------------
ACCA_BACSK/5-147--------------------------------------------------------------.QEF--------------
R5QM64_9PROT/6-149--------------------------------------------------------------YLDF--------------
B3ERA3_AMOA5/2-146--------------------------------------------------------------LLEF--------------
K4IV53_PSYTT/3-147--------------------------------------------------------------YLDF--------------
B2V9Z0_SULSY/2-143--------------------------------------------------------------..DI--------------
F5Y6P2_TREAZ/2-135--------------------------------------------------------------....--------------
ACCA_PARDP/3-147--------------------------------------------------------------YLEF--------------
ACCA_OLICO/8-150--------------------------------------------------------------YLDF--------------
D6Z010_DESAT/30-172--------------------------------------------------------------....--------------
ACCA_OCHA4/4-148--------------------------------------------------------------YLDF--------------
S0EW53_CHTCT/6-157--------------------------------------------------------------.LDF--------------
ACCA_COLP3/5-150--------------------------------------------------------------FLDF--------------
ACCA_ARCB4/5-141--------------------------------------------------------------.LEF--------------
ACCA_TOLAT/5-150--------------------------------------------------------------FLEF--------------
H6N9Y7_9BACL/6-147--------------------------------------------------------------..PF--------------
C7NC27_LEPBD/4-144--------------------------------------------------------------....--------------
ACCA_DEIRA/4-145--------------------------------------------------------------..TP--------------
R7GN66_9FIRM/3-139--------------------------------------------------------------LKEK--------------
G8R0N5_OWEHD/3-147--------------------------------------------------------------YLDF--------------
R5S9W6_9GAMM/4-147--------------------------------------------------------------VLDF--------------
R5RFQ5_9FIRM/9-143--------------------------------------------------------------....--------------
K0B3H8_CLOA9/4-147--------------------------------------------------------------SLDF--------------
E3HB41_ILYPC/2-143--------------------------------------------------------------..EF--------------
D6GQG0_FILAD/2-144--------------------------------------------------------------....--------------
K0P1U1_9BACT/2-146--------------------------------------------------------------LLDF--------------
F2J212_POLGS/4-148--------------------------------------------------------------YLEF--------------
U5QFX0_9CYAN/13-155--------------------------------------------------------------.IDF--------------
E8R5M4_ISOPI/5-159--------------------------------------------------------------.LPF--------------
R6J4C9_9PROT/8-151--------------------------------------------------------------VLDF--------------
S5RQ07_9PROT/5-148--------------------------------------------------------------FLNF--------------
ACCA_DICNV/5-148--------------------------------------------------------------YLDF--------------
ACCA_AQUAE/8-151--------------------------------------------------------------HLEF--------------
E8UCK2_TAYEM/5-148--------------------------------------------------------------FLEF--------------
B3DWQ6_METI4/5-148--------------------------------------------------------------YLDF--------------
B8DL69_DESVM/26-171--------------------------------------------------------------....--------------
C7R5W6_KANKD/5-148--------------------------------------------------------------FLDF--------------
I6ZWV1_MELRP/5-146--------------------------------------------------------------TLDF--------------
L0F5J8_DESDL/5-147--------------------------------------------------------------.FDF--------------
I0K7J9_9BACT/4-147--------------------------------------------------------------YLDF--------------
Q0BUI6_GRABC/12-154--------------------------------------------------------------FLEF--------------
U5LED4_9BACI/5-147--------------------------------------------------------------.LEF--------------
J7QSL5_METSZ/4-148--------------------------------------------------------------YLDF--------------
ACCA_BACAN/4-146--------------------------------------------------------------.LEF--------------
K4LJD9_9FIRM/2-144--------------------------------------------------------------.LER--------------
X2H0U8_9GAMM/4-150--------------------------------------------------------------FLEF--------------
ACCA_BAUCH/6-151--------------------------------------------------------------.IDF--------------
ACCA_STRMK/5-148--------------------------------------------------------------YLDF--------------
F8EKR1_RUNSL/4-147--------------------------------------------------------------YLDF--------------
G8T7C8_NIAKG/9-152--------------------------------------------------------------FLDF--------------
ACCA_CYAP4/9-152--------------------------------------------------------------LLEF--------------
ACCA_BEII9/4-148--------------------------------------------------------------YLDF--------------
J9Z203_9PROT/3-145--------------------------------------------------------------YLDF--------------
M1E6T6_9FIRM/9-151--------------------------------------------------------------YIDF--------------
ACCA_NITEU/5-148--------------------------------------------------------------FLDF--------------
C7RN27_ACCPU/5-148--------------------------------------------------------------FLDF--------------
F9ZM26_ACICS/5-145--------------------------------------------------------------YLDF--------------
K0C175_CYCSP/5-148--------------------------------------------------------------YLDF--------------
A5G4G6_GEOUR/6-148--------------------------------------------------------------YLEF--------------
E3F1D1_KETVY/3-147--------------------------------------------------------------YLDF--------------
Q3JCT5_NITOC/9-152--------------------------------------------------------------FLDF--------------
K9VDH0_9CYAN/10-153--------------------------------------------------------------LLDF--------------
ACCA_LISMO/5-147--------------------------------------------------------------.MEF--------------
A8FG56_BACP2/5-147--------------------------------------------------------------.LEF--------------
ACCA_RUTMC/5-145--------------------------------------------------------------YLDF--------------
Q2RXX2_RHORT/7-150--------------------------------------------------------------FLDF--------------
ACCA_PSEHT/5-150--------------------------------------------------------------YLDF--------------
E6W2T7_DESIS/5-148--------------------------------------------------------------ALEF--------------
D0MDD2_RHOM4/9-159--------------------------------------------------------------LLDF--------------
F8L7E7_SIMNZ/5-148--------------------------------------------------------------MLDH--------------
W0RIF3_9BACT/5-148--------------------------------------------------------------ALDF--------------
L0D934_SINAD/9-155--------------------------------------------------------------.LPF--------------
F2NQ24_MARHT/2-145--------------------------------------------------------------ALEF--------------
E6X0S5_NITSE/4-141--------------------------------------------------------------YLDF--------------
F4CCW2_SPHS2/4-147--------------------------------------------------------------TFDF--------------
D3ECM3_GEOS4/5-147--------------------------------------------------------------.LPF--------------
ACCA_SPHAL/4-147--------------------------------------------------------------FLDF--------------
Q0AMD1_MARMM/8-151--------------------------------------------------------------YLDF--------------
B3E7C0_GEOLS/6-146--------------------------------------------------------------YMEF--------------
Q1D555_MYXXD/8-151--------------------------------------------------------------VLEF--------------
ACCA_CHRSD/5-148--------------------------------------------------------------YLDF--------------
ACCA_EXIS2/3-143--------------------------------------------------------------..PF--------------
F8KZD1_PARAV/4-145--------------------------------------------------------------.LPH--------------
ACCA_FUSNN/2-143--------------------------------------------------------------..QF--------------
S6B4Y6_9PROT/5-148--------------------------------------------------------------FLDF--------------
B4U9A1_HYDS0/4-142--------------------------------------------------------------....--------------
ACCA_CHESB/4-148--------------------------------------------------------------YLDF--------------
A1AQQ7_PELPD/6-148--------------------------------------------------------------NLEF--------------
F8JC16_HYPSM/32-176--------------------------------------------------------------YLDF--------------
B9E7A5_MACCJ/2-145--------------------------------------------------------------VLDF--------------
D4H0L9_DENA2/5-148--------------------------------------------------------------TLDF--------------
F0SFK4_RUBBR/6-146--------------------------------------------------------------.LPF--------------
ACCA_SPHWW/4-147--------------------------------------------------------------YLEF--------------
F6CQZ6_DESK7/2-145--------------------------------------------------------------VYDF--------------
R5K1S9_9CLOT/3-142--------------------------------------------------------------.REI--------------
I4D4N6_DESAJ/5-147--------------------------------------------------------------.FDF--------------
D6YRI8_WADCW/23-165--------------------------------------------------------------ILPH--------------

PF01039

PCCB_SACEN/46-544---------------------------------------KQHAKGKRTARERIDMLLDEGS.FVELDEHARHRSTNFGM.
ACACB_HUMAN/1780-2334---------------------------------------QEYPEGRDVIVIGNDITFRIGS.FGPGEDLLYLRASEMAR.
PCCB_BACSU/26-505---------------------------------------QQRQKGKLTARERIIFLLDQDS.FIELHPFMESQVLTREQ.
YNGE_BACSU/27-509---------------------------------------SNREKGKLFVRERLSLLFDDDI...ELEDAFFAECMSDG..
ACACA_HUMAN/1669-2223---------------------------------------PEYPEGRDIIVIGNDITYRIGS.FGPQEDLLFLRASELAR.
PCCB_HUMAN/57-537---------------------------------------AQHKRGKLTARERISLLLDPGS.FVESDMFVEHRCADFGMA
Q9ZCU2_RICPR/30-512---------------------------------------AQHQKGKLTARERIEVLLDPNS.FTETGMFVSHRCDNFGMQ
ACC1_ARATH/1587-2139---------------------------------------PEFPMGRKLLVIANDVTFKAGS.FGPREDAFFLAVTELAC.
HFA1_YEAST/1619-2176---------------------------------------PEYPEGRNMIVISNDITYNIGS.FGPREDLFFDRVTNYAR.
O28066_ARCFU/27-514---------------------------------------RQHEQGKLTARERIELLLDPGS.FVEINPFVEKRNTDFGL.
O86318_MYCTU/45-527---------------------------------------RHHARGNLTPRERIELLVDPDSPFLELSPLAAY...GSNF.
Q20676_CAEEL/55-534---------------------------------------AQHARGKLTARERIDLLLDRNT.FREYDMFAEHTCNDFGMQ
O86517_STRCO/39-525---------------------------------------AQHAKGKLTARERIELLLDPGS.FREVEQLRRHRATGFGLE
PCCB_MYCLE/50-547---------------------------------------KVHAKGKFTARERIYALLDDDS.FVELDALARHRSTNFGLG
ACAC_YEAST/1574-2130---------------------------------------PEYPRGRQFVVVANDITFKIGS.FGPQEDEFFNKVTEYAR.
MCCB_ARATH/93-585---------------------------------------RNRSRNKLLPRERIDRLLDPGSSFLELSQLAGHELYEEPL.
ACAC_SCHPO/1615-2170---------------------------------------PEYPNGRKIIVVANDITFQIGS.FGPQEDEYFYKVTQLAR.
MCCB_CAEEL/119-606---------------------------------------LHRSRGKMLARERIDGIVDAGSPFIEFSQLAGYEMYGKEE.
GCDA_ACIFV/54-573---------------------------------------DVNKRGELTALQRIEKLVEPGS.WRPLNTLFNPQGNKNG..
B5YMF5_THAPS/1470-2012---------------------------------------PEYPEGREVVFISNDITVQSGS.FGVAEDEVFFKASKYAR.
D1BNG7_VEIPT/29-507---------------------------------------KQHAQGKMTARERLAKLFDDNS.FVELDQFVKHRCVNFGQ.
D7GFR7_PROFC/38-518---------------------------------------KQHSQGKQTARERLNNLLDPHS.FDEVGAFRKHRTTLFGM.
G5EAT9_EMENI/1606-2161---------------------------------------PEYPEGRRFIIVANDITFQIGS.FGPLEDKFFHKCTELAR.
M0WLS8_HORVD/1642-2195---------------------------------------PEYPNGRQIVVIANDITFRAGS.FGPREDAFFETVTNLAC.
ACCD_MYCTU/14-479---------------------------------------..LDRGSFVSWDSEPLAVPVAD...SYARELAAARAATG..
Q1DDA0_MYXXD/32-518---------------------------------------KQHESGKLTARERIDLLLDPGS.FCELDKFVTHRSSEFGMG
A0A0D1DYD5_USTMA/1546-2102---------------------------------------PEYPAGRKLVVIGNDVTIQAGS.FGPVEDRFFAAASKLAR.
Q8NSG7_CORGL/44-541---------------------------------------KVHAAGRLTARERLDYLLDEGS.FIETDQLARHRTTAFGL.
Q8NSG8_CORGL/38-535---------------------------------------KVHAAGRKTARERIEYLLDEGS.FVEIDALARHRSKNFGL.
Q8U305_PYRFU/28-520---------------------------------------KQHDKGKLTARERIELLLDPGS.FVEIGMFVKHRATEFGM.

PF06833

Q8P4U4_XANCP/5-230---------------------------------------------------------ALFDQLFPL--------------
Q89XP1_BRADU/5-233---------------------------------------------------------DIIASLFPD--------------
Q9I6S6_PSEAE/11-268---------------------------------------------------------AWFQALAGS--------------
Q89UY5_BRADU/5-233---------------------------------------------------------DILAGLFPN--------------
Q87V58_PSESM/9-266---------------------------------------------------------NWFNALSAD--------------
A6T8S0_KLEP7/11-266---------------------------------------------------------.WLNKLAPD--------------

PF03572

Q8CVF0_LEPIN/340-512-----------------------------------------------------------HIGYIKLTGFVKSEE......
CTPA_SYNP2/215-376-----------------------------------------------------------KVGYIRLNQF..SA.......
Q81R25_BACAN/181-400-----------------------------------------------------------DTLLITLTDFANIE.......
Q7UUN0_RHOBA/410-573-----------------------------------------------------------KIGYFRLTNF..QK.......
Q8Y2I4_RALSO/213-395-----------------------------------------------------------GIAWVRITSF..QE.......
Q8DII0_THEEB/215-376-----------------------------------------------------------TVGYIRLSQF..SA.......
Q8R712_CALS4/193-353-----------------------------------------------------------GIGYIKITEF..NE.......
Q87YB6_PSESM/365-539-----------------------------------------------------------KLGVIDIPAFYLDFKAYRA..
TRI_SULSO/887-1042-----------------------------------------------------------RLGYIHIPDM...........
Q7VMG7_HAEDU/365-546-----------------------------------------------------------NIAVIKIPAFYIGL.......
Q8R7P6_CALS4/299-499-----------------------------------------------------------KVAYLKIPEM....KMSQ...
Q8A406_BACTN/202-362-----------------------------------------------------------KVGYISLSTF..SG.......
Q7NKF3_GLOVI/143-304-----------------------------------------------------------GIAQVQLASI....G......
TRI_THEAC/878-1033-----------------------------------------------------------TIGYIHIPDM...........
O83301_TREPA/167-332-----------------------------------------------------------NIAYVRLIEF..NP.......
Q7TUF4_PROMP/222-383-----------------------------------------------------------TIGYLRITQF..SE.......
Q8R6Q0_CALS4/169-397-----------------------------------------------------------KVAYLKVYSF...LIDRHK..
Q87PB1_VIBPA/356-526-----------------------------------------------------------KIGVLEVPSFYVGL.......
Q8EDY9_SHEON/364-534-----------------------------------------------------------KVGVIQIPGFYMNL.......
Q97LQ5_CLOAB/210-372-----------------------------------------------------------EIGYMQVSMF..DE.......
O66985_AQUAE/192-355-----------------------------------------------------------GIGYIKISQF..TS.......
Q9RU43_DEIRA/206-370-----------------------------------------------------------NIGYVALNTFYNEQ.......
P73458_SYNY3/220-381-----------------------------------------------------------RVGYIRLNQF..SA.......
Q7UNS4_RHOBA/218-383-----------------------------------------------------------DIVYVRMTSF..GD.......
Q9RUS4_DEIRA/235-411-----------------------------------------------------------DVALIRIPTF...........
Q894Q8_CLOTE/197-416-----------------------------------------------------------DTAYIKINNF....YHY....
Q82BY0_STRAW/878-1033-----------------------------------------------------------RLGYLHVPDM...........
Q8YRM4_NOSS1/218-379-----------------------------------------------------------SFGYLRLTQF..NA.......
Q8CVF1_LEPIN/197-364-----------------------------------------------------------KLGYIKLNQFMGKE.......
Q8A5K0_BACTN/312-500-----------------------------------------------------------KIGYLVYSAF....E......
Q89KT1_BRADU/201-369-----------------------------------------------------------DIGYIRVTSF..NE.......
Q8ENJ3_OCEIH/223-384-----------------------------------------------------------LTGIIEITNF..SE.......
Q8XNN1_CLOPE/231-397-----------------------------------------------------------DIGYIEVLAF..DE.......
Q8P5D2_XANCP/126-301-----------------------------------------------------------DVGYVAVPGL....MTSS...
PRC_HAEIN/363-533-----------------------------------------------------------NIAVIKIPSFYIGL.......
Q8Y649_LISMO/229-395-----------------------------------------------------------KIAHVTISTF..SE.......
P75023_SYNY3/244-405-----------------------------------------------------------RVGYIRLDEF..SS.......
Q9A2X1_CAUCR/195-362-----------------------------------------------------------DYGYVRLPGF..NE.......
Q8R7P7_CALS4/191-422-----------------------------------------------------------KIAYLRVNSF...LIDKDQ..
Y858_CHLTR/316-560-----------------------------------------------------------KVGFLRIPTY.SWQDMEDF..
Q8KAA8_CHLTE/214-383-----------------------------------------------------------SSGYVQMNSF..SE.......
Q8ZXG0_PYRAE/836-991-----------------------------------------------------------AVGYIHIPDM...........
Q7VFQ7_HELHP/223-383-----------------------------------------------------------DFAYVRVASF..DK.......
Q8A3B9_BACTN/191-351-----------------------------------------------------------KIGYIRINRF..GA.......
Q7VBS8_PROMA/229-390-----------------------------------------------------------HFGYIRLKQF..SA.......
CTPA2_ARATH/320-483-----------------------------------------------------------KIGYIKLTTF..NQ.......
Q815H1_BACCR/212-374-----------------------------------------------------------DIGYMQITSF..AE.......
Q87UG9_PSESM/211-377-----------------------------------------------------------GYGYIRITQF..QV.......
Q7V214_PROMP/205-366-----------------------------------------------------------LIGYVRLKQF..NA.......
Q7NPI8_GLOVI/227-389-----------------------------------------------------------PIGYIRLSQF..NG.......
Q82H90_STRAW/894-1049-----------------------------------------------------------HCGYLHIPDM...........
Q9AAF2_CAUCR/247-457-----------------------------------------------------------DAAILTMPTW....GLY....
Q87Q24_VIBPA/260-446-----------------------------------------------------------KVGYLQYNSF....E......
RET3_HUMAN/438-617-----------------------------------------------------------NVGYLRFDSF....ADAS...
Q7UJ42_RHOBA/384-569-----------------------------------------------------------KLGYINLPSFYMDMEAARR..
Q8R7Q0_CALS4/178-406-----------------------------------------------------------KIAYLKIYSF...LIDYHK..
Q8R8M1_CALS4/207-366-----------------------------------------------------------KIGYIKITLF..DQ.......
Q8YPV0_NOSS1/193-349-----------------------------------------------------------KIGYVHIWSN...........
PRC_ECOLI/356-530-----------------------------------------------------------KVGVLDIPGFYVGL.......
Q892K7_CLOTE/192-411-----------------------------------------------------------DTCYVKIHTF....NHD....
Q834H3_ENTFA/208-374-----------------------------------------------------------QIGSIKITSF..GK.......
Q89X80_BRADU/202-369-----------------------------------------------------------DIAYIRITTF..NE.......
Q8DGJ2_THEEB/238-398-----------------------------------------------------------RVGYIRLSGF..NS.......
Q9CP01_PASMU/362-532-----------------------------------------------------------IVASIKIPSFYIGL.......
Q896W4_CLOTE/217-379-----------------------------------------------------------NIGYVHIKSF..GN.......
Q7MSB3_WOLSU/198-359-----------------------------------------------------------EMLYVRVTSF..DK.......
Q9WZK6_THEMA/203-364-----------------------------------------------------------SIGYVRITRF..GE.......
Q8YW78_NOSS1/226-387-----------------------------------------------------------RVGYIRLREF..SA.......
Q83BH0_COXBU/210-383-----------------------------------------------------------GYGYVRITFF..QG.......
Q7NSR6_CHRVO/194-376-----------------------------------------------------------GYGYVRIAQF..QE.......
Q9RUA1_DEIRA/235-408-----------------------------------------------------------RVAVIDLPSF...........
Q9A6Q6_CAUCR/254-429-----------------------------------------------------------DVGYLNVLTM..GAFARNA..
Q7MTT6_PORGI/195-361-----------------------------------------------------------SIAYVRIDSW..TG.......
Q9L1S8_STRCO/194-352-----------------------------------------------------------GLTVVKVTSF..TK.......
Q82PY7_STRAW/269-453-----------------------------------------------------------GTGYLRVSGF....GGYDG..
Q7MXF8_PORGI/163-329-----------------------------------------------------------RTGYIRLSRF..SR.......
Q8KDJ6_CHLTE/340-525-----------------------------------------------------------KIGVIVLPSFYLDFEGERQ..
Q8A1T1_BACTN/145-316-----------------------------------------------------------NIGYIRYESF....S......
Q7NGR6_GLOVI/216-377-----------------------------------------------------------RVGYIRLSQF..NA.......
Q8R640_FUSNN/203-364-----------------------------------------------------------GIGYLRLTQF..GD.......
Q82TT8_NITEU/202-384-----------------------------------------------------------GYAYVRITQF..QE.......
Q7NL17_GLOVI/226-387-----------------------------------------------------------KLGYIQLQQF..NA.......
Q8DZX2_STRA5/125-302-----------------------------------------------------------DILLITIPSI....S......
CTPA_SYNY3/218-379-----------------------------------------------------------SVGYIRLSQF..SA.......
O25905_HELPY/210-371-----------------------------------------------------------PYLYVRVSGF..DK.......
Q7U4U5_SYNPX/228-389-----------------------------------------------------------TLGYLRITQF..TD.......
Q7MUB1_PORGI/151-321-----------------------------------------------------------SIGYIVYESF....G......
CTPB_BACSU/213-375-----------------------------------------------------------SVGYIAISTF..SE.......
O84448_CHLTR/354-525-----------------------------------------------------------IIGKITLHSFYEGEN......
Q8DJ23_THEEB/220-381-----------------------------------------------------------PVGYIRLVTF..SS.......
Q8A7W6_BACTN/916-1071-----------------------------------------------------------RLGYVHIQSM...........
Q9KNC0_VIBCH/209-365-----------------------------------------------------------RLGYVHLAAM...........
Q7U711_SYNPX/231-392-----------------------------------------------------------KIGYIRLKQF..NA.......
Q8YU55_NOSS1/219-380-----------------------------------------------------------KVGYIRLNQF..SA.......
Q8KD83_CHLTE/187-349-----------------------------------------------------------RTGYIRISQF..VE.......
Q8EBT8_SHEON/888-1043-----------------------------------------------------------KIGYLHLYAM...........
Q7VS41_BORPE/198-377-----------------------------------------------------------NVAYLRIAQF..QE.......
CTPA_BACSU/201-363-----------------------------------------------------------NIGEIQITSF..SE.......
TRIC_SULTO/669-824-----------------------------------------------------------KLGYVHIPDM...........
Q9K6X5_BACHD/210-372-----------------------------------------------------------TIGMLEITSF..SE.......
Q7MVK0_PORGI/205-366-----------------------------------------------------------SIGYIRLNNF..TD.......
Q8P3J7_XANCP/253-471-----------------------------------------------------------RLAILRMPDW....ALY....
Q89ZW2_BACTN/204-370-----------------------------------------------------------DIGYVKVSKF..GR.......
Q8EKP4_SHEON/197-361-----------------------------------------------------------NIGYVRLSSF..QE.......
Q7TUQ0_PROMM/225-386-----------------------------------------------------------TLGYLRITQF..SE.......
Q890X6_CLOTE/207-369-----------------------------------------------------------DVALVQVTMF..DE.......
Q7NPD6_GLOVI/225-386-----------------------------------------------------------KVGYIRLAEF..SE.......
B2J2K4_NOSP7/217-378-----------------------------------------------------------KIGYIRLPEF..TQ.......
CTPA3_ARATH/310-472-----------------------------------------------------------KTGYVKLTAF..SQ.......
CTPA1_ARATH/307-467-----------------------------------------------------------.VGYIRLKEF..NA.......
G3WSG1_SARHA/36-212-----------------------------------------------------------NVGYLRVDYI.PGRDM.....
M0ZTS1_SOLTU/116-276-----------------------------------------------------------.VGYVRLKEF..NA.......
M3WLH1_FELCA/129-305-----------------------------------------------------------NVGYLRVDDI.PSQEV.....
Q1D0E2_MYXXD/209-374-----------------------------------------------------------.IGHVKVKNF..QD.......
Q2YLJ3_BRUA2/181-348-----------------------------------------------------------DVGYLRIISF..TE.......
CTPAL_STAEQ/226-389-----------------------------------------------------------NVGVLTINKF..QS.......
Q9PA16_XYLFA/231-394-----------------------------------------------------------.YGYIRISVF..QA.......
Q9PCF8_XYLFA/366-548-----------------------------------------------------------RIGIIKLPTF..YEDFEGRRR
Q9ZDU6_RICPR/189-355-----------------------------------------------------------NIAYIRITTF..NE.......

PF01972

Y137_METJA/3-286-------------------------------------------------------------------------GIPV-YK
Y1495_METJA/9-292-------------------------------------------------------------------------GIPI-YK
O29403_ARCFU/7-290-------------------------------------------------------------------------GIPI-YR
O66996_AQUAE/1-288-------------------------------------------------------------------------GIPI-FR

PF00574

Q7XBR2_ORYSJ/73-254-------------------------------------------------------------------------GNEI.ED
CLPP2_BORBU/6-189-------------------------------------------------------------------------AGEI.TK
CLPP1_BORBU/13-194-------------------------------------------------------------------------SGEI.ND
CLPP1_CAEEL/34-215-------------------------------------------------------------------------MTPV.DD
CLPP4_ARATH/74-253-------------------------------------------------------------------------GSSI.DD
CLPP1_CHLTR/3-189-------------------------------------------------------------------------SEPV.TE
Q9CFR9_LACLA/7-176-------------------------------------------------------------------------TSPS.KV
CLPP1_PSEAE/28-209-------------------------------------------------------------------------VGQV.ED
CLPP2_RHIME/20-201-------------------------------------------------------------------------TGPV.ED
CLPP2_BACHD/13-194-------------------------------------------------------------------------GAAI.DD
CLPP_CAUCR/20-201-------------------------------------------------------------------------TGPV.ED
CLPP5_ARATH/107-288-------------------------------------------------------------------------GGAV.DD
CLPP_MOUSE/63-244-------------------------------------------------------------------------MGPI.DD
CLPP_CALS4/12-193-------------------------------------------------------------------------GDEI.ND
O97252_PLAF7/180-359-------------------------------------------------------------------------TDEI.NK
CLPP1_AGRFC/16-197-------------------------------------------------------------------------NGEV.DD
CLPP_XYLFA/19-200-------------------------------------------------------------------------VGPI.DD
Q42886_SOLLC/95-274-------------------------------------------------------------------------GQPV.NS
CLPP1_TREPA/17-198-------------------------------------------------------------------------DGEI.TD
CLPP2_MYCLE/27-207-------------------------------------------------------------------------GVQV.DD
CLPP_DEIRA/15-196-------------------------------------------------------------------------GTPV.ES
CLPP1_BACHD/12-193-------------------------------------------------------------------------GTAI.DD
CLPP_THEMA/21-202-------------------------------------------------------------------------GSPI.DD
CLPP2_TREPA/15-193-------------------------------------------------------------------------SGEI.SK
CLPP_CHLTE/37-218-------------------------------------------------------------------------GSPI.DE
TEPA_BACHD/48-232-------------------------------------------------------------------------PPQN.KT
CLPP3_NOSS1/13-196-------------------------------------------------------------------------GRDV.DD
CLPP3_AGRFC/23-198-------------------------------------------------------------------------YGGI.TQ
CLPP1_RHILO/16-197-------------------------------------------------------------------------NGEI.ND
CLPP1_SYNE7/10-191-------------------------------------------------------------------------GEPV.TS
CLPP_CLOPE/13-194-------------------------------------------------------------------------SGEV.ND
CLPP_RICPR/12-193-------------------------------------------------------------------------CSTV.ED
CLPP2_CORGL/13-195-------------------------------------------------------------------------GSQV.DD
CLPP1_CORGL/24-204-------------------------------------------------------------------------GTQV.DD
CLPP5_STRCO/18-201-------------------------------------------------------------------------GTPV.DE
CLPP_CLOAB/12-193-------------------------------------------------------------------------GEEV.ND
CLPP_HAEIN/12-193-------------------------------------------------------------------------SGEV.ED
CLPP_CHLRE/310-482-------------------------------------------------------------------------GRSL.YR
CLPP1_STRCO/32-208-------------------------------------------------------------------------GQPV.DD
CLPR2_ARATH/79-263-------------------------------------------------------------------------GQNI.DE
CLPP3_SYNY3/13-197-------------------------------------------------------------------------GQEV.ND
CLPP4_STRCO/14-196-------------------------------------------------------------------------GTEI.DD
CLPP2_PSEAE/13-193-------------------------------------------------------------------------TGGV.DE
CLPP_WHEAT/13-197-------------------------------------------------------------------------GQEI.RC
CLPP2_STRCO/28-210-------------------------------------------------------------------------GVQI.DD
CLPP_AQUAE/19-200-------------------------------------------------------------------------GSPI.DD
CLPP3_SYNE7/13-197-------------------------------------------------------------------------GQEV.TD
CLPP1_NOSS1/11-192-------------------------------------------------------------------------GQQV.DS
CLPP2_ARATH/41-222-------------------------------------------------------------------------NGPI.ND
CLPP_RALSO/34-215-------------------------------------------------------------------------VGEV.ND
CLPP2_SYNY3/32-213-------------------------------------------------------------------------GTPV.DD
Q8ZQG9_SALTY/47-225-------------------------------------------------------------------------YDEIGGW
CLPP_CAMJE/11-192-------------------------------------------------------------------------SGEI.HD
CLPP2_MYXXD/11-192-------------------------------------------------------------------------GTPV.ND
Q9VKY3_DROME/38-219-------------------------------------------------------------------------MGNI.TD
F2YGL7_CHLVA/18-193-------------------------------------------------------------------------CQEL.DD
G8AKT8_AZOBR/21-200-------------------------------------------------------------------------IGGV.ND
M4CIZ3_BRARP/88-261-------------------------------------------------------------------------GSQV.DD
CLPP1_MYCTU/18-192-------------------------------------------------------------------------GSEV.ND
CLPP_STAA8/13-191-------------------------------------------------------------------------GSQI.DD
CLPP_BRUA2/21-200-------------------------------------------------------------------------NGPV.ED
CLPP_NEIG1/17-198-------------------------------------------------------------------------VGPV.TD
CLPP_STRT2/10-192-------------------------------------------------------------------------TGPI.ED
CLPP1_BACAN/14-192-------------------------------------------------------------------------GSEI.ND
Q8Y7Y1_LISMO/12-186-------------------------------------------------------------------------YGEI.NQ
CLPP_LISMO/12-192-------------------------------------------------------------------------GSAI.DD
W8UFH3_YEREN/25-205-------------------------------------------------------------------------TGQV.ED

PF00378

ECI1_MOUSE/39-287-------------------------------------------------------------------------RNP.PVN
MENB_BACSU/16-271-------------------------------------------------------------------------NRPEVHN
PKSH_BACSU/12-259-------------------------------------------------------------------------HRPEANN
PKSI_BACSU/10-249-------------------------------------------------------------------------QDRTHKN
CAID_ECOLI/8-261-------------------------------------------------------------------------DRP.KAN
ECI1_HUMAN/52-302-------------------------------------------------------------------------KNP.PVN
ECHM_HUMAN/42-290-------------------------------------------------------------------------NRPKALN
ECHM_CAEEL/40-288-------------------------------------------------------------------------NRPKALN
ECHH_RHOCB/9-257-------------------------------------------------------------------------DRPEVMN

PF01343

Y651_METJA/110-263--------------------------------------------------------------------------------
SOHB_HAEIN/163-314--------------------------------------------------------------------------------
O26897_METTH/96-249--------------------------------------------------------------------------------
SPPA_HAEIN/387-539--------------------------------------------------------------------------------
SPPA_SYNY3/126-282--------------------------------------------------------------------------------
SPPA_BACSU/129-283--------------------------------------------------------------------------------
P95072_MYCTU/128-283--------------------------------------------------------------------------------
SPPA_ECOLI/140-296--------------------------------------------------------------------------------
SPPA_SYNY3/383-536--------------------------------------------------------------------------------
SPPA_ECOLI/391-543--------------------------------------------------------------------------------
P95072_MYCTU/402-555--------------------------------------------------------------------------------
SCAF_LAMBD/148-300--------------------------------------------------------------------------------
Y021_SYNY3/67-220--------------------------------------------------------------------------------
O25976_HELPY/103-256--------------------------------------------------------------------------------
SPPA_HAEIN/132-288--------------------------------------------------------------------------------
SOHB_ECOLI/161-310--------------------------------------------------------------------------------
Q0PC65_CAMJE/102-253--------------------------------------------------------------------------------

PF08496

Q3SFM4_THIDA/3-147-------------------------------------------------------------------------AEAATLV
SOHB_ECOLI/2-158-------------------------------------------------------------------------AKIVTVV
Q5E611_VIBF1/2-162-------------------------------------------------------------------------AKIATVV
U3U6L2_9ENTR/2-156-------------------------------------------------------------------------AKSITTI
B8F6J6_HAEPS/4-160-------------------------------------------------------------------------LELLTVF
M9WWT9_MANHA/4-159-------------------------------------------------------------------------LELLTVF
A1WT84_HALHL/2-146-------------------------------------------------------------------------AQTATVV
K6ZKA6_9ALTE/2-154-------------------------------------------------------------------------AKAITIV
A6VW04_MARMS/3-155-------------------------------------------------------------------------LKLVSVA
A1U0U5_MARHV/2-161-------------------------------------------------------------------------AKVATFV
Q6ML34_BDEBA/2-147-------------------------------------------------------------------------AQTFMIL
C4K721_HAMD5/2-157-------------------------------------------------------------------------AKMITIL
Q5F7D2_NEIG1/4-160-------------------------------------------------------------------------LELLTVF
C9R4B3_AGGAD/4-161-------------------------------------------------------------------------LEVITLL
D4GFA3_PANAM/2-157-------------------------------------------------------------------------AKAVTVV
L0GQQ0_9GAMM/3-144-------------------------------------------------------------------------AKTVTLV
Q6D4V2_PECAS/4-159-------------------------------------------------------------------------AKALTIV
E1VKB3_9GAMM/3-151-------------------------------------------------------------------------AKTITVV
G4QLK8_GLANF/2-149-------------------------------------------------------------------------AKAITIV
Q88G04_PSEPK/2-149-------------------------------------------------------------------------AKTATLV
Q3JCU0_NITOC/3-143-------------------------------------------------------------------------AKTLTIV
Q4KAG4_PSEF5/2-152-------------------------------------------------------------------------AKTVTLV
F2JWF9_MARM1/2-145-------------------------------------------------------------------------VRILTVI
W8L9B4_HALHR/2-153-------------------------------------------------------------------------AKVLTIV
E0WSD1_9ENTR/2-157-------------------------------------------------------------------------AKMVTIV
K0CD66_ALCDB/4-159-------------------------------------------------------------------------AKVATLV
U5T5A0_9GAMM/2-148-------------------------------------------------------------------------ARVLTLL
Q9CN58_PASMU/4-161-------------------------------------------------------------------------LEILTIL
Q6LPB4_PHOPR/2-162-------------------------------------------------------------------------AKIATVV
K4KI74_SIMAS/2-171-------------------------------------------------------------------------AKTLTLV
Q9KT45_VIBCH/5-165-------------------------------------------------------------------------AKIVTVV
Q9I2R3_PSEAE/2-148-------------------------------------------------------------------------ARTVTVL
B2VKR2_ERWT9/2-158-------------------------------------------------------------------------AKTVTVV
B8GRY4_THISH/2-150-------------------------------------------------------------------------AKTLTLL
A6VNT8_ACTSZ/5-162-------------------------------------------------------------------------LEILTIL
I3Y8M1_THIV6/9-152-------------------------------------------------------------------------AKTLTLV
Q15TT9_PSEA6/2-153-------------------------------------------------------------------------AKAVTIV
C5BJB2_TERTT/2-161-------------------------------------------------------------------------AKALTVV
Q7N4B0_PHOLL/2-157-------------------------------------------------------------------------AKVVTLV
W0E0L9_MARPU/2-148-------------------------------------------------------------------------AKTLTLL
H2FWJ9_OCESG/3-149-------------------------------------------------------------------------AKALTWV
C1DKS7_AZOVD/4-150-------------------------------------------------------------------------AQTVTVV
E1V393_HALED/3-148-------------------------------------------------------------------------AQLLIVA
SOHB_BUCBP/2-161-------------------------------------------------------------------------FKIVIVI
M4VAW8_9DELT/2-148-------------------------------------------------------------------------SQALIIV
R5EC27_9GAMM/2-173-------------------------------------------------------------------------SKLVVTV
X2H295_9GAMM/2-181-------------------------------------------------------------------------AETATVV
A8GF70_SERP5/2-157-------------------------------------------------------------------------AKVATVV
U3TWV0_9ENTR/2-157-------------------------------------------------------------------------AKAVTVV
Q21J53_SACD2/2-173-------------------------------------------------------------------------AKTVTFV
D3RTH4_ALLVD/10-153-------------------------------------------------------------------------AKTLTLL
L0E340_THIND/2-150-------------------------------------------------------------------------LKGLTIL
M1SGT4_MORMO/2-158-------------------------------------------------------------------------AETVTIV
C7RA79_KANKD/2-191-------------------------------------------------------------------------LKTATIA
Q486S9_COLP3/2-158-------------------------------------------------------------------------AKAITFV
V4LD97_9GAMM/3-151-------------------------------------------------------------------------AKSFTVI
Q1QW68_CHRSD/3-155-------------------------------------------------------------------------AKLATLV
Q7VMW6_HAEDU/4-160-------------------------------------------------------------------------LELLTIF
Q12LC5_SHEDO/2-148-------------------------------------------------------------------------AKAVTIL
M1FK11_9ALTE/2-170-------------------------------------------------------------------------AKAVTLV
B3PHP3_CELJU/2-172-------------------------------------------------------------------------AKTVTFV
S6AL13_PSERE/2-151-------------------------------------------------------------------------ARIVTLV
A1SW75_PSYIN/13-168-------------------------------------------------------------------------AKIVTFA
Q83EG9_COXBU/8-154-------------------------------------------------------------------------AKLISLV
D8MSU4_ERWBE/2-158-------------------------------------------------------------------------AKTVTVV
Q882A1_PSESM/2-148-------------------------------------------------------------------------AKTVTLV
C4LEI0_TOLAT/2-149-------------------------------------------------------------------------AKSITLV
I2B860_SHIBC/2-158-------------------------------------------------------------------------AKVATFL
Q2SJ39_HAHCH/2-155-------------------------------------------------------------------------AKTVTLV
Q080A4_SHEFN/6-151-------------------------------------------------------------------------AKAVTIV
F5Z7M4_ALTSS/2-152-------------------------------------------------------------------------AKAVTLV
D3SB45_THISK/2-168-------------------------------------------------------------------------AKLVTAL
W5X6P0_BDEBC/2-148-------------------------------------------------------------------------AQTFLIV
A4VLP8_PSEU5/22-167-------------------------------------------------------------------------AKTVTLV
SOHB_HAEIN/4-161-------------------------------------------------------------------------LEILTIL
Q87N43_VIBPA/2-162-------------------------------------------------------------------------AKIVTVV
A3QFM5_SHELP/2-153-------------------------------------------------------------------------AKAVTIV
M4U4F5_9GAMM/2-157-------------------------------------------------------------------------AKAVTIV
Q7CIM0_YERPE/2-157-------------------------------------------------------------------------AKVVTIV
Q0VQ70_ALCBS/3-158-------------------------------------------------------------------------AKVATLV
M5DSS1_9GAMM/2-160-------------------------------------------------------------------------LKVVTLV
SOHB_BUCAI/2-147-------------------------------------------------------------------------AKIITFI
E1SNQ6_FERBD/2-150-------------------------------------------------------------------------AKAVTLV
F7YNU5_VIBA7/19-179-------------------------------------------------------------------------AKIATIV
A0KMV5_AERHH/2-146-------------------------------------------------------------------------AKTLTLL
D3VGP7_XENNA/2-157-------------------------------------------------------------------------AKVLTVV
A4XVC0_PSEMY/2-147-------------------------------------------------------------------------AKTLTLV
A5EWW5_DICNV/5-147-------------------------------------------------------------------------AKMVTVV
R4I0F4_9ENTR/2-157-------------------------------------------------------------------------AKITTVV
I0DNT2_PROSM/2-157-------------------------------------------------------------------------AKVVTIV
H2IX53_RAHAC/2-156-------------------------------------------------------------------------AKVVTVV
Q7MLX8_VIBVY/2-162-------------------------------------------------------------------------AKVVTFI
W0HSX4_9ENTR/2-157-------------------------------------------------------------------------AKTLTVV
C5BDW5_EDWI9/2-157-------------------------------------------------------------------------AKAATLV
Q0ABV0_ALKEH/2-149-------------------------------------------------------------------------AKGLTVV
D4G886_RIEPU/2-151-------------------------------------------------------------------------SKIITVF
Q3IL32_PSEHT/3-148-------------------------------------------------------------------------AKTVTFV
F9ZL28_ACICS/2-144-------------------------------------------------------------------------AETATIV
Q5QYQ0_IDILO/2-143-------------------------------------------------------------------------LKAAIIV
F4HAL3_GALAU/4-170-------------------------------------------------------------------------LELITLV
B4EW27_PROMH/2-157-------------------------------------------------------------------------AEIATVV
B0UU39_HISS2/4-161-------------------------------------------------------------------------LEILTIL
A3MY80_ACTP2/4-160-------------------------------------------------------------------------LELLTLF
A7MN97_CROS8/2-158-------------------------------------------------------------------------AKIVTVV
A1S7G8_SHEAM/2-147-------------------------------------------------------------------------AKAVTVV
M4R4I6_BIBTR/4-160-------------------------------------------------------------------------LELLTVF
D0L1Z6_HALNC/2-150-------------------------------------------------------------------------AKTLTFV

PF16113

B4M5Z4_DROVI/58-379-------------------------------------------------------------------------NRPKALN
D7SLU2_VITVI/50-384-------------------------------------------------------------------------NRPHVLN
F6I042_VITVI/68-402-------------------------------------------------------------------------NRPHVLN
HIBCH_CHICK/45-375-------------------------------------------------------------------------NRPKVLN
HIBCH_SCHPO/66-398-------------------------------------------------------------------------NRPKVLN
Q488V8_COLP3/18-356-------------------------------------------------------------------------NSEKTLN
C4KDL8_THASP/20-344-------------------------------------------------------------------------NRPAVLN
A5FW64_ACICJ/17-342-------------------------------------------------------------------------NRPRALN
F5Z7N6_ALTSS/21-362-------------------------------------------------------------------------NKPKALN
Q8I523_PLAF7/190-524-------------------------------------------------------------------------NRPEKLN
E3FSI9_STIAD/13-346-------------------------------------------------------------------------DRPRALN
F0ZTV2_DICPU/166-501-------------------------------------------------------------------------NNREKLN
G5BGL1_HETGA/35-365-------------------------------------------------------------------------NRPGSLN
B6HLY2_PENRW/44-388-------------------------------------------------------------------------NRPKKLN
Q1LLS5_CUPMC/36-367-------------------------------------------------------------------------TRPQALN
F7QLT9_9BRAD/23-350-------------------------------------------------------------------------NRPKAIN
Q21WJ0_RHOFT/28-365-------------------------------------------------------------------------NRPKALN
A0A016PD16_GIBZA/69-413-------------------------------------------------------------------------NRPQKLN
I1G4V7_AMPQE/50-378-------------------------------------------------------------------------NKPKTLN
F6HIV7_VITVI/22-356-------------------------------------------------------------------------NRPHKLN
Q8ES26_OCEIH/14-345-------------------------------------------------------------------------NRPKAIN
A7INC3_XANP2/15-342-------------------------------------------------------------------------NRPKALN
F4PNE6_DICFS/76-406-------------------------------------------------------------------------NRPKQLN
I1BHM9_RHIO9/79-409-------------------------------------------------------------------------NRPKKLN
C8X9E6_NAKMY/35-349-------------------------------------------------------------------------NRPRQIN
I1KQ42_SOYBN/46-396-------------------------------------------------------------------------DRPKALN
Q13IB6_BURXL/22-355-------------------------------------------------------------------------NRPKAHN
E9SYN2_RHOHA/17-337-------------------------------------------------------------------------NRPKAIN
G2NK33_STREK/15-339-------------------------------------------------------------------------NRPRALN
D7SV41_VITVI/52-386-------------------------------------------------------------------------NRPSDLN
G7UPF5_PSEUP/25-367-------------------------------------------------------------------------NAPKTLN
A8LME8_DINSH/12-333-------------------------------------------------------------------------NRPRALN
B2W7S4_PYRTR/68-416-------------------------------------------------------------------------NRPKKLN
B2IFQ5_BEII9/17-341-------------------------------------------------------------------------NRPQSLN
E4XNE1_OIKDI/19-346-------------------------------------------------------------------------NRPKALN
A1SIK1_NOCSJ/14-329-------------------------------------------------------------------------DRPEALN
B0UJ66_METS4/21-343-------------------------------------------------------------------------NRPQALN
D3PW51_STANL/21-338-------------------------------------------------------------------------HRPKAIN
Q084X0_SHEFN/18-357-------------------------------------------------------------------------NIEKALN
B2JKB1_BURP8/21-360-------------------------------------------------------------------------NRPKALN
G2J3D7_PSEUL/18-358-------------------------------------------------------------------------NAGKTLN
F4RGZ4_MELLP/11-358-------------------------------------------------------------------------NRPKVLN
Q0C3Q9_HYPNA/20-349-------------------------------------------------------------------------TRPAALH
F8J779_HYPSM/27-350-------------------------------------------------------------------------NRPSSLN
Q2SP84_HAHCH/24-363-------------------------------------------------------------------------NVEKSLN
E1VLZ8_9GAMM/17-356-------------------------------------------------------------------------NAEKSLN
D2V7D6_NAEGR/73-426-------------------------------------------------------------------------NRPKSFN
Q12MV4_SHEDO/18-360-------------------------------------------------------------------------NVEKALN
F5YTZ4_MYCSD/16-336-------------------------------------------------------------------------NRPQAIN
Q5WH10_BACSK/10-343-------------------------------------------------------------------------AREKALN
B8ESI3_METSB/13-334-------------------------------------------------------------------------NRPAALN
B9IB41_POPTR/22-356-------------------------------------------------------------------------NRPKQLN
F0ZLP9_DICPU/30-365-------------------------------------------------------------------------NRPKALN
H2ZC72_CIOSA/54-386-------------------------------------------------------------------------NRPGALN
Q2W460_MAGSA/13-341-------------------------------------------------------------------------NRPKVLN
B1LX53_METRJ/12-337-------------------------------------------------------------------------NRPKALN
D5GGY6_TUBMM/44-383-------------------------------------------------------------------------NRPGSLN
A4SZ56_POLSQ/13-344-------------------------------------------------------------------------NRPKALN
E9T596_RHOHA/14-336-------------------------------------------------------------------------DRPRALN
F4CYK1_PSEUX/14-333-------------------------------------------------------------------------NRPRSLN
Q5ZX62_LEGPH/13-340-------------------------------------------------------------------------NRPKALN
B9RD44_RICCO/57-391-------------------------------------------------------------------------NRPSALN
G0RME1_HYPJQ/43-386-------------------------------------------------------------------------NRPKKLN
A9WQX7_RENSM/20-336-------------------------------------------------------------------------NRPKAGN
H1VE28_COLHI/45-366-------------------------------------------------------------------------NRSKKLN
G2IVT0_PSEUL/18-359-------------------------------------------------------------------------NAEKSLN
E2BCN8_HARSA/46-370-------------------------------------------------------------------------NRPKVLN
C6W855_ACTMD/12-334-------------------------------------------------------------------------NRPGVIN
A0A088AET4_APIME/95-420-------------------------------------------------------------------------NRPKALN
Q143S2_BURXL/33-374-------------------------------------------------------------------------NRPAALN
F4S4Z1_MELLP/87-423-------------------------------------------------------------------------NRPSVLN
B9J934_AGRRK/15-342-------------------------------------------------------------------------NRPQALN
F4Q929_DICFS/53-395-------------------------------------------------------------------------NREKALN
Q381D8_TRYB2/20-346-------------------------------------------------------------------------NREKALN
A1BAK1_PARDP/12-321-------------------------------------------------------------------------NRPQALN
G3WP62_SARHA/46-376-------------------------------------------------------------------------NRPKVLN
B2IDI2_BEII9/14-338-------------------------------------------------------------------------NRPKALN
I1MM39_SOYBN/20-357-------------------------------------------------------------------------NRTKQLN
F6EFK8_AMYSD/12-332-------------------------------------------------------------------------NRPAAIN
Q212Q2_RHOPB/18-345-------------------------------------------------------------------------NRPKAIN
G8MC08_9BURK/24-360-------------------------------------------------------------------------DRPHALN
A0JS02_ARTS2/30-352-------------------------------------------------------------------------NRPRAVN
A8HXV6_AZOC5/51-378-------------------------------------------------------------------------NRPKALN
HIBC8_ARATH/21-353-------------------------------------------------------------------------NRPRQLN
B6Q688_TALMQ/41-385-------------------------------------------------------------------------NRPKKLN
A0C505_PARTE/18-343-------------------------------------------------------------------------NRPEKLN
C1DFA4_AZOVD/17-349-------------------------------------------------------------------------NRPANLN
G7Z662_AZOL4/15-341-------------------------------------------------------------------------NRPKALN
Q5QW21_IDILO/17-357-------------------------------------------------------------------------NSEKSLN
C1DNT4_AZOVD/14-346-------------------------------------------------------------------------NRPNGLN
Q230X4_TETTS/30-358-------------------------------------------------------------------------NKPKALN
B9SXD3_RICCO/47-382-------------------------------------------------------------------------NRPHVLN
Q5LRB7_RUEPO/12-333-------------------------------------------------------------------------TRPQALN
D6X3R7_TRICA/42-364-------------------------------------------------------------------------NRPKALN
A1R246_ARTAT/18-336-------------------------------------------------------------------------NRPKAVN
D3BN96_POLPA/192-532-------------------------------------------------------------------------NNRKTLN
B9SKJ5_RICCO/22-357-------------------------------------------------------------------------NRPKQLN
B7G076_PHATC/15-365-------------------------------------------------------------------------NNPKALH
F4F5N6_VERMA/14-334-------------------------------------------------------------------------NRPAAIN
A9PBA7_POPTR/21-353-------------------------------------------------------------------------NRPRQLN
G6DDP6_DANPL/16-332-------------------------------------------------------------------------NRPKALN
F8AY96_FRADG/12-334-------------------------------------------------------------------------NRPRAIN
H6N4E1_GORPV/12-333-------------------------------------------------------------------------DRPKALN
E0VLB5_PEDHC/53-383-------------------------------------------------------------------------NRPKQLN
Q0A896_ALKEH/22-361-------------------------------------------------------------------------TAPRKLN
D8SM52_SELML/13-356-------------------------------------------------------------------------DRPKALN
D7AAE9_STAND/32-359-------------------------------------------------------------------------DRPRALN
D7MNH9_ARALL/19-353-------------------------------------------------------------------------NRPKQLN
E3I3E7_RHOVT/14-335-------------------------------------------------------------------------NRPAAMN
D0J4R8_COMT2/40-371-------------------------------------------------------------------------NRPKALN
D5QAS0_KOMHA/14-335-------------------------------------------------------------------------DRPRALN
F4NRB7_BATDJ/54-395-------------------------------------------------------------------------DRPAAMN
G3QQM4_GORGO/20-355-------------------------------------------------------------------------NRPKFLN
A1K1H9_AZOSB/18-358-------------------------------------------------------------------------NAERALN
Q0IP17_ORYSJ/128-462-------------------------------------------------------------------------NRPKQLN
A1TSJ8_ACIAC/16-348-------------------------------------------------------------------------NRPRALN
HIBCH_DICDI/33-370-------------------------------------------------------------------------NRPKALN
I1BZ13_RHIO9/189-518-------------------------------------------------------------------------NRPNKLN
A9SUT7_PHYPA/29-361-------------------------------------------------------------------------NRPRVLN
D3HQR9_LEGLN/13-338-------------------------------------------------------------------------NRPGALN
G4NGW1_MAGO7/67-414-------------------------------------------------------------------------NRPKKLN
A9RJN7_PHYPA/31-365-------------------------------------------------------------------------NRPRKLN
A9TYA6_PHYPA/60-394-------------------------------------------------------------------------NRPKKLN
E1VZ37_ARTAR/22-349-------------------------------------------------------------------------NRDAKLN
Q4DMX8_TRYCC/74-400-------------------------------------------------------------------------CRPAMLN
Q6LIA0_PHOPR/19-359-------------------------------------------------------------------------ENTASLN
B7Q288_IXOSC/44-375-------------------------------------------------------------------------DRPKALN
H3B677_LATCH/47-377-------------------------------------------------------------------------NRPKALN
A7RHZ5_NEMVE/46-374-------------------------------------------------------------------------NRPKALN
Q8FQY6_COREF/29-353-------------------------------------------------------------------------NRPKALN
E1VC38_HALED/19-356-------------------------------------------------------------------------NAPKALN
Q11J99_CHESB/19-339-------------------------------------------------------------------------NRPSALN
B0S642_DANRE/44-374-------------------------------------------------------------------------NRPKALN
D7LRR5_ARALL/47-381-------------------------------------------------------------------------NRPPALN
F8K1G3_STREN/18-341-------------------------------------------------------------------------DRPAALN
G2KLT0_MICAA/19-358-------------------------------------------------------------------------DRPQALN
B6JX18_SCHJY/32-363-------------------------------------------------------------------------NRPAKLN
I1M992_SOYBN/52-386-------------------------------------------------------------------------NRPSSLN
A8NEJ7_COPC7/45-386-------------------------------------------------------------------------NRPNKLN
Q12AQ1_POLSJ/18-355-------------------------------------------------------------------------NAPATLN
Q1QVU3_CHRSD/19-353-------------------------------------------------------------------------NAPDSLN
I1JMV6_SOYBN/52-386-------------------------------------------------------------------------NRPSALN
Q4JU31_CORJK/25-358-------------------------------------------------------------------------NRPKALN
Q2GA19_NOVAD/13-336-------------------------------------------------------------------------NRPKAIH
Q2N893_ERYLH/16-341-------------------------------------------------------------------------NRPKALH
Q16U65_AEDAE/33-352-------------------------------------------------------------------------NRPKALN
C6XIW5_HIRBI/14-333-------------------------------------------------------------------------NRPQALH
C3PF62_CORA7/13-336-------------------------------------------------------------------------NRPKAIN
D8IW53_HERSS/21-370-------------------------------------------------------------------------ASEKTLH
C8WWK9_ALIAD/12-344-------------------------------------------------------------------------NRPKQLN
F0XEA1_GROCL/74-428-------------------------------------------------------------------------NRPRKFN
Q0BR39_GRABC/31-348-------------------------------------------------------------------------NRPSALN
F2T0Y3_TRIRC/73-417-------------------------------------------------------------------------NRPKKLN
A1WLH8_VEREI/23-355-------------------------------------------------------------------------NRPRALN
A9C200_DELAS/16-348-------------------------------------------------------------------------NRAKALN
Q2L131_BORA1/18-371-------------------------------------------------------------------------NAPQTLN
F2R851_STRVP/13-333-------------------------------------------------------------------------NRPRALN
D5BR70_PUNMI/19-347-------------------------------------------------------------------------ARPKALN
E1VS22_ARTAR/12-327-------------------------------------------------------------------------NRPKALN
Q28R37_JANSC/11-334-------------------------------------------------------------------------NRPKALN
C3Z9L9_BRAFL/41-373-------------------------------------------------------------------------NRPKALN
B3S7F3_TRIAD/23-347-------------------------------------------------------------------------NRPKALN
A5V401_SPHWW/17-339-------------------------------------------------------------------------NRPKAIH
E5SEM2_TRISP/42-371-------------------------------------------------------------------------NRPTALN
C0HHJ2_MAIZE/66-416-------------------------------------------------------------------------DRPKALN
B0CSR7_LACBS/50-391-------------------------------------------------------------------------DRPLKRN
A4VIV7_PSEU5/16-354-------------------------------------------------------------------------DAPRQLN
D4ZAM5_SHEVD/14-353-------------------------------------------------------------------------NMEQALN
A7HX73_PARL1/15-335-------------------------------------------------------------------------NRPKALN
F4QC51_DICFS/178-513-------------------------------------------------------------------------NDRKTLN
Q7NWA8_CHRVO/15-354-------------------------------------------------------------------------NAEKSLN
G0MPK6_CAEBE/44-375-------------------------------------------------------------------------NRPKALN
Q55GN0_DICDI/49-392-------------------------------------------------------------------------NRSEALN
C7RD63_ANAPD/10-343-------------------------------------------------------------------------DRGEKIN
Q6CA37_YARLI/41-379-------------------------------------------------------------------------NRPKKLN
A9V573_MONBE/16-343-------------------------------------------------------------------------NRPKSLN
A0BEK3_PARTE/25-354-------------------------------------------------------------------------NRPSQLN
F2R4L5_STRVP/18-338-------------------------------------------------------------------------HRPRAIN
HIBC5_ARATH/51-385-------------------------------------------------------------------------NNPSSLN
E4N1A8_KITSK/18-339-------------------------------------------------------------------------NRPRALN
E5ASB4_BURRH/34-371-------------------------------------------------------------------------NRPDALN
H3FRY8_PRIPA/40-371-------------------------------------------------------------------------NRPKQLN
A9HE55_GLUDA/18-336-------------------------------------------------------------------------NRPKALN
F2IWL1_POLGS/13-333-------------------------------------------------------------------------NRSAALN
Q7MDJ7_VIBVY/19-358-------------------------------------------------------------------------ENPSALN
D5UVM7_TSUPD/17-334-------------------------------------------------------------------------NRPAALN
G8SEU3_ACTS5/15-332-------------------------------------------------------------------------NRPRAIN
Q0VP05_ALCBS/18-356-------------------------------------------------------------------------NAPKSLN
B2UAB6_RALPJ/70-398-------------------------------------------------------------------------NRPQALN
A1S5D0_SHEAM/18-354-------------------------------------------------------------------------NVEAALN
H8MVZ6_CORCM/13-341-------------------------------------------------------------------------NRPKALN
D5ATL9_RHOCB/13-333-------------------------------------------------------------------------NRPAALN
B9RPB0_RICCO/58-404-------------------------------------------------------------------------DRPKALN
B6IMT6_RHOCS/17-352-------------------------------------------------------------------------NRPKALN
H6BSS6_EXODN/72-425-------------------------------------------------------------------------NRPKKLN
Q1GNL4_SPHAL/17-339-------------------------------------------------------------------------NRPKAIH
E9IZM3_SOLIN/56-380-------------------------------------------------------------------------NRPKALN
Q6FM09_CANGA/43-400-------------------------------------------------------------------------NRPKKLN
E1SUP0_FERBD/18-358-------------------------------------------------------------------------NSEKSLN
G4RGU8_PELHB/12-344-------------------------------------------------------------------------TRPKAIN
G2P5N8_STRVO/31-352-------------------------------------------------------------------------NRPRALN
HIBC2_ARATH/15-349-------------------------------------------------------------------------NRPKQLN
Q4Q4Q6_LEIMA/22-353-------------------------------------------------------------------------SRPDALN
G7DUF6_MIXOS/94-452-------------------------------------------------------------------------NRPKALN
C1DAN4_LARHH/20-362-------------------------------------------------------------------------NSERTLN
A1U6V2_MARHV/15-353-------------------------------------------------------------------------NEPGTLN
C7NJ16_KYTSD/22-350-------------------------------------------------------------------------NRPKALN
D2VUW6_NAEGR/936-1276-------------------------------------------------------------------------NRPRESN
C4WVV0_ACYPI/36-362-------------------------------------------------------------------------NRPKALN
E9G4T3_DAPPU/56-370-------------------------------------------------------------------------NRPKALN
C1EG25_MICSR/14-367-------------------------------------------------------------------------NRPRQLN
F4GS44_PUSST/18-360-------------------------------------------------------------------------NSPQTLN
A4F9Q5_SACEN/15-334-------------------------------------------------------------------------NRPKALN
G8RS69_MYCRN/28-352-------------------------------------------------------------------------NRPKAIN
G3IHA0_CRIGR/18-348-------------------------------------------------------------------------NRPKFLN
G2QR77_THITE/46-391-------------------------------------------------------------------------NRPKKLN
B9TBM0_RICCO/16-343-------------------------------------------------------------------------DRPKALN
Q4DMX9_TRYCC/20-346-------------------------------------------------------------------------NREKALN
D7FIS1_ECTSI/31-370-------------------------------------------------------------------------NKPEKLN
E8NCI0_MICTS/19-345-------------------------------------------------------------------------NRPRAIN
Q89N86_BRADU/17-344-------------------------------------------------------------------------NRPKAIN
E8RLF2_ASTEC/19-339-------------------------------------------------------------------------NRPQALN
F0M0J8_VIBFN/19-357-------------------------------------------------------------------------DNPASLN
A1U2J0_MARHV/19-355-------------------------------------------------------------------------NSPRNLN
Q0RM03_FRAAA/66-391-------------------------------------------------------------------------NRPRAIN
H3DE45_TETNG/45-375-------------------------------------------------------------------------NRPKVLN
B4RB39_PHEZH/14-336-------------------------------------------------------------------------NRPQALH
F0ZI93_DICPU/87-416-------------------------------------------------------------------------NRPKSLN
G1X6E1_ARTOA/73-419-------------------------------------------------------------------------NRPQKLN
A4G9P0_HERAR/23-358-------------------------------------------------------------------------DRPQAMN
A0R2Y4_MYCS2/15-335-------------------------------------------------------------------------NRPKAIN
D3B388_POLPA/36-371-------------------------------------------------------------------------NRPEALN
C6THR1_SOYBN/37-369-------------------------------------------------------------------------NRPRQLN
D8RN96_SELML/20-345-------------------------------------------------------------------------NRPQVLN
F6AA82_PSEF1/16-354-------------------------------------------------------------------------DAPASLN
F8E0K2_CORRG/15-348-------------------------------------------------------------------------DRPRALN
F2GC52_ALTMD/22-362-------------------------------------------------------------------------NKPKALN
A4I8I6_LEIIN/21-350-------------------------------------------------------------------------NRPNSLN
A4VKU6_PSEU5/16-348-------------------------------------------------------------------------NRPAGLN
A4XS22_PSEMY/16-354-------------------------------------------------------------------------DAEKSLN
A0A0K0J9E9_BRUMA/37-374-------------------------------------------------------------------------NRPRTLN
B1MKI3_MYCA9/13-333-------------------------------------------------------------------------NRPKAIN
B1VV62_STRGG/15-334-------------------------------------------------------------------------NRPKALN
B4FIT7_MAIZE/26-359-------------------------------------------------------------------------NRPKQLN
B9IL60_POPTR/51-383-------------------------------------------------------------------------NRPASRN
C1A226_RHOE4/16-335-------------------------------------------------------------------------NRPKAIN
C4R612_PICPG/39-387-------------------------------------------------------------------------NRSAKLN
C5AQY8_METEA/35-359-------------------------------------------------------------------------TRPKALN
C5CR27_VARPS/20-356-------------------------------------------------------------------------NAPASLN
C5GL55_AJEDR/45-388-------------------------------------------------------------------------NRPKKLN
C7JEY4_ACEP3/21-337-------------------------------------------------------------------------DRPKRLN
C8V2I5_EMENI/70-410-------------------------------------------------------------------------NRPKKLN
D9Q9E6_CORP2/23-349-------------------------------------------------------------------------NRPKALN
F6INA5_9SPHN/14-335-------------------------------------------------------------------------NRPKAIH
F8Q7W3_SERL3/52-393-------------------------------------------------------------------------NRPKKLN
G8PLL8_PSEUV/25-348-------------------------------------------------------------------------NRPKALN
M0YPS1_HORVD/57-387-------------------------------------------------------------------------NRPGHLN
M1FH42_9ALTE/19-355-------------------------------------------------------------------------NAPRSLN
O53419_MYCTU/16-336-------------------------------------------------------------------------NRPKAIN
Q0K1Z5_CUPNH/27-360-------------------------------------------------------------------------NRPRQLN
Q0K9D4_CUPNH/13-344-------------------------------------------------------------------------NRPQALN
Q13M23_BURXL/27-363-------------------------------------------------------------------------NRPAALN
Q1D8V8_MYXXD/13-346-------------------------------------------------------------------------NRPKALN
HIBCH_XENTR/46-375-------------------------------------------------------------------------NRPKALN
Q2RTB1_RHORT/15-345-------------------------------------------------------------------------NRPRALN
Q2YNA1_BRUA2/20-339-------------------------------------------------------------------------TRTAALN
Q3J1K7_RHOS4/13-327-------------------------------------------------------------------------SRPAALN
Q3SQN0_NITWN/20-346-------------------------------------------------------------------------NRPRAIN
Q5JMX9_ORYSJ/26-356-------------------------------------------------------------------------NRPRQLN
Q63MM8_BURPS/27-362-------------------------------------------------------------------------NRPAALN
Q63TV7_BURPS/21-364-------------------------------------------------------------------------NRPQALN
Q65IX3_BACLD/15-345-------------------------------------------------------------------------NRPKALN
Q6N492_RHOPA/19-345-------------------------------------------------------------------------NRPKAIN
Q6NI92_CORDI/19-346-------------------------------------------------------------------------NRPQALN
Q7APV2_MYCLE/16-336-------------------------------------------------------------------------NRPKAIN
Q7VYA4_BORPE/19-371-------------------------------------------------------------------------NAPQTLN
Q83AM7_COXBU/43-368-------------------------------------------------------------------------NRPKALN
Q87H46_VIBPA/18-356-------------------------------------------------------------------------DNPAALN
Q87II2_VIBPA/19-358-------------------------------------------------------------------------DNTPSLN
Q87YT7_PSESM/28-360-------------------------------------------------------------------------NRPEGLN
Q88H70_PSEPK/22-354-------------------------------------------------------------------------NRPAGLN
Q8NRX2_CORGL/14-334-------------------------------------------------------------------------NRPKALN
Q8XS34_RALSO/27-369-------------------------------------------------------------------------NRPSALN
Q92TQ6_RHIME/18-338-------------------------------------------------------------------------NRPRALN
Q983C3_RHILO/18-337-------------------------------------------------------------------------TRPQALN
Q9A8K1_CAUCR/15-337-------------------------------------------------------------------------NRPKALH
Q9I5I5_PSEAE/16-354-------------------------------------------------------------------------DAEKSLN
U5FFA4_POPTR/23-356-------------------------------------------------------------------------NRPHKLN
U5G8W9_POPTR/30-363-------------------------------------------------------------------------NRPQKLN
V4KPJ6_9ACTN/14-339-------------------------------------------------------------------------NRPRALN
V9XKW7_9NOCA/15-343-------------------------------------------------------------------------DRPGALN
V9XNE6_9NOCA/16-336-------------------------------------------------------------------------NRPKAIN
W4W6S1_ATTCE/168-489-------------------------------------------------------------------------NRPKELN
W5JCR8_ANODA/20-341-------------------------------------------------------------------------NRPKALN
W5XRW0_9CORY/14-331-------------------------------------------------------------------------NRPKALN

PF03255

D2UEG3_XANAP/5-148-------------------------------------------------------------------------EQPIADL
ACCA_METCA/5-148-------------------------------------------------------------------------EQPIAEL
E3I8F4_RHOVT/21-165-------------------------------------------------------------------------EKPIAEL
D8PGA3_9BACT/4-146-------------------------------------------------------------------------EKPIREL
R7MD99_9CLOT/4-147-------------------------------------------------------------------------EKPILEI
F8EZE8_TRECH/5-136-------------------------------------------------------------------------....TSI
W0DRR8_9GAMM/5-148-------------------------------------------------------------------------EQPIAEL
A8LLX0_DINSH/4-147-------------------------------------------------------------------------EKPLAEI
ACCA_SYNWW/6-148-------------------------------------------------------------------------EQKVQEI
E0TDQ6_PARBH/4-147-------------------------------------------------------------------------ERPIAEL
R7GKD0_9CLOT/3-138-------------------------------------------------------------------------ERKIEEL
G2KND5_MICAA/4-146-------------------------------------------------------------------------EKPVLEL
Q2S032_SALRD/7-156-------------------------------------------------------------------------EKPLVEL
Q6AM83_DESPS/30-172-------------------------------------------------------------------------...LEEF
Q311Q7_DESAG/25-171-------------------------------------------------------------------------EENIRLL
S6A148_9SPIO/4-140-------------------------------------------------------------------------.KEKNQI
A0KHH9_AERHH/16-160-------------------------------------------------------------------------EQPIAEL
ACCA_PHOLL/5-151-------------------------------------------------------------------------EQPIAEL
ACCA_FLAPJ/3-147-------------------------------------------------------------------------ELPIKEL
G2TPG4_BACCO/5-147-------------------------------------------------------------------------EKPVIEL
D5EJ62_CORAD/7-150-------------------------------------------------------------------------EKPLREL
B8D1K4_HALOH/6-149-------------------------------------------------------------------------EKPLLEL
ACCA_ROSDO/4-148-------------------------------------------------------------------------EKPLAEI
X2GZP6_9BACI/5-147-------------------------------------------------------------------------EEPVVQL
ACCA_RHIME/4-148-------------------------------------------------------------------------EKPISDL
D7BGY4_MEISD/3-145-------------------------------------------------------------------------EKPIFEL
ACCA_MAGSA/3-146-------------------------------------------------------------------------EKPIAEL
I0AHK2_IGNAJ/5-146-------------------------------------------------------------------------EKPIFEL
G4REG5_PELHB/4-148-------------------------------------------------------------------------EKPVAEL
ACCA_CHLTE/6-163-------------------------------------------------------------------------EKPLYEL
ACCA_AGRFC/4-148-------------------------------------------------------------------------EKPISDL
ACCA_ALKOO/4-147-------------------------------------------------------------------------EKAIHEL
ACCA_MARMS/5-148-------------------------------------------------------------------------EQPIAEL
K6ZTQ8_9ALTE/5-150-------------------------------------------------------------------------EKPIAEL
C0QT26_PERMH/2-143-------------------------------------------------------------------------DKEIQIL
Q2G730_NOVAD/6-148-------------------------------------------------------------------------EKPVAAL
V5SAJ3_9RHIZ/15-158-------------------------------------------------------------------------EKPIAEL
R7C0E0_9BURK/6-149-------------------------------------------------------------------------EKALGEI
C6XFA8_LIBAP/4-148-------------------------------------------------------------------------EEPISDL
ACCA_SYNE7/11-154-------------------------------------------------------------------------EKPLVEL
C1CYF8_DEIDV/5-142-------------------------------------------------------------------------..ILREL
H6L155_SAPGL/3-146-------------------------------------------------------------------------EQPLEEL
R6L4F3_9FIRM/289-430-------------------------------------------------------------------------KENVDTY
D1B429_SULD5/5-141-------------------------------------------------------------------------ENGIKQI
D3UH38_HELM1/4-141-------------------------------------------------------------------------EQKIKVL
B9L7W0_NAUPA/3-140-------------------------------------------------------------------------EKRIEEL
ACCA_HELMI/5-146-------------------------------------------------------------------------EKPLFEL
D3SP93_THEAH/2-144-------------------------------------------------------------------------EKDLEEL
R7AXN0_9FIRM/3-137-------------------------------------------------------------------------QQKINEI
C5CPW8_VARPS/6-149-------------------------------------------------------------------------EQPIAEL
W0E5D8_MARPU/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_ALCBS/5-148-------------------------------------------------------------------------EQPIADL
D9SFY0_GALCS/5-149-------------------------------------------------------------------------ESPIAEL
I1YEX9_METFJ/5-148-------------------------------------------------------------------------EQPIAEL
K4LHZ1_THEPS/6-149-------------------------------------------------------------------------EKDYQEI
E4TZ34_SULKY/5-141-------------------------------------------------------------------------EQNIRQI
D0LXB2_HALO1/14-155-------------------------------------------------------------------------ERPVFEL
C6WW95_METML/5-149-------------------------------------------------------------------------EQPIAQL
C7M555_CAPOD/3-147-------------------------------------------------------------------------EQPIKEL
ACCA_FRATT/3-144-------------------------------------------------------------------------ESKIKEI
H8KSG2_SOLCM/5-147-------------------------------------------------------------------------EKPIAIL
D1AII8_SEBTE/3-144-------------------------------------------------------------------------EAEMRDL
ACCA_CUPNH/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_ERYLH/4-146-------------------------------------------------------------------------EKPVAQL
D2R421_PIRSD/12-153-------------------------------------------------------------------------EQPLLEL
D9QKB7_BRESC/5-147-------------------------------------------------------------------------EKPIAEL
R5DZV5_9BURK/6-150-------------------------------------------------------------------------EKPVAQL
Q0C318_HYPNA/4-148-------------------------------------------------------------------------EKPIAEL
I0IBV1_PHYMF/56-206-------------------------------------------------------------------------EKPLIAL
C6XPW8_HIRBI/7-150-------------------------------------------------------------------------EKPLAEM
ACCA_CHLPD/6-163-------------------------------------------------------------------------EKPLFEL
R6Z0L2_9CLOT/259-400-------------------------------------------------------------------------...IDKI
D4JZM5_9FIRM/2-150-------------------------------------------------------------------------LEQLAPL
K9P1M5_CYAGP/6-149-------------------------------------------------------------------------EKPLVEL
D4G8D7_RIEPU/6-152-------------------------------------------------------------------------EKPIVQL
E8SIV5_STAPH/2-144-------------------------------------------------------------------------EKPIQDI
U5T6J3_9GAMM/8-151-------------------------------------------------------------------------ERPIAEL
W0JJL3_DESAE/4-146-------------------------------------------------------------------------ERPIYEI
F0P1A9_WEEVC/3-147-------------------------------------------------------------------------EQPIKDL
F8KU37_HELBC/4-141-------------------------------------------------------------------------ETRIKGL
G4QI06_GLANF/5-150-------------------------------------------------------------------------EQPIAEL
L0EG96_THECK/6-148-------------------------------------------------------------------------EKPLFEL
ACCA_IDILO/5-150-------------------------------------------------------------------------EQPIAEL
A0LCL9_MAGMM/15-158-------------------------------------------------------------------------ERPIGEL
W0E6N2_9FIRM/5-147-------------------------------------------------------------------------EKPILEL
E6U0M3_BACCJ/6-148-------------------------------------------------------------------------EKPIIEL
ACCA_CAMHC/4-141-------------------------------------------------------------------------EKSIKQI
ACCA_HELPY/4-141-------------------------------------------------------------------------ENHIKEI
F8E5R1_FLESM/6-148-------------------------------------------------------------------------ETPIFEL
ACCA_LEGPH/5-148-------------------------------------------------------------------------EQPIEEL
ACCA_RHOBA/6-147-------------------------------------------------------------------------ENEIADL
I0JPN9_HALH3/4-147-------------------------------------------------------------------------EKPVIEL
R6UTY3_9FIRM/3-138-------------------------------------------------------------------------ESSIAVL
R5QI57_9FIRM/286-429-------------------------------------------------------------------------SENISGL
ACCA_RUBXD/2-142-------------------------------------------------------------------------ERPIKEL
R5NX12_9CLOT/2-140-------------------------------------------------------------------------DERIAEI
D7CNC0_SYNLT/7-149-------------------------------------------------------------------------ERDYLEL
Q2JI82_SYNJB/9-151-------------------------------------------------------------------------EQPVAAL
A8J646_CHLRE/72-215-------------------------------------------------------------------------EKPLLEL
I2EZ83_EMTOG/4-147-------------------------------------------------------------------------EKPIAEL
ACCA_CHLCH/6-163-------------------------------------------------------------------------EKPLFEL
Q1MR33_LAWIP/27-171-------------------------------------------------------------------------.KVIELL
ACCA_ZYMMO/4-146-------------------------------------------------------------------------EKPVAEL
ACCA_PARUW/3-145-------------------------------------------------------------------------EKQIHEY
B1I3G8_DESAP/4-147-------------------------------------------------------------------------ERPISEL
ACCA_XYLFA/5-148-------------------------------------------------------------------------EQPIADL
ACCA_BRASO/8-150-------------------------------------------------------------------------EKPVAEL
ACCA_ACAM1/10-153-------------------------------------------------------------------------EKPLAEL
D3PKT0_MEIRD/3-145-------------------------------------------------------------------------EKPIEEL
B1ZYS7_OPITP/7-150-------------------------------------------------------------------------EKPLRDL
K9ZX35_DEIPD/3-142-------------------------------------------------------------------------EASLQGL
G8PGM3_PSEUV/4-148-------------------------------------------------------------------------EKPVADL
D9QS74_ACEAZ/6-148-------------------------------------------------------------------------EKPLLEL
D3DFX7_HYDTT/3-145-------------------------------------------------------------------------EKEHLEL
ACCA_CHLL7/6-163-------------------------------------------------------------------------ERPVVEL
ACCA_SORC5/5-147-------------------------------------------------------------------------EKPVAEL
W0J949_9BACT/7-150-------------------------------------------------------------------------EKPLRDL
ACCA_GEMAT/6-149-------------------------------------------------------------------------ERPIADL
Q11UX8_CYTH3/2-145-------------------------------------------------------------------------EKPIADL
ACCA_XANP2/4-148-------------------------------------------------------------------------EKPVAEL
C8X286_DESRD/27-171-------------------------------------------------------------------------.ANVKLL
ACCA_WOLSU/4-141-------------------------------------------------------------------------EQKIKNI
D5XA35_THEPJ/4-147-------------------------------------------------------------------------EKPLVEL
ACCA_HELHP/4-141-------------------------------------------------------------------------EQKIKNL
ACCA_PELUB/4-149-------------------------------------------------------------------------ETDIKNL
ACCA_COXBU/5-148-------------------------------------------------------------------------EQPIAEL
L0K556_HALHC/4-147-------------------------------------------------------------------------EKPLIEL
A7HCR7_ANADF/7-150-------------------------------------------------------------------------ERPLIAL
D0KZU8_HALNC/5-148-------------------------------------------------------------------------EQPIAEL
E4U646_OCEP5/2-145-------------------------------------------------------------------------EQPILEL
C5AV00_METEA/7-151-------------------------------------------------------------------------EKPVAEL
F3YX99_DESAF/28-171-------------------------------------------------------------------------..NMAML
Q729X2_DESVH/28-170-------------------------------------------------------------------------..NIELL
F2I397_PELSM/3-148-------------------------------------------------------------------------EKELEQL
ACCA_STACT/2-144-------------------------------------------------------------------------EKPLFEI
ACCA_BLOFL/5-151-------------------------------------------------------------------------EQPILKI
A5D053_PELTS/4-147-------------------------------------------------------------------------EKPIQEL
F2IGK6_FLUTR/4-148-------------------------------------------------------------------------EEPLKAL
ACCA_LARHH/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_PARL1/4-148-------------------------------------------------------------------------EKPIAEL
D7CVI6_TRURR/3-145-------------------------------------------------------------------------EKPIDEL
K9RT78_SYNP3/9-152-------------------------------------------------------------------------EKPLVEL
ACCA_UNCTG/5-146-------------------------------------------------------------------------EKPIAEI
R5QLG5_9FIRM/3-135-------------------------------------------------------------------------EKEIEKL
D4LVS3_9FIRM/273-410-------------------------------------------------------------------------LGKILEM
A9RT89_PHYPA/97-240-------------------------------------------------------------------------ERPIVDL
ACCA_PELCD/4-146-------------------------------------------------------------------------EKPLVEL
E4TL55_MARTH/2-145-------------------------------------------------------------------------EQPIVEL
ACCA_PELPB/6-163-------------------------------------------------------------------------EKPLFEL
E1VNM7_9GAMM/16-159-------------------------------------------------------------------------EQPIAEL
K4AZH5_SOLLC/103-246-------------------------------------------------------------------------EKPLVNL
C6D8B9_PAESJ/6-149-------------------------------------------------------------------------EKPISDL
K0J396_AMPXN/4-147-------------------------------------------------------------------------EKPIYEL
E8U5S6_DEIML/5-142-------------------------------------------------------------------------..VLTQL
ACCA_CAUCR/5-149-------------------------------------------------------------------------ERPIADL
F2LWN6_HIPMA/3-146-------------------------------------------------------------------------EKPIYEI
G2LDZ5_CHLTF/6-153-------------------------------------------------------------------------AAQIKLM
E4TI62_CALNY/6-148-------------------------------------------------------------------------EVPIYEL
ACCA_PSEAE/5-148-------------------------------------------------------------------------EQPIADL
D5SMU5_PLAL2/7-147-------------------------------------------------------------------------ERPIFQL
H8KZ76_FRAAD/5-148-------------------------------------------------------------------------EKPIADL
L0G434_ECHVK/2-145-------------------------------------------------------------------------EKPIADL
C7JEV8_ACEP3/4-146-------------------------------------------------------------------------EKPVAEL
U3U7V8_9ENTR/5-151-------------------------------------------------------------------------EKPIAEL
I4AJK8_FLELS/2-145-------------------------------------------------------------------------EKPIFEL
U6B8Z9_9RHIZ/4-148-------------------------------------------------------------------------EKPISDI
I3THF2_TISMK/4-147-------------------------------------------------------------------------EKPIAEL
C7PMD3_CHIPD/3-146-------------------------------------------------------------------------EKPIEDL
D5BMW6_PUNMI/4-146-------------------------------------------------------------------------EKPIASL
C6VWQ9_DYAFD/4-147-------------------------------------------------------------------------EKPMAEL
A0A068NX81_9BACT/5-153-------------------------------------------------------------------------EKPLAEL
K7S984_GLUOY/13-161-------------------------------------------------------------------------EKSVAEL
F2JNG5_CELLD/8-142-------------------------------------------------------------------------EGAITHL
L0DWX9_THIND/5-148-------------------------------------------------------------------------EQPIVEL
K9Q7M9_9NOSO/10-153-------------------------------------------------------------------------EKPLAEL
ACCA_TRIEI/9-152-------------------------------------------------------------------------EKPLAEL
L0EVZ1_LIBCB/4-148-------------------------------------------------------------------------EKPISDL
D4M3A9_9FIRM/275-407-------------------------------------------------------------------------LGQILKM
ACCA_NITSB/4-141-------------------------------------------------------------------------EQKIKEI
R5QCK4_9BURK/6-152-------------------------------------------------------------------------EHDIEAL
R6P4G2_9CLOT/2-145-------------------------------------------------------------------------EKPITKI
ACCA_CARHZ/6-148-------------------------------------------------------------------------EKPLVEL
ACCA_CELJU/5-148-------------------------------------------------------------------------EQPIAEL
G2ISU6_9SPHN/4-147-------------------------------------------------------------------------EKPVAAL
D4KAA0_9FIRM/2-148-------------------------------------------------------------------------LQQLAPL
F6IN39_9SPHN/4-146-------------------------------------------------------------------------EKPIAAL
D4Z3Q1_SPHJU/4-147-------------------------------------------------------------------------EKPIAEL
W0EXF5_9SPHI/9-152-------------------------------------------------------------------------EKPIKDL
I3ZX40_ORNRL/3-147-------------------------------------------------------------------------EEPIKDL
F0RKQ5_DEIPM/7-153-------------------------------------------------------------------------..LIRDL
E0UBA6_CYAP2/10-153-------------------------------------------------------------------------EKPLYEL
R5YAR4_9PROT/8-151-------------------------------------------------------------------------EKDILEI
ACCA_ACICJ/4-146-------------------------------------------------------------------------EKPVAEL
K9SWQ9_9SYNE/7-150-------------------------------------------------------------------------EKPIVEL
ACCA_THET8/3-145-------------------------------------------------------------------------EKPILEL
B8EN13_METSB/21-164-------------------------------------------------------------------------EKPVAEL
Q39833_SOYBN/90-233-------------------------------------------------------------------------EKPLVDL
E8RUB5_ASTEC/4-147-------------------------------------------------------------------------ERPIADL
ACCA_TERTT/5-148-------------------------------------------------------------------------EQPIAVL
C6Y0P1_PEDHD/8-150-------------------------------------------------------------------------EKPIAEL
ACCA_CHLTR/3-146-------------------------------------------------------------------------EKQVVEY
ACCA_THICR/5-147-------------------------------------------------------------------------EQPIAEL
ACCA_ALKEH/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_OCEIH/4-147-------------------------------------------------------------------------EKPIVNL
ACCA_WIGBR/5-149-------------------------------------------------------------------------EQPIADL
Q1IN03_KORVE/6-146-------------------------------------------------------------------------QQELERI
F4L135_HALH1/3-146-------------------------------------------------------------------------EKPLEIL
E1SU30_FERBD/5-150-------------------------------------------------------------------------EHPIAEL
E1X4H2_HALMS/9-151-------------------------------------------------------------------------EKPVRDL
F6DPP9_DESRL/2-145-------------------------------------------------------------------------EKPLLEL
K9SI36_9CYAN/7-154-------------------------------------------------------------------------EKPLAEL
D3PDG9_DEFDS/6-148-------------------------------------------------------------------------ETQIFEL
R6SFM1_9FIRM/263-401-------------------------------------------------------------------------VDQIVER
D8TBU9_SELML/23-165-------------------------------------------------------------------------EKPIIDL
B4ETY2_PROMH/5-152-------------------------------------------------------------------------EKPIVEL
ACCA_THEYD/4-147-------------------------------------------------------------------------EKPIQEL
R5YCC5_9FIRM/275-410-------------------------------------------------------------------------LSKILDM
ACCA_RHILO/4-148-------------------------------------------------------------------------EKPVQDL
C0ZEF2_BREBN/2-145-------------------------------------------------------------------------EGPIIEL
C4L480_EXISA/3-141-------------------------------------------------------------------------.DPIKEV
Q187P7_PEPD6/3-145-------------------------------------------------------------------------SEKIKVL
ACCA_AROAE/5-148-------------------------------------------------------------------------EQPVADL
W8TMD3_EUBAC/5-147-------------------------------------------------------------------------DGPVLQL
R7I7W2_9BURK/5-149-------------------------------------------------------------------------EKDIEAL
C9RBG3_AMMDK/4-147-------------------------------------------------------------------------ERPLVEL
ACCA_ACTP2/5-149-------------------------------------------------------------------------ELPIAEL
W8EY50_9BACT/2-145-------------------------------------------------------------------------EQPIAAL
C8W257_DESAS/5-148-------------------------------------------------------------------------EKPILEL
J9QYP7_RIEAN/3-148-------------------------------------------------------------------------ETPIKEL
ACCA_CAMJE/5-141-------------------------------------------------------------------------EKNIQQI
F0S695_PSESL/5-147-------------------------------------------------------------------------EKPIAEL
H2FXK3_OCESG/5-150-------------------------------------------------------------------------EQPIAEL
F0S0A5_DESTD/5-143-------------------------------------------------------------------------EKKVDRL
B3QS67_CHLT3/5-161-------------------------------------------------------------------------EKPLVEL
D7A5W6_STAND/4-148-------------------------------------------------------------------------EKPVAEL
F0LUJ9_VIBFN/5-151-------------------------------------------------------------------------EKPIVEL
ACCA_BACHD/5-147-------------------------------------------------------------------------EKPIRDL
R5EMT9_9GAMM/5-150-------------------------------------------------------------------------EQPIADL
ACCA_PROA2/6-163-------------------------------------------------------------------------EKPLFEL
F0T0C4_SYNGF/2-144-------------------------------------------------------------------------EKNIREL
H8GK81_METAL/5-148-------------------------------------------------------------------------EQPIAEL
D5WSS7_KYRT2/5-147-------------------------------------------------------------------------EKPLLEL
F6GHA4_LACS5/3-147-------------------------------------------------------------------------ELPIKEL
W8KT18_HALHR/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_GEOMG/7-148-------------------------------------------------------------------------EKPVFEL
K9Z068_CYAAP/11-154-------------------------------------------------------------------------EKPLVEL
H1XP22_9BACT/9-151-------------------------------------------------------------------------EKPIVNL
H2IA21_FLACA/3-147-------------------------------------------------------------------------ELPIKEL
C8WRU9_ALIAD/5-147-------------------------------------------------------------------------ERPIAEL
F7XXZ5_MOREP/5-149-------------------------------------------------------------------------EQPIADI
ACCA_BACSK/5-147-------------------------------------------------------------------------EKPVIEL
R5QM64_9PROT/6-149-------------------------------------------------------------------------EKPIAEL
B3ERA3_AMOA5/2-146-------------------------------------------------------------------------EKPIALL
K4IV53_PSYTT/3-147-------------------------------------------------------------------------ELPIKAL
B2V9Z0_SULSY/2-143-------------------------------------------------------------------------NQELQSL
F5Y6P2_TREAZ/2-135-------------------------------------------------------------------------..EIQAI
ACCA_PARDP/3-147-------------------------------------------------------------------------EKPLADL
ACCA_OLICO/8-150-------------------------------------------------------------------------EKPVAEL
D6Z010_DESAT/30-172-------------------------------------------------------------------------...LPAL
ACCA_OCHA4/4-148-------------------------------------------------------------------------EKPVADL
S0EW53_CHTCT/6-157-------------------------------------------------------------------------EKPISEL
ACCA_COLP3/5-150-------------------------------------------------------------------------EQPIAEL
ACCA_ARCB4/5-141-------------------------------------------------------------------------EEKIKKI
ACCA_TOLAT/5-150-------------------------------------------------------------------------EQPIAEL
H6N9Y7_9BACL/6-147-------------------------------------------------------------------------EQPLVEL
C7NC27_LEPBD/4-144-------------------------------------------------------------------------KDEIKEL
ACCA_DEIRA/4-145-------------------------------------------------------------------------ADALREL
R7GN66_9FIRM/3-139-------------------------------------------------------------------------EEKIAEL
G8R0N5_OWEHD/3-147-------------------------------------------------------------------------EKPIQEL
R5S9W6_9GAMM/4-147-------------------------------------------------------------------------EKPIVEI
R5RFQ5_9FIRM/9-143-------------------------------------------------------------------------..KIKEI
K0B3H8_CLOA9/4-147-------------------------------------------------------------------------EKPIVEL
E3HB41_ILYPC/2-143-------------------------------------------------------------------------EKDILEL
D6GQG0_FILAD/2-144-------------------------------------------------------------------------...IQEL
K0P1U1_9BACT/2-146-------------------------------------------------------------------------EKPIVKL
F2J212_POLGS/4-148-------------------------------------------------------------------------EKPVADI
U5QFX0_9CYAN/13-155-------------------------------------------------------------------------EREIREL
E8R5M4_ISOPI/5-159-------------------------------------------------------------------------EAPIYEM
R6J4C9_9PROT/8-151-------------------------------------------------------------------------EKNIVEI
S5RQ07_9PROT/5-148-------------------------------------------------------------------------EEPIIKL
ACCA_DICNV/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_AQUAE/8-151-------------------------------------------------------------------------EKELLEI
E8UCK2_TAYEM/5-148-------------------------------------------------------------------------EKPIEEL
B3DWQ6_METI4/5-148-------------------------------------------------------------------------EKPIVDL
B8DL69_DESVM/26-171-------------------------------------------------------------------------NENIALL
C7R5W6_KANKD/5-148-------------------------------------------------------------------------ERPIAEL
I6ZWV1_MELRP/5-146-------------------------------------------------------------------------EKPIVEL
L0F5J8_DESDL/5-147-------------------------------------------------------------------------EKPILEL
I0K7J9_9BACT/4-147-------------------------------------------------------------------------EKPLADL
Q0BUI6_GRABC/12-154-------------------------------------------------------------------------EKPIAEL
U5LED4_9BACI/5-147-------------------------------------------------------------------------EKPVVEL
J7QSL5_METSZ/4-148-------------------------------------------------------------------------EKPVAEL
ACCA_BACAN/4-146-------------------------------------------------------------------------EKPVVEL
K4LJD9_9FIRM/2-144-------------------------------------------------------------------------EKELAEL
X2H0U8_9GAMM/4-150-------------------------------------------------------------------------EKPIAEL
ACCA_BAUCH/6-151-------------------------------------------------------------------------EQPIADI
ACCA_STRMK/5-148-------------------------------------------------------------------------EQPIADL
F8EKR1_RUNSL/4-147-------------------------------------------------------------------------EKPVSDL
G8T7C8_NIAKG/9-152-------------------------------------------------------------------------EKPIKDL
ACCA_CYAP4/9-152-------------------------------------------------------------------------EKPLAEL
ACCA_BEII9/4-148-------------------------------------------------------------------------EKPVAEL
J9Z203_9PROT/3-145-------------------------------------------------------------------------EEKLEKL
M1E6T6_9FIRM/9-151-------------------------------------------------------------------------EKPIIDL
ACCA_NITEU/5-148-------------------------------------------------------------------------EKGIEEF
C7RN27_ACCPU/5-148-------------------------------------------------------------------------EQPIADL
F9ZM26_ACICS/5-145-------------------------------------------------------------------------EQSVAEL
K0C175_CYCSP/5-148-------------------------------------------------------------------------EQPIVEL
A5G4G6_GEOUR/6-148-------------------------------------------------------------------------EKPLADL
E3F1D1_KETVY/3-147-------------------------------------------------------------------------EKPLAEI
Q3JCT5_NITOC/9-152-------------------------------------------------------------------------EQPIAEL
K9VDH0_9CYAN/10-153-------------------------------------------------------------------------EKPLAEL
ACCA_LISMO/5-147-------------------------------------------------------------------------EKPILEL
A8FG56_BACP2/5-147-------------------------------------------------------------------------EKPVIEL
ACCA_RUTMC/5-145-------------------------------------------------------------------------EQPIVEL
Q2RXX2_RHORT/7-150-------------------------------------------------------------------------EKPIAEL
ACCA_PSEHT/5-150-------------------------------------------------------------------------ELPIAEL
E6W2T7_DESIS/5-148-------------------------------------------------------------------------ERPIVEL
D0MDD2_RHOM4/9-159-------------------------------------------------------------------------EKPIAEL
F8L7E7_SIMNZ/5-148-------------------------------------------------------------------------EKQIRDY
W0RIF3_9BACT/5-148-------------------------------------------------------------------------EKPIADL
L0D934_SINAD/9-155-------------------------------------------------------------------------EAQIYEM
F2NQ24_MARHT/2-145-------------------------------------------------------------------------ERPIIEL
E6X0S5_NITSE/4-141-------------------------------------------------------------------------EKPIEAI
F4CCW2_SPHS2/4-147-------------------------------------------------------------------------EKPIADL
D3ECM3_GEOS4/5-147-------------------------------------------------------------------------EMPLAEM
ACCA_SPHAL/4-147-------------------------------------------------------------------------EKQVAAL
Q0AMD1_MARMM/8-151-------------------------------------------------------------------------ERPLAEL
B3E7C0_GEOLS/6-146-------------------------------------------------------------------------EKPIAEL
Q1D555_MYXXD/8-151-------------------------------------------------------------------------ERPLIEL
ACCA_CHRSD/5-148-------------------------------------------------------------------------EQPIAEL
ACCA_EXIS2/3-143-------------------------------------------------------------------------DQPVIAL
F8KZD1_PARAV/4-145-------------------------------------------------------------------------EKQINEY
ACCA_FUSNN/2-143-------------------------------------------------------------------------EFQIEEL
S6B4Y6_9PROT/5-148-------------------------------------------------------------------------EQPIAEL
B4U9A1_HYDS0/4-142-------------------------------------------------------------------------.KDVQEL
ACCA_CHESB/4-148-------------------------------------------------------------------------EKPVADL
A1AQQ7_PELPD/6-148-------------------------------------------------------------------------EKPIVEL
F8JC16_HYPSM/32-176-------------------------------------------------------------------------EKPILEL
B9E7A5_MACCJ/2-145-------------------------------------------------------------------------EQPIRDI
D4H0L9_DENA2/5-148-------------------------------------------------------------------------EAPILEI
F0SFK4_RUBBR/6-146-------------------------------------------------------------------------ERNIHEL
ACCA_SPHWW/4-147-------------------------------------------------------------------------EKPIAEL
F6CQZ6_DESK7/2-145-------------------------------------------------------------------------ERPIIEL
R5K1S9_9CLOT/3-142-------------------------------------------------------------------------DERIRAI
I4D4N6_DESAJ/5-147-------------------------------------------------------------------------EKPILEL
D6YRI8_WADCW/23-165-------------------------------------------------------------------------EKQIFEY

PF01039

PCCB_SACEN/46-544.DADRPYGDGVVTGWGTVDGRRVCVFSQDFTVFGGSLGEVFGEK...IVKVMDLAMKT...............GCPLVGI
ACACB_HUMAN/1780-2334..AEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISSLNSVHC...KHIEEGGESRYMI
PCCB_BACSU/26-505..R..MLGDGVVTGYGTIDGRSVYVFAQDFTVYGGALGETHARK...ICALMDLAAKN...............KAPIIGL
YNGE_BACSU/27-509.....LPADGVVTAIGKIGGQTVCVMANDSTVKAGSWGAKTVEK...IIRIQEIAEKL...............NCPLIYL
ACACA_HUMAN/1669-2223..AEGIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYKRVSALNSVHC...EHVEDEGESRYKI
PCCB_HUMAN/57-537ADKNKFPGDSVVTGRGRINGRLVYVFSQDFTVFGGSLSGAHAQK...ICKIMDQAITV...............GAPVIGL
Q9ZCU2_RICPR/30-512NKK..FLGDGVVTGYGTINGRLVFIYSQDFTVLGGSLGEYHAKK...ICDIIDQAIAT...............GAPVIGI
ACC1_ARATH/1587-2139..AKKLPLIYLAANSGARLGVAEEVKACFKVGWSDEISPENGFQYIYLSPEDHERIGSSVIAH....EVKLSSGETRWVI
HFA1_YEAST/1619-2176..ERGIPRIYLAANSGAKLGIAEELIPLFRVAWNDPSDPTKGFQYLYLAPKDMQLLKDSGKGNSVVVEHKMVYGEERYII
O28066_ARCFU/27-514.DKMDLPADGVVTGYGTVDGRPVAVFAQDFTVMGGSLGEMHGFK...IAYILDFAMKL...............GIPVVGL
O86318_MYCTU/45-527.Q....IGASLVTGIGAVCGVECMIVANDPTVKGGTSNPWTLRK...ILRANQIAFEN...............RLPVISL
Q20676_CAEEL/55-534KEK..YPGDSVVTGRGEINGRTVFVFSQDFTVFGGSLSSIHAKK...IVKIMREAMLV...............GAPVIGL
O86517_STRCO/39-525AKKP..YTDGVITGWGTVEGRTVFVYAHDFRIFGGALGEAHATK...IHKIMDMAIAA...............GAPLVSL
PCCB_MYCLE/50-547ENRP..VGDGVVTGYGTIDGRDVCIFSQDVTVFGGSLGEVYGEK...IVKVQELAIKT...............GRPLIGI
ACAC_YEAST/1574-2130..KRGIPRIYLAANSGARIGMAEEIVPLFQVAWNDAANPDKGFQYLYLTSEGMETLKKFDKENSVLTERTVINGEERFVI
MCCB_ARATH/93-585......PSGGIITGIGPIHGRICMFMANDPTVKGGTYYPITIKK...HLRAQEIAARC...............RLPCIYL
ACAC_SCHPO/1615-2170..QRGIPRIYLAANSGARIGVADEIVPLFNIAWVDPDSPEKGFDYIYLTPEAYERLQKENPNILTTEEVVTETGELRHKI
MCCB_CAEEL/119-606.V....PSGGILTGVGIVSGRVCVIVANDATVKGGTYYPITVKK...HLRAQEIAREN...............KLPCIYL
GCDA_ACIFV/54-573.......SVAIVKGLGRVNGKWCVVVASDNKKLAGAWVPGQAEC...LLRASDTAKTL...............HVPLVYV
B5YMF5_THAPS/1470-2012..EHKLPRVYISCNSGARIGLVEDLKPKFKIKFVDEASPSKGFE...YLYLDDETYKTLPEGS.....VNVREVPEGWAI
D1BNG7_VEIPT/29-507.EKKELPGEGVVTGYGTIDGRLVYAFAQDFTVEGGSLGEMHAAK...IVKVQRLAMKM...............GAPIVGI
D7GFR7_PROFC/38-518.DKAVVPADGVVTGRGTILGRPVHAASQDFTVMGGSAGETQSTK...VVETMEQALLT...............GTPFLFF
G5EAT9_EMENI/1606-2161..KLGIPRVYLSANSGARIGMADELIPYFSVAWNDPAKPEAGFKYLYLTPEVKKKFDASKQKEVI.TELIHDEGEERHKI
M0WLS8_HORVD/1642-2195..ERKLPLIYLAANSGARIGIADEVKSCFRVGWSDDGSPERGFQYIYLTEEDHARISASVIAH....KMQLDNGEVRWVI
ACCD_MYCTU/14-479......ADESVQTGEGRVFGRRVAVVACEFDFLGGSIGVAAAER...ITAAVERATAE...............RLPLLAS
Q1DDA0_MYXXD/32-518.DKK.IPGDGVVTGYGTVEGRKVFVFAQDFTVFGGSLSGAYAQK...ICKIMDLATRV...............GAPVIGL
A0A0D1DYD5_USTMA/1546-2102..ELGVPRLYISANSGARIGLATEALDLFKVKFVGD.DPAKGFEYIYLDDESLQAVQAKAPNSVMTKPVQAADGSVHNII
Q8NSG7_CORGL/44-541.GAKRPATDGIVTGWGTIDGREVCIFSQDGTVFGGALGEVYGEK...MIKIMELAIDT...............GRPLIGL
Q8NSG8_CORGL/38-535.DAKRPVTDGVVTGYGTIDGRKVCVFSQDGAVFGGALGEVYGEK...IVKVMDLAIKT...............GVPLIGI
Q8U305_PYRFU/28-520.DKRELPADGVITGYGTIDGRLVFVYAQDFTVMGGSLGEMHAMK...IKRIMELALEA...............GAPVIGL

PF06833

Q8P4U4_XANCP/5-230-------------------------------------------------------------------------...GHAI
Q89XP1_BRADU/5-233-------------------------------------------------------------------------...GHEV
Q9I6S6_PSEAE/11-268-------------------------------------------------------------------------LAPRPGD
Q89UY5_BRADU/5-233-------------------------------------------------------------------------...GRKI
Q87V58_PSESM/9-266-------------------------------------------------------------------------ASEVTGL
A6T8S0_KLEP7/11-266-------------------------------------------------------------------------APLMSGL

PF03572

Q8CVF0_LEPIN/340-512....G--------------------------------------------------------------------PSVDREI
CTPA_SYNP2/215-376.....--------------------------------------------------------------------.NAKTEI
Q81R25_BACAN/181-400.....--------------------------------------------------------------------.AINKLL
Q7UUN0_RHOBA/410-573.....--------------------------------------------------------------------.STPAEV
Q8Y2I4_RALSO/213-395.....--------------------------------------------------------------------.RTVPDL
Q8DII0_THEEB/215-376.....--------------------------------------------------------------------.MAPTEM
Q8R712_CALS4/193-353.....--------------------------------------------------------------------.NTTANL
Q87YB6_PSESM/365-539GDPEY--------------------------------------------------------------------KSTTRDV
TRI_SULSO/887-1042.....--------------------------------------------------------------------..MYQGF
Q7VMG7_HAEDU/365-546.....--------------------------------------------------------------------...ANDM
Q8R7P6_CALS4/299-499..NDI--------------------------------------------------------------------KKDGKEI
Q8A406_BACTN/202-362.....--------------------------------------------------------------------.NPSKDF
Q7NKF3_GLOVI/143-304.....--------------------------------------------------------------------FGSASQV
TRI_THEAC/878-1033.....--------------------------------------------------------------------..GMMGL
O83301_TREPA/167-332.....--------------------------------------------------------------------.VTATRM
Q7TUF4_PROMP/222-383.....--------------------------------------------------------------------.SVPKKI
Q8R6Q0_CALS4/169-397GEEEY--------------------------------------------------------------------KKEKEKI
Q87PB1_VIBPA/356-526.....--------------------------------------------------------------------...SQDT
Q8EDY9_SHEON/364-534.....--------------------------------------------------------------------...SQDV
Q97LQ5_CLOAB/210-372.....--------------------------------------------------------------------.NTGNNF
O66985_AQUAE/192-355.....--------------------------------------------------------------------.GTSKSL
Q9RU43_DEIRA/206-370.....--------------------------------------------------------------------..ASAQF
P73458_SYNY3/220-381.....--------------------------------------------------------------------.QASEEM
Q7UNS4_RHOBA/218-383.....--------------------------------------------------------------------.KTVSEL
Q9RUS4_DEIRA/235-411.....--------------------------------------------------------------------.LTGGGV
Q894Q8_CLOTE/197-416...NI--------------------------------------------------------------------ANDKDKL
Q82BY0_STRAW/878-1033.....--------------------------------------------------------------------..VGSGW
Q8YRM4_NOSS1/218-379.....--------------------------------------------------------------------.NASMEL
Q8CVF1_LEPIN/197-364.....--------------------------------------------------------------------.NTLSEF
Q8A5K0_BACTN/312-500.....--------------------------------------------------------------------SGFDQEL
Q89KT1_BRADU/201-369.....--------------------------------------------------------------------.QTTDGL
Q8ENJ3_OCEIH/223-384.....--------------------------------------------------------------------.KTGDEF
Q8XNN1_CLOPE/231-397.....--------------------------------------------------------------------.GTAKDF
Q8P5D2_XANCP/126-301.SDVR--------------------------------------------------------------------GDYQRAL
PRC_HAEIN/363-533.....--------------------------------------------------------------------...TEDV
Q8Y649_LISMO/229-395.....--------------------------------------------------------------------.TTYDEL
P75023_SYNY3/244-405.....--------------------------------------------------------------------.HSAEQM
Q9A2X1_CAUCR/195-362.....--------------------------------------------------------------------.KATDAL
Q8R7P7_CALS4/191-422NSKNY--------------------------------------------------------------------REEKKEI
Y858_CHLTR/316-560.DPSG--------------------------------------------------------------------PPPWEEF
Q8KAA8_CHLTE/214-383.....--------------------------------------------------------------------.HSREEL
Q8ZXG0_PYRAE/836-991.....--------------------------------------------------------------------..GPAGY
Q7VFQ7_HELHP/223-383.....--------------------------------------------------------------------.NVTRNV
Q8A3B9_BACTN/191-351.....--------------------------------------------------------------------.TTAEEF
Q7VBS8_PROMA/229-390.....--------------------------------------------------------------------.NAAKEM
CTPA2_ARATH/320-483.....--------------------------------------------------------------------.NASSAV
Q815H1_BACCR/212-374.....--------------------------------------------------------------------.NTAKEF
Q87UG9_PSESM/211-377.....--------------------------------------------------------------------.KTGDEV
Q7V214_PROMP/205-366.....--------------------------------------------------------------------.NASREM
Q7NPI8_GLOVI/227-389.....--------------------------------------------------------------------.NAAQQV
Q82H90_STRAW/894-1049.....--------------------------------------------------------------------..GGSGW
Q9AAF2_CAUCR/247-457..NSK--------------------------------------------------------------------WDWRGWL
Q87Q24_VIBPA/260-446.....--------------------------------------------------------------------PSAQTPL
RET3_HUMAN/438-617..VLG--------------------------------------------------------------------VLAPYVL
Q7UJ42_RHOBA/384-569NETDY--------------------------------------------------------------------RSSTRDV
Q8R7Q0_CALS4/178-406DGEGY--------------------------------------------------------------------KKERDMI
Q8R8M1_CALS4/207-366.....--------------------------------------------------------------------.STSSDF
Q8YPV0_NOSS1/193-349.....--------------------------------------------------------------------.AADPYQ
PRC_ECOLI/356-530.....--------------------------------------------------------------------...TDDV
Q892K7_CLOTE/192-411...FV--------------------------------------------------------------------KINTDKL
Q834H3_ENTFA/208-374.....--------------------------------------------------------------------.KTYQEL
Q89X80_BRADU/202-369.....--------------------------------------------------------------------.QTTEGL
Q8DGJ2_THEEB/238-398.....--------------------------------------------------------------------.RSQQQM
Q9CP01_PASMU/362-532.....--------------------------------------------------------------------...TQDV
Q896W4_CLOTE/217-379.....--------------------------------------------------------------------.KTPELF
Q7MSB3_WOLSU/198-359.....--------------------------------------------------------------------.KVGKRV
Q9WZK6_THEMA/203-364.....--------------------------------------------------------------------.KADSDM
Q8YW78_NOSS1/226-387.....--------------------------------------------------------------------.HAAEQM
Q83BH0_COXBU/210-383.....--------------------------------------------------------------------.PVENQL
Q7NSR6_CHRVO/194-376.....--------------------------------------------------------------------.HTAEDL
Q9RUA1_DEIRA/235-408.....--------------------------------------------------------------------.LSTDTA
Q9A6Q6_CAUCR/254-429APDDP--------------------------------------------------------------------RPLDAVL
Q7MTT6_PORGI/195-361.....--------------------------------------------------------------------.TTHAEF
Q9L1S8_STRCO/194-352.....--------------------------------------------------------------------.GVGEQV
Q82PY7_STRAW/269-453DSPAY--------------------------------------------------------------------ARNSAVL
Q7MXF8_PORGI/163-329.....--------------------------------------------------------------------.TTYDEF
Q8KDJ6_CHLTE/340-525QKHNY--------------------------------------------------------------------ASTTKDV
Q8A1T1_BACTN/145-316....S--------------------------------------------------------------------GVGDGNL
Q7NGR6_GLOVI/216-377.....--------------------------------------------------------------------.YAAKDM
Q8R640_FUSNN/203-364.....--------------------------------------------------------------------.NVYPDM
Q82TT8_NITEU/202-384.....--------------------------------------------------------------------.RTGENL
Q7NL17_GLOVI/226-387.....--------------------------------------------------------------------.KAGREV
Q8DZX2_STRA5/125-302.....--------------------------------------------------------------------KLDKRSI
CTPA_SYNY3/218-379.....--------------------------------------------------------------------.NAYKEV
O25905_HELPY/210-371.....--------------------------------------------------------------------.NVTKSV
Q7U4U5_SYNPX/228-389.....--------------------------------------------------------------------.GVPEQV
Q7MUB1_PORGI/151-321....K--------------------------------------------------------------------PISNSNI
CTPB_BACSU/213-375.....--------------------------------------------------------------------.HTAEDF
O84448_CHLTR/354-525....Q--------------------------------------------------------------------VSSEQDL
Q8DJ23_THEEB/220-381.....--------------------------------------------------------------------.NAAGEM
Q8A7W6_BACTN/916-1071.....--------------------------------------------------------------------..GDGSF
Q9KNC0_VIBCH/209-365.....--------------------------------------------------------------------..DAASF
Q7U711_SYNPX/231-392.....--------------------------------------------------------------------.NASREM
Q8YU55_NOSS1/219-380.....--------------------------------------------------------------------.NASKEM
Q8KD83_CHLTE/187-349.....--------------------------------------------------------------------.TTGSEF
Q8EBT8_SHEON/888-1043.....--------------------------------------------------------------------..GGGDI
Q7VS41_BORPE/198-377.....--------------------------------------------------------------------.KTGPDL
CTPA_BACSU/201-363.....--------------------------------------------------------------------.TTAKEL
TRIC_SULTO/669-824.....--------------------------------------------------------------------..MYQGF
Q9K6X5_BACHD/210-372.....--------------------------------------------------------------------.DTADRF
Q7MVK0_PORGI/205-366.....--------------------------------------------------------------------.KSAEEV
Q8P3J7_XANCP/253-471..DSQ--------------------------------------------------------------------WDWRGFL
Q89ZW2_BACTN/204-370.....--------------------------------------------------------------------.TSHVEL
Q8EKP4_SHEON/197-361.....--------------------------------------------------------------------.DSTEDM
Q7TUQ0_PROMM/225-386.....--------------------------------------------------------------------.GVPEQV
Q890X6_CLOTE/207-369.....--------------------------------------------------------------------.NTAKNF
Q7NPD6_GLOVI/225-386.....--------------------------------------------------------------------.KAPNEM
B2J2K4_NOSP7/217-378.....--------------------------------------------------------------------.TAPAQM
CTPA3_ARATH/310-472.....--------------------------------------------------------------------.TAASDM
CTPA1_ARATH/307-467.....--------------------------------------------------------------------.LARKDL
G3WSG1_SARHA/36-212...IE--------------------------------------------------------------------EVGEFLV
M0ZTS1_SOLTU/116-276.....--------------------------------------------------------------------.LARKDL
M3WLH1_FELCA/129-305...VS--------------------------------------------------------------------KLGGFLV
Q1D0E2_MYXXD/209-374.....--------------------------------------------------------------------.RTDLYL
Q2YLJ3_BRUA2/181-348.....--------------------------------------------------------------------.QTSEDL
CTPAL_STAEQ/226-389.....--------------------------------------------------------------------.NTSGEL
Q9PA16_XYLFA/231-394.....--------------------------------------------------------------------.DTGNDF
Q9PCF8_XYLFA/366-548NVANY--------------------------------------------------------------------TSATRDV
Q9ZDU6_RICPR/189-355.....--------------------------------------------------------------------.STISEL

PF01972

Y137_METJA/3-286FI--------TIEDSEEILRAIRA-A---PKDKPIDLII-----------------------------------------
Y1495_METJA/9-292FI--------TIEDSEEILRAIRL-T---PEDMPIDLII-----------------------------------------
O29403_ARCFU/7-290FI--------DIDDSEKVLRAIRS-T---PKDKPIDLII-----------------------------------------
O66996_AQUAE/1-288FM--------TIEDSERVLRAIRM-T---PDDMPIDLII-----------------------------------------

PF00574

Q7XBR2_ORYSJ/73-254FL--------ADAVVS.QLLLLDA-V---DPNSDIRLFV-----------------------------------------
CLPP2_BORBU/6-189DV--------SRLFQE.KILLLEA-L---DFKKPIFVYI-----------------------------------------
CLPP1_BORBU/13-194PK--------ADTVIA.QLLFLES-E---DSSKDIYLYL-----------------------------------------
CLPP1_CAEEL/34-215FI--------ASALIA.QLLFLQS-E---SGKKPIHMYI-----------------------------------------
CLPP4_ARATH/74-253FV--------ADAIMS.QLLLLDA-K---DPKKDIKLFI-----------------------------------------
CLPP1_CHLTR/3-189KS--------ATEAIK.KLWYLEL-T---NPGQPIVFVI-----------------------------------------
Q9CFR9_LACLA/7-176ND--------A..........L.V-N---ADDEEIVLNI-----------------------------------------
CLPP1_PSEAE/28-209YM--------ANLVVA.QLLFLEA-E---NPEKDIHLYI-----------------------------------------
CLPP2_RHIME/20-201HM--------ATLVCA.QLLFLEA-E---NPKKEVALYI-----------------------------------------
CLPP2_BACHD/13-194QI--------ANSIVA.QLLFLEA-E---NPKKDIYLYI-----------------------------------------
CLPP_CAUCR/20-201GM--------ASLICA.QLLFLES-E---NPKKEIAMYI-----------------------------------------
CLPP5_ARATH/107-288DM--------ANIIVA.QLLYLDA-V---DPTKDIVMYV-----------------------------------------
CLPP_MOUSE/63-244SV--------ASLVIA.QLLFLQS-E---SNKKPIHMYI-----------------------------------------
CLPP_CALS4/12-193TT--------ASLVIA.QMLFLEA-E---DPDKDIWLYI-----------------------------------------
O97252_PLAF7/180-359KT--------ADELIS.QLLYLDN-I---NHN.DIKIYI-----------------------------------------
CLPP1_AGRFC/16-197TV--------SALVCA.QLLFLEA-E---NPKKPIHLYI-----------------------------------------
CLPP_XYLFA/19-200YM--------ANLIVA.QLLFLEA-E---NPEKDINIYI-----------------------------------------
Q42886_SOLLC/95-274AV--------AQKVIS.QLVTLAT-I---DENADILIYL-----------------------------------------
CLPP1_TREPA/17-198AV--------ADLVVA.QLLFLES-Q---NPDKDISLYI-----------------------------------------
CLPP2_MYCLE/27-207AS--------ANDIMA.QLLVLES-L---DPDRDITMYI-----------------------------------------
CLPP_DEIRA/15-196QM--------ANSIVA.QLLLLDS-Q---NPEQEIQMYI-----------------------------------------
CLPP1_BACHD/12-193NV--------ANSIVA.QLLFLQA-E---DPDKDISLYI-----------------------------------------
CLPP_THEMA/21-202YV--------ANLVIA.QLLFLEA-E---DPDKDVYLYI-----------------------------------------
CLPP2_TREPA/15-193DL--------AEGIVR.QLFVLES-L---SVSKPIYMYV-----------------------------------------
CLPP_CHLTE/37-218HV--------AGLIIA.QLIFLES-E---DPERDIYIYI-----------------------------------------
TEPA_BACHD/48-232TK--------YEHIIP.QLVAAEQ-N---KKIEGLLIIL-----------------------------------------
CLPP3_NOSS1/13-196EI--------ANQIIA.VMLYLDS-E---DPGKDIYLYI-----------------------------------------
CLPP3_AGRFC/23-198EL--------AQKVCT.QLVAL.A-A---ASDDDIRVYV-----------------------------------------
CLPP1_RHILO/16-197DV--------SALVCA.QLLSLES-D---NPDKEISLYI-----------------------------------------
CLPP1_SYNE7/10-191DV--------ANRIVA.QLLFLEA-E---DPEKDIYLYI-----------------------------------------
CLPP_CLOPE/13-194VT--------ANLVVA.QLLFLES-E---DPDKDIHLYI-----------------------------------------
CLPP_RICPR/12-193HM--------ANLIVA.QLLFLEA-E---NPKKDIYMYI-----------------------------------------
CLPP2_CORGL/13-195EI--------ANKLCA.QILLLSA-E---DPTRDISLYI-----------------------------------------
CLPP1_CORGL/24-204TS--------ANDIMA.QLLVLEG-M---DPDRDITLYI-----------------------------------------
CLPP5_STRCO/18-201TS--------ANDVTA.QLMYLEH-Q---APDRDIELYV-----------------------------------------
CLPP_CLOAB/12-193TT--------ASLVVA.QLLFLES-E---DPDKDIYLYI-----------------------------------------
CLPP_HAEIN/12-193RM--------ANLIVA.QLLFLES-E---DPTKDINIYI-----------------------------------------
CLPP_CHLRE/310-482KQ--------TERVI........Q-E---EESKKVFMII-----------------------------------------
CLPP1_STRCO/32-208DI--------ANKITA.QLLLL.A-S---DPDKDIFLYI-----------------------------------------
CLPR2_ARATH/79-263EF--------SNQILA.TMLYLDT-L---DDSRRIYMYL-----------------------------------------
CLPP3_SYNY3/13-197SI--------ANRIVA.FLLYLDS-D---DPSKPIYLYI-----------------------------------------
CLPP4_STRCO/14-196GV--------ANVVIA.QLLHLES-S---APESEIAVYI-----------------------------------------
CLPP2_PSEAE/13-193KM--------AKDVVQ.QLHIL.A-S---ISDDPIYMFV-----------------------------------------
CLPP_WHEAT/13-197EI--------TNHITG.LMVYLSI-E---DGISDIFLFI-----------------------------------------
CLPP2_STRCO/28-210AS--------ANDVMA.QLLCLES-M---DPDRDISVYI-----------------------------------------
CLPP_AQUAE/19-200HV--------ANLIVA.QLLFLES-Q---DPDKDIYLYI-----------------------------------------
CLPP3_SYNE7/13-197GL--------ANSIVA.QLLYLDS-E---DSSKPIYLYI-----------------------------------------
CLPP1_NOSS1/11-192NL--------ANLIVA.QLLFLDA-E---DPEKDIYLYI-----------------------------------------
CLPP2_ARATH/41-222DT--------SHVVVA.QLLYLES-E---NPSKPIHMYL-----------------------------------------
CLPP_RALSO/34-215QT--------ANLVVA.QLLFLES-E---NPDKDISLYI-----------------------------------------
CLPP2_SYNY3/32-213QV--------ADSIVA.QLLFLDA-E---DPEKDIQLYI-----------------------------------------
Q8ZQG9_SALTY/47-225GI--------SAHWFAEELVAL..-.---GSITQINLHI-----------------------------------------
CLPP_CAMJE/11-192EL--------AASIVA.QLLFLEA-E---DPTKDIYLYI-----------------------------------------
CLPP2_MYXXD/11-192DV--------ANIIVA.QLLFLES-E---DPDKGINLYI-----------------------------------------
Q9VKY3_DROME/38-219DI--------SSTVVA.QLLFLQS-E---NVNKPIHLYI-----------------------------------------
F2YGL7_CHLVA/18-193EL--------ANQLIG.IMLYLNA-E---EQNKGLYIYI-----------------------------------------
G8AKT8_AZOBR/21-200AV--------ASLICS.QLLFLES-E---NPSKDIALYI-----------------------------------------
M4CIZ3_BRARP/88-261MT--------ADLVIS.QLLLLDA-Q---DSERDITLFI-----------------------------------------
CLPP1_MYCTU/18-192EI--------ANRLCA.QILLLAA-E---DASKDISLYI-----------------------------------------
CLPP_STAA8/13-191NV--------ANSIVS.QLLFLQA-Q---DSEKDIYLYI-----------------------------------------
CLPP_BRUA2/21-200GM--------SMLVCA.QLLFLEA-E---NPKKEINMYI-----------------------------------------
CLPP_NEIG1/17-198ES--------ANLVVA.QLLFLES-E---NPDKDIFFYI-----------------------------------------
CLPP_STRT2/10-192NM--------ANSIIA.QLLFLDA-Q---DNTKDIYLYV-----------------------------------------
CLPP1_BACAN/14-192QV--------ASSVVA.QLLFLEA-E---DAEKDIFLYI-----------------------------------------
Q8Y7Y1_LISMO/12-186EL--------AEDVSK.QLLLLES-I---SND.PITIFI-----------------------------------------
CLPP_LISMO/12-192NV--------ANSIVS.QLLFLDA-Q---DPEKDIFLYI-----------------------------------------
W8UFH3_YEREN/25-205HM--------ANLITA.QMLFLEA-E---NPEKDIFLYI-----------------------------------------

PF00378

ECI1_MOUSE/39-287SL--------SLECLTEFTISLEK-L---ENDKSIRGVILTSE-------CPG----IFSAGLDLLEMYGRNP-------
MENB_BACSU/16-271AF--------TPKTVAEMIDAFAD-A---RDDQNVGVIVLAGA-------GDK----AFCSGGDQKVRGHGGY-------
PKSH_BACSU/12-259TI--------NDTLIEECLQVLNQ-C---ETS.TVTVVVLEG.-------LPE----VFCFGADFQEIYQEMK-------
PKSI_BACSU/10-249AF--------SQELTDDLIQAFEY-I---RQNPKYKAVILTG.-------YDN----YFASGGTQEGLLR...-------
CAID_ECOLI/8-261AI--------DAKTSFEMGEVFLN-F---RDDPQLRVAIITGA-------GEK----FFSAGWDLKAAAEGE.-------
ECI1_HUMAN/52-302SL--------SLEFLTELVISLEK-L---ENDKSFRGVILTSD-------RPG----VFSAGLDLTEMCGRSP-------
ECHM_HUMAN/42-290AL--------CDGLIDELNQALKT-F---EEDPAVGAIVLTG.-------GDK----AFAAGADIKEMQNL..-------
ECHM_CAEEL/40-288AL--------CAQLMTELADALEV-L---DTDKSVGAIVITG.-------SER----AFAAGADIKEMTNN..-------
ECHH_RHOCB/9-257AL--------NAAMRHELTAALHR-A---RGE..ARAIVLTG.-------SGR----AFCSGQDLGDGAAEGL-------

PF01343

Y651_METJA/110-263----------------------EE-L---AKKKPVVVYV-----------------------------------------
SOHB_HAEIN/163-314----------------------RL-K---QKGIKLTVAV-----------------------------------------
O26897_METTH/96-249----------------------AI-N---KSEKPVVSWI-----------------------------------------
SPPA_HAEIN/387-539----------------------NL-Q---KIGKPVIVSM-----------------------------------------
SPPA_SYNY3/126-282----------------------KF-K---QSGKKIVAYG-----------------------------------------
SPPA_BACSU/129-283----------------------IK-K---ETKKPIYVSM-----------------------------------------
P95072_MYCTU/128-283----------------------AA-F---SAVKPSLAWA-----------------------------------------
SPPA_ECOLI/140-296----------------------EF-R---DSGKPVYAVG-----------------------------------------
SPPA_SYNY3/383-536----------------------EL-L---QAQKPVIISM-----------------------------------------
SPPA_ECOLI/391-543----------------------AA-R---AAGKPVVVSM-----------------------------------------
P95072_MYCTU/402-555----------------------RA-R---DRGKPVVASM-----------------------------------------
SCAF_LAMBD/148-300----------------------AR-V---RDIKPVWALA-----------------------------------------
Y021_SYNY3/67-220----------------------KQ-L---SEKIKVVASF-----------------------------------------
O25976_HELPY/103-256----------------------AD-L---KQKMPVLAYA-----------------------------------------
SPPA_HAEIN/132-288----------------------HF-K---DAGKPVIAYA-----------------------------------------
SOHB_ECOLI/161-310----------------------.L-R---DKNIPLTVTV-----------------------------------------
Q0PC65_CAMJE/102-253----------------------.D-L---KIKKPVLVYA-----------------------------------------

PF08496

Q3SFM4_THIDA/3-147LA--------VTGAI.AALIAVAR-R---RS.------------------------------------------------
SOHB_ECOLI/2-158LA--------IAAIA.AIIVNVAQ-R---NK.------------------------------------------------
Q5E611_VIBF1/2-162VS--------IIAIL.VAAKAVGG-K---ST.------------------------------------------------
U3U6L2_9ENTR/2-156FT--------IAIIL.MLINNTLR-K---RQ.------------------------------------------------
B8F6J6_HAEPS/4-160GI--------VAVVI.MLI..LES-R---KQ.------------------------------------------------
M9WWT9_MANHA/4-159GI--------IAVVV.MLI..LES-K---KQ.------------------------------------------------
A1WT84_HALHL/2-146LA--------ILLVL....TAVVR-L---RQE------------------------------------------------
K6ZKA6_9ALTE/2-154VA--------ILLAL.GGIIALFS-K---QK.------------------------------------------------
A6VW04_MARMS/3-155LV--------IGVLL.AALSSGKR-K---SQ.------------------------------------------------
A1U0U5_MARHV/2-161VA--------AIVLV.SIIVSATQ-K---DRD------------------------------------------------
Q6ML34_BDEBA/2-147FA--------VLAVI.LVIALLAA-K---AS.------------------------------------------------
C4K721_HAMD5/2-157GA--------FAVFA.VLIIHIRQ-R---KS.------------------------------------------------
Q5F7D2_NEIG1/4-160GA--------IALIV.LAI..VQS-K---KQ.------------------------------------------------
C9R4B3_AGGAD/4-161LV--------IAAVV.AMIIAIKQ-K---KA.------------------------------------------------
D4GFA3_PANAM/2-157IA--------IAAIV.MIVVNAAQ-R---KR.------------------------------------------------
L0GQQ0_9GAMM/3-144LA--------IAIPL...LLLMRS-R---AT.------------------------------------------------
Q6D4V2_PECAS/4-159VA--------IGALV.VLAFGMTQ-R---KR.------------------------------------------------
E1VKB3_9GAMM/3-151VA--------FMMLF.GTLASFSA-R---NR.------------------------------------------------
G4QLK8_GLANF/2-149VA--------IVVVV.GFIVGMAA-K---QK.------------------------------------------------
Q88G04_PSEPK/2-149IA--------ILVVL.SAIAGLRG-K---GR.------------------------------------------------
Q3JCU0_NITOC/3-143IL--------IALLI...RSSISS-K---SR.------------------------------------------------
Q4KAG4_PSEF5/2-152VA--------ILVVL.ITAAALRS-K---GR.------------------------------------------------
F2JWF9_MARM1/2-145VL--------FALVL.VLLTAGKS-K---KN.------------------------------------------------
W8L9B4_HALHR/2-153VA--------ILVVL.GSLASTAA-S---AR.------------------------------------------------
E0WSD1_9ENTR/2-157TA--------IGALV.FIVFYIGQ-H---QS.------------------------------------------------
K0CD66_ALCDB/4-159VA--------ILFVI.GGIATAAA-R---NRQ------------------------------------------------
U5T5A0_9GAMM/2-148VA--------FGVLL.GMIGGMSN-R---RR.------------------------------------------------
Q9CN58_PASMU/4-161LV--------IAGIA.FMIVTLKQ-H---KA.------------------------------------------------
Q6LPB4_PHOPR/2-162IA--------LVGIL.VLAKGLNG-R---HG.------------------------------------------------
K4KI74_SIMAS/2-171VA--------VVLVI.GFAVAAGM-K---NK.------------------------------------------------
Q9KT45_VIBCH/5-165VA--------LVAVL.VIVKSLGG-R---SG.------------------------------------------------
Q9I2R3_PSEAE/2-148AA--------IIVVL.VVIVALRG-R---GR.------------------------------------------------
B2VKR2_ERWT9/2-158VA--------IAAIA.LIMTHLAL-R---KR.------------------------------------------------
B8GRY4_THISH/2-150FA--------ALVLF.GTLVALAT-R---GR.------------------------------------------------
A6VNT8_ACTSZ/5-162LV--------VAGIV.AMIFAFKQ-R---QP.------------------------------------------------
I3Y8M1_THIV6/9-152LG--------IAVLL...ILALRA-R---QE.------------------------------------------------
Q15TT9_PSEA6/2-153IA--------ILLVV.GGVVGLIS-K---QK.------------------------------------------------
C5BJB2_TERTT/2-161VA--------FGAVV.AIIAAAGM-R---QQ.------------------------------------------------
Q7N4B0_PHOLL/2-157LA--------IIALA.ILGIGIGM-R---KS.------------------------------------------------
W0E0L9_MARPU/2-148LA--------FAALL...LILARA-R---GAG------------------------------------------------
H2FWJ9_OCESG/3-149AA--------VAVII.ALVAGVAA-R---QK.------------------------------------------------
C1DKS7_AZOVD/4-150VA--------VLVIL.VAIAVLRS-R---SR.------------------------------------------------
E1V393_HALED/3-148VV--------VALAL....VMVVR-A---RSG------------------------------------------------
SOHB_BUCBP/2-161FF--------IIFVS.SIILKISR-K---KN.------------------------------------------------
M4VAW8_9DELT/2-148VS--------VIAVL.ITIATLVA-K---AK.------------------------------------------------
R5EC27_9GAMM/2-173AL--------ILFGLITLLMAVKG-L---KSA------------------------------------------------
X2H295_9GAMM/2-181IA--------ILSIL.IFILSQRR-K---LS.------------------------------------------------
A8GF70_SERP5/2-157IA--------IAALA.LLAVSLGQ-R---KN.------------------------------------------------
U3TWV0_9ENTR/2-157VA--------IAAIV.LIVLNAAL-R---KR.------------------------------------------------
Q21J53_SACD2/2-173IA--------FAAIV.VVIVSAGS-K---GQ.------------------------------------------------
D3RTH4_ALLVD/10-153TG--------IAVLI...VLALRV-R---SS.------------------------------------------------
L0E340_THIND/2-150AL--------TLGLF.GAVIAGTT-R---GR.------------------------------------------------
M1SGT4_MORMO/2-158LA--------IIAIV.VFFVMLSI-R---KG.------------------------------------------------
C7RA79_KANKD/2-191VV--------VIIII.SMLISEGQ-R---QR.------------------------------------------------
Q486S9_COLP3/2-158LA--------VIAII.IAIAGAAT-K---QQ.------------------------------------------------
V4LD97_9GAMM/3-151AF--------IGLIM..LLLVRAR-R---QTG------------------------------------------------
Q1QW68_CHRSD/3-155VA--------VGVLV.GLVVTLKQ-R---AS.------------------------------------------------
Q7VMW6_HAEDU/4-160GI--------IAMVI.MLM..LAD-R---KN.------------------------------------------------
Q12LC5_SHEDO/2-148LS--------VLAVI.TMVLMSAI-K---QK.------------------------------------------------
M1FK11_9ALTE/2-170LA--------VVVII.TLIISAAQ-R---EKS------------------------------------------------
B3PHP3_CELJU/2-172VA--------VFVII.SLAVSLGG-R---NK.------------------------------------------------
S6AL13_PSERE/2-151VA--------ILVVL.VAIAALRG-R---NR.------------------------------------------------
A1SW75_PSYIN/13-168IA--------IIAVV.AAVIALVS-K---QK.------------------------------------------------
Q83EG9_COXBU/8-154LA--------IAVVL.FIFFGLIA-H---AK.------------------------------------------------
D8MSU4_ERWBE/2-158VA--------IAAIA.ILITNLAM-R---KR.------------------------------------------------
Q882A1_PSESM/2-148IA--------IVVVL.VAIAAVRG-K---GR.------------------------------------------------
C4LEI0_TOLAT/2-149TV--------IALGV.ITIIAAIA-R---NK.------------------------------------------------
I2B860_SHIBC/2-158VA--------IAVLV.VVVINAAQ-R---KR.------------------------------------------------
Q2SJ39_HAHCH/2-155AA--------ILFVV.GTIIALSQ-R---GK.------------------------------------------------
Q080A4_SHEFN/6-151VA--------ILAVV.IFVLAASM-K---NK.------------------------------------------------
F5Z7M4_ALTSS/2-152IA--------FIIVV.STIVGVAS-K---QK.------------------------------------------------
D3SB45_THISK/2-168VV--------VLIFV.SAVAGVVA-K---SR.------------------------------------------------
W5X6P0_BDEBC/2-148FA--------IVAII.LVIAMVAS-R---KA.------------------------------------------------
A4VLP8_PSEU5/22-167VA--------IVIVL.IALASMRR-G---RS.------------------------------------------------
SOHB_HAEIN/4-161LL--------ILAVV.GLIISYRQ-H---NK.------------------------------------------------
Q87N43_VIBPA/2-162AA--------IIVIL.ILVKSVGS-K---SG.------------------------------------------------
A3QFM5_SHELP/2-153VA--------IVAVV.VLVLASAV-K---QK.------------------------------------------------
M4U4F5_9GAMM/2-157VA--------IIAVI.GTVVALGS-K---QK.------------------------------------------------
Q7CIM0_YERPE/2-157VA--------IGAVV.LLVVSQGM-R---RQ.------------------------------------------------
Q0VQ70_ALCBS/3-158VA--------ILFIF.GGIAAAAS-R---SRG------------------------------------------------
M5DSS1_9GAMM/2-160VA--------VLILV.GGIVSIAA-R---NK.------------------------------------------------
SOHB_BUCAI/2-147II--------SISIL.ILFYTIIK-R---KK.------------------------------------------------
E1SNQ6_FERBD/2-150AA--------VVAII.VAAAAANR-A---GK.------------------------------------------------
F7YNU5_VIBA7/19-179VA--------LVVLL.VIVKSVGG-K---NS.------------------------------------------------
A0KMV5_AERHH/2-146LA--------IGAVI.LMVVS.SR-Q---PK.------------------------------------------------
D3VGP7_XENNA/2-157LS--------IVILA.VVCIGLGV-R---KT.------------------------------------------------
A4XVC0_PSEMY/2-147VA--------IVLVL.VALAATRG-K---GR.------------------------------------------------
A5EWW5_DICNV/5-147LA--------ILAVI.ATISLMKK-S---KD.------------------------------------------------
R4I0F4_9ENTR/2-157IA--------ISALV.LLAASLGQ-R---KN.------------------------------------------------
I0DNT2_PROSM/2-157VA--------IIALA.VFVFGVGM-R---RQ.------------------------------------------------
H2IX53_RAHAC/2-156IA--------IGALV.VLFVGLRQ-R---KS.------------------------------------------------
Q7MLX8_VIBVY/2-162VA--------VVVLL.ILAKSVSG-K---SS.------------------------------------------------
W0HSX4_9ENTR/2-157LA--------IGALL.LLVFGLRM-R---SR.------------------------------------------------
C5BDW5_EDWI9/2-157VV--------VAAVV.LLVVGLRQ-R---QG.------------------------------------------------
Q0ABV0_ALKEH/2-149AL--------VVAAV.GMILNSLR-W---ERP------------------------------------------------
D4G886_RIEPU/2-151VG--------IVLLI.PIILSIGN-K---KK.------------------------------------------------
Q3IL32_PSEHT/3-148IA--------IAIIL.MLIVGAAV-K---PK.------------------------------------------------
F9ZL28_ACICS/2-144LA--------LLILAGGLIFLGRK-G---MR.------------------------------------------------
Q5QYQ0_IDILO/2-143VA--------VGFIV.GLIAQAAQ-K---QK.------------------------------------------------
F4HAL3_GALAU/4-170AV--------IAVVF.GIIVTMKQ-K---NL.------------------------------------------------
B4EW27_PROMH/2-157VA--------IIAIV.SFFVVIGS-K---KQ.------------------------------------------------
B0UU39_HISS2/4-161LI--------VAGIV.MMIMTLKE-R---KS.------------------------------------------------
A3MY80_ACTP2/4-160GI--------VAVVV.MLI..LEA-R---KQ.------------------------------------------------
A7MN97_CROS8/2-158VA--------IAIVI.ALIANLTQ-R---KK.------------------------------------------------
A1S7G8_SHEAM/2-147AA--------IGAIL.VMVFAGAA-R---GK.------------------------------------------------
M4R4I6_BIBTR/4-160GV--------IAVVV.MMI..LDA-R---KQ.------------------------------------------------
D0L1Z6_HALNC/2-150FA--------VLFLL.AGLTALRQ-R---QK.------------------------------------------------

PF16113

B4M5Z4_DROVI/58-379AI--------NLEMVRKIYKHLKK.C...EKSK..SLMII.KG.T.....GDK....AFCAGGDVRALVDA.G-------
D7SLU2_VITVI/50-384AL--------NTSMGARLQNLYKS.W...EENPDIGFVVM.KG.S.....G.R....AFCAGGDIVGLYNL.I-------
F6I042_VITVI/68-402AV--------VTPMGVRLIELYES.W...EKDPHFGFVVI.KG.S.....G.K....AFSAGGDVVCLYQF.M-------
HIBCH_CHICK/45-375AL--------SFKMIQQIYPQIKA.W...EQDPETFLIII.KG.T.....GEK....AFCAGGDVRAIADA.G-------
HIBCH_SCHPO/66-398AI--------NVDMIDSILPKLVS.L...EESNLAKVIIL.KG.......NGR....SFSSGGDIKAAALS.I-------
Q488V8_COLP3/18-356AL--------TLEMIDLMSAQLQQ.W...QTNDKIAAVFI.QG.A.....GEK....AFCAGGDVQALYKS.S-------
C4KDL8_THASP/20-344AL--------DLATVRALTRQLDA.W...AHDPAIRAVLL.RG.S.....GER....AFCAGGDVRALYEL.Q-------
A5FW64_ACICJ/17-342AL--------THDMEVAIDAALLR.W...ADDPSVAFVMV.DG.R.....GER....GLCAGGDIRALYDA.A-------
F5Z7N6_ALTSS/21-362AL--------DLEMASLLLDALQA.W...ENRSDLVCVVL.KA.A.....GEK....AFCAGGDIVSMYNA.M-------
Q8I523_PLAF7/190-524AI--------NKDMINALLNIIKS.L...DNDERCFMVII.RS.T.....NSN....CFSSGSDVKYVVEN.K-------
E3FSI9_STIAD/13-346AL--------DLGMIRRIHPQLEA.W...AREPAVKAVVI.RG.A.....GGK....AFCAGGDVRAVAAS.L-------
F0ZTV2_DICPU/166-501VL--------DLSTLTSIEHFIKT.Q...VANDIVGSYSIHTT.T.....PGA....IQSSGIDFVNLYES.N-------
G5BGL1_HETGA/35-365TL--------TLHMIRQIHLQIKK.W...EQDPETYLIII.KG.A.....GGK....AFCAGGDVRVISEA.A-------
B6HLY2_PENRW/44-388SL--------NGSMARKILPRLKE.W...EKSHLANMILI.SG.A.....GTK....ALCAGGDVAALALQ.N-------
Q1LLS5_CUPMC/36-367AL--------SLEMIRAITGALQS.W...ENDPAVHAMVV.AG.A.....GGK....AFCAGGDIRWFYQA.H-------
F7QLT9_9BRAD/23-350AL--------TLDMTREIVAALDE.F...ESDPGVSLVLL.EG.A.....GER....GLCAGGDIRGLYES.A-------
Q21WJ0_RHOFT/28-365AL--------SLPMIRALTQCLLA.W...RGDARVKAVAI.RG.N.....SKTGPFGAFCAGGDIRFFHQA.A-------
A0A016PD16_GIBZA/69-413SL--------NSSMIRKMVPRLVE.W...EKSDLANVVVL.KG.A.....GHK....ALCAGGDVAALAEM.N-------
I1G4V7_AMPQE/50-378AL--------SGNMIDLLTTDMKS.V...VPDNSINFMLV.RG.......GEK....AFCAGGDIRRVTEA.G-------
F6HIV7_VITVI/22-356SL--------TYEMISQILRNLEV.Y...EKDPMVKLLIL.KG.Q.....G.K....AFCAGGDVVGMVLS.I-------
Q8ES26_OCEIH/14-345SL--------SQRMIELIHQQLTA.W...KNDSNIKFILF.SG.N.....GPK....GFCAGGDIKTLYQA.K-------
A7INC3_XANP2/15-342AL--------NLAMVREILPRLRA.W...AKDPAITRVII.KG.A.....GEK....AFCAGGDVRSIYDL.G-------
F4PNE6_DICFS/76-406VL--------CTDIFVGLNRKLLN.Y...VHNDNLHLLIL.KG.S.....GNK....AYCAGGDIKELTSN.T-------
I1BHM9_RHIO9/79-409AL--------NLPMVRSITPQLQA.W...EKSDLAKIIIL.KH.S.....GGK....GFCAGGDVKTVVDL.A-------
C8X9E6_NAKMY/35-349AL--------TLPMIDGIRAALAG.W...ADDPAVDVVLI.DG.A.....GER....GLCAGADIRALRQS.I-------
I1KQ42_SOYBN/46-396AM--------NLDMDVKYKSYLDE.W...ESDPRVKCVLV.DS.S.....SPR....AFCAGMDIKGVVAE.I-------
Q13IB6_BURXL/22-355AL--------THAMVLALTERLSQ.W...KDDPAIYGVVI.RG.A.....GDR....AFCAGGDIRALYQS.Y-------
E9SYN2_RHOHA/17-337AL--------NHAMVRSMAAALLE.W...ADDDAVDAVLL.TG.A.....GER....GLCAGGDIVSIYHD.A-------
G2NK33_STREK/15-339AL--------THTMVRSIDEALTQ.A...EADASVVAVVI.SG.A.....GER....GLCAGGDIRSIYQD.A-------
D7SV41_VITVI/52-386AL--------TIPMVARLKRLYES.W...EENSDLGFVIM.KG.S.....G.R....ALCSGGDVVALNQL.I-------
G7UPF5_PSEUP/25-367GL--------SLEMTRLLDAQLRR.W...ADDAAIACVVL.QG.A.....GEK....AFCAGGDLHALYRS.M-------
A8LME8_DINSH/12-333AL--------TYEMCLAIDAALRA.W...AEDPEVALVLI.EG.A.....GEK....AFSAGGDIVEMYET.G-------
B2W7S4_PYRTR/68-416SL--------NGSMARKIIPRLQE.W...AKSELAGVVII.KG.N.....G.R....AFCAGGDVAALAKW.N-------
B2IFQ5_BEII9/17-341AL--------TGPMVLAISDQLKI.W...ADDPAVRVIIL.TG.A.....GER....GLCAGGDIRALCNS.G-------
E4XNE1_OIKDI/19-346AL--------NHPIVKMMRPQLKT.W....EESGIDRVIL.KA.E.....GGK....AFCAGGDIKDLTLP.T-------
A1SIK1_NOCSJ/14-329AL--------TLEMVTSMRAALAH.W...ETDPQIDSYLV.TG.......EGR....AFCAGGDVRWIVEE.I-------
B0UJ66_METS4/21-343AL--------DLGMVRRLRAALDA.W...LADPGVTRIVL.RG.......AGR....AFCAGGDIRHLHDE.A-------
D3PW51_STANL/21-338AL--------THAMIAAMLAQLDD.W...ASDASVRAVVI.DG.E.....GER....GLCAGGDVRQLREA.I-------
Q084X0_SHEFN/18-357AL--------TLDMVAAMQAQLTK.W...QQDDSIACVVL.DG.A.....GEK....AFCAGGDVRAIYHA.S-------
B2JKB1_BURP8/21-360AL--------SLDMMRAMQAALDQ.W...RDEPGVLAVVV.RS.T.....SER....AFCAGGDIRYLYDA.F-------
G2J3D7_PSEUL/18-358AL--------TLDMIRLLQQRLSA.W...EADLGLVAVVL.RG.A.....GDK....AFCAGGDVRSLRRA.L-------
F4RGZ4_MELLP/11-358AL--------TPQMLVSMTSCLVD.W...ENSEEVDLVIL.KS.......SSG....VFCAGGDLIPLMQP.A-------
Q0C3Q9_HYPNA/20-349AL--------NTPMCAEILAALQA.W...KADSAIHLVWIDHQ.E.....GTR....GFCSGGDIRMLAES.G-------
F8J779_HYPSM/27-350AL--------DNEMCRALLSAIPR.V...ARNPDVYIVAL.VS.S.....SPK....AFCAGGDVVALSAA.A-------
Q2SP84_HAHCH/24-363AL--------KLSMIESMYSVMQE.W...RLDDKIVAVFM.QG.A.....GDK....AFCAGGDIVQMYES.I-------
E1VLZ8_9GAMM/17-356SL--------SAEMVGLLRAVLEN.W...QKNDRVVCVFL.QG.A.....GEK....AFCAGGDVRKVYDS.I-------
D2V7D6_NAEGR/73-426AL--------SLSMIRSLRRILEQ.A...LSDTKVHFVIL.QS.A.....SDK....AFCAGGDIKDLRRG.F-------
Q12MV4_SHEDO/18-360AL--------NIDMVQAMNAQLKK.W...QSDDNVACVML.EG.S.....GEK....AFCAGGDVRAIYQA.S-------
F5YTZ4_MYCSD/16-336SL--------NLPMVTAMTAALST.W...ADDPAVAAVVL.SG.A.....GER....GLCAGGDVVAIYHS.A-------
Q5WH10_BACSK/10-343SL--------SYDMVSGMLAQLQQ.W...KQDDEVALVLL.EG.A.....GSK....AFCAGGDIKALYSA.R-------
B8ESI3_METSB/13-334SL--------NIGMAQAIAAALDR.W...RTDAAVGCVAI.RG.A.....GGR....AFCAGADIRALYEL.G-------
B9IB41_POPTR/22-356AL--------SHQMVSRLLELFLA.Y...EKDPNVKLLLL.KG.S.....G.R....AFCAGGDVAAVVRD.I-------
F0ZLP9_DICPU/30-365AL--------NPGMVKLLTPKYQE.M...KNMKDGDMVLIMKG.S.....GEK....AFCAGGDIKAIYDY.K-------
H2ZC72_CIOSA/54-386AL--------NLNMIKKIFPKIKE.W...EEDPTTTMIIM.KG.A.....GGK....AFCAGGDIRTITDE.G-------
Q2W460_MAGSA/13-341AL--------SARQYHDITACLVS.W...ESDPDVAVILI.EG.E.....GER....AFCAGGDIRMVWDA.A-------
B1LX53_METRJ/12-337AL--------THGMVGEIDRALDQ.F...SADPGIAAVLL.TG.E.....GER....GLCAGGDLRSLYD...-------
D5GGY6_TUBMM/44-383AL--------NGSMARKIVPRLRE.W...EKSQMANIIIL.KG.A.....G.R....ALCSGGDVAALVESIK-------
A4SZ56_POLSQ/13-344AL--------NYSMIKLLHQTLKI.W...ADDSEVLAVLI.QG.E.....GEK....AFCAGGDIRSIYES.I-------
E9T596_RHOHA/14-336AL--------DGSMIRDMYAALTK.W...RDDDAITAVLV.TS.A.....SER....AFCAGGDIKSVRQS.A-------
F4CYK1_PSEUX/14-333AI--------DHEMVRLLADALDD.F...EHDDGVRAVAI.DG.A.....GER....GLSAGGDVRFLVAD.A-------
Q5ZX62_LEGPH/13-340AL--------TLTMIMALQKQLSI.W...KEDNSIKAVVV.QA.V.....PGN....AFCAGGDIRWLYNA.G-------
B9RD44_RICCO/57-391AL--------NTNMGARLLKLYKS.W...EENPDVGFVMM.KG.S.....G.R....AFCAGGDIVTLYNL.V-------
G0RME1_HYPJQ/43-386SL--------NGSMIRKIVPRLIE.W...EKSDMANVIVM.KG.A.....GEK....ALCAGGDVAELAKY.N-------
A9WQX7_RENSM/20-336AL--------NVAMTEAMLGQLQL.W...AVDDAVQTVLV.YG.N.....GDR....GLCAGGDITAIYND.I-------
H1VE28_COLHI/45-366SL--------NASMIRKILPRLLE.W...EKSDLANVVVM.KG.A.....GDK....AFCAGGDVAELAKY.N-------
G2IVT0_PSEUL/18-359AL--------TLGMIRLLNAQLQR.W...AADDTIACVLL.RG.A.....GER....AFCAGGDVRAVRDA.I-------
E2BCN8_HARSA/46-370SL--------NLSMIKKIHPILKQ.W.....ESSKRLVMI.EG.A.....GDK....AFCAGGDVKSITTV.L-------
C6W855_ACTMD/12-334AL--------NRGMVVEIHAALTR.W...ADDDSVRAVLL.DG.A.....GER....GLCAGGHIRSVHDD.A-------
A0A088AET4_APIME/95-420AL--------NLSMVEKIYPVLKK.W.....ESSKKLVII.EG.A.....GDK....AFCAGGDIKSIGIE.I-------
Q143S2_BURXL/33-374AL--------SHLMVRDLANLLER.V...RNDDRIVALVL.RG.G.....DPK....GFCAGGDVRALYQL.A-------
F4S4Z1_MELLP/87-423AL--------NAEMIETITSRLIE.W...ENSKEANLIIL.KS.......NGR....AFCAGGDVVSMTEA.V-------
B9J934_AGRRK/15-342SL--------TLPMIRAIATALDD.F...AADPSIASVII.KG.E.....GER....AFCAGGDIRLLHQS.G-------
F4Q929_DICFS/53-395SL--------TLEMINHLLNLLKK.Y...ENDKRVTFVLV.VG.A.....GDR....AYCSGGDLLEFSSS.V-------
Q381D8_TRYB2/20-346AL--------NLEMVREMSLAYFH.E...HHPKGDNALFVVKG.M.....GEK....SFCAGGDIVMITTD.N-------
A1BAK1_PARDP/12-321AL--------SHEMALAIDAALQE.W...RDDPEVALVVI.DA.E.....GER....AFCSGGDIAAVYRA.G-------
G3WP62_SARHA/46-376SL--------NLSMIRRIYSQLKK.W...EQEPETSLIII.KG.A.....GGK....AFCAGGDIKAISEA.G-------
B2IDI2_BEII9/14-338AL--------DTETILVFNQALDT.L...ERESGVKTVVV.RG.A.....GGK....AFCAGGDMKFIYEL.G-------
I1MM39_SOYBN/20-357AL--------SFYMVSRLLEIFSE.D...EKDSDIKLVVV.KG.N.....G.R....AFCAGGDVAAVARD.G-------
F6EFK8_AMYSD/12-332SL--------NHDMVRDLAAALAS.W...EHDDSVRAVAI.TG.A.....GER....GLCAGGDIVAIHRD.A-------
Q212Q2_RHOPB/18-345AL--------TLEMARGIDAALDV.F...AADPDVALVLL.EG.A.....GER....GLCAGGDIRTLYNS.A-------
G8MC08_9BURK/24-360AL--------SHDMIALLADRFAT.C...AEDDAILAVVL.RG.S.....GDK....AFCAGGDVRKLYHA.A-------
A0JS02_ARTS2/30-352AL--------TAGMAAAMLGQLTA.W...ADDDGVATVLV.HG.A.....GDR....GLCAGGDIVAIYED.M-------
A8HXV6_AZOC5/51-378AL--------THAMVQAIDPRLRA.W...ARDPGVTRVIL.KA.A.....GER....AFCAGGDVRQIYDL.G-------
HIBC8_ARATH/21-353VI--------SPEVVFKLAEYLEL.W...EKDDQTKLILI.KG.T.....G.R....AFSAGGDLKVFYHG.Q-------
B6Q688_TALMQ/41-385SL--------NGSMCQQIIPRLLE.W...EKSQLANIIMI.SG.R.....GEK....ALCAGGDVAALAIN.N-------
A0C505_PARTE/18-343AV--------HLEMCEDILESTKL.W.....NEHAVVTIL.QG.......NGR....AFSVGGDLKHVFNI.S-------
C1DFA4_AZOVD/17-349TL--------TLPVVCALQRQLEA.W...AADPTILAVVL.RG.A.....GDK....AFCAGGDIRALYDS.F-------
G7Z662_AZOL4/15-341AL--------TLGMIRLFDPQLRA.W...NADPEVKAVVI.RG.A.....GEK....AFCAGGDVVSLYEA.G-------
Q5QW21_IDILO/17-357AL--------SLAMAEKLLPQLKK.W...AEDDKVACVWL.QG.A.....GEK....AFCAGGDIVAMYKA.M-------
C1DNT4_AZOVD/14-346AL--------SLPMVRLLHRQLQA.W...ADDPQILAVVL.RG.A.....GEK....AFCAGGDIRWLYES.Y-------
Q230X4_TETTS/30-358AL--------DLAMIRQIQGRIVP.W...T.QEGIKAVWI.NG.A.....GGK....AFCAGGDIKSLYDA.K-------
B9SXD3_RICCO/47-382AL--------TTPMGVRLTELYQS.W...EKDPLVGFVVL.KG.N.....G.R....AFCAGGDVVKLYQL.I-------
Q5LRB7_RUEPO/12-333AM--------SYDMCMAIDAALRN.W...REDDDVALVII.DA.E.....GDK....AFCAGGDIAELYDT.G-------
D6X3R7_TRICA/42-364AL--------NLSMVNKLYPTLVQ.W.....ESEKSLVII.KG.A.....GGK....AFCAGGDVKSIALA.G-------
A1R246_ARTAT/18-336AL--------NAGMVKTMLSQLTD.W...AADDAVATVLV.RG.A.....GDR....GLCAGGDIVAIYKD.M-------
D3BN96_POLPA/192-532AI--------DISTIDLLEEFVKD.K...IKDDTITSFSIHTS.T.....PGV....IHSAGTDFVTLFEK.R-------
B9SKJ5_RICCO/22-357AL--------SFKMISRLLDLFLA.Y...EEDPNVKFLVL.KG.N.....G.R....AFCAGGDVSAVVRD.I-------
B7G076_PHATC/15-365AL--------SLDMMHFFQDILKE.C...YADDSVGALLV.KS.NTTGMKT.K....AFCAGGDVKRVYRS.C-------
F4F5N6_VERMA/14-334AL--------TAEMVTIIRRTLAM.W...AASDRVRTVLV.SG.A.....GGR....GLCAGGDIRAIHAD.A-------
A9PBA7_POPTR/21-353VI--------SSKVVSLLADFLEK.L...EKDDNTKLILI.KG.A.....G.R....AFSAGGDLRMFYDG.R-------
G6DDP6_DANPL/16-332SL--------NTSMVSKLLPQLSE.W.....ENSKQLVII.KG.A.....GDK....AFCAGGDVKAAIDR.E-------
F8AY96_FRADG/12-334AL--------NHGMLRRIADALTA.W...EHDERIRAVLI.DG.A.....GER....GLCAGGDIRSIYDD.V-------
H6N4E1_GORPV/12-333AL--------DQSMVDDMYDVLLR.W...ADDDDIETVML.TS.G.....TDR....AFCAGGDIRAIRDS.A-------
E0VLB5_PEDHC/53-383TL--------NLCMVCQIRPTLIS.W...SQDK..YLILM.KG.A.....GEK....AFCAGGDVVSVVKD.K-------
Q0A896_ALKEH/22-361AL--------DLGMIQALSRQLEA.W...ARDPAVACVVL.EG.E.....GER....AFCAGGDVRAVAEA.L-------
D8SM52_SELML/13-356AM--------NLDMDVAYKNYLDE.W...AANPAVKAVLV.ES.S.....SSR....AFSAGMDVKWLAAT.L-------
D7AAE9_STAND/32-359AL--------DHAMVRAMRAQLDA.W...IADDSVAHVVL.RS.A.....HER....AFCVGGDVRAMATL.G-------
D7MNH9_ARALL/19-353AL--------SFQMISRLLQLFLA.F...EEDSSVKLVIL.KG.N.....G.R....AFCAGGDVAAVVRD.I-------
E3I3E7_RHOVT/14-335AL--------TWAMALRIEQALDK.W...EHDSGVDVVVV.DA.A.....GEK....AFCAGGDIADLYKK.G-------
D0J4R8_COMT2/40-371AL--------SLGMVRDLLGTLLA.W...QKDDSILGVAI.RG.S.....NKEGVFGAFCAGGDIRFLHAA.G-------
D5QAS0_KOMHA/14-335AL--------DIGMIEAIAACLAR.W...REDREVRTIVI.DS.T.....SSR....AFCAGADLRALITL.L-------
F4NRB7_BATDJ/54-395AL--------NLDMVYAITSQLKT.W...KDSDLCKVIVL.ANVE.....GSR....AFCAGGDVKTLVLK.A-------
G3QQM4_GORGO/20-355AL--------TLNMIRQIYPQLKK.W...EQDPETFLIII.KG.A.....GGK....AFCAGGDIRVINYT.S-------
A1K1H9_AZOSB/18-358AL--------SLEMIDLLAPQLDA.W...AADPDIVGVVL.DG.S.....GDK....AFCAGGDVAALYRA.L-------
Q0IP17_ORYSJ/128-462AL--------SSAMITCFLRCFTA.Y...EEDDGVKLLIV.KG.K.....G.R....AFCAGGDVAAVVRS.I-------
A1TSJ8_ACIAC/16-348AL--------SLGMVRDLMEALLR.W...RSDPAVHAVAI.RG.T.....NKEGAFGAFCAGGDIRFLHQA.G-------
HIBCH_DICDI/33-370AL--------NPNMVKILTPKYLE.M...KTKKDGEGVIVMKG.A.....GEK....AFCAGGDIRAIYDY.K-------
I1BZ13_RHIO9/189-518AL--------NLSMVQMMTPQIKA.W...EKSEMIDVILL.KH.S.....GGK....GFCAGGDVKMVVDL.A-------
A9SUT7_PHYPA/29-361CI--------NLPMLEEIAEAYEQ.W...EEDDSVGFIVL.KG.A.....G.R....VFCAGGDLKTFYGL.G-------
D3HQR9_LEGLN/13-338AL--------TLTMILKMQWQLSL.W...KEDDTVHAVVV.RA.A.....SGN....AFCAGGDIRSLYFS.G-------
G4NGW1_MAGO7/67-414SL--------NLSMIKKITPRLLE.W...EKSDMANVIVM.KG.A.....GDK....AFCAGGDVAALAEA.N-------
A9RJN7_PHYPA/31-365SL--------NENMIDRLLELYMK.W...EKDERVRMVII.AG.A.....G.R....GFCAGGDVAVVYLL.G-------
A9TYA6_PHYPA/60-394AV--------NENMIDRLLELYVK.W...ENDKHVRMVIL.AG.A.....G.R....GFCAGGDVATVYHL.G-------
E1VZ37_ARTAR/22-349AL--------NLDMLNELSRVLRA.W...AQDSSISLVLL.TG.R.....GQR....AFCAGGDIADFHAA.I-------
Q4DMX8_TRYCC/74-400AL--------SLEMAQHMLWLHLK.R..PHPSLPRSAIYILKG.A.....GNK....SFCAGGDVRSIVAH.G-------
Q6LIA0_PHOPR/19-359AL--------TFDMLVQLKDKLMT.W...QDDEHIVSVFL.DG.A.....GEK....AFCAGGDVRSMYHA.M-------
B7Q288_IXOSC/44-375AL--------SLDMIRQIYPTLKK.W...DTDPDMKMVII.KAKK.....DSK....AFCSGGDVKAIAQT.K-------
H3B677_LATCH/47-377AL--------NLPMIRQIYPQLKK.W...EQDAETSLVII.KG.A.....GGK....AFCAGGDIRAVTEA.G-------
A7RHZ5_NEMVE/46-374AL--------NLPMIRKIYPQLKQ.W...DMDPNIGVILI.KG.T.....GDK....AFCAGGDVRAIAEA.G-------
Q8FQY6_COREF/29-353SL--------NQEMVDLVQEALDK.W...IDDDAVHRVLI.YS.T.....TDR....AFCAGGDVRAVREA.V-------
E1VC38_HALED/19-356AL--------SLEMIQLVADKLDA.W...AVDPGVVAVWL.EG.S.....GDK....AFCAGGDVVALYRA.L-------
Q11J99_CHESB/19-339AL--------NHGMIRALSRTLSQ.W...EADSSIRFVVI.MG.......EGR....AFSAGGDIVDVYRA.G-------
B0S642_DANRE/44-374AL--------TLNMIRHIYPQLKK.W...DKNSETDVVII.KG.A.....GEK....AFCAGGDIRAIAEA.G-------
D7LRR5_ARALL/47-381AL--------TTHMGYRLQKLYKN.W...EEDPNIGFVMM.KG.S.....G.R....AFCAGGDIVSLYHL.R-------
F8K1G3_STREN/18-341AL--------DLEMVRLLTAALDR.W...RDDDSVHAVVI.AS.T.....SPK....AFCAGGDIRAVREA.A-------
G2KLT0_MICAA/19-358AL--------TLGMIRGIHAALEA.W...RDDDGIRAIII.RG.A.....GDR....AFCAGGDVKAVYEA.G-------
B6JX18_SCHJY/32-363AI--------NRAITDFIHPRLIK.Y...EKSDMTKLIVF.RG.......VGR....AFSSGGDVKAGAIN.I-------
I1M992_SOYBN/52-386SL--------NASMVARLKRLYDS.W...EENSDIGFVLM.KG.S.....G.R....AFCSGADVVRLYQS.L-------
A8NEJ7_COPC7/45-386AL--------DTPMLELLRPKILE.W...NSSDLCGAIVG.TG.......AGR....AFCAGGDVATVVEN.A-------
Q12AQ1_POLSJ/18-355AL--------SLPMVQALTPALRA.W...AADPGMAGVVL.QA.S.....GDK....AFCAGGDLRELYQS.M-------
Q1QVU3_CHRSD/19-353AL--------SLTMIHALHARLEA.W...AQAPAVHAVWL.QG.A.....GGK....AFCAGGDVVALYHA.M-------
I1JMV6_SOYBN/52-386AL--------NTNMAATLHKLYRS.W...EEDPDIGFVML.KG.S.....G.R....AFAAGGDIVALYHL.I-------
Q4JU31_CORJK/25-358SL--------SVEMIRLIREAVDR.W...ADDDWIRFIVI.KS.S.....SDR....AFCAGGDVRYVRMR.D-------
Q2GA19_NOVAD/13-336AL--------TLDMVHAMTASLLQ.W...RGDASVGVVLIDHA.......EGR....GFCAGGDIAFLRNS.A-------
Q2N893_ERYLH/16-341AL--------TLEMCHAMSAALAD.W...ADDDEVEAIILDHA.......EGR....GFCAGGDIAFLRNS.A-------
Q16U65_AEDAE/33-352AI--------NLDMVRQIYGAMKN.W......QDKSLVIV.KG.A.....GEK....SFCAGGDVRAVVEN..-------
C6XIW5_HIRBI/14-333AL--------NTMMCAQISNALSD.W...KINNEVKLIVIDHA.E.....GTR....GFCAGGDIKPMAES.G-------
C3PF62_CORA7/13-336AL--------NQTMIDEMTAVLQE.W...QDDDRVKLVIL.RG.A.....GER....GLCAGGDVAALYHD.A-------
D8IW53_HERSS/21-370AI--------SLEMVQLLTPQLQH.W...QADPEVAMVVL.QA.Q.....GEK....AFCAGGDLQQLYRS.M-------
C8WWK9_ALIAD/12-344AL--------SLEMIRLLRRHLDE.M...AQDPSVELVVL.YG.E.....GDR....AFCAGGDIRALYDA.K-------
F0XEA1_GROCL/74-428SL--------NGSMIRKIVPRLLE.W...ERSDMANVVVL.KG.A.....GDK....ALCAGGDVAALAAA.N-------
Q0BR39_GRABC/31-348AL--------NGEMVRAIQQTLNL.W...RDDPAVTAIIL.QG.T.....GR.....AFCAGADVRRLREA.V-------
F2T0Y3_TRIRC/73-417SL--------NGSMVRKILPRLQE.W...EKSQLANIVMI.SG.A.....GTK....AFCAGGDVAELAKQ.N-------
A1WLH8_VEREI/23-355AL--------SLAMVRALMRILLA.W...QSDAQVHAVAI.RG.S.....SKDGPFGAFCAGGDIRFLHQA.G-------
A9C200_DELAS/16-348AL--------SLGMVRDLLATLLA.W...QKDEQVLAVAI.RG.M.....GKEGVFGAFCAGGDIRFLHGA.G-------
Q2L131_BORA1/18-371GL--------SLGMVDLLNARLNA.W...AQNPAVALVVL.QG.A.....GGK....AFCAGGDLHGLYAS.M-------
F2R851_STRVP/13-333AL--------THAMVLRIEEALTA.W...RDDPAVEAVVI.SG.A.....GER....GLCAGGDIRAIHED.A-------
D5BR70_PUNMI/19-347AL--------SIEMVTVLHDQLAA.W...DQDDTVSHVIL.KS.S.....APR....AFCAGGDVRLARTL.M-------
E1VS22_ARTAR/12-327AL--------NADMCRTILDALLE.W...KDDPNIAQVAV.MG.A.....GER....GLCAGGDIVAIHRD.I-------
Q28R37_JANSC/11-334AV--------TYQMCLAIEAALDA.W...AGDDAVDLVMI.DA.A.....GER....AFSAGGDIQEMYDT.G-------
C3Z9L9_BRAFL/41-373AL--------NLNMIRQIYPKLKE.W...EDNDDTTMIII.KG.A.....GDK....AFCAGGDIRAVTEA.G-------
B3S7F3_TRIAD/23-347VL--------SLNMINTIYPIMME.W...DKDPNVQVIVM.KG.A.....GEK....AFCAGGDVKSLV....-------
A5V401_SPHWW/17-339AL--------THPICTAMIGALTA.W...ATDDAVDLVMIDHA.......EGR....GFCAGGDIRHIAES.A-------
E5SEM2_TRISP/42-371AL--------NINMAKMMFEKLKK.T...NTDNSTKMVIL.KG.A.....GNK....AFCAGGDIRALALS.I-------
C0HHJ2_MAIZE/66-416AM--------NLEMDVRYKALLDE.W...ETNPSVKCILV.ES.S.....SSR....AFSAGMDIKGVAVE.I-------
B0CSR7_LACBS/50-391AL--------DEQMLTLLRPKIEE.W...SASDLCGTIVG.RG.......SGP....VFCSGGDVASVVQN.A-------
A4VIV7_PSEU5/16-354AL--------SLPMIEALLDQFNR.W...ATDPAVVCVLL.RG.N.....GPK....AFCAGGDVRKLAEA.C-------
D4ZAM5_SHEVD/14-353AI--------NLEMVQSMLAQLMR.W...QDDDAIAMVML.DG.A.....GEK....AFCAGGDVRAIYHA.S-------
A7HX73_PARL1/15-335AL--------TLGMVRAIHPQLAA.W...AEEPNVQCVVI.EA.A.....GEK....AFCAGGDIRALYDW.G-------
F4QC51_DICFS/178-513SL--------SDTTLRLIDEYLKE.V...IINERISCFSLHTS.T.....PGL....IQSAGTDFVAMFEK.R-------
Q7NWA8_CHRVO/15-354AL--------TLDMIRLLDARLTI.W...ERDEGIVAVVL.RG.A.....GER....AFCAGGDVRGLREK.L-------
G0MPK6_CAEBE/44-375AL--------NLNMVREFYPKLQE.W...NSSADVDLVIL.KG.S.....GDK....AFCAGGDVLAVVRS.Y-------
Q55GN0_DICDI/49-392SL--------TMEMLKFLSEKLKE.F...NNDDNCKFVII.NS.S.....TEK....SFCSGGDIKEFSQL.S-------
C7RD63_ANAPD/10-343AL--------NLDMIYEIYDILEK.W...KDDGRIRAVLF.DS.L.....AEK....GFCAGGDLKEVYED.Y-------
Q6CA37_YARLI/41-379AL--------DDPMCRAIFPRLKE.W...LKSDSANVVLF.KG.S.....GNK....AFCAGGDVATLAKQ.N-------
A9V573_MONBE/16-343AL--------TLNMVRLMQDELQR.F...QASSDTDVMVL.VG.A.....GEK....AFCAGGDVVQVAKS.A-------
A0BEK3_PARTE/25-354AL--------NLPMIAELNQILDQ.......ANSASCIIL.SG.E.....GGK....AFCAGGDIKTLYFA.K-------
F2R4L5_STRVP/18-338AL--------THAMVLAVDAALDA.W...EHDPAVTTVVI.EG.A.....GDR....GLCAGGDIRAIHDD.A-------
HIBC5_ARATH/51-385AL--------SAPMVGRLKRLYES.W...EENPAISFVLM.KG.S.....G.K....TFCSGADVLSLYHS.I-------
E4N1A8_KITSK/18-339SL--------TRPMLETVRAALDG.W...ADDDRVSAVLL.SG.A.....GER....GLCAGADIRAVHDD.A-------
E5ASB4_BURRH/34-371AL--------SHSMVRTLAQWVEQ.C...RADDRILTLVL.RG.A.....GDK....GFCAGGDVRALYQL.A-------
H3FRY8_PRIPA/40-371AL--------NLNMVRELYPLMKK.W...DDGGHVSMVIV.KG.A.....GGK....AFCAGGDVLAVTKS.A-------
A9HE55_GLUDA/18-336AL--------DRTLFARIAACLAD.W...REDPSVETVLI.DS.S.....SPR....AFCAGGDLRAIHAT.L-------
F2IWL1_POLGS/13-333AL--------TLAMVRAMAERLDA.W...ARDDSIAHVVV.RG.A.....GGK....AFCAGGDIRRIYEM.G-------
Q7MDJ7_VIBVY/19-358AL--------SEEMLAALKNSLEK.W...HEDEQIICVIL.KG.A.....GEK....AFCAGGDVRAMHHV.M-------
D5UVM7_TSUPD/17-334AL--------TTDMVHAIDAALQA.W...ESDDAVTRVLI.TS.A.....SPK....AYCAGGDIRAIRDQ.V-------
G8SEU3_ACTS5/15-332AL--------TAGMVAIMRRALAG.W...AASDTVRAVLI.TG.A.....GER....GLCAGGDIRAIHAD.A-------
Q0VP05_ALCBS/18-356AL--------SLEMITLLSEKLDA.W...EQRSDIVAIWL.DG.A.....GDK....ALCAGGDIVQMHKS.M-------
B2UAB6_RALPJ/70-398AL--------SLEMIRAMSHALLA.W...QHDPEVHAVIL.RG.E.....GGK....ALCAGGDIRFFYRA.A-------
A1S5D0_SHEAM/18-354AL--------DLDMVRALSAQLKA.W...QADSNIAMVLL.DG.A.....GDK....AFCAGGDVRALYQA.S-------
H8MVZ6_CORCM/13-341AL--------SLEMCHVMHPRLDA.W...AADPSVKAVVI.RG.A.....GGR....AFCAGGDVRAVASS.V-------
D5ATL9_RHOCB/13-333AL--------DHDMAGAIEAALEG.W...RHDPAVEVVII.DA.V.....GER....AFCAGGDIATIYHL.G-------
B9RPB0_RICCO/58-404AM--------NLDMDVKYKSFLDE.W...ESDPRVKCVLV.EG.S.....SPR....AFCAGGDVKAITSK.N-------
B6IMT6_RHOCS/17-352AL--------TLGMIRVLDPQLQA.W...ARDPAVTAVLI.RG.A.....GDR....AFCAGGDVRAVHDD.G-------
H6BSS6_EXODN/72-425SL--------NGSMARKILPRLRE.W...EKSQIANIVMI.SG.A.....GPK....AFCAGGDVAELANQ.N-------
Q1GNL4_SPHAL/17-339AL--------NLAMCQAMIDALLK.W...RADDGIEAVTIEHS.......EGR....GFCAGGDIRMLAES.G-------
E9IZM3_SOLIN/56-380AL--------NLTMVQKIYSTLKQ.W.....EPSKKLVII.EG.A.....GEK....AFCAGGDVKSLVLA.L-------
Q6FM09_CANGA/43-400AL--------NEEMCSSIFNTLTE.Y...SKSDAANLILI.KSNN.....SPR....SLCAGGDVASVAQS.N-------
E1SUP0_FERBD/18-358AL--------SLEMVDALHAQLLS.W...QADDNVVCVWL.QG.A.....GEK....AFCAGGDIRAMHQA.A-------
G4RGU8_PELHB/12-344AL--------SAEMIAAVRYALDE.W...DENEAVRTVLI.EG.E.....GEK....GLCAGGDVRRTREM.A-------
G2P5N8_STRVO/31-352AL--------TPPMVTRIAEALTD.W...ERDPAVQAVVI.GG.A.....GER....GLCAGGDIRMIHRD.V-------
HIBC2_ARATH/15-349AL--------SFHMVSRLLQLFLA.Y...EEDPSVKLVVL.KG.Q.....G.R....AFSAGGDIPPIVRD.I-------
Q4Q4Q6_LEIMA/22-353VM--------SLPMVQDLHRLYIT.....EPHPNEDAVYVVRG.D.....GRR....SFCAGGDLKALTGP.E-------
G7DUF6_MIXOS/94-452SL--------NLDMMNIIKPALRR.W...KDKQECKLVLI.KG.......AGR....AFCAGGDVVAIVQG.A-------
C1DAN4_LARHH/20-362AL--------TLDMIRLLAERLTR.W...QHDPDIALIVL.AG.S.....GDK....AFCAGGDIRALRRQ.L-------
A1U6V2_MARHV/15-353AL--------TEEMVNQAQQALAQ.W...AEDSRICLVVL.QG.A.....GDR....AFCAGGNIRALYPA.L-------
C7NJ16_KYTSD/22-350AL--------THDMCAAMLGQLRE.WDAAEGEQRPRAVVV.SG.E.....GEK....GLCAGGDIKVLREA.A-------
D2VUW6_NAEGR/936-1276RI--------TSEVARDLLHQFKV.M...DTNPIINLITL.SG.I.....GNG....FLSAGYDFRELQNL.M-------
C4WVV0_ACYPI/36-362AL--------NTSMVVKIKPKLKE.Y.....ESLVRMVII.QG.A.....GGK....AFCAGGDVKSITEN.G-------
E9G4T3_DAPPU/56-370AL--------NLNMIRKITPALKQ.W....ENEEKVLIII.HG.T.....GGK....AFCAGGDVRSIIET.R-------
C1EG25_MICSR/14-367VL--------SVAVVQKLLEVYAK.S...ESDPGVKAIVV.QG.......SSEARVPCLCAGGDVKRIYEM.R-------
F4GS44_PUSST/18-360GL--------SLDMCKLLAAQLRQ.W...EDDTQIAMVVL.RG.A.....GDR....AFCAGGDLHGIYKG.M-------
A4F9Q5_SACEN/15-334AL--------TLGMVRTMSETLCR.W...RDAEHIEAVLI.DG.A.....GER....GLCAGGDIRALYDA.A-------
G8RS69_MYCRN/28-352SL--------THPMVNAIAPVLDD.W...ADNDDIHTVLV.DG.A.....GDR....GLCAGGDLVALYHS.A-------
G3IHA0_CRIGR/18-348AL--------SLNMIRQIYPQLKK.W...EQDPETFLIII.KG.A.....GGK....AFCAGGDIKAISEA.K-------
G2QR77_THITE/46-391AL--------NGSMIRKIVPRLLE.W...SKSDMANVIVM.KG.A.....GDK....AFCAGGDVAQLAQW.N-------
B9TBM0_RICCO/16-343SL--------SLDMVRAITRALLD.W...RDDERVAAVLV.RS.S.....SEK....AFCAGGDIRFFYEA.G-------
Q4DMX9_TRYCC/20-346SM--------DLEMVKAMQRAYVH.E...PHAKGDSALFVVKG.A.....GNK....SFCAGGDIVSLKDR.Y-------
D7FIS1_ECTSI/31-370AL--------SLTMVRGMSAAIEEHW...SVDQVPKLLVL.RG.S.....GGK....AFCAGGDVKAVAQS.E-------
E8NCI0_MICTS/19-345AL--------GLDMIRDLAAALDR.W...QDDTDIELILL.DG.A.....GER....GFCAGGDVRALHGL.V-------
Q89N86_BRADU/17-344AV--------TLEMFRDIETALDR.F...ETDAAVAVIVL.EG.A.....GER....GLCAGGDIRTLWES.S-------
E8RLF2_ASTEC/19-339AL--------TTAMCRDMAHTLSQ.W...AADDRVRYVVLDHS........GR....AFCAGGDVRAAARS.G-------
F0M0J8_VIBFN/19-357AL--------SYNMLALLFDQLKQ.W...QDDEQLMCVIL.EG.G.....GEK....AFCAGGDVRTMHNV.M-------
A1U2J0_MARHV/19-355SL--------SMDMIRLLKPQLQR.W...ADDDSVCAVWL.EA.E.....GDK....AFCAGGDIVSLYRS.M-------
Q0RM03_FRAAA/66-391AL--------TPTMVGLLDAALRD.W...ADDPTVAVVVL.DG.A.....GER....GLCAGGDIRAIREA.V-------
H3DE45_TETNG/45-375AL--------NLNMIRLIYPQLKK.W...EDEEDTGLVLI.KS.V.....GGK....AFCAGGDIRAVTEA.G-------
B4RB39_PHEZH/14-336AL--------TTRMCRDITDALLG.W...KDDPAVELVLLDHS.......GER....GFCAGGDIRMLAES.G-------
F0ZI93_DICPU/87-416VL--------NTHLFVNLNKKFQY.F...RDDPKLSLMII.KG.N.....G.R....AYCAGGDIKELSIQ.T-------
G1X6E1_ARTOA/73-419AL--------SASMAGKILPRLLE.W...QKSQMANVVVI.KG.T.....GDR....AFCAGGDVAVLAEQ.N-------
A4G9P0_HERAR/23-358SL--------SLDMIRTMSQALSA.W...RTDENVHAALI.NS.S.....TPK....AFCAGGDIRFFYDV.G-------
A0R2Y4_MYCS2/15-335SL--------TEAMVAEIGKALHA.W...ENDDSVHTVLL.TG.A.....GER....GLCAGGDVVALYHS.A-------
D3B388_POLPA/36-371AL--------SLPMVRKLTPLYQR.L...HQSKDGDAVVVMKG.A.....GGK....AFCAGGDIRSIYDT.N-------
C6THR1_SOYBN/37-369AI--------SPELVSQLATYLEK.W...EKDEKAELVII.KG.A.....G.R....AFCAGGDLRVFYDG.R-------
D8RN96_SELML/20-345CL--------NLSVVSRLAELFEQ.W...ERDESVELIII.KA.......AGK....VFSAGGDLRMFYDH.R-------
F6AA82_PSEF1/16-354AL--------SLPMIDALQDRLRA.W...AEDADIACVLL.RG.N.....GSK....AFCAGGDVVQLAKK.C-------
F8E0K2_CORRG/15-348AL--------DHTMILALHEAFSQ.Y...EADDSVGQYII.RS.T.....SSR....AYCAGGDVRWVREQ.D-------
F2GC52_ALTMD/22-362AL--------DLEMAGIMLDALRQ.W...QARSDIVAVVI.DA.A.....GEK....AFCAGGDIVSMYNS.M-------
A4I8I6_LEIIN/21-350AL--------DYGMIRELHRLYVT.....EPAPPSSLYIL.TG.A.....GTK....AFCAGGDVIGLATN.N-------
A4VKU6_PSEU5/16-348AV--------TLEMVRLLHQQLSA.W...AADPQIHAVVL.RA.N.....GEK....AFCAGGDIRSLYDS.F-------
A4XS22_PSEMY/16-354AL--------TLPMIQALDARLQA.W...AEDPTIACVML.RG.N.....GPK....AFCAGGDVVQLVQQ.C-------
A0A0K0J9E9_BRUMA/37-374AL--------NISMVRKLYPMLKK.C...DSDSSVPFIFV.KG.T.....GGK....AFCAGGDIVAVSRS.A-------
B1MKI3_MYCA9/13-333SL--------TYDMIAAMNAVLAE.W...EADDAVRVVVL.SG.A.....GER....GLCAGGDVVAVHDS.A-------
B1VV62_STRGG/15-334AL--------TRTMVETIAAALDR.W...EHDHGVATVVI.TG.A.....GER....GLCAGGDIRSIHED.A-------
B4FIT7_MAIZE/26-359AL--------SSEMIKGLLWYFTA.F...EKDDGVRLLIM.KG.N......RR....VFCSGGDIAQCARC.L-------
B9IL60_POPTR/51-383AL--------TIPMVARLKRLYES.W...EENHDIGFVLM.KG.S.....G.K....AFCSGSDVVSLCEL.L-------
C1A226_RHOE4/16-335AL--------NHSMVKAMAKALAE.W...KSDDDVKAVVL.TG.A.....GER....GLCAGGDIVSIYHD.A-------
C4R612_PICPG/39-387AL--------STDMCHQIVPRLLE.Y...SKSDSNNLIVL.RS.D.....EPR....AFCSGGDVVQCAKD.N-------
C5AQY8_METEA/35-359AL--------TLPMVEAMHRQLRA.W...AGDARVSRIVV.RG.S.....GGR....AFCAGGDIRQIQAL.G-------
C5CR27_VARPS/20-356AL--------SVDMVRLLTPKLRE.W...AADDGIIGVLL.QA.A.....GEK....AFCAGGDLRQLYQT.L-------
C5GL55_AJEDR/45-388AL--------NGSMARKITPRLKE.W...EKSELANIIII.SG.A.....GSK....AFCAGGDVAALAEQ.C-------
C7JEY4_ACEP3/21-337AV--------DISMASGIKAALQT.W...RDDPSIHTILL.ES.S.....STR....AFCAGGDLRAIHDC.L-------
C8V2I5_EMENI/70-410SL--------NGSMVRKILPRLKE.W...EKSQLANIIMV.AG.A.....GTK....ALCAGGDVAALALQ.N-------
D9Q9E6_CORP2/23-349SL--------NQEMIDRIDQALDA.W...WDDDAVHRVIV.CS.T.....SEK....AFCAGGDVRTSREQ.I-------
F6INA5_9SPHN/14-335AL--------TLDMCRGMSSALAD.W...ADDDNIGAIMI.DH.S.....EGR....GFCSGGDINLLRKS.A-------
F8Q7W3_SERL3/52-393AL--------NEEMLNTLRPQIEE.W...TKSDLCKVIVG.TG.L.....G.R....AFCAGGDVANVLQD.S-------
G8PLL8_PSEUV/25-348AL--------THEMCVAMHRQLER.W...LIDDAVHHVLI.KS.N.....SEK....AFCAGGDIRQVAEN.G-------
M0YPS1_HORVD/57-387AL--------TTTMGARLNKFYES.W...EDSPDIGFVMM.KG.S.....G.R....AFCAGGDVVGLRQL.I-------
M1FH42_9ALTE/19-355SL--------SLEMIRLLTPQLKA.W...AEDERICAVWL.EA.E.....GDK....AFCAGGDIVALYRS.M-------
O53419_MYCTU/16-336SL--------NQTMVDLLATVLMS.W...EHEDAVHAVVL.SG.A.....GER....GLCAGGDVVAVYHS.A-------
Q0K1Z5_CUPNH/27-360AL--------SYPMIVALGAQMEA.W...ARDDAVRAVVL.RG.A.....GPK....AFCAGGDIRALTDS.Y-------
Q0K9D4_CUPNH/13-344AL--------SLDMIRAITQALQT.W...AAAPEVAAVVV.AG.A.....GGK....AFCAGGDIRYFHKA.A-------
Q13M23_BURXL/27-363AL--------SHAMVRELAVLVEH.C...RTDDGIVALVL.KG.A.....GTK....GFCAGGDVREVQRL.A-------
Q1D8V8_MYXXD/13-346AL--------NLGMCRKLHPALDA.W...AADPSIQAVVI.RG.A.....GGR....AFCAGGDVRAVALS.V-------
HIBCH_XENTR/46-375AL--------NLGMIRLIYPQLGL.W...EEDPETYLVII.KG.V.....GGK....AFCAGGDIRAVTDA.G-------
Q2RTB1_RHORT/15-345AL--------TLPKVERMDRALRA.W...ATDKTVGVVTV.EG.S.....GGR....AFCAGGDVRALAEV.G-------
Q2YNA1_BRUA2/20-339AL--------THNMILALDRALQA.W...EDDPEVACVIL.EG.E.....G.R....AFCAGGDVVAAFKA.G-------
Q3J1K7_RHOS4/13-327AL--------TCAMVQEIDAALRG.W...IGDPEVELVVI.DA.E.....GPR....AFCAGGDIAELHGR.G-------
Q3SQN0_NITWN/20-346AV--------TLDMFRGIHKALDE.F...EADPEVGLILI.EG.A.....GER....GLCAGGDIRSLWES.A-------
Q5JMX9_ORYSJ/26-356VI--------SDRVVYLLAQFLES.W...EKDEDAKLVIF.KG.A.....G.R....AFSAGGDLKMFYEG.K-------
Q63MM8_BURPS/27-362AL--------SHDMVRELAAWLER.C...RDDRSIVAVVL.RG.A.....GDK....GFCAGGDVRALYRM.A-------
Q63TV7_BURPS/21-364AL--------STDMIRALHRALDA.W...RDDADVLAVVI.HS.P.....HPR....AFCAGGDVRFFHDA.H-------
Q65IX3_BACLD/15-345SL--------TYDMVRLIGEKLNE.W...ETDQNVSIVVI.KG.A.....GPK....GLCAGGDIKALYEA.R-------
Q6N492_RHOPA/19-345AL--------TLEMARELDRALDT.F...AADPDVALILV.EG.A.....GER....GLCAGGDIVGLYNS.A-------
Q6NI92_CORDI/19-346SL--------THEMVNIIDQALDQ.W...WDDDAVHRVLV.YS.N.....SPK....AFCAGGDVRAAREA.I-------
Q7APV2_MYCLE/16-336SL--------NQQMVDALTAILTS.W...ADDDAVRAVVL.SG.A.....GER....GLCAGGDVVAIYHS.A-------
Q7VYA4_BORPE/19-371GL--------SLEMVELLDARLRA.W...AADAAVAMVIL.QG.A.....GEK....AFCAGGDLHGLYRS.M-------
Q83AM7_COXBU/43-368AL--------TGDMCRRLHEQLLG.W...ESDRTIKAVVI.KG.A.....GDR....AFCAGGDIRTLYMN.G-------
Q87H46_VIBPA/18-356AL--------SYVMIEQLYKQLNE.W...QMDDSIVAVFL.HA.K.....GDK....AFCAGGDIQAIYRA.L-------
Q87II2_VIBPA/19-358AL--------TFDMLLQLHDQLIK.W...QHDPHVVCVVL.SG.A.....GEK....AFCAGGDVRAMYHV.M-------
Q87YT7_PSESM/28-360AI--------DLDMVRTLRQQLDL.W...ADDASVHAVVL.RG.A.....GGK....AFCAGGDIRSLYES.H-------
Q88H70_PSEPK/22-354AL--------TLDMVRSLRQHLDQ.W...ADNPQVRAVVL.RG.E.....GPK....GFCAGGDIRSLYDS.F-------
Q8NRX2_CORGL/14-334SL--------NQEMIDLVQEALTT.W...ADDDQVQQVLI.YS.S.....SER....AFCAGGDVRAVRES.V-------
Q8XS34_RALSO/27-369AL--------SHGMVRQLSALLAQ.C...RDDPRIAAVVL.RG.A.....GEK....GFCAGGDVRALYRL.A-------
Q92TQ6_RHIME/18-338SL--------NRTMIRAIAAALTE.F...ERNPEIAAVLV.TG.E.....GER....GLCAGGDIRMIYES.G-------
Q983C3_RHILO/18-337AV--------THRMVMALGVALRA.W...ERDDGVDVVVV.KA.E.....G.R....AFSAGGDILHIYEA.G-------
Q9A8K1_CAUCR/15-337AL--------TLGMCETMIGALLD.W...QDDPEVYMVLI.DH.T.....GER....GFCAGGDIRMLADS.G-------
Q9I5I5_PSEAE/16-354AL--------SLPMIEALAAKLDA.W...AEDAGIACVLL.RG.N.....GAK....AFCAGGDVRKLVDA.C-------
U5FFA4_POPTR/23-356SL--------TYHMTCQMIKELKA.Y...EVDPKVKIVIL.KG.N.....G.K....AFCAGGDVLASYTC.M-------
U5G8W9_POPTR/30-363CI--------NHHMISEMTKKLKV.Y...EIDPEVKVVVL.KG.N.....G.K....AFCAGGDVVASYIY.M-------
V4KPJ6_9ACTN/14-339AL--------NHAMVERIAQALDA.W...EHDPAVTTVVV.DG.A.....GER....GLCAGGDVRAIRED.A-------
V9XKW7_9NOCA/15-343AL--------DRSMIRDIRSSLLA.W...RDDPAVTAVLV.TS.T.....SDR....AFCAGGDVKPVREL.A-------
V9XNE6_9NOCA/16-336AL--------NHAMVLEMSKALSA.W...ENDDSVRAVLV.RG.A.....GER....GLCAGGDIVSIYHD.A-------
W4W6S1_ATTCE/168-489SI--------NLSMIQKIDSILKQ.W...ESSK..KLVII.EG.I.....GEK....AFCVGGDVKALVLS.L-------
W5JCR8_ANODA/20-341AI--------NLDMVRIIYGAMKS.W...ETSK..SLVIV.KS.V.....GEK....AFCAGGDVRAITET.S-------
W5XRW0_9CORY/14-331AL--------DLDMIRAMTKTLKA.W...ESDDSVALVIV.RG.A.....GDR....AFCAGGDIAALYAD.A-------

PF03255

D2UEG3_XANAP/5-148EA--------K...IQE.LRSA....---..STG.........TAVN........VDTEV.EALQDKLRARTA-------
ACCA_METCA/5-148EA--------K...IEE.LRHV....---..GFD.........NEIN........ISEEI.SKLEEKSRKLTE-------
E3I8F4_RHOVT/21-165ES--------K...IAE.LSALG...---..EGE.........SGVS........INDEL.AKLREKAQTALQ-------
D8PGA3_9BACT/4-146EE--------K...IEK.LAS.....---..AES.........PKSG........TQDEI.RKLRTKLAQVEH-------
R7MD99_9CLOT/4-147QE--------K...IEE.LKKM....---..SLE.........SGMD........LNKDI.ETLEQEAEDFKK-------
F8EZE8_TRECH/5-136TK--------K...IEE.LKKL....---..AEA.........SGID........VSDEL.ALLESKVKAASK-------
W0DRR8_9GAMM/5-148EA--------K...IDE.LRHL....---..EGN.........QDFD........LIQEI.KSLEAKSQALTE-------
A8LLX0_DINSH/4-147EG--------K...AEE.LRAVA...---..RKS.........GKMD........IEKEV.SALDRKAAQLLG-------
ACCA_SYNWW/6-148RE--------K...LEE.LNNL....---..SSN.........MEFD........LSQEI.ESLEEKIENNRE-------
E0TDQ6_PARBH/4-147EG--------K...IDD.LRAL....---..AGD.........QKVD........VADEI.SRLEGKAEKLLG-------
R7GKD0_9CLOT/3-138ES--------K...LIS.........---...............LDP........TSNEF.KDVSLSLHKLKE-------
G2KND5_MICAA/4-146EA--------K...IAE.LRNT....---..SSS.........TSVN........VAEEI.KRMQDKSARLLQ-------
Q2S032_SALRD/7-156ED--------K...LTE.MREL....---..NAE.........TQDD........LSNEI.EALEERVEQLRT-------
Q6AM83_DESPS/30-172KA--------G...CESIKNSI....---..YDF.........TAEE........TASEI.TKLDESISFLEE-------
Q311Q7_DESAG/25-171ES--------K...LNELMLRE....---..KHL.........SASE........QQAAA.ATVDDLFDFVER-------
S6A148_9SPIO/4-140EQ--------KEL.LNE.LQDI....---..ADK.........YGLD........ISGEL.KQINEKFQNCSS-------
A0KHH9_AERHH/16-160QA--------Q...IDE.LRHV....---..SEGN........HAVD........LKEEI.RRLEKKNEELTK-------
ACCA_PHOLL/5-151EA--------K...IDS.LTAV....---..SRQGEK......LDIN........LDEEV.QRLREKSLELTR-------
ACCA_FLAPJ/3-147LE--------Q...LDK.CQII....---..GTE.........SNVD........VTETC.KQISQKLEDTKK-------
G2TPG4_BACCO/5-147KR--------K...IAE.LKEF....---..TKQ.........SDVD........LSSEI.EKLEARLSRLEE-------
D5EJ62_CORAD/7-150QK--------Q...LDT.LQTV....---..SQE.........SKVD........VSKEI.SAIEKKIAATKA-------
B8D1K4_HALOH/6-149KD--------K...IEE.LQSF....---..MDE.........KGID........LSEEI.NRLKTRAKNLQR-------
ACCA_ROSDO/4-148EG--------K...AEE.LRALA...---..RAN.........EEMD........VTDEA.SALDAKARKMLE-------
X2GZP6_9BACI/5-147RE--------K...IDE.LKTI....---..AAD.........ADVD........MTGEI.EKLETRLTQLEQ-------
ACCA_RHIME/4-148EG--------K...ILE.LKKLA...---..SED.........ESVN........TSDEI.ARLEGRVRDAMV-------
D7BGY4_MEISD/3-145QA--------K...IAE.LEAA....---..AKQ.........SGVD........LEAEL.SVLRERLHRLEQ-------
ACCA_MAGSA/3-146EG--------K...IEE.LRHL....---..SDG.........GDVN........IADEV.SKLQAKVDKLLR-------
I0AHK2_IGNAJ/5-146EQ--------K...LEE.MRKF....---....S.........DRLD........IEKDM.VRLEEKVRQLKE-------
G4REG5_PELHB/4-148EG--------K...IAE.LKNLA...---..QTD.........EAVS........IGDEV.SRLQQRADDALR-------
ACCA_CHLTE/6-163EE--------K...LNE.MRVY....---..LKS.........GEVDSMSEGRAGLKREI.ESLEAKVESLRK-------
ACCA_AGRFC/4-148EG--------K...IIE.LKKLA...---..DED.........ESID........TSEEI.NRLESRVNDAMQ-------
ACCA_ALKOO/4-147EG--------K...IIE.LINF....---..ADK.........NKVD........LTYEI.EILSQKLEQMQK-------
ACCA_MARMS/5-148EQ--------K...IEE.LRLV....---..GND.........NELN........ISDEI.SRLEDKKIALTK-------
K6ZTQ8_9ALTE/5-150EA--------K...IEE.LRLV....---..NQG.GE......FDLN........IEEEI.TKLREKSAELSR-------
C0QT26_PERMH/2-143SD--------K...IKI.LRQE....---..LKK.........GNRS........VLKEL.VESRKKFKKLAR-------
Q2G730_NOVAD/6-148EA--------R...IAE.LRET....---..AQN.........GDID........IASEI.RRLENKSAELLA-------
V5SAJ3_9RHIZ/15-158ES--------K...VTE.LKTL....---..ESG.........EGVS........ISEEI.KKLEQKAKAALV-------
R7C0E0_9BURK/6-149DA--------Q...IEK.LEND....---..AME.........NGTE........HQSEI.ARLEREMTQKTA-------
C6XFA8_LIBAP/4-148EA--------K...IHE.LKKLS...---..RED.........INED........FSEEI.RELEAMVCKTLS-------
ACCA_SYNE7/11-154EE--------R...ITQ.IRTL....---..AAD.........NQVD........VSGQI.QQLEARAIQLRR-------
C1CYF8_DEIDV/5-142EA--------R...VHD.LEDT....---..ARR.........TGQN........LDAAL.NPLRSEVQRLRE-------
H6L155_SAPGL/3-146HN--------K...MEA.LRER....---..QDL.........TEEE........IEEQV.GKLEKLQSSLRR-------
R6L4F3_9FIRM/289-430QS--------NSDIMKKYLEYL....---..DNI.....................YFKKI.DREEEKKAEADN-------
D1B429_SULD5/5-141DE--------D...IST.........---...AK.........IKGD.........SHAV.EILEKNLEKEIS-------
D3UH38_HELM1/4-141QD--------E...IEM.........---...AI.........IRGD.........HAAK.EILEIDLEKEVR-------
B9L7W0_NAUPA/3-140KE--------Q...IDV.........---...AK.........IKGD.........SHAA.STLAKELEKEIE-------
ACCA_HELMI/5-146ET--------K...IDE.LRTF....---..SQE.........KDLD........FSSEI.ATLEQKAEELRK-------
D3SP93_THEAH/2-144AQ--------K...ILQ.LKKL....---..LQL.........GERH........RESEL.RRLQREFREKAR-------
R7AXN0_9FIRM/3-137KI--------QQMQIDE.........---..........................KDLDMWNDYQRQIETIQK-------
C5CPW8_VARPS/6-149ET--------K...IEE.LRYV....---..QTE.........SAVD........ISEEI.DQLGKKSQQLTK-------
W0E5D8_MARPU/5-148EA--------K...IEE.LRLV....---..GHD.........NELN........IQEEI.ERLQTKCVALTE-------
ACCA_ALCBS/5-148EA--------K...IEE.LRLV....---..GSG.........SDIN........ISEEV.AKLQEKSITLTE-------
D9SFY0_GALCS/5-149ED--------K...IEQ.LRDV....---..HDD..T......AALD........ITDEI.DQLSKKSEALTR-------
I1YEX9_METFJ/5-148EA--------K...IDE.LRYM....---..SND.........TDLN........ITDEI.QKLKEKSESLTK-------
K4LHZ1_THEPS/6-149KK--------K...LNE.FKEL....---..SER.........IDMD........LSAEI.AALERKLALAKE-------
E4TZ34_SULKY/5-141QE--------E...IIA.........---...AE.........VRYD.........HHAV.EILKQDLDKEVQ-------
D0LXB2_HALO1/14-155ER--------K...IEE.LRGM....---..SS..........EQVD........MSAEI.RKLEQKARKLQN-------
C6WW95_METML/5-149EA--------K...IES.LRSS....---..HDD..H......DNLD........ISKEL.AALEKKSKKLSE-------
C7M555_CAPOD/3-147EE--------Q...MEK.CQVI....---..GNE.........SDVD........MTDAC.KKIEKKLNQVKK-------
ACCA_FRATT/3-144ED--------K...ITS.LSHV....---..FEDEK...................TEVEI.KKLSKKRLELME-------
H8KSG2_SOLCM/5-147ME--------E...LEK.VKQA....---..QEK.........TKVD........FSATI.REIEAKIDQTQK-------
D1AII8_SEBTE/3-144ES--------K...IEE.LKKF....---..SKE.........QKID........FSKQI.EELEEVLKEKIK-------
ACCA_CUPNH/5-148EA--------K...IEE.LRFV....---..QDD.........SAVD........ISEEI.SRLAGKSQQLTK-------
ACCA_ERYLH/4-146EA--------R...IAE.LRSA....---..AEG.........DEVD........ISNEL.KRLERKSAALLT-------
D2R421_PIRSD/12-153EA--------RRRALEQ.LTTR....---.......................TPEEEEEL.RQVRRAWADTTA-------
D9QKB7_BRESC/5-147EA--------K...IEE.LGLL....---..AAT.........SGS.........FETEI.DGLKRKADQLRK-------
R5DZV5_9BURK/6-150EE--------K...IQE.LRDM....---..SSG..S......EGLD........LTSDI.NGLEKKKAKLLK-------
Q0C318_HYPNA/4-148DA--------K...IAE.LEALA...---..ARK.........DGPL........ISDEL.AKLKTKSVKQLK-------
I0IBV1_PHYMF/56-206ER--------Q...IEE.LEAQ....---..ADP.........DRSAVGIDPTLEVGDEI.AGLRATHTAMLR-------
C6XPW8_HIRBI/7-150EK--------K...IAE.LEAA....---..AAE.........GGAS........IEEEV.QKLREKSDKQLR-------
ACCA_CHLPD/6-163EA--------K...LEE.MRVY....---..LRN.........SSRDQDSSDQDVLNREI.EALEVKVETLRR-------
R6Z0L2_9CLOT/259-400VE--------RKD.MKETL.......---...........................YKII.NCTEKKRSQVCN-------
D4JZM5_9FIRM/2-150DA--------Q...IAA.LRGG....---..AQDEESQMA...AITA........HASEL.AELAVEEDEILR-------
K9P1M5_CYAGP/6-149EE--------Q...IEQ.IRQL....---..ARD.........SEVD........VSQQL.LQLETLATRRRE-------
D4G8D7_RIEPU/6-152EK--------K...IDM.LRSSD...---..FSNKY.......RKSE........RNLKI.KKLEERVIRLTK-------
E8SIV5_STAPH/2-144QT--------K...IES.LKET....---..QAK.........NDVD........LSDEI.EILEAALQTEKE-------
U5T6J3_9GAMM/8-151EA--------K...IEE.LHYV....---..NDD.........AEIN........ISDEL.TRLRAKSRQLTE-------
W0JJL3_DESAE/4-146EE--------E...IEN.LRQM....---..AQN.........SSID........VHEEI.EALERKKNEIIK-------
F0P1A9_WEEVC/3-147ME--------Q...LKS.CQIV....---..GEE.........SGVN........IKQAC.VEIEIAIENKKK-------
F8KU37_HELBC/4-141QD--------E...IEM.........---...AT.........IRGD.........MDAK.EILEKRLAKETD-------
G4QI06_GLANF/5-150EA--------K...IEE.LRIV....---..NQG.GE......FDVS........IEEAI.GKLREKCSEQTK-------
L0EG96_THECK/6-148RN--------K...IDE.LRKF....---..AEE.........RGFD........FSDEI.ARLEAQYRQLEN-------
ACCA_IDILO/5-150EA--------Q...IEE.LKSV....---..GNR.GQ......LDLN........LEEEV.QRLTTKSQELTE-------
A0LCL9_MAGMM/15-158MA--------K...VDE.LRHL....---..SSN.........SDIN........IEEQI.QQLEQKARTLTV-------
W0E6N2_9FIRM/5-147EQ--------K...IAE.LQAF....---..SRE.........KEID........LTQEI.FKLQHKLIRQRK-------
E6U0M3_BACCJ/6-148KT--------K...IAE.LKEF....---..TAE.........KGID........LSGEI.EKLEGRLEQLEK-------
ACCA_CAMHC/4-141DD--------D...ISS.........---...AK.........IRGD.........DSAV.EILKKNLEKEIN-------
ACCA_HELPY/4-141QN--------E...IEL.........---...AL.........IRGD.........EDAK.EILEKRLDKEVK-------
F8E5R1_FLESM/6-148EK--------K...IDE.LKNM....---..SSL.........SDQD........MKHEL.NSLEKKLEKVKS-------
ACCA_LEGPH/5-148NQ--------K...IEA.LRMV....---..GSD.........NEVN........LSEEI.ARLEAKCSELTE-------
ACCA_RHOBA/6-147EE--------Q...IAS.LERN....---....................TDRSEEIDSAI.RSLRLARVAKLK-------
I0JPN9_HALH3/4-147RE--------K...IAE.LRRM....---..TEN.........SEMD........LSEEI.ITLEKRLEKLEV-------
R6UTY3_9FIRM/3-138EA--------E...LAK.LDAM....---...........................DPHA.DELRLQIDHLRE-------
R5QI57_9FIRM/286-429QD--------K...INK.LACD....---..NSDEGRREQ...............LQSGKAGADQKKEPSCNA-------
ACCA_RUBXD/2-142EE--------R...IAE.LHRL....---..AGESEG..................LQAEI.SRLEEALEAARR-------
R5NX12_9CLOT/2-140DK--------E...IEEIMASD....---..LVD......................EAKV.YVLKRERHDLIH-------
D7CNC0_SYNLT/7-149KA--------K...LEE.LKDI....---..AEQ.........KNID........LAEEI.SSLESKVARLKE-------
Q2JI82_SYNJB/9-151EQ--------R...IQE.IRAL....---..AEE.........NDID........ASEQI.RQLEAKAEELRR-------
A8J646_CHLRE/72-215DK--------R...IKE.VRKV....---..AEE.........NGVD........VSASI.AELEGRAKQLRK-------
I2EZ83_EMTOG/4-147ES--------K...LED.MKRL....---..ADE.........NSVD........VSGAV.RTLNDNIEQLKK-------
ACCA_CHLCH/6-163EA--------K...LHE.MREC....---..LRN.........TTRDQSPADADLLYGDI.EALERKVELLRR-------
Q1MR33_LAWIP/27-171QG--------R...LATFTNRT....---..NGE.........TQQD........PSAEI.GTLEELFTFMEH-------
ACCA_ZYMMO/4-146QT--------R...IAE.LRK.....---..ATS.........DEMD........LDREI.SDLEVKVQKLLR-------
ACCA_PARUW/3-145IK--------T...IEH.LKKQ....---..SQD.........NPIF.........DVEI.QKLEQKLDSLKQ-------
B1I3G8_DESAP/4-147ET--------K...IEE.LKQF....---..SAE.........KGLD........LKHEI.EVLAERAATLKK-------
ACCA_XYLFA/5-148EA--------K...IQE.LHTA....---..SMG.........PSIN........VDTEV.RALENKLRLRTA-------
ACCA_BRASO/8-150DS--------K...VDE.LRAMA...---..ASG.........T..D........IGEEV.SRIEEKAGQALA-------
ACCA_ACAM1/10-153ED--------R...IEQ.IRSL....---..SEQ.........NGVD........VTDQI.AQLEGRAEQLRQ-------
D3PKT0_MEIRD/3-145EA--------K...IAE.LEGF....---..ATS.........SGVD........LSGEL.QVLRERLAQLKS-------
B1ZYS7_OPITP/7-150AR--------E...FDA.LHQK....---..SLE.........QKVN........LSAEL.AAIEKRIGDAQR-------
K9ZX35_DEIPD/3-142ER--------Q...IVD.LERL....---..ARE.........TGEN........FEAEL.QPLRDKLGRLRS-------
G8PGM3_PSEUV/4-148EG--------K...VQE.LKILA...---..EGG.........EAVD........VEDEI.ARLQEKADQALS-------
D9QS74_ACEAZ/6-148ED--------K...IKE.LKQF....---..MEE.........KDID........LTDEI.ETLKHRSAQLKE-------
D3DFX7_HYDTT/3-145YQ--------K...IDQ.LRRL....---..YQL.........GEKD........KEAEL.RKLQREFRKNAK-------
ACCA_CHLL7/6-163EA--------K...LNE.MREC....---..LRS.........SSREQAPVESDALSKEI.ETLEKKVDALRR-------
ACCA_SORC5/5-147IE--------K...VRE.LRAL....---..............AAAD......PRFEPEL.AQLEDNTGRLAR-------
W0J949_9BACT/7-150SA--------Q...LEQ.LRQQ....---..SLE.........NNLD........LSAEI.AGIEKKITATQR-------
ACCA_GEMAT/6-149EK--------Q...IEE.LKRL....---..AAD.........RSLD........VAEEL.APLQKKLGDLRI-------
Q11UX8_CYTH3/2-145ET--------N...LAE.MKQV....---..ASE.........SEVD........VSSAV.KALETKIKSLKK-------
ACCA_XANP2/4-148EA--------K...VEE.LRALA...---..SAG.........DGVT........ITDEV.QRLETKAREALL-------
C8X286_DESRD/27-171ES--------K...LSDFKAKE....---..HQL.........DVHQ........QVRQL.TSLEDLFSFLEK-------
ACCA_WOLSU/4-141QD--------E...IES.........---...SI.........VKGD.........SHAK.EILERELKKEVE-------
D5XA35_THEPJ/4-147EA--------K...IEE.LKNF....---..SNE.........KGID........LSDEI.RTLENKAQALKQ-------
ACCA_HELHP/4-141QD--------D...IES.........---...AI.........ISGD.........NDAI.SILEKELEKEVS-------
ACCA_PELUB/4-149EI--------E...IDK.LKDP....---..YNQDGL......SEVD.........TKKI.SESQKEIDNKLQ-------
ACCA_COXBU/5-148QA--------K...IDE.LRRV....---..GTS.........QEIN........LTEEV.NKLEEKNAQLTR-------
L0K556_HALHC/4-147EE--------K...INE.LNSF....---..MQD.........KDID........LTDEV.KRLEKRANNLRE-------
A7HCR7_ANADF/7-150ES--------K...IAE.LKEL....---..SGG.........ARVD........FSDEI.QKLEKKAKRLQA-------
D0KZU8_HALNC/5-148DA--------K...IRE.LRLM....---..DNE.........AGLN........INEEI.ARLEAKSMELTR-------
E4U646_OCEP5/2-145ES--------R...IRE.LREY....---..AQE.........KGVD........LSDEI.ALLEQKLERLQK-------
C5AV00_METEA/7-151EA--------K...LEE.LKALG...---..QRD.........GAVS........ISEEV.GRLEGKAAQALA-------
F3YX99_DESAF/28-171ES--------K...LGEFLAKE....---..KDL.........TIPE........QVRQV.QQLEDIFSFLEN-------
Q729X2_DESVH/28-170AT--------R...LAEFSQRD....---..TG..........AQGE........NGPAL.ATLEDLFTFVER-------
F2I397_PELSM/3-148DS--------N...IEN.LKNP....---..FENTGL......SSLN.........NEEI.QKAQSEIDKKTS-------
ACCA_STACT/2-144KN--------K...IDA.LKES....---..QEK.........NDVD........LQEEI.DMLEASLERETE-------
ACCA_BLOFL/5-151ES--------K...IHS.LMKL....---..IHHDKK......LAIN........IYEKI.NHLKQKSVELTQ-------
A5D053_PELTS/4-147EL--------K...ISE.LRNF....---..SRE.........KGID........LANEI.SILENRVREVRE-------
F2IGK6_FLUTR/4-148ED--------Q...IEQ.TREI....---..GNS.........TGVD........MSDKI.GVLEENLVKKTK-------
ACCA_LARHH/5-148EN--------K...IEE.LRYV....---..QDD.........SVLD........ISEEI.ARLQKKSQDLTK-------
ACCA_PARL1/4-148EG--------K...VQE.LKLLA...---..QED.........PSVS........IGDEV.SKLEQKAAQLLQ-------
D7CVI6_TRURR/3-145AA--------R...IQD.MRAY....---..ARE.........QEID........LSEEI.GLLEARLERLQA-------
K9RT78_SYNP3/9-152EA--------Q...IQQ.VRDK....---..SSE.........LGVD........VAEQV.RQLEQRAAQVRR-------
ACCA_UNCTG/5-146NN--------R...IDD.LKES....---..SRV.........GNID........LLAQI.EDLEKTRDELRQ-------
R5QLG5_9FIRM/3-135QK--------E...LLD.........---..........................CNQERKKEIESQIKKQE.-------
D4LVS3_9FIRM/273-410HE--------VSGSSDD.........---..........................LIDEM.HSAKSSSESNFE-------
A9RT89_PHYPA/97-240EN--------K...IDE.VREL....---..ANK.........TGMD........FSEQI.AELEERYDQVRR-------
ACCA_PELCD/4-146EQ--------K...LSE.LRDY....---..ST..........DEVD........FSGEI.QRLEKKAEKLRR-------
E4TL55_MARTH/2-145EN--------K...LAG.MKTL....---..AEE.........SDVD........ISDAI.KKLEDKIVSLKK-------
ACCA_PELPB/6-163EA--------K...LDE.MRQC....---..LRN.........STREQSPSETEMLNHDI.ETLELKVDALRR-------
E1VNM7_9GAMM/16-159ES--------K...IEE.LQSV....---..VSD.........ANLN........MSDEI.ERLRLRSVSLTE-------
K4AZH5_SOLLC/103-246EK--------Q...LIE.VRRM....---..AED.........TGLD........FTDQI.YALEAKYQQALR-------
C6D8B9_PAESJ/6-149RE--------K...IAT.LKTL....---..AES.........NGMD........FSEEI.ARLEEKCKQMEE-------
K0J396_AMPXN/4-147KD--------K...IAE.LKQM....---..AEE.........SELD........LTEDI.SRLEMRLVNLEQ-------
E8U5S6_DEIML/5-142EA--------R...IRD.LEGL....---..ARD.........TGQD........FAAEI.QALRDKLNRART-------
ACCA_CAUCR/5-149ES--------K...IEE.LSRL....---..SET.........AGPGA.......FDTEI.QALRDRAQELRK-------
F2LWN6_HIPMA/3-146EE--------Q...IEN.LKKM....---..ALE.........RGLD........VKSEI.EQLEKKKNEILK-------
G2LDZ5_CHLTF/6-153ES--------Q...LAQ.LSAA....---..PHT.........PAQD..........AEI.LRLQARVRELQA-------
E4TI62_CALNY/6-148EK--------K...LEE.LKSI....---..SEV.........VDKD........IEDKI.AKLEERIQKVKA-------
ACCA_PSEAE/5-148QA--------K...IEE.LRLV....---..GND.........NALN........ISDEI.SRLQDKSKALTE-------
D5SMU5_PLAL2/7-147ED--------Q...LSQ.LESQ....---....................SNPTPAILESI.RTVRLELARMKR-------
H8KZ76_FRAAD/5-148DA--------K...IEE.LRST....---..SDG.........QAFN........IDDEV.ARLKEKLKLKTA-------
L0G434_ECHVK/2-145EL--------K...LQE.MKEL....---..AKG.........KQID........LSADI.ESLEEKIQTLKK-------
C7JEV8_ACEP3/4-146EN--------K...IDE.LRQM....---..TDP.........NGVN........IEEET.ARLSEKAEKHLR-------
U3U7V8_9ENTR/5-151EE--------K...IDS.LRSI....---..SRQDKQ......YDIN........LDEEV.QRLCEKRIELTR-------
I4AJK8_FLELS/2-145EE--------K...LQE.TKGL....---..AAQ.........NNMD........VSEAV.KLLEERILHLKK-------
U6B8Z9_9RHIZ/4-148EA--------K...IHE.LKKIS...---..NGE.........EDCD........NSKEI.TKLENMVHETLS-------
I3THF2_TISMK/4-147EG--------K...IKE.LRHL....---..SGE.........TGVN........IVEEV.GKLETKVDRLLR-------
C7PMD3_CHIPD/3-146YD--------Q...LAK.LKEN....---..GAK.........SGVD........VTATV.KEYEQKIADTRL-------
D5BMW6_PUNMI/4-146EG--------K...VEE.LRHM....---..TTD.........GNIN........IADEI.GKLQTRIERELK-------
C6VWQ9_DYAFD/4-147ER--------K...LEE.MKTL....---..ANE.........NNVD........FSDAI.ALLEGNITNLRK-------
A0A068NX81_9BACT/5-153EE--------G...IAK.LREL....---..............ARKENDSAKREALEVKI.KEFEDRRDRYVD-------
K7S984_GLUOY/13-161ET--------K...IDE.LRQMGSQE---KDSGT.........SGIN........IDDEV.ARLSDKADKQLR-------
F2JNG5_CELLD/8-142KT--------....LEQ.........---..TPD.....................IIDEM.ARLEKLATKLRK-------
L0DWX9_THIND/5-148EA--------R...IQD.LRFV....---..GDD.........AEVN........LQEEI.QRLEEKCLSLTE-------
K9Q7M9_9NOSO/10-153SN--------R...IEQ.IRQL....---..AEE.........NGVD........VSGEI.RKLEARATKLRE-------
ACCA_TRIEI/9-152EN--------R...INQ.IREL....---..AKDC........SSVD........VSEQI.YQLEAKATQLRQ-------
L0EVZ1_LIBCB/4-148EG--------R...IHE.LKKLV...---..MED.........KSAN........VSEEL.EKLEVKVHETLR-------
D4M3A9_9FIRM/275-407HT--------VTDEKKE.........---................................DCPEKKKENRKN-------
ACCA_NITSB/4-141EN--------E...LEA.........---...AK.........ARGD.........TAAI.EIFEKDLQKEAS-------
R5QCK4_9BURK/6-152EK--------K...IDD.LREL....---..DESEAG......HAVS........VASEI.ASLQAKEDELVK-------
R6P4G2_9CLOT/2-145EE--------K...IEE.LKKM....---..SEE.........SGMD........LSKEI.EVFEQQSHEYKK-------
ACCA_CARHZ/6-148EN--------K...ISD.LKKF....---..AEE.........KNID........VSREL.ELLSAKAQQLAK-------
ACCA_CELJU/5-148EG--------K...IEE.LQLV....---..GNS.........SDVN........LADEV.AKLREKSTKLTE-------
G2ISU6_9SPHN/4-147QA--------R...IDE.LRET....---..ADS.........GAID........IDAEI.EKLQQRSTTMLA-------
D4KAA0_9FIRM/2-148DE--------K...IAA.LRGD....---..PADE..NMT...DITN........HAAEL.AELSAQEDALLS-------
F6IN39_9SPHN/4-146EA--------R...IHE.LRST....---..ADT.........GGLD........LVNEI.QKLETKSEQLLA-------
D4Z3Q1_SPHJU/4-147EA--------R...IIE.LRAT....---..ANA.........GDID........ISGEI.DKLEQRASKMLV-------
W0EXF5_9SPHI/9-152IE--------E...IEL.TKER....---..SEK.........TKID........LSDQV.QQLEQKVTETRK-------
I3ZX40_ORNRL/3-147QE--------Q...YVK.CALV....---..GEQ.........SGVD........VKESC.RQIQDKINAKKK-------
F0RKQ5_DEIPM/7-153EH--------K...VRD.LEQT....---..ARK.........TGQN........LEAAL.APLREEVAKLRR-------
E0UBA6_CYAP2/10-153QA--------R...INQ.IRQL....---..AEE.........NDVD........VSEQI.SQLQTRAEQLRK-------
R5YAR4_9PROT/8-151EE--------K...IEH.LKLL....---..AKD.........EDMD........ITREI.RRLERKLSQHVN-------
ACCA_ACICJ/4-146EA--------K...IEE.LRRM....---..TDP.........GELN........IAEEV.TLLSDKAERQLR-------
K9SWQ9_9SYNE/7-150EN--------R...IDQ.IRNL....---..AKE.........NGVD........VSDQI.QQLEKRADQLRR-------
ACCA_THET8/3-145ER--------R...IAE.LKET....---..AKA.........TGVD........LEAEI.RLLEERLARLRK-------
B8EN13_METSB/21-164EA--------K...VQE.LRSLA...---..ADG.........EGVQ........ISDEL.FRLESKSEKALA-------
Q39833_SOYBN/90-233QK--------K...IID.VQKM....---..ANE.........TGLD........FSDQI.LSLETKYQQALK-------
E8RUB5_ASTEC/4-147EA--------K...IEE.LSAL....---..SSS.........GGAN........LDIEI.RALRERTQVLIR-------
ACCA_TERTT/5-148EG--------K...IQE.LQLV....---..GTD.........NDLN........ISEEI.DRLKEKSTKLTE-------
C6Y0P1_PEDHD/8-150EQ--------Q...IEK.VKQV....---..ADK.........TKVD........MSATL.TELEEKLDKTQQ-------
ACCA_CHLTR/3-146EK--------T...IAE.FKEK....---..NKE.........NSLL........SSSEI.QKLDKRLDRLKE-------
ACCA_THICR/5-147EA--------K...IDE.LRHL....---..DG..........QDMD........LIKEV.SALEQKSKNLTQ-------
ACCA_ALKEH/5-148EA--------K...IEE.LRHV....---..GHD.........AEVN........ISEEI.QRLQEKSHVLTE-------
ACCA_OCEIH/4-147KE--------K...IVE.LKSF....---..TEN.........SEID........LTKEI.ETLEERLARLEE-------
ACCA_WIGBR/5-149ES--------K...INS.LVEL....---..SQR..D......KTLN........INKEI.NCLRKKSEDLTK-------
Q1IN03_KORVE/6-146EK--------Q...IAE.LEKA....---..AGD.........NQA.........ARKQL.QEMHERVSGLRR-------
F4L135_HALH1/3-146YE--------Q...LEK.LKEI....---..GAS.........GEID........VSESI.KALETKISEKRK-------
E1SU30_FERBD/5-150QA--------K...IDE.LKNV....---..SQN.GD......LDLD........LQKEI.SQLEEKREGLTR-------
E1X4H2_HALMS/9-151EN--------Q...IKE.LQEA....---..SLR.........PEID........ISKEI.KALQKKVSTLIK-------
F6DPP9_DESRL/2-145EA--------K...INE.LKHF....---..TNE.........KGID........FTDEI.VLLEKKAREMKE-------
K9SI36_9CYAN/7-154EN--------R...IDQ.VRNL....---..AKE.........NGIEADDK....IVEQI.TQLELRADSLRQ-------
D3PDG9_DEFDS/6-148EK--------K...IEE.LKKV....---..SEL.........SDQS........LSKEI.ESLEKKLEQVKA-------
R6SFM1_9FIRM/263-401QQ--------MRQTLEKILKMH....---..QTGN..........................EKVEKATKEFQN-------
D8TBU9_SELML/23-165EA--------R...IEE.VRDL....---..ANK.........TGVD........FSGQI.EELEQKYHQVRQ-------
B4ETY2_PROMH/5-152DE--------K...IDA.LLAF....---..KQSQDET.....TAVD........IDEEI.AKLRQKSLSLTR-------
ACCA_THEYD/4-147EI--------K...IEE.LKKL....---..SDG.........SDID........LTQEI.KRLNKKLKELKT-------
R5YCC5_9FIRM/275-410HI--------T...KTE.........---..........................QNTEFVKNKEQMQTAEEK-------
ACCA_RHILO/4-148EL--------K...ILE.LKKLA...---..ENG.........EAVD........VADEI.TRLEKRSRDALR-------
C0ZEF2_BREBN/2-145KE--------K...IDE.LQKY....---..MEK.........NDLD........LSSEI.HALRERLKVMQS-------
C4L480_EXISA/3-141TE--------Q...LNK.LRET....---..AET.........KGID........LSREI.RHLELKLDRLEK-------
Q187P7_PEPD6/3-145EN--------D...IKQ.LITI....---..SKA.........NNID........LSDKI.NSLNEKLEKLKE-------
ACCA_AROAE/5-148EA--------K...IEK.LRFV....---..QDD.........SAVD........ISEEI.ARLEAKSQTLSK-------
W8TMD3_EUBAC/5-147EE--------K...IKE.LKTL....---..VEE.........TGVD........LSGEI.EMLSKKAASMKD-------
R7I7W2_9BURK/5-149DE--------K...IDE.LRSM....---..QESD........PSMD........IGEEV.DRLEQKSAELLK-------
C9RBG3_AMMDK/4-147EE--------K...IAE.LTSF....---..SQE.........KGLD........LSEEI.AKLHQRAEELKR-------
ACCA_ACTP2/5-149EA--------K...IES.LRAV....---..SEQD........GKID........LDDEI.KRLQKKSEELTK-------
W8EY50_9BACT/2-145EG--------K...LRE.MQQL....---..ALD.........SQVD........VSEAV.TALEAKIKALKK-------
C8W257_DESAS/5-148VE--------K...ISE.LKNF....---..SSQ.........TGID........LVSEI.DILDKKARELKK-------
J9QYP7_RIEAN/3-148ME--------Q...YEK.CSLV....---..GEE.........SGVD........MKTAC.SQIEDKINKKKK-------
ACCA_CAMJE/5-141DE--------D...IIN.........---...AQ.........IKGD.........TEAV.SILKKNLEKEIS-------
F0S695_PSESL/5-147QQ--------Q...VEK.VNQI....---..AEK.........TKVD........MSATL.RELEEKIEKAKQ-------
H2FXK3_OCESG/5-150QA--------Q...IEE.LRHV....---..GEGDG.......LDID........LDEEI.SRLEAKRDELTR-------
F0S0A5_DESTD/5-143RK--------K...IEE.LKSM....---...............GRF........EQPVI.EEIEKKFQKKIQ-------
B3QS67_CHLT3/5-161EE--------K...LNE.MRRY....---..LVS.........GEEKNGEISSE.LSREI.LTLEQKVEDLRL-------
D7A5W6_STAND/4-148EA--------K...LEE.LRAMA...---..AQG.........DAVS........IGDDI.VRLEGKAKDALV-------
F0LUJ9_VIBFN/5-151EA--------K...IQA.LRDV....---..SRHGGG......TSVD........LEKEI.EQLEKKSLELKK-------
ACCA_BACHD/5-147KG--------K...IEE.LRTF....---..TEE.........KEID........LSDEI.EKLEKRLHALEE-------
R5EMT9_9GAMM/5-150LA--------H...IEE.LKRL....---..SAD.SN......SGVD........LTSEL.NQLEKKNLELTK-------
ACCA_PROA2/6-163EE--------K...LDE.MRVC....---..LKK.........SARDHNTAETEGLNQEI.ETLESKVQGLRR-------
F0T0C4_SYNGF/2-144KN--------K...IGE.LEKM....---..AEE.........KQID........FSDEI.GKLEAKLLELEA-------
H8GK81_METAL/5-148EA--------K...IRE.LRNV....---..EFD.........NDIN........ISDAI.QQLEEKSRALTE-------
D5WSS7_KYRT2/5-147ER--------K...IEE.LKCF....---..TET.........QQID........LGEEV.TRLEERAKQLAE-------
F6GHA4_LACS5/3-147EE--------Q...LDK.CQVI....---..GEE.........SDVD........VTETC.KQIEKKLVATKK-------
W8KT18_HALHR/5-148EA--------K...IEE.LRFV....---..GDD.........AEVN........IQDEI.ARLEAKCKSLTE-------
ACCA_GEOMG/7-148EQ--------K...IQE.LADI....---..AG..........DNVE........LKTEV.VKLEKKVDKMRE-------
K9Z068_CYAAP/11-154QA--------R...IDQ.IREL....---..GEE.........KQLD........VSGQL.QELEGKVEQLRQ-------
H1XP22_9BACT/9-151EQ--------K...IAE.MREY....---..AAA.........SHLD........LEEDI.KRLEKKAAELRR-------
H2IA21_FLACA/3-147EE--------Q...IEK.CQLI....---..GED.........TQVD........VSATC.EQLAEKLEETKK-------
C8WRU9_ALIAD/5-147KA--------K...IAE.LKAF....---..MEK.........NEID........LQGEV.DKLEERLKELTE-------
F7XXZ5_MOREP/5-149EA--------Q...IDL.LTTV....---..NPQ..I......LDLN........LDDEV.RYLRAKSLALTN-------
ACCA_BACSK/5-147RQ--------K...IAD.LRAF....---..AME.........RDMD........LSTEI.KKMEARLSELEE-------
R5QM64_9PROT/6-149ES--------K...IEG.LRHL....---..SSA.........DGVS........IAEEI.GRLQSKLDKQVK-------
B3ERA3_AMOA5/2-146EE--------K...LAA.MKAK....---..AAQ.........RKASK.......LLQPI.QKLEEQIKTLQA-------
K4IV53_PSYTT/3-147QE--------Q...FEK.ACEI....---..GQD.........SEVD........VTETC.KQIKLKLDNKKK-------
B2V9Z0_SULSY/2-143QD--------Q...IEI.LRER....---..VKK.........GEHH........LINEL.AKLRRKFKKLSK-------
F5Y6P2_TREAZ/2-135EK--------K...VAE.LKKL....---..IKE.........SGLN........LSEEL.ELLETKIQASSK-------
ACCA_PARDP/3-147EG--------K...AEE.LRALA...---..RKG.........EGVD........LEKEA.AALDRKAEEMLR-------
ACCA_OLICO/8-150DS--------K...IDE.LRALA...---..ANG.........S..D........ISEEI.SRIEDKAKAALH-------
D6Z010_DESAT/30-172QE--------K...LQSLRDAF....---..YEH.........SHEH........LAEKI.GALEESLTFLES-------
ACCA_OCHA4/4-148EG--------Q...ILE.LKKLA...---..QEQ.........GSVE........MSDEI.RRLEKRSADALK-------
S0EW53_CHTCT/6-157DA--------N...IAE.LKRI....---..AADPVLRKDALDRGID........IDEEI.ARIERRREEVMR-------
ACCA_COLP3/5-150DA--------K...IEE.LQLV....---..NNG.QE......LDLD........IEDQI.SQLREKNKEQTK-------
ACCA_ARCB4/5-141EE--------D...IIV.........---...AK.........TKAD.........EPAV.DILEKKLEKEVE-------
ACCA_TOLAT/5-150LA--------Q...IEE.LKHV....---..SEHVG.......SSVD........LTDEI.KHLEKKNEELTR-------
H6N9Y7_9BACL/6-147RA--------K...IEE.LRKF....---..SSD.........KQID........FSDEI.ARLEQRLQQLES-------
C7NC27_LEPBD/4-144EE--------A...ISE.LKSF....---..SDE.........KNID........FSAQI.VELEKKLESKYK-------
ACCA_DEIRA/4-145EA--------R...VRD.LEAT....---..AER.........TGQN........LDAAL.APLRTQLETLRR-------
R7GN66_9FIRM/3-139EK--------K...LAV.IKND....---..........................REIDS.SKIEETINDYKK-------
G8R0N5_OWEHD/3-147EE--------Q...LEK.TRNL....---..EQE.........TQVD........MGKTV.KEIEKKLIATKK-------
R5S9W6_9GAMM/4-147QK--------K...IDE.LKKM....---..SEA.........SGMD........LDNQI.QTFEQQAQDYKK-------
R5RFQ5_9FIRM/9-143EL--------E...LLK.LKDD....---..QE............ID........HTLQI.QDLENTKAKIEA-------
K0B3H8_CLOA9/4-147ED--------K...IRE.IETF....---..AKE.........SDVD........LSGEI.EILRNKVKDMKK-------
E3HB41_ILYPC/2-143EK--------K...IVE.LKEF....---..SEA.........KNID........LSGEI.DKLKNEYNEKMK-------
D6GQG0_FILAD/2-144EK--------K...IEC.LQKE....---..IERIREEDS...QLLP........TKKMI.DSIQEQKQKLLN-------
K0P1U1_9BACT/2-146EE--------K...LVK.MQEA....---..AKA.........QNAPA.......LMASI.AKLANDIKALQK-------
F2J212_POLGS/4-148EG--------K...VQE.LRALA...---..ASG.........EAVD........VDDEI.ARLETKASQTLA-------
U5QFX0_9CYAN/13-155QE--------R...IAQ.IRRL....---..AAE.........NNVD........VSDKL.GELEARLAELQR-------
E8R5M4_ISOPI/5-159EA--------R...LTE.LELQ....---..SQRAGGSSTSGEETAD.....SQALREQI.RALRRELANLRR-------
R6J4C9_9PROT/8-151EA--------K...IEG.LKLL....---..AKD.........EDVD........IAHEV.NRLQQKLEKQVK-------
S5RQ07_9PROT/5-148EK--------K...IEK.LRSL....---..QFS.........SNID........TSKEI.NDLVKKCNKLTE-------
ACCA_DICNV/5-148EY--------K...LNE.LKQF....---..SEQ.........SKVD........ISDEV.ERLKTKLERLTG-------
ACCA_AQUAE/8-151KE--------K...IDR.LLGL....---..YRL.........GKEE........VLSEL.DELRKKFKEKAR-------
E8UCK2_TAYEM/5-148EQ--------K...IEQ.LRNV....---..STE.........DVID........ISEEV.SKLQAKSESLTK-------
B3DWQ6_METI4/5-148LQ--------R...LEL.LKTD....---..KSL.........SAQE........LKKRE.TVLEEELLQTRK-------
B8DL69_DESVM/26-171DS--------K...LQEFNLRL....---..SEG.........AISD........ENAAL.TTLEDLFDFVER-------
C7R5W6_KANKD/5-148EA--------Q...IDE.LRMM....---..GED.........TEIN........ISEEI.ERLKKKSKDLTK-------
I6ZWV1_MELRP/5-146EN--------K...IDE.MKKY....---....E.........GQLD........ISGEV.KKLEEKVEELKK-------
L0F5J8_DESDL/5-147EK--------K...IAE.LQDF....---..SKE.........KDIN........LSPEV.SKLMRRLVRLRK-------
I0K7J9_9BACT/4-147EG--------R...LDE.LKRL....---..GET.........SKVD........VTEAI.ASLEESIAKLRA-------
Q0BUI6_GRABC/12-154EG--------K...IEE.LRRM....---..SEP.........DGIN........IADEV.SRLTDKADKLLR-------
U5LED4_9BACI/5-147KK--------K...IAE.LKDF....---..TKD.........AEVD........LSAEI.TKLENRLEKLEK-------
J7QSL5_METSZ/4-148ET--------K...VDE.LRALA...---..ENG.........EAVS........IGEEL.SKLQAKAAKALA-------
ACCA_BACAN/4-146RN--------K...IRE.LKDY....---..TKN.........SQMD........FSEEI.RILEDKLENLEE-------
K4LJD9_9FIRM/2-144NN--------K...LSD.LRKL....---..AED.........KQAD........FSSEI.EGLEEKLTRMKE-------
X2H0U8_9GAMM/4-150EA--------K...INS.LKNI....---..DSQQVE......LDLN........LDKEI.KQLNRKSRELTK-------
ACCA_BAUCH/6-151EA--------K...IES.LTSI....---..SSIDKT......CDTN........FNEEI.KRLRDKSIELTR-------
ACCA_STRMK/5-148EA--------K...IQE.LRNA....---..SAG.........PAVN........VEAEV.HALQDKLRMRTA-------
F8EKR1_RUNSL/4-147ES--------K...LIE.LKKL....---..AET.........TQVD........VSEAV.ARLETSIIQLRQ-------
G8T7C8_NIAKG/9-152FD--------D...IEG.LKQK....---..AEK.........SKLD........LTDPI.KKLEERVLETRK-------
ACCA_CYAP4/9-152EA--------Q...INQ.VRQK....---..SAE.........LGVD........VSDQI.RELENNSTQLRQ-------
ACCA_BEII9/4-148EA--------K...IDE.LRTLN...---..AQE.........DTPA........IGEEL.TKLEAKAQKALG-------
J9Z203_9PROT/3-145ES--------E...KKS.LQKA....---..SEE.........SGID........ITSKI.LSIEEKERTELE-------
M1E6T6_9FIRM/9-151YN--------K...IEE.LKRV....---..SAE.........TGVD........MTGEI.ESLQKRVENLYK-------
ACCA_NITEU/5-148EA--------K...IEQ.LRFA....---..QDN.........SALD........ISAEI.ARLQTKSLGLTK-------
C7RN27_ACCPU/5-148EG--------K...IEA.LRLA....---..QDD.........SALD........IADEI.SRLEKKGQTQTR-------
F9ZM26_ACICS/5-145EG--------K...VEE.LRAL....---..............NQPG........IEEDI.RRLELKARKELQ-------
K0C175_CYCSP/5-148EE--------K...LEE.LRRV....---..GSD.........NEID........IQKEI.DRLQEKSLSLTE-------
A5G4G6_GEOUR/6-148ER--------K...IEE.LQEL....---..SS..........DTLD........LKAEI.AKLEKKAEKVQE-------
E3F1D1_KETVY/3-147EG--------K...AEE.LRAMA...---..RAN.........PEMD........VEKEA.AALDRKAGELLV-------
Q3JCT5_NITOC/9-152EA--------K...IEE.LRFV....---..GDD.........AKLN........ISEEI.QRLKAKSKTLTE-------
K9VDH0_9CYAN/10-153ET--------R...IHQ.IREL....---..AEE.........NSVD........VTDEI.RKLEARSAQLRQ-------
ACCA_LISMO/5-147KS--------K...IAD.LKEY....---..NET.........SDVD........LTNEI.EKLEKRLAKLES-------
A8FG56_BACP2/5-147RA--------K...IDE.LKKF....---..TQN.........SEMD........LSAEI.ERLETRLSKLEA-------
ACCA_RUTMC/5-145EE--------K...IQA.LDNI....---....K.........DKAD........IVDEM.GALKIKSNALTK-------
Q2RXX2_RHORT/7-150EG--------K...IEE.LRHL....---..SDA.........DGIN........IAEEV.GRLQQKVDKQLR-------
ACCA_PSEHT/5-150EV--------K...IEE.LQNV....---..SRA.GE......LDLE........LEEEV.SKLKEKSDRLKE-------
E6W2T7_DESIS/5-148EK--------K...IED.LEKF....---..ASQ.........EGLN........FSTEI.EKLNRKMESLKE-------
D0MDD2_RHOM4/9-159EE--------K...LDE.MRALM...---..AEN.........PEVD........LSAEI.SALEARVAALRE-------
F8L7E7_SIMNZ/5-148ER--------T...IAQ.LKEQ....---..NKV.........NGIW........TDEEI.VKLENKLEKLKH-------
W0RIF3_9BACT/5-148ER--------R...IDE.LKRL....---..AAE.........QSVD........VHEEI.APLERKLGELRL-------
L0D934_SINAD/9-155EA--------R...LAE.MEVG....---.........YSKNRTGVD.....SSAIAEQI.RRLRRELANLKR-------
F2NQ24_MARHT/2-145EN--------R...IKE.LEAY....---..AAE.........KGLD........LSDEI.ALLKEKLERVQR-------
E6X0S5_NITSE/4-141QK--------D...IES.........---...AK.........ARGD.........QDAV.EILEKELGKEVK-------
F4CCW2_SPHS2/4-147LM--------Q...IEK.VNQV....---..AEK.........TKVD........MSATI.TELQGKLEETRK-------
D3ECM3_GEOS4/5-147RK--------K...IDE.LKQF....---..GQE.........KGID........FTDEI.ARLEERYSRLEE-------
ACCA_SPHAL/4-147DR--------Q...IAE.LREM....---..GDD.........PTLD........IEGDI.ARLEDKSAKLLR-------
Q0AMD1_MARMM/8-151EA--------K...IEE.LESL....---..AGE.........DSPD........MAEET.ARLRQKAAEQLA-------
B3E7C0_GEOLS/6-146EK--------K...IEE.LRAL....---..............GAGE........MSAEI.DALQSCVDTKRQ-------
Q1D555_MYXXD/8-151EK--------K...IDE.LKVL....---..STS.........GTVD........FSSEI.SKLEKKAKKLQT-------
ACCA_CHRSD/5-148EA--------K...IEE.LRLV....---..GND.........SGIS........LSDEI.GKLEDKNRKLTE-------
ACCA_EXIS2/3-143RK--------K...ILE.LHDM....---..AET.........QGLD........FKEEL.NLLEERLRRLEL-------
F8KZD1_PARAV/4-145IK--------T...IEH.LKKQ....---..NQD.........NPLF.........TAEI.RKLEQKLEKLKE-------
ACCA_FUSNN/2-143EH--------K...IEE.LKKF....---..AEE.........KEVD........LSDEI.AKLKDQRDIALK-------
S6B4Y6_9PROT/5-148EA--------R...IEE.LRFV....---..QDD.........SAVD........ISEEI.GRLQKKNNTLTK-------
B4U9A1_HYDS0/4-142KT--------K...IDQ.LKIL....---..YKQ.........GKTD........VEKDL.RAFQRESKQISK-------
ACCA_CHESB/4-148EG--------K...ILE.LKKLS...---..ESG.........EAVD........VAEEI.SRLERRSKDALR-------
A1AQQ7_PELPD/6-148EQ--------K...IEE.LNQL....---..SR..........EGLD........IGADV.AALESRVEAMRK-------
F8JC16_HYPSM/32-176EN--------K...VAE.LKALQ...---..TDG.........KGPQ........ITDEI.TKLEQKAKAALA-------
B9E7A5_MACCJ/2-145EK--------K...IQD.IEQY....---..MKA.........SDVD........LTHEV.ELLKAKKESLFK-------
D4H0L9_DENA2/5-148ES--------R...IDE.IKNV....---..SGI.........GSGD........IDKEL.KSLEDKLAKMKA-------
F0SFK4_RUBBR/6-146EQ--------H...LET.LEMQ....---....................QQPSTETLEAI.KNMRAEIVRLRR-------
ACCA_SPHWW/4-147QA--------R...IAE.LRST....---..ADA.........GSLD........LESEA.SKLEAKSDKLLR-------
F6CQZ6_DESK7/2-145EE--------K...IAE.LQRF....---..ASE.........KGID........LSTEI.ENLEKRARELKQ-------
R5K1S9_9CLOT/3-142DT--------E...IEE.LSAK....---..TDDYA...................ADVRV.KELKNEKRKLLH-------
I4D4N6_DESAJ/5-147EQ--------K...ITE.LQKF....---..SAE.........KDID........LSSEV.ETLEKKIAFLKK-------
D6YRI8_WADCW/23-165IK--------T...IDH.LKKQ....---..NQN.........NPLF.........NSEI.IKLEEKLEELKE-------

PF01039

PCCB_SACEN/46-544NDSGGA....R---IQEGVAALGLYA---EIFKRNTHASG.VIPQISLIMGPCAGGAVYS-PAITDFTVMVDQ.TSHMFI
ACACB_HUMAN/1780-2334TDIIGKDDG..---..LGVENLRGSG---MIAGESSLAYE.EIVTISLVTCRAIGIGAYL-VRLGQRVIQVEN..SHIIL
PCCB_BACSU/26-505NDSGGA....R---IQEGVLSLDGYG---HIFYRNVLYSG.VIPQISVILGPCAGGAVYS-PALTDFIFMAEQ.TGRMFI
YNGE_BACSU/27-509VDSAGARIT.D---QINVFPGRRGAG---RIFYNQVKLSG.RIPQICLLFGPSAAGGAYI-PAFCDIVVMVDG.NASMYL
ACACA_HUMAN/1669-2223TDIIGKEEG..---..IGPENLRGSG---MIAGESSLAYN.EIITISLVTCRAIGIGAYL-VRLGQRTIQVEN..SHLIL
PCCB_HUMAN/57-537NDSGGA....R---IQEGVESLAGYA---DIFLRNVTASG.VIPQISLIMGPCAGGAVYS-PALTDFTFMVKD.TSYLFI
Q9ZCU2_RICPR/30-512NDSGGA....R---IQEGVDALAGYG---ELFQRNVLASG.VIPQITLIMGPCAGGAVYS-PALTDFIFMVKN.SSYMFV
ACC1_ARATH/1587-2139DTIVGKEDG..---..IGVENLTGSG---AIAGAYSKAYN.ETFTLTFVSGRTVGIGAYL-ARLGMRCIQRLD..QPIIL
HFA1_YEAST/1619-2176KAIVGFEEG..---..LGVECLQGSG---LIAGATSKAYR.DIFTITAVTCRSVGIGSYL-VRLGQRTIQVED..KPIIL
O28066_ARCFU/27-514NDSGGA....R---IQEGVDALKGYG---DIFYRNTLASG.VIPQISVIMGPCAGGAVYS-PAIGDFIVMTKNPNCYMFI
O86318_MYCTU/45-527VESGGA.DLPT---QKEIFIPG...G---QMFRDLTRLSAAGIPTIALVFGNSTAGGAYV-PGMSDHVVMIKE.RSKVFL
Q20676_CAEEL/55-534NDSGGA....R---IQEGVESLAGYA---DIFQENVMASG.VVPQISMIMGPCAGGAVYS-PALTDFTFMVRD.TSYLFI
O86517_STRCO/39-525NDGAGA....R---IQEGVSALAGYG---GIFQRNTKASG.VIPQISVMLGPCAGGAAYS-PALTDFVFMVRD.TSQMFI
PCCB_MYCLE/50-547NDGAGA....R---IQEGVVSLGLYS---RIFRNNILASG.VIPQISLIMGAAAGGHVYS-PALTDFVVMVDQ.TSQMFI
ACAC_YEAST/1574-2130KTIIGSEDG..---..LGVECLRGSG---LIAGATSRAYH.DIFTITLVTCRSVGIGAYL-VRLGQRAIQVEG..QPIIL
MCCB_ARATH/93-585VDSGGA.YLPK---QAEVFPDKENFG---RVFYNESVMSSDGIPQIAIVLGSCTAGGAYI-PAMADESVMVKG.NGTIFL
ACAC_SCHPO/1615-2170TTIIGSSEG..---..LGVECLRGSG---LIAGVTSRAYN.DIFTCTLVTCRAVGIGAYL-VRLGQRAVQIEG..QPIIL
MCCB_CAEEL/119-606VDSGGA.NLP