Sequence alignment for CL0130

PF04258

SIPL5_ARATH/240-524--GAEEETLD......ISAMGAVIFVISASTFLVLL-------FFFMSSW---------....FIL..............
SPP2A_MOUSE/214-499--KKKDDYLT......FSPLTVVVFVVICCIMIVLL-------YFFYRW.---------....LVY..............
SIP_ARATH/47-323--KDTPPTET......MSKEHAMRFPLVGSAMLLSL-------FLLFKFL---------SKDLVNA..............
SPP2B_HUMAN/213-505--KQEDEAVD......VTPVMTCVFVVMCCSMLVLL-------YYFYDL.---------....LVY..............
Q9VPQ7_DROME/71-359--STGEKADT......MTKKDAMYFPLIASAALFGL-------YLFFKIF---------QKVHINY..............
Q9VBL1_DROME/96-408--EPTDKFAT......LDTMHALCLPLGASISLLIM-------FFFFDS.---------....MQL..............
SIPL4_ARATH/241-527--TSSRGVVE......VTVISAILFVVVASCFLIML-------YKLMSFW---------....FIE..............
SIPL2_ARATH/242-525--GGS.GVVE......INSISAIFFVVLASGFLVIL-------YKLMSYW---------....FVE..............
YL8H_SCHPO/31-282--QL............INKRLAVLFPIFGGVTLVLM-------YLALRYL---------SKEYIQL..............
YKK0_YEAST/145-510--KSKRFFDM......MDEKHAIILPLTSGCTLLAL-------YFVIKKL---------HLNWLKY..............
SPPL3_MOUSE/60-374--STNNSIQT......IDSTQALFLPIGASVSLLVM-------FFFFDS.---------....VQV..............
IMP2_CAEEL/55-450--KKRLIEGS......ITMREARKFPISASLVLFGL-------YLFFKPA---------AERFLWVARVFQILRVPEEYV
HM13_MOUSE/62-350--SSSDMPET......ITSRDAARFPIIASCTLLGL-------YLFFKIF---------SQEYINL..............
Q93346_CAEEL/275-601--SPSNDSETKGFLDRFGGIITICLMMTTLCGVLLL-------GYFFRPV---------....LVI..............

PF06550

Q9HM09_THEAC/1-278-----MTIFV------LSSLLAILLAVAIYNSEPSS-------YAHRSPT---------YGIGYVF--------------
Q9HQ23_HALSA/15-306-----VALFV------VVQVGALALVEPFQSAGLQ.-------.STENPQ---------NPLNSVV--------------
Q8TIY9_METAC/27-303-----AGLIL------IVQVLALLLSMPMEINDMQ.-------.AFEDPT---------QVSNSIY--------------

PF01080

D3B5F5_POLPA/149-528...SDQMVSI------AIPVFFTMVVVTAVIRAISVPDNQSSPPPANRID.........IPAGFKY--------------
G4VJ47_SCHMA/58-484YYGAKQIISL------FIPVTVCMLFVVAVASTVDF.......YG..HTD..........QY.LLY--------------
E9C2Q6_CAPO3/204-586KYGAKEVMAL------IVPVTLCMAIVVASIQSITY.......YA..QDS.........GDY.LAY--------------
T1KI16_TETUR/103-479KYGASHVIKL------FIPVSICMLIVVASIGSLQF.......YT..KTN..........QY.LLY--------------
K7J3W8_NASVI/92-490KYGAVHVIKL------FVPVSLCMLVVVATISSIGF.......YT..TKG..........VY.LVY--------------
U6IMP9_HYMMI/46-488RVGAKQIISL------FIPVTICMFFVAFISKNVPF.......FS..TTD..........AH.SVY--------------
W5JK58_ANODA/96-499KYGAQHVIKL------FVPVTLCMLVVVATISSINF.......YT..IKD..........VY.LVY--------------
E9FSB0_DAPPU/62-438KYGAAHVIKL------FVPVSLCMMVVVATISSVTY.......YT..QKG..........IY.LVY--------------
C5WT76_SORBI/25-446...GEDITRI------VYPVSACMLLVVLLVSLL..........SSPSSP.SPLS....ASIAAAT--------------
C3Z2C5_BRAFL/88-496KYGAKHVIML------FAPVSLCMAVVVATISSITF.......YT..EKN..........GY.LIY--------------
H2TY46_TAKRU/29-412KYGAKHVIML------FIPVTLCMVVVVTTIKSVSF.......YS..EKS..........DQQLIY--------------
H3AT04_LATCH/77-455KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..KKN..........GQ.LIY--------------
I1HEG8_BRADI/69-507...GEEVLAV------MSPVSICMALVVLLISIL..........SPPSSPASPSAPPPVTAATLVY--------------
W4XU10_STRPU/68-474KYGAKHVIML------FVPVSLCMLVVVATISTVSF.......YT..ESG.........DVY.LIY--------------
G7Y344_CLOSI/42-431VFGAKQVIRL------FIPVTICMFFVVLVATTVDY.......YA..STE..........TY.LIY--------------
B7Q2V0_IXOSC/41-421KYGAKHVIRL------FVPVSLCMLVVVATISSISF.......YR..HTN..........TY.LVY--------------
PSN1_RAT/76-458KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..RKD..........GQ.LIY--------------
T1JMG4_STRMM/67-438KYGAKHVIKL------FVPVTLCMLVVVATISSVTF.......YT..QRG..........KF...Y--------------
T1G6P3_HELRO/9-376QYGAESIIML------FIPVSICISFVIASVQALDF.......YK..EEG..........LP.LPF--------------
D7LLE1_ARALL/15-389...GEELIAI------LTPVSICMFTVVLLVCILN........SDPSSSS.ASFS....SIATAAY--------------
A2G9L8_TRIVA/13-428.IYSKRIYKI------AVPVILTLVIDVWLTRTLEEKFDNTALSTSFASV................--------------
F6RA92_CIOIN/37-422RYGASTVISL------FIPVTLCMLVVVATITSVSY.......YTDQSQQ..........QF.LVY--------------
I3IV36_ORENI/95-480KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..QND..........GQRLIY--------------
H2Z6F8_CIOSA/7-395RYGANTVISL------FIPVTLCMLVVVATITSVSY.......YTDQSQG..........QY.LVY--------------
K1PKB7_CRAGI/84-479LYGAKHVIML------FVPVSLCMAVVVATISSVTF.......YT..EKG..........GY.LVY--------------
S2K404_MUCC1/83-504.FYTLQIYRI------IKPVVACIILSIFWVKVS.........YSGSSDY....SPTRPNYVNLTP--------------
H3FRQ2_PRIPA/66-481KYGAEHVIRL------FVPVSICMALVILTMKMMSY.......YS..IVQ.........PEMGFVY--------------
E0VJ41_PEDHC/87-467KYGAKHVIKL------FAPVSLCMLVVVATISSIKF.......YT..TSD..........MY.FVY--------------
E2AIY0_CAMFO/93-484KYGAAHVIKL------FVPVSLCMLVVVATISSVHF.......YT..TKG..........MY.LVY--------------
F4PRZ5_DICFS/219-583..YSKAMVSI------ALPVSISMAIVISAVRLSEEARNFKSVSPL.................IQY--------------
B0WS38_CULQU/61-516KYGAQHVIKL------FVPVTLCMLVVVATISSINF.......YS..TKD..........VY.LVY--------------
U6HU93_ECHMU/45-476RIGAKQIISL------FIPVSICMFLVVFISKTVPY.......FS..TTD..........VY.LIY--------------
E2BSL4_HARSA/95-504KSGVVHVINL------FIPVSLCMLVVVATISSVNF.......YT..TKG..........MY.LVY--------------
H9J5W9_BOMMO/68-456KYGARHVIKL------FVPVTLCMLVVVATISSINF.......YS..VKD..........VY.LAY--------------
G3Q8S2_GASAC/77-448KYGAKHVIML------FIPVTLCMLVVVVTIKSVSF.......YT..EKT..........NQTLIY--------------
F6GSZ0_VITVI/15-427...GEEIIRI------ISPVSICMFLVVLLVTILN........SDTSSSS.SSVS....TIATIAY--------------
B4QRZ4_DROSI/98-517KYGAQHVIKL------FVPVSLCMLVVVATINSISF.......YN..STD..........VY.LLY--------------
SPE4_CAEEL/11-464LVRSSQLRWT------LFSVIANMSLTLSIWIGV.........YNMEVNS..........ELSKTY--------------
C7J054_ORYSJ/30-449...GEDITRI------VTPVSTCMLLVVLLVSLL..........SSPSSP.SPFT....AAFSAAA--------------
T1HN85_RHOPR/7-402KYGAAHVIKL------FVPVSLCLLVVVATMNNITF.......YS..TRD..........IY.LLY--------------
A9S846_PHYPA/9-467..VGGEIVGI------VTPVSICMFLVVTLVHIL..........DPRGED.APVS....NIAMMVY--------------
E3N426_CAERE/9-463FRRSSQLQWT------LFSVIVNMSLTLSIWIGI.........YQMQVNS..........ELSKLY--------------
D8LTV7_ECTSI/63-572AYSANSFMAV------VKPVTLCMTLSAFITVSL.........YSDAEGA........TNSALSVY--------------
H3CB70_TETNG/22-406KYGAKHVIML------FVPVTLCMVVVVTTIKSVSF.......YS..EKS..........KQQLIY--------------
G2J6Q7_CAEBR/9-477LRRSSQLQWT------LFSVVVNMSLTLAIWIGI.........YHMEVNS..........ELSKMY--------------
I1N8G3_SOYBN/8-407.WLGVEIIGV------MSPVSICMFLVVLLVYSL..........SSPSTTATTIA....TAANLVY--------------
G3W888_SARHA/88-452KYGAKHVIML------FVPVTLCMVVVVATIKSVRF.......YT..EKN..........GQ.LIY--------------
PSN_CAEEL/44-434KYGASHVIHL------FVPVSLCMALVVFTMNTITF.......YS..QNN.........GRH.LLY--------------
F2CQD9_HORVD/22-450...GEEVLAV------MSPVSICMALVVLLITLL..........APPSSP..PSAPPPVTAATLVY--------------
W5N759_LEPOC/69-512KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..QKD..........GQ.LIY--------------
Q7PR98_ANOGA/98-513KYGAQHVIKL------FVPVTLCMMVVVATISSINF.......YT..IKD..........VY.LVY--------------
M1CAI2_SOLTU/15-421...GEEIVRI------VTPVSICMLLVVILVSVLN........NDSDSSG.PSFT....SIATVAY--------------
W1NQ31_AMBTC/9-446..VGVEIIGV------MAPVSACMFLVVLLVYNM..........SSQGSD.STIR....TAATLVY--------------
K3WL66_PYTUL/82-563MHGINSFWAI------VFPVCVTMIIASLAVVNYR........NSSIEAS.........MQTYLVY--------------
A2DZ73_TRIVA/13-381.FYARKVAKI------AVPVVLTLILDAVCIRFIERTHGSAELNRNFVDT................--------------
G0NCU3_CAEBE/9-464VRRSAQLQWT------LFSVIANMSLTLSIWIGI.........YRMEVNS..........ELSKMY--------------
U9UMQ1_RHIID/178-561KFYMQQIYKI------IKPVVLCILLSVLWVKISILAPNFRPQHPTQQII................--------------
T1EFZ6_HELRO/89-576KYGAGHVIQL------FIPVSLCMAAVVCGINFIEF.......YN..VKD..........VY.LMY--------------
B7QGI2_IXOSC/14-384...MRQVITL------ICALSICMASVACLVRIL.........KPSKNDG..............MS--------------
A8PAF6_BRUMA/94-527KYGAQHVIHL------FVPVSICMVFVIFTMNTVGY.......YT..RKD.........GQY.LIY--------------
S2J107_MUCC1/49-424QFYVEQLTLL------FYPLIVTFALTCWIEITLNI.......DSSQISN...........PLMVY--------------
D3B4U3_POLPA/99-477...SNMIIAI------LKPVTITMFLVVWAVRSINAKNNILGQYVGGGSM...........GMLVY--------------
H2VWC4_CAEJA/11-477LNRSSQLKWT------LFSVIVNMLLTLSVWIGV.........YGMEVNS..........ELSRLY--------------
A9VBA9_MONBE/203-602KYDAESVLAL------IKPVSACMIVVIATIRSITY.......FS..QND..........TQ.FAY--------------
F2TYS0_SALR5/109-504KYGAESVLAL------IKPVSVCMIVVIATIRSVAY.......FS..TND..........TQ.FVY--------------
E1G929_LOALO/15-397...KKMVERL------LIPVTLNILLTLIVWIGV.........YHTKTDS..........NSVFYY--------------
H3FRQ2_PRIPA/544-933KYGAEHVIRL------FVPVSVCMAVVVLTMNTVEF.......YSEPVTA.........SDATSLY--------------

PF01478

FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRT5/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_THETN/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_THETN/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
C9R6J1_AGGAD/90-198--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524.............................................................ILTIFFVIGGMQ--GMHNI
SPP2A_MOUSE/214-499.............................................................VMIAIFCIASSM--SLYNC
SIP_ARATH/47-323.............................................................VLTAYFFVLGIV--ALSAT
SPP2B_HUMAN/213-505.............................................................VVIGIFCLASAT--GLYSC
Q9VPQ7_DROME/71-359.............................................................LLTGYFFVLGVI--ALAHL
Q9VBL1_DROME/96-408.............................................................LFAVCTAIIATV--ALAFL
SIPL4_ARATH/241-527.............................................................VLVVLFCIGGVE--GLQTC
SIPL2_ARATH/242-525.............................................................LLVVVFCIGGVE--GLQTC
YL8H_SCHPO/31-282.............................................................ILQGYASLASII--CFVRS
YKK0_YEAST/145-510..........................................................VVKILNFNITLLNIP--AGTFV
SPPL3_MOUSE/60-374.............................................................VFTICTAVLATI--AFAFL
IMP2_CAEEL/55-450QKINSTIISYTANTTTTGPSEPFLLRLASRIPQERVPEAIQNAATYAYTNLPTIQKAECMQLLTFLICFEGVN--AFASL
HM13_MOUSE/62-350.............................................................LLSMYFFVLGIL--ALSHT
Q93346_CAEEL/275-601.............................................................FFNIFLVIFGTC--SLYGC

PF06550

Q9HM09_THEAC/1-278----------------------------------------------------------VYIIAAFLFS.FVII--YLGRK
Q9HQ23_HALSA/15-306----------------------------------------------------------.YVAFLLVATGGILL--VIKYD
Q8TIY9_METAC/27-303----------------------------------------------------------.YIVMILVFTLFVLI--AIKKN

PF01080

D3B5F5_POLPA/149-528---------------------------------D.......TDPNIQQVFLNTLINSLIFLGVVVLSTVIMVI--LYKFK
G4VJ47_SCHMA/58-484---------------------------------TPFHT...PDADIGTQTWQTIANTLIFMSVVVVMTCVLVL--LFKYQ
E9C2Q6_CAPO3/204-586---------------------------------IAFKE...DSDSGAENFGGAIINALIIVGVILVMTCVLVL--LYKYR
T1KI16_TETUR/103-479---------------------------------TPFTD...QKADTTTRVWHSFANAFIFLIVIVVMTFVLIL--LYTYR
K7J3W8_NASVI/92-490---------------------------------TPFHE...ETNDSGTKAWQAVANSLILMAVVVFMTVILIV--LYKYR
U6IMP9_HYMMI/46-488---------------------------------APFNT...PNADIGTQTWQTLVNVAIILTFVIVITFILVL--LFKFK
W5JK58_ANODA/96-499---------------------------------TPFHE...LADDTGTKIWNALANSLILMTVIVIMTILLIV--LYKHR
E9FSB0_DAPPU/62-438---------------------------------TPFHE...DSPDTGTKVWNAVANAAILLGVIVVMTVFLIM--LYKYR
C5WT76_SORBI/25-446---------------------------------GGV.....SGGGDGDDIPTALITALTFVVAVTAATFLLAL--LFYLR
C3Z2C5_BRAFL/88-496---------------------------------TPFHE...EGASTASKVGDSLANAAIMVGVILVMTVFLVI--LYKYR
H2TY46_TAKRU/29-412---------------------------------TPFTE...NTSSVGRRLLNSVLNTIIMISVIVVMTIFLVV--LYKYR
H3AT04_LATCH/77-455---------------------------------TPFSE...DTDTVGQRALNSILNAAIMISVIIVMTLLLVL--LYKCR
I1HEG8_BRADI/69-507---------------------------------LES.....PSDSPGQKLVGALLDAAVFVALVAVVTFVLVA--LYYYR
W4XU10_STRPU/68-474---------------------------------TPFHE...KSDQAGTKAWNALANALIIIGIVLIMTIFLVV--LYKYR
G7Y344_CLOSI/42-431---------------------------------TPFHT...PDADLGTRTWQTIANTLIFMSVIIVMTCVLVL--LFKYQ
B7Q2V0_IXOSC/41-421---------------------------------TPFTD...QTVDTGTKVWQSFANAFILMGVIVVMTILLIL--LYKFR
PSN1_RAT/76-458---------------------------------TPFTE...DTETVGQRALHSILNAAIMISVIVVMTILLVV--LYKYR
T1JMG4_STRMM/67-438---------------------------------TPFHE...NTTDPGTKAWQSLANAFILMGVIVVMTVFLIL--LYKYK
T1G6P3_HELRO/9-376---------------------------------TPFVPE..EKDEVKDTLWKSLANSLIIVGVVIIMTILLFL--LFKYR
D7LLE1_ARALL/15-389---------------------------------AES.....DSDSSWDKFVGALLNSVVFVAAITVATFVLVL--LFYLR
A2G9L8_TRIVA/13-428---------------------------------.......VSQSSGGVSTAVAIYIAIGFIVAIALVTGLLLL--LYWFN
F6RA92_CIOIN/37-422---------------------------------TPFHT...TNAAPAQVVWESIANSLIMIGVIVVMTVFLVL--LYKYR
I3IV36_ORENI/95-480---------------------------------TPFPE...DTDTVGQRALNSILNATIMITVIIVMTLVLVM--LYKYR
H2Z6F8_CIOSA/7-395---------------------------------TPFHT...QNAGTAQVVWESIANSLIMISVIVVMTIFLVL--LYKYR
K1PKB7_CRAGI/84-479---------------------------------TPFHDGDKADADTGTKVWQSVANALILLGVICVMTIVLLL--LYKFR
S2K404_MUCC1/83-504---------------------------------STSSSSTDGSTSSGPSIANSFTNAAIIIGQIIGVTILIVF--LFKKG
H3FRQ2_PRIPA/66-481---------------------------------TPFHTN..AGDDTSTRVLSGLGNALIMICFIVVMTFGLIL--LYKFK
E0VJ41_PEDHC/87-467---------------------------------TPFHE...TDSNPGTKAWNAVANSLILIAVIVVMTIVLII--LYKKR
E2AIY0_CAMFO/93-484---------------------------------TPFHE...DSSDTSTKVWQAFANSLILMSVIVFMTVILII--LYKYR
F4PRZ5_DICFS/219-583---------------------------------DVR.....EDPATQTLVWGTIINSLILVGIIFLSSVIMFA--LYYFK
B0WS38_CULQU/61-516---------------------------------TPFHE...LSDDTGTKIWNALANSLILMTVIVIMTILLIV--LYKRR
U6HU93_ECHMU/45-476---------------------------------TPFHT...PNADIGTQTWQTLANVVIFLSVIVVMTFLLVL--LFKFK
E2BSL4_HARSA/95-504---------------------------------TPFHE...DSSDTSTKVWQAFANSLILMSVIVFMTVILII--LYKYK
H9J5W9_BOMMO/68-456---------------------------------TPFHE...ESPYASTKVWNALANSMILLCVIALMTVLLIV--LYKKK
G3Q8S2_GASAC/77-448---------------------------------TPFTE...NTASVGRRLLNSVLNTIIMISVIVVMTIFLVV--LYKYR
F6GSZ0_VITVI/15-427---------------------------------SED.....SSDSTWDKFKGALLNSLVFVGVVTVVTFLLVL--LFYLR
B4QRZ4_DROSI/98-517---------------------------------TPFHE...QSPEPSVKFWSALANSLILMSVVVVMTFLLIV--LYKKR
SPE4_CAEEL/11-464---------------------------------FLDPS...FEQTTGNLLLDGFINGVGTILVLGCVSFIMLA--FVLFD
C7J054_ORYSJ/30-449---------------------------------G........PGGGGDDITTALITAVTFVVAVTAATFLLAF--LFYLR
T1HN85_RHOPR/7-402---------------------------------TPFHE...RSSDPGTKMWNALANATILLSVIVLMTVLLIL--LYKYR
A9S846_PHYPA/9-467---------------------------------NEQ.....ASDSFSEKLGGALLNAIVFVVIVTLVTFMLVA--LFYYR
E3N426_CAERE/9-463---------------------------------FLDDS...FERTTGNTTLDGLINGFATILVLGCVSFVMLA--FVLYD
D8LTV7_ECTSI/63-572---------------------------------EVYDESTTTLDPSSVRLGKSFVNALIIVLVLAAATFVIVW--MYWMR
H3CB70_TETNG/22-406---------------------------------TPFSE...DTSSVGQRLLHSVLNTVIMISVIVVMTVFLVV--LYKYR
G2J6Q7_CAEBR/9-477---------------------------------FLDDS...FNWTTGNPALDGLINGFCTILVLGCVSFVMLA--FVLYD
I1N8G3_SOYBN/8-407---------------------------------AEN.....PSDTAAQKLEGAVLNAVVFIVFIALATFLLVL--LYYYN
G3W888_SARHA/88-452---------------------------------TPFTE...DTPSIGQRLLNSVLNTLIMISVIVVMTIFLVV--LYKHR
PSN_CAEEL/44-434---------------------------------TPFVR...ETDSIVEKGLMSLGNALVMLCVVVLMTVLLIV--FYKYK
F2CQD9_HORVD/22-450---------------------------------LES.....PSDSPAQKLVGALLDAVVFIALVAVVTFVLVA--LYYYR
W5N759_LEPOC/69-512---------------------------------TPFPE...ETETVGQRALNSILNAAIMISVIVVMTLLLVV--LYKYR
Q7PR98_ANOGA/98-513---------------------------------TPFHE...LTDDTGTKIWNALANSLILMTVIVIMTILLIV--LYKHR
M1CAI2_SOLTU/15-421---------------------------------NES.....SSDSNWDKLKGAILNALVFVVVVTAVTFLLVL--LFYFR
W1NQ31_AMBTC/9-446---------------------------------LEK.....STDSNTQKFEGALLNAGVFVILIALVTFLLVM--LYYYR
K3WL66_PYTUL/82-563---------------------------------GSS.....DQDSGAQQLGMSLVNAVVIIGAIAVLTFGMAL--LYKYN
A2DZ73_TRIVA/13-381---------------------------------.......MSRNDSGISVTASIWSAVGIIFMIIVVTAILLT--LYYFG
G0NCU3_CAEBE/9-464---------------------------------FLDDS...FNWTTGSPTLDGLINGFCTILVLGGVSFIMLA--FVLYD
U9UMQ1_RHIID/178-561---------------------------------.....DTSEDASESAQIFNSFLTAAVIIGNIIVVTIIIVC--LFKYG
T1EFZ6_HELRO/89-576---------------------------------TPFEQSVTPETSTGTRIWQSLANALIMLSVVIVMTVVLLL--LYKYR
B7QGI2_IXOSC/14-384---------------------------------QPYVRYPVEYDAEPVLLMNSFANAFSFLSMIMIVNCTLVL--LYKGG
A8PAF6_BRUMA/94-527---------------------------------TPFTK...ETDNTGEKLIMSFGNAFIILGVVVTMTVLLIF--LYKFR
S2J107_MUCC1/49-424---------------------------------DEL.....PSDSVGTRLGGSVLNAIIVVCGITLMTFMFVL--CFKYR
D3B4U3_POLPA/99-477---------------------------------NES.....SDDSTGQKIWGSLLNGLVFLVVIVLTTVAFVL--LYKYR
H2VWC4_CAEJA/11-477---------------------------------FLDTA...SNSTTGNPVLDGAINGMFTIVVLGIVSFVMLG--FVLYD
A9VBA9_MONBE/203-602---------------------------------TPFESNGGAGESSGERFGGAVLNALIVVGIVIVMTFILVM--LYIYE
F2TYS0_SALR5/109-504---------------------------------TPYESN.NPNASNSEKFGGAILNALIIIGIVVGMTCVLLL--LYKYR
E1G929_LOALO/15-397---------------------------------MLDPG...HNRTTGNEIVDGMVNGIGCVLMLAVISFALLA--MALYD
H3FRQ2_PRIPA/544-933---------------------------------TPFLSD..EEDDTSTRVLSALGNAGIMIGVIVVMTFVLIL--LYKYK

PF01478

FLAK_METJA/5-130---------------------------------------------------------------IVGAIGLLIA..SIYDL
FLAK_METMP/5-130---------------------------------------------------------------IIGVIGLLLA..SVQDF
LEP4_BACSU/100-204---------------------------------------------------------------VVFISLLIIV..AVTDI
Q9HWA5_PSEAE/4-110---------------------------------------------------------------LALALWASVC..GYQDI
Q8FME5_COREF/77-189---------------------------------------------------------------AAAAVGCTLL..MVIDL
Q9CPF6_PASMU/89-199---------------------------------------------------------------ASYVSIAICI..AVIDW
Q9RSQ9_DEIRA/109-347---------------------------------------------------------------MVLFTILLVG..SAIDL
Q97HN8_CLOAB/64-168---------------------------------------------------------------CVIATMLFLA..ALIDF
Q8XQX7_RALSO/14-117---------------------------------------------------------------VVLAVLVITS.....DL
LEP4_HAEIN/90-200---------------------------------------------------------------GLTLIILWTI..SYLDW
Q8TMQ5_METAC/5-101---------------------------------------------------------------ILISLFLVLA..CYTDL
Q8NQ30_CORGL/4-110---------------------------------------------------------------FLVGLWCAVL..AVIDI
Q98BF9_RHILO/11-116---------------------------------------------------------------VVFPFCMLFA..AISDM
Y421_METTH/12-138---------------------------------------------------------------FIALLACFYA..SYSDI
Q8CXM1_OCEIH/104-208---------------------------------------------------------------LLLTSLLVII..CISDF
A9CKJ3_AGRT5/8-113---------------------------------------------------------------LILPLCLCFA..ALNDL
Q8TXH1_METKA/6-112---------------------------------------------------------------LAGLAVATVA..AITDL
Q8DLL0_THEEB/89-199---------------------------------------------------------------WLLSAWLLAL..ALIDL
YC8A_METJA/6-148---------------------------------------------------------------LYGLICSIYG..AVEDW
Q9XAP1_STRCO/112-224---------------------------------------------------------------LLLAPVGVLL..AVVDL
LEP4_MYXXD/113-222---------------------------------------------------------------LVLVSLLVPL..AFIDL
LEP4_XANCP/133-242---------------------------------------------------------------IVLSCFLVAM..SGIDL
Q8TLD4_METAC/26-152---------------------------------------------------------------LFAMAFLLYS..CYSDL
O67535_AQUAE/105-214---------------------------------------------------------------YFFFSALLVM..SIIDW
Q988A4_RHILO/13-122---------------------------------------------------------------IALAVVLGAI..SIADF
Q8XVK3_RALSO/140-249---------------------------------------------------------------AALLWFLIAG..SMIDA
Q87I88_VIBPA/13-110---------------------------------------------------------------LVNVLLIFYG.....DI
Q8F6L1_LEPIN/127-232---------------------------------------------------------------LFLCGHLLIS..CLTDA
Q891G5_CLOTE/115-221---------------------------------------------------------------SIFICFLIIV..SVIDF
Q9K8H1_BACHD/15-120---------------------------------------------------------------LALVSLFSII..FVSDL
LEP4_PSEAE/136-245---------------------------------------------------------------LLLTWGLLAM..SLIDA
Q8XI34_CLOPE/100-206---------------------------------------------------------------IVLITFLIVI..SFIDY
Q8EJP8_SHEON/157-266---------------------------------------------------------------AILTFVLIAL..TGIDL
Q9CMH2_PASMU/11-110---------------------------------------------------------------CITMILLIIL..SWTDI
Q92T43_RHIME/12-117---------------------------------------------------------------VVFPFSLALA..ALSDL
HOPD_SALTY/9-119---------------------------------------------------------------IFYASFSLLL..GIYDA
Q8FT27_COREF/8-114---------------------------------------------------------------AVFVVWVGVL..AAWDL
Q8THK9_METAC/8-134---------------------------------------------------------------AACLPFLLYS..SYLDL
Q8RAF7_THETN/104-208---------------------------------------------------------------MFLSSVLISA..SFIDL
PPPA_ECOLI/130-240---------------------------------------------------------------MILSAWLIAA..SVIDL
Q92YL6_RHIME/12-116---------------------------------------------------------------LLFAGAMTYA..GIRDV
Q89PI9_BRADU/13-114---------------------------------------------------------------LLQILLLLYV..ATIDV
Q89UH6_BRADU/9-113---------------------------------------------------------------LLFPALMAFA..AASDL
Q87M36_VIBPA/5-111---------------------------------------------------------------LVIWSLLIAI..GVSDA
Q8Y6Y1_LISMO/101-204---------------------------------------------------------------YIIYYFLAFF..FITDI
Q89HG8_BRADU/40-149---------------------------------------------------------------AFLAALMLAI..ATHDA
Q8YXA0_NOSS1/108-226---------------------------------------------------------------WTFCGWLLAL..SLIDL
Q9X222_THEMA/103-204---------------------------------------------------------------CVIASALIAI..SLIDL
LEP4_VIBCH/112-221---------------------------------------------------------------LGLYFILFNL..FVIDF
Q989C3_RHILO/11-122---------------------------------------------------------------ALAIPLLARI..AWLDF
LEP4_ECOLI/81-190---------------------------------------------------------------FLYFCFVLTL..SVIDF
Q9ABP2_CAUCR/121-230---------------------------------------------------------------ALMGWSLLLI..ATIDT
Q8Y1N3_RALSO/10-114---------------------------------------------------------------LSLLVLVVTA..AVHDV
Q88QB9_PSEPK/4-110---------------------------------------------------------------IVLLLWLALC..SEQDV
Y83C_METJA/9-115---------------------------------------------------------------IINFILLLLA..AITDI
Q87VV0_PSESM/5-111---------------------------------------------------------------FFLLVWFAIC..AEQDA
O29326_ARCFU/8-129---------------------------------------------------------------LVVLGFLLYA..CKLDL
Q97FF6_CLOAB/100-211---------------------------------------------------------------IVLFSFLFII..SIIDL
Q8RHE5_FUSNN/7-119---------------------------------------------------------------ILLYILLFLV..MYIDI
Q980Y8_SULSO/10-125---------------------------------------------------------------FLSIIMLIHT..SILDL
Q8R8E5_THETN/6-111---------------------------------------------------------------LSLPVVVLTAYAAWTDC
LEP4_SYNY3/108-223---------------------------------------------------------------WILISFLISL..TLIDW
A0KPV9_AERHH/142-247---------------------------------------------------------------....WVLVAL..TFIDL
A5EXL5_DICNV/138-247---------------------------------------------------------------LVFTWTLIAL..CFIDA
A9H675_GLUDA/111-216---------------------------------------------------------------CLFGWWLLVL..AAIDL
C9R2X4_AGGAD/10-108---------------------------------------------------------------IIMLLLLITL..SITDI
C9R6J1_AGGAD/90-198---------------------------------------------------------------.LYGALLIAI..SLVDW
E0SLF4_DICD3/139-243---------------------------------------------------------------...FGTLLAL..AAIDA
G1UB88_HAEDU/13-108---------------------------------------------------------------..IVLLLIWL..SYTDI
H7C7G6_CAUCR/11-113---------------------------------------------------------------.IFPALAIVG..ALKDL
H9L4S3_VIBCH/135-244---------------------------------------------------------------.FFSYVLIAA..TFIDF
I6Y9M6_MYCTU/5-108---------------------------------------------------------------.AVLAWMGVL..CVCDV
LEP4_BURPS/162-269---------------------------------------------------------------..LCAALLAM..SAIDM
Q0WIM7_YERPE/129-236---------------------------------------------------------------LVLIWSLTAL..AFIDF
Q5F692_NEIG1/134-242---------------------------------------------------------------LILTAFLISL..TFIDA
Q5ZVB6_LEGPH/138-246---------------------------------------------------------------.LAIWILISL..VFIDL
Q65GL0_BACLD/102-205---------------------------------------------------------------.ALISLLLIV..FVSDV
Q7MJZ8_VIBVY/10-109---------------------------------------------------------------.ALLLLLAMV..VLSDV
Q9PAI1_XYLFA/133-241---------------------------------------------------------------IVFSCFLVAL..AGIDL

PF04258

SIPL5_ARATH/240-524NVTLIT..RR.CSK-----CGQKNLK..................................LPLL...-------......
SPP2A_MOUSE/214-499LSALIH..RMPCGQ-----CTILCCG.........................................-------......
SIP_ARATH/47-323LLPAIR..RFLPNP-----WNDNLIV..................................WRFPY..-------......
SPP2B_HUMAN/213-505LAPCVR..RLPFGK-----CRIPNNS..................................LPYFH..-------......
Q9VPQ7_DROME/71-359LSPVIN..SLMPAA-----VPKVPFH..................................ILFTK..-------......
Q9VBL1_DROME/96-408LLPMCQ..YIIRPC-----TDGKRFS..................................FGFC...-------......
SIPL4_ARATH/241-527LVSLLSCFRW.FRR-----FGESYVK..................................VPFL...-------......
SIPL2_ARATH/242-525LVALLS..RW.FQR-----AADTYVK..................................VPFL...-------......
YL8H_SCHPO/31-282FNPKTT........-----................................................-------......
YKK0_YEAST/145-510YSYFLN..SLFRNL-----SHLASWNPLVVLPRYRVTIADDNEDLNKIGGFVTNLNYKDGLTNSVVH-------KKTLDE
SPPL3_MOUSE/60-374LLPMCQ..YLTRPC-----SPQNKIS..................................FGCC...-------......
IMP2_CAEEL/55-450LKPFVT...AFLKK-----MPLVPSF..................................LRFNAPY-------LFSLKK
HM13_MOUSE/62-350ISPFMN..KFFPAN-----FPNRQYQ..................................LLFTQ..-------......
Q93346_CAEEL/275-601IRGFLS..NFKFVG-----HRWYNAK..................................MEWFP..-------......

PF06550

Q9HM09_THEAC/1-278KKLRIF--KVIYSI-----VVAYVIF----------------------------------YVFLILL-------SI----
Q9HQ23_HALSA/15-306KQWILR--GVVLVT-----SGL.VAS----------------------------------YVFAVAI-------PA----
Q8TIY9_METAC/27-303MKWIIS--LLIYLA-----IVS.TLY----------------------------------YVFFALF-------TL----

PF01080

D3B5F5_POLPA/149-528FMKALY--GWLMAT-----SILLLGV----------------------------------FGGFLFI.......LILTYV
G4VJ47_SCHMA/58-484CYKFIR--GWIIMT-----TIFLLFL----------------------------------ISFTFFA.......EVLRAM
E9C2Q6_CAPO3/204-586CYKAIW--MWLFLS-----TVMLLFL----------------------------------FTYIYLE.......LVFDRY
T1KI16_TETUR/103-479FYKVIY--GWLVLS-----SSLLLFL----------------------------------FMFIYLS.......VVLQKY
K7J3W8_NASVI/92-490FYKTIH--AWLIIS-----SLILLFL----------------------------------FTSLYCE.......EVLKAY
U6IMP9_HYMMI/46-488CYKFLT--GWLIMA-----TFVVVFL----------------------------------ASFTFFA.......QLLQVS
W5JK58_ANODA/96-499CYKVIH--GWLILS-----SLLLLFL----------------------------------FSGLYLF.......EILRAY
E9FSB0_DAPPU/62-438CYKIIH--GWLIMS-----SLMLLFI----------------------------------FAYLYLG.......EVLRTY
C5WT76_SORBI/25-446CTPCLR--AYLGFS-----ALAVLLV----------------------------------LGGQVAL.......LLLSRL
C3Z2C5_BRAFL/88-496CYKFIH--GWLILS-----SLMLLFL----------------------------------FAYIYLG.......EVLQAY
H2TY46_TAKRU/29-412CYKFIH--GWLILS-----SLMLLFW----------------------------------FSFMYLG.......EVFKTY
H3AT04_LATCH/77-455CYKVIH--GWLIIS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
I1HEG8_BRADI/69-507CTGFLK--NYMRFS-----AFFVLFS----------------------------------MGGAIAI.......TILRRL
W4XU10_STRPU/68-474CYKVIH--GWLVLS-----SLLLLFF----------------------------------FTFFYLQ.......ELLVTY
G7Y344_CLOSI/42-431CYRFIH--GWLILT-----TFMLLFL----------------------------------ISFLFFT.......EIIRAM
B7Q2V0_IXOSC/41-421CYKVIH--AWLIVS-----SLLLVFL----------------------------------FAYIYLG.......EVLRAY
PSN1_RAT/76-458CYKVIH--AWLIVS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
T1JMG4_STRMM/67-438CYKVIH--GWLILS-----SLMLLFL----------------------------------FAYIYLG.......EVLRAY
T1G6P3_HELRO/9-376CYKVCA--FWMFLA-----TLLLLFI----------------------------------FSYIYYS.......EFCRYL
D7LLE1_ARALL/15-389CVKFLK--FYMGFS-----AFIVLGN----------------------------------LGGEILV.......LLIDRF
A2G9L8_TRIVA/13-428CVKCIY--VWMVVA-----VSLLLSY----------------------------------YVYLAVG.......KIPSLY
F6RA92_CIOIN/37-422CYKVIH--GWLILS-----TLLLVFL----------------------------------FAYLYLA.......EVLRAY
I3IV36_ORENI/95-480CYKVIQ--GWLFLS-----SLLLLFF----------------------------------FSYIYLK.......EVFKTY
H2Z6F8_CIOSA/7-395CYKVIH--GWLILS-----SLLLLFL----------------------------------FAYLYLA.......EVLRAY
K1PKB7_CRAGI/84-479CYKVIH--GWLIAS-----SLMLLFL----------------------------------FSYIYLG.......VVLQAY
S2K404_MUCC1/83-504WIKVLI--GFFMVI-----VLLLLGF----------------------------------MTYLLLL.......NLIQVF
H3FRQ2_PRIPA/66-481CYRFIH--GWLMMS-----SLMLLTM----------------------------------FSMVYVS.......ELMKMN
E0VJ41_PEDHC/87-467CYKTIH--GWLIAS-----SLMLLFL----------------------------------FSYLYLE.......EVLRAY
E2AIY0_CAMFO/93-484FYKVIH--GWLIIS-----SLLLLSM----------------------------------FSILYCE.......QVLKAY
F4PRZ5_DICFS/219-583FMKALY--GWLMAT-----SILLLGV----------------------------------FGGFLFI.......LLMTYA
B0WS38_CULQU/61-516CYKIIH--GWLIMS-----SLMLLFL----------------------------------FSYLYME.......EVLRAY
U6HU93_ECHMU/45-476CYKCLT--GWLVAT-----TFLLVFV----------------------------------ISFTFFT.......ELLRAS
E2BSL4_HARSA/95-504FYKVIH--GWLIIS-----SLLLLSL----------------------------------FSILYCE.......QVLKAY
H9J5W9_BOMMO/68-456CYKTIH--GWLILS-----SLILLFL----------------------------------FSYLYIE.......EALIAY
G3Q8S2_GASAC/77-448CYKFIH--GWLILS-----SLMLLFW----------------------------------LSFMYLS.......EVFKTY
F6GSZ0_VITVI/15-427CTKFLK--YYMGFS-----SFIVLGF----------------------------------MGGEITL.......FLIQDF
B4QRZ4_DROSI/98-517CYRIIH--GWLILS-----SFMLLFI----------------------------------FTYLYLE.......ELLRAY
SPE4_CAEEL/11-464FRRIVK--AWLTLS-----CLLILFG----------------------------------VSAQTLH.......DMFSQV
C7J054_ORYSJ/30-449CTPCLR--AYLGFS-----SLSVLLL----------------------------------LGGHVAL.......LLLSRL
T1HN85_RHOPR/7-402CYKIIH--GWLIMS-----SLILLSI----------------------------------FSYIYLL.......EVLRAY
A9S846_PHYPA/9-467CTRCLR--VYMGIS-----AFTVLAW----------------------------------MGGIVAV.......QIIKLY
E3N426_CAERE/9-463FQRVVK--AWLTLS-----CMLILFG----------------------------------VSGQTLY.......DLFTQI
D8LTV7_ECTSI/63-572CMRCLV--GYMAMS-----SAVLLGV----------------------------------MGGAVWA.......AALEVY
H3CB70_TETNG/22-406CYKFIH--GWLILS-----SLMLLFW----------------------------------FSFMYLG.......EVFRTY
G2J6Q7_CAEBR/9-477FRRIVK--SWLTFS-----CLLILFG----------------------------------VSGQTIY.......DLFSQI
I1N8G3_SOYBN/8-407CTAFLL--HYTRFS-----TFFVLAA----------------------------------MGGSILL.......SLLERF
G3W888_SARHA/88-452CYKFIH--GWLILS-----SLMLLFL----------------------------------FTYIYLG.......EVLKTY
PSN_CAEEL/44-434FYKLIH--GWLIVS-----SFLLLFL----------------------------------FTTIYVQ.......EVLKSF
F2CQD9_HORVD/22-450CTGFLK--NYMRFS-----AFFVLFS----------------------------------MGGAIAV.......ALLRRL
W5N759_LEPOC/69-512CYKVIH--GWLIIS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
Q7PR98_ANOGA/98-513CYKVIH--GWLILS-----SLLLLFL----------------------------------FSGLYLF.......EILRAY
M1CAI2_SOLTU/15-421CTKFLK--YYMGFS-----SFLVLGF----------------------------------MGGEICL.......FLIGKF
W1NQ31_AMBTC/9-446FTGFLK--NYMRFS-----AFFVLGS----------------------------------MGGPIFL.......SIIEQF
K3WL66_PYTUL/82-563CMKFLG--GYIMFA-----STAILSF----------------------------------VGGQLVD.......SIVNDQ
A2DZ73_TRIVA/13-381CMKIIF--GWLILA-----VSLLLSM----------------------------------YFLVGFG.......TYPSIV
G0NCU3_CAEBE/9-464FRRIVK--LWLTFS-----CILILFG----------------------------------VSGQTIY.......DLFVQV
U9UMQ1_RHIID/178-561FIKILI--GFFMVV-----VLLLLGF----------------------------------MGYLLMM.......AILQVF
T1EFZ6_HELRO/89-576CYKFIA--GWLFMS-----SFMLLFF----------------------------------FTFIFYS.......ELCRTM
B7QGI2_IXOSC/14-384YTNVIK--AWLMTG-----SGVLLFV----------------------------------VTYYYMG.......RCVYYF
A8PAF6_BRUMA/94-527FYRVIS--AWLVLS-----SLILLSL----------------------------------FTFMYLQ.......EVFKSY
S2J107_MUCC1/49-424LYKFLF--FWLGLS-----VLSILGV----------------------------------TASALWI.......EMLNVY
D3B4U3_POLPA/99-477CLKAIY--AWLFLS-----VGILLAS----------------------------------MGSYVFM.......AMLEAN
H2VWC4_CAEJA/11-477FQNLVK--TWLIFS-----CLLILFG----------------------------------VSGQTFY.......DLFSQL
A9VBA9_MONBE/203-602YYKIIY--GWLALS-----ALLLLYF----------------------------------FSYQYIECVMCTRRQVLIAH
F2TYS0_SALR5/109-504CYKAIH--GWLLLS-----SLLLLFF----------------------------------FSYQFVD.......QVLRAY
E1G929_LOALO/15-397YKCLVQ--MWLYMS-----CVLIIFG----------------------------------VFASFLV.......DLFKAF
H3FRQ2_PRIPA/544-933CYKCLH--GWMISS-----SFMMLTL----------------------------------ISGTYVM.......HVLENH

PF01478

FLAK_METJA/5-130KSREIE--DYVWVS.....MVIFGLI----------------------------------YN.....-------------
FLAK_METMP/5-130RSREIE--DYIWIV.....LAVFGIL----------------------------------FAIYSA.-------------
LEP4_BACSU/100-204HFMLIP--NRILIF.....FLPFLAA----------------------------------AR.....-------------
Q9HWA5_PSEAE/4-110KRLRVS--NWLILG.....GFLISFV----------------------------------YLY....-------------
Q8FME5_COREF/77-189AVCRLP--DRLVAAT..LLALVLGFL----------------------------------AS.....-------------
Q9CPF6_PASMU/89-199RYQLIS--VQLCYC.....LFWIGVV----------------------------------AA.....-------------
Q9RSQ9_DEIRA/109-347DTMTLP--DELTLP.....GTLLGVL----------------------------------FGLAGAG-------------
Q97HN8_CLOAB/64-168KTKNVY--FFITII.....SFLFSTV----------------------------------FV.....-------------
Q8XQX7_RALSO/14-117RSRRVP--NWLVAV.....GLVLSIV----------------------------------LVK....-------------
LEP4_HAEIN/90-200HYQLIS--TTPCLW.....LLTLGLF----------------------------------GA.....-------------
Q8TMQ5_METAC/5-101RYRRVS--NRSCFL.....MFVISVP----------------------------------FI.....-------------
Q8NQ30_CORGL/4-110KYRRLP--DVLTLP.....GALLI..----------------------------------.......-------------
Q98BF9_RHILO/11-116LSMTIA--NRVSVL.....LVVVFAL----------------------------------VA.....-------------
Y421_METTH/12-138KRGIIP--NRLTFP.....VIGLGLL----------------------------------LNGA...-------------
Q8CXM1_OCEIH/104-208IYMVIP--NKLLLF.....FLPIFII----------------------------------LR.....-------------
A9CKJ3_AGRT5/8-113FSMTIP--NVITVV.....LLLSFAF----------------------------------IA.....-------------
Q8TXH1_METKA/6-112KWGIVP--NRLTYP.....AIVAGAI----------------------------------YA.....-------------
Q8DLL0_THEEB/89-199DTMTLP--HPLTKW.....GLITGLL----------------------------------AR.....-------------
YC8A_METJA/6-148RKREVT--DFLWIS.....MLWVGVF----------------------------------I......-------------
Q9XAP1_STRCO/112-224KVRRLP--DPLTLPLAGAALVLLGLT----------------------------------AL.....-------------
LEP4_MYXXD/113-222DHWILP--LSMTVP.....GMLAGIA----------------------------------LA.....-------------
LEP4_XANCP/133-242RHKLLP--DQLTLP.....LMWLGLV----------------------------------GS.....-------------
Q8TLD4_METAC/26-152KARRVS--NGVWKY.....MLVSGSV----------------------------------FVI....-------------
O67535_AQUAE/105-214YYFILP--PGINIG.....GLVLGIL----------------------------------VS.....-------------
Q988A4_RHILO/13-122RRQIIP--DGLNLA.....LAGIGLS----------------------------------YQ.....-------------
Q8XVK3_RALSO/140-249DTQLLP--DAITQP.....LLWLGLL----------------------------------VN.....-------------
Q87I88_VIBPA/13-110RYRIVK--HRFLLI.....IFITSLL----------------------------------.......-------------
Q8F6L1_LEPIN/127-232FHFSLD--YENLPW.....ILCFGVI----------------------------------SIF....-------------
Q891G5_CLOTE/115-221KTMYVY--FSIILI.....TIFLRIG----------------------------------IFF....-------------
Q9K8H1_BACHD/15-120VYMIIP--DRIILF.....FAILFVL----------------------------------FR.....-------------
LEP4_PSEAE/136-245DHQLLP--DVLVLP.....LLWLGLI----------------------------------AN.....-------------
Q8XI34_CLOPE/100-206DTQDVY--AVTTYP.....AVILGII----------------------------------FALIEK.-------------
Q8EJP8_SHEON/157-266DEMLLP--DQMTLP.....LLWLGLL----------------------------------IN.....-------------
Q9CMH2_PASMU/11-110KSRIIS--NKIVFL.....LLLVMV.----------------------------------.......-------------
Q92T43_RHIME/12-117LTMTIP--NRVSLV.....LLVSFFF----------------------------------VA.....-------------
HOPD_SALTY/9-119RTGLLP--DRFTCP.....LLWGGLL----------------------------------YH.....-------------
Q8FT27_COREF/8-114RTRRLP--DALTLP.....GALMI..----------------------------------.......-------------
Q8THK9_METAC/8-134ETRRVP--NRIWKL.....MLFSLSG----------------------------------FLI....-------------
Q8RAF7_THETN/104-208EHKIIP--NSIIIA.....GFIGALI----------------------------------FR.....-------------
PPPA_ECOLI/130-240DHQWLP--DVFTQG.....VLWTGLI----------------------------------AA.....-------------
Q92YL6_RHIME/12-116ATMTIS--NRVVVF.....LVIAFAI----------------------------------LA.....-------------
Q89PI9_BRADU/13-114ATRLIR--NEICLV.....LAFLGIV----------------------------------T......-------------
Q89UH6_BRADU/9-113FTMTIS--NRVSLA.....LVAGFFA----------------------------------LA.....-------------
Q87M36_VIBPA/5-111QKHRIP--NKAVLL.....LLVAVTA----------------------------------NV.....-------------
Q8Y6Y1_LISMO/101-204FYLYVP--NSILIV.....FFCVLAT----------------------------------IA.....-------------
Q89HG8_BRADU/40-149RHYLIP--NELTGT.....AFALALL----------------------------------RAGA...-------------
Q8YXA0_NOSS1/108-226DTMTLP--NPLTKS.....GLVLGLV----------------------------------FQMIVG.-------------
Q9X222_THEMA/103-204ETYLIP--DYLNFT.....VLIFSFV----------------------------------VA.....-------------
LEP4_VIBCH/112-221KSMLLP--NLLTYP.....IFMLAFI----------------------------------Y......-------------
Q989C3_RHILO/11-122TTQKIA--NRDALL.....LLCLGAG----------------------------------SLLL...-------------
LEP4_ECOLI/81-190RTQLLP--DKLTLP.....LLWLGLV----------------------------------FN.....-------------
Q9ABP2_CAUCR/121-230EHLWLP--DRLTLP.....FGALGVI----------------------------------AT.....-------------
Q8Y1N3_RALSO/10-114RTRRIP--NRLVAA.....GLAAALI----------------------------------AQ.....-------------
Q88QB9_PSEPK/4-110RQRQIS--NVLTLG.....AAGCALA----------------------------------WLF....-------------
Y83C_METJA/9-115KERIIP--HKYTIA.....MIIINLV----------------------------------VGY....-------------
Q87VV0_PSESM/5-111RRKEIL--NGLTLG.....AAALAAG----------------------------------YLA....-------------
O29326_ARCFU/8-129ESRIVP--NRVWKR.....MLLVSLP----------------------------------ITV....-------------
Q97FF6_CLOAB/100-211DTTNVY--LCTTLP.....GIISGII----------------------------------FIAINI.-------------
Q8RHE5_FUSNN/7-119NKKYIP--NVLNFS.....ILVLSIF----------------------------------ICG....-------------
Q980Y8_SULSO/10-125KYREVD--PKIWIY.....YSPLCLF----------------------------------II.....-------------
Q8R8E5_THETN/6-111KRKEID--NWVPAA.....ILTYGII----------------------------------LN.....-------------
LEP4_SYNY3/108-223DTMTLP--NSLTKP.....GLVLGLL----------------------------------FHLL...-------------
A0KPV9_AERHH/142-247DKMLLP--DQLTLP.....LLWGGLL----------------------------------FN.....-------------
A5EXL5_DICNV/138-247EHQLLP--DRLTLP.....LLWLGIL----------------------------------AA.....-------------
A9H675_GLUDA/111-216KSFRLP--DTLTVP.....LIAAGLG----------------------------------LA.....-------------
C9R2X4_AGGAD/10-108RSRLIS--NRVVLF.....LLLVIIP----------------------------------FS.....-------------
C9R6J1_AGGAD/90-198HYRLIS--PALCQA.....LFTLGLG----------------------------------AA.....-------------
E0SLF4_DICD3/139-243RTQLLP--DVMTLP.....LLWGGLL----------------------------------FN.....-------------
G1UB88_HAEDU/13-108RSRIIT--NKVVLA.....LFCAILP----------------------------------FS.....-------------
H7C7G6_CAUCR/11-113TSYTIP--NWISLA.....LIAAFVP----------------------------------AA.....-------------
H9L4S3_VIBCH/135-244DTLLLP--DQLTLP.....LLWGGIA----------------------------------LA.....-------------
I6Y9M6_MYCTU/5-108RQRRLP--NWLTLP.....GAGVILL----------------------------------FA.....-------------
LEP4_BURPS/162-269QTGFLP--DSLTLP.....LLWAGLC----------------------------------VN.....-------------
Q0WIM7_YERPE/129-236DTYLLP--DCMTIP.....LLWLGLL----------------------------------IN.....-------------
Q5F692_NEIG1/134-242DTQYLP--DSMTLP.....LIWLGLI----------------------------------FN.....-------------
Q5ZVB6_LEGPH/138-246DHQLLP--DSLTLG.....LLWIGLI----------------------------------AN.....-------------
Q65GL0_BACLD/102-205THMIIP--DAVLCF.....FLPVFAV----------------------------------GR.....-------------
Q7MJZ8_VIBVY/10-109LKRKIY--NANLAV.....LVFVSTY----------------------------------YR.....-------------
Q9PAI1_XYLFA/133-241RTRLLP--DQLTLM.....LMWLGLI----------------------------------GS.....-------------

PF04258

SIPL5_ARATH/240-524.............................GNTSILSLVVLLFCFV-----VAILWFMNRKTS.HAWAGQDIFGICMMINV
SPP2A_MOUSE/214-499.............................KNIKVSLIFLSGLCIS-----VAVVWAVFRNEDRWAWILQDILGIAFCLNL
SIP_ARATH/47-323..................FKSLE......VEFTKSQVVAGIPGTF-----FCAWYAWKKH.....WLANNILGLSFCIQG
SPP2B_HUMAN/213-505.............................KRPQARMLLLALFCVA-----VSVVWGVFRNEDQWAWVLQDALGIAFCLYM
Q9VPQ7_DROME/71-359............GEGKHKEDIVN......YKFSTHDIVCLVISSA-----IGVWYLLKKH.....WIANNLFGLAFAING
Q9VBL1_DROME/96-408.............................GRFTAAELFSFTLSVS-----IVCIWVLTGH.....WLLMDAMGMGLCVAF
SIPL4_ARATH/241-527.............................GAVSYLTLAICPFCIA-----FAVFWAVKRQYS.YAWIGQDILGISLIITV
SIPL2_ARATH/242-525.............................GPISYLTLAVSPFCIV-----FAVLWAVYRVHS.FAWIGQDVLGIALIITV
YL8H_SCHPO/31-282.................................FGKITATMSSIA-----IALFYFKTKH.....WMASNILAWALAANS
YKK0_YEAST/145-510IEKDHWMKHFYRRELVEPKDIKSKRQISNMYLNSALIVSFVLSIV-----STVYFYLSPND....WLISNAVSMNMAIWS
SPPL3_MOUSE/60-374.............................GRFTAAELLSFSLSVM-----LVLIWVLTGH.....WLLMDALAMGLCVAM
IMP2_CAEEL/55-450GNKEMEEGDIEDAKKKETEYLFK......IDFDRYDIIALLMCSP-----ILISHLLKRH.....WITNNIIGVSFSILG
HM13_MOUSE/62-350............GSGENKEEIIN......YEFDTKDLVCLGLSSV-----VGVWYLLRKH.....WIANNLFGLAFSLNG
Q93346_CAEEL/275-601.......................TCGGRIHQYKYSEAFIGIICLS-----FCVTWFIIRRQP.YAFILLDVINMALCMHV

PF06550

Q9HM09_THEAC/1-278-----------------------------FLYNVYAIFTVSIVVA-----IVFFYMILFRNE---WYVTDLAGFFLSVGI
Q9HQ23_HALSA/15-306-----------------------------V.VVAG.VNLAVWGPA-----LALVGALYAYPE---WWVIDAAGAIMGMGA
Q8TIY9_METAC/27-303-----------------------------IPALAGLENIASLLLS-----IGLTVLLYKYPE---WYVIDLLGVCIAGGV

PF01080

D3B5F5_POLPA/149-528.......N---------------------IALDYLTFVFVVWNFS.AGGIVCIFW..FCP-----KYLNQAYLICLSAFL
G4VJ47_SCHMA/58-484.......G---------------------VFVDYITVAFALWNFG.VVGMIVIHW..RGP-----LVLQQAYLIFISAQI
E9C2Q6_CAPO3/204-586.......N---------------------VAMDWVTFAFVIWNFG.CVGVVAVHW..KAP-----LLLQQAYLITTSALL
T1KI16_TETUR/103-479.......N---------------------LPVDYISVSIFIWNFG.ILGMICIHW..KGP-----LIVQQAYLLVVSALM
K7J3W8_NASVI/92-490.......N---------------------IPMDIITLAIGLWNFG.VVGMVCIHW..QGP-----LSLQQAYLIFIAALM
U6IMP9_HYMMI/46-488.......R---------------------IFFDNITFAILLWNFG.VLGLISIHW..RGP-----LVLQQAYLIFNSVVV
W5JK58_ANODA/96-499.......N---------------------VPMDWFTAGLLVWNFG.VVGMISIHW..QGP-----LRLQQGYLIFVAALM
E9FSB0_DAPPU/62-438.......N---------------------IPLDYISLLFIMWNFG.VVGMIAIHW..KAP-----LHLQQAYLIFVAALM
C5WT76_SORBI/25-446.......R---------------------FPLDAVSFALLLPNAAGALALAALAP.ASVP-----IALHQAALVAVAVLT
C3Z2C5_BRAFL/88-496.......N---------------------IPCDYITLAIVMWNFG.AVGMVCIHW..KGP-----LLLQQAYLIVISALM
H2TY46_TAKRU/29-412.......N---------------------VAMDYPTVGLLIWNFG.AVGMICIHW..KGP-----LQLQQIYLILISALM
H3AT04_LATCH/77-455.......N---------------------VAMDYITVALIIWNFG.VVGMICIHW..KGP-----LRLQQAYLIMISALM
I1HEG8_BRADI/69-507.......D---------------------VPLDAPTALLLLFNAS.AVGVLSVFA.SAVP-----ILVRQGYMVTLAVIV
W4XU10_STRPU/68-474.......N---------------------IPMDYFTIAVIMWNFG.MVGMVSIHW..KGP-----LRLQQLYLIVISALM
G7Y344_CLOSI/42-431.......G---------------------IFVDYITMAFILWNFG.VVGMVVIHW..RGP-----LILQQAYLIFISAQI
B7Q2V0_IXOSC/41-421.......N---------------------VPMDYLTVALVMWNFG.VVGMISIHW..KGP-----LLLQQAYLILVSALM
PSN1_RAT/76-458.......N---------------------VAVDYITVALLIWNFG.VVGMIAIHW..KGP-----LRLQQAYLIMISALM
T1JMG4_STRMM/67-438.......N---------------------VPMDYITLVFIMWNFG.VVGMICIHW..KGP-----LLLQQAYLIVVAALM
T1G6P3_HELRO/9-376.......N---------------------TATDFISTGFNLWNFG.LMGILAIHW..KSP-----LIVQQFYLIVVSALM
D7LLE1_ARALL/15-389.......R---------------------FPIDSITFLILLFNFS.VVGVFAVFM.SKFS-----ILITQGYLVWIGVLV
A2G9L8_TRIVA/13-428.......N---------------------IPIDYIAVVIFLLNGV.VVGGMSIFW..RAP-----PIVTQAFMIWISVMT
F6RA92_CIOIN/37-422.......N---------------------TAVDYITVVIVLWNFG.VVGMICIHW..KGP-----LLLQQAYLIIVSSLM
I3IV36_ORENI/95-480.......N---------------------LAMDYITLAIIIWNFG.VVGMMCIHW..KGP-----LRLQQAYLIMISALM
H2Z6F8_CIOSA/7-395.......N---------------------TPMDYITVAVVLWNFG.VVGMICIHW..KGP-----LLLQQAYLIVVSSLM
K1PKB7_CRAGI/84-479.......N---------------------VAMDYITVALLMWNFG.VVGMICIHW..KGP-----LFLQQAYLIVISALM
S2K404_MUCC1/83-504.......S---------------------IALDYITLVFALWNFA.VVGLVSIFW..KGP-----LWLQQSYLTIMSSLM
H3FRQ2_PRIPA/66-481.......N---------------------CCVSWPTVLIGLFNFA.AMGMICIHW..KGP-----LLMQQAYLISVSALM
E0VJ41_PEDHC/87-467.......N---------------------IPMDYFTLTIIMWNFG.VVGMICIHW..KGP-----LLLQQAYLIFIAALM
E2AIY0_CAMFO/93-484.......N---------------------IPMDLFTLGIGLWNFG.VVGMICIHW..QGP-----LQLQQAYLIFISALM
F4PRZ5_DICFS/219-583.......N---------------------VGLDYFTFSFIVWNFS.AGGMVCLFW..FCP-----QYLTRAYLVSISSLM
B0WS38_CULQU/61-516.......N---------------------IPFDYPTALLLMWNFG.VVGMISIHW..QGP-----LRLQQGYLIFIAALM
U6HU93_ECHMU/45-476.......M---------------------IFFDNITFAILLWNFG.VLGLISIHW..RSP-----LILQQAYLIFNSVQM
E2BSL4_HARSA/95-504.......N---------------------IPMDFFTLSIGLWNFG.AVGMICIHW..QGP-----LQLQQAYLIFISALM
H9J5W9_BOMMO/68-456.......N---------------------IPMDYITLGFVLWNFG.VMGMIVIHW..KGP-----LRLQQAYLIFIAALM
G3Q8S2_GASAC/77-448.......N---------------------LAVDYPTVGVIIWNFG.TVGMICIHW..KGP-----LQLQQAYLILISALM
F6GSZ0_VITVI/15-427.......S---------------------FPIDCITFLVVLFNFT.VVGVLAVFM.SKMA-----ILVTQGYLVVIGMLV
B4QRZ4_DROSI/98-517.......N---------------------IPMDYPTALLIMWNFG.VVGMMSIHW..QGP-----LRLQQGYLIFVAALM
SPE4_CAEEL/11-464FDQDDNNQ---------------------YYMTIVLIVVPTVVYG.FGGIYAFFS..NSS-----LILHQIFVVTNCSLI
C7J054_ORYSJ/30-449.......R---------------------LPLDAASFALLLPNAAAALALAALSP.ASVP-----IALHQAALVAIAVLT
T1HN85_RHOPR/7-402.......N---------------------IPFDFITLCLFMWNFG.TMGMICIHW..KGP-----LHMQQAYLIFLAALM
A9S846_PHYPA/9-467.......S---------------------IPIDVITFLICTINFA.SVGVAAVFF.CRMP-----IMVTQGYLIVIGMLV
E3N426_CAERE/9-463LDQNDENQ---------------------YILTVALTVIPTTIYG.VLGIYAFFA..NGS-----LALHQFFVISNCSLI
D8LTV7_ECTSI/63-572.......Q---------------------LPCDAFTYYGVLWNFA.VVGVVAIFYQKGIP-----TVVTQAYLVATSIIM
H3CB70_TETNG/22-406.......N---------------------VAVDYPTVALLLWNFG.AVGMVCIHW..KGP-----LQLQQLYLILVSALM
G2J6Q7_CAEBR/9-477FDQNDENQ---------------------FILTVALTVIPTVVYG.CLGIYAFLA..NGS-----LLLHQFFVVSNCSLI
I1N8G3_SOYBN/8-407.......S---------------------VPLDAVTSFLLLFNFA.VVGVLSVFAGGGLP-----ILLRQCYTVCLGIIV
G3W888_SARHA/88-452.......N---------------------VAMDYPTLFLVIWNFG.AVGMICIHW..KGP-----LVLQQAYLIMISALM
PSN_CAEEL/44-434.......D---------------------VSPSALLVLFGLGNYG.VLGMMCIHW..KGP-----LRLQQFYLITMSALM
F2CQD9_HORVD/22-450.......D---------------------APLDAPTALLLLFNAS.AVGVLSVFA.SAVP-----ILVRQGYMVALAVIV
W5N759_LEPOC/69-512.......N---------------------VGMDYITLAVIIWNFG.VVGMICIHW..KGP-----LRLQQAYLIMISALM
Q7PR98_ANOGA/98-513.......N---------------------VPMDWFTAGLLVWNFG.VVGMISIHW..QGP-----LRLQQGYLIFVAALM
M1CAI2_SOLTU/15-421.......R---------------------IPIDCVTFALSLFNFT.VVGVLAVFM.SKTA-----IIITQVYLVVIGVLV
W1NQ31_AMBTC/9-446.......S---------------------IPIDSITCFILLFNFC.VIGVLSVFS.GGVP-----IIVRQVYMVLLGIIV
K3WL66_PYTUL/82-563L......G---------------------WPVDWITFLFVMINFG.FVGVISIFYQKGTP-----KFVQNGYLVLVSVIL
A2DZ73_TRIVA/13-381.......N---------------------IPVDYLSLAVFLLNLV.VVGNMSIFW..RAP-----QRITQAFLVLISILT
G0NCU3_CAEBE/9-464FDQNDENG---------------------FLMTVFCTVIPTVVYG.CLGIYAFLA..NGS-----LLLHQFFVVSNCSLI
U9UMQ1_RHIID/178-561.......Q---------------------IPMDYVTLSFALWNFA.AVGLISVFW..KGP-----LLLQQTYLTIMSSLM
T1EFZ6_HELRO/89-576.......N---------------------IPMDYITTAVFLWNFG.VLGIMCIHW..KGP-----LLLQQFFLIVVSALM
B7QGI2_IXOSC/14-384.......N---------------------FPMDHLSCSFIVWNIG.MTGMGTLYY..KGP-----FVMHQGFVIYVSILM
A8PAF6_BRUMA/94-527.......N---------------------VPVDYILICIFIWNYG.VMGMICIHW..KGP-----LRMQQGYLIMMSALM
S2J107_MUCC1/49-424.......N---------------------MPMDYLTMLFCTWNVA.VVGVVAIFW..KSP-----LWVQQVYLVLVSAAT
D3B4U3_POLPA/99-477.......N---------------------LALDYITFAFIMFNFS.VGGIIAVFW..YAP-----VLMNQGYLVLISTLM
H2VWC4_CAEJA/11-477VDQETENG---------------------RNLTLVLTILPTLVYG.LAGIVAFLA..NGS-----LLLHQCFVVSNCSLI
A9VBA9_MONBE/203-602.......N---------------------ASIDWITMAFIIWNFG.TVGFIAIFW..RSP-----LAVQQVYLVIVSALM
F2TYS0_SALR5/109-504.......N---------------------STLDWITMVVSIWNFG.VVGLICIHW..KGP-----LLLQQVYLVAVSALM
E1G929_LOALO/15-397GLQTAPP.---------------------.....IFTALIVITYG.TVGILVFFT.KKTP-----LYMHQFYVICNCSLV
H3FRQ2_PRIPA/544-933.......N---------------------WCMSNATALFGLFNYA.AMGMICIHW..KGP-----LLMQQAYLISVSALM

PF01478

FLAK_METJA/5-130-----------------------------......G.YLS.FISH--------------------DMLYVIQS...IVGF
FLAK_METMP/5-130-----------------------------..ITLSN.YSI.LINS--------------------ISGFVICF...ILGY
LEP4_BACSU/100-204-----------------------------........LIS.PLDS--------------------WYAGLLGA...AAGF
Q9HWA5_PSEAE/4-110-----------------------------.....VKESSL.TGAT--------------------VNMAMTAL...FIGV
Q8FME5_COREF/77-189-----------------------------.......AAVGGTWND--------------------WVRALLAG...LVLL
Q9CPF6_PASMU/89-199-----------------------------.......YVEV.SPLH--------------------LEQSLQSA...LTGF
Q9RSQ9_DEIRA/109-347-----------------------------LYAQEGQL....GLPN--------------------VAQAVEGA...LMGA
Q97HN8_CLOAB/64-168-----------------------------......MITYF.SGNC--------------------IEDYVVGA...VAMG
Q8XQX7_RALSO/14-117-----------------------------.....FGSVVA.LAYD--------------------WRDVWLGG...AIAL
LEP4_HAEIN/90-200-----------------------------.......DNNF.SLLT--------------------LSESIKSA...ASFF
Q8TMQ5_METAC/5-101-----------------------------............VQLI--------------------SVRYVITV...GLIF
Q8NQ30_CORGL/4-110-----------------------------........NLW.ALTI--------------------YPQWMLGG...LVWA
Q98BF9_RHILO/11-116-----------------------------......PLTGM.EWAA--------------------YGWHFAAG...ALVL
Y421_METTH/12-138-----------------------------.....RALMES.DPWI--------------------FIYTAIFT...AGIF
Q8CXM1_OCEIH/104-208-----------------------------........LLL.PLDP--------------------WWSMFTGA...AIGF
A9CKJ3_AGRT5/8-113-----------------------------......PFAGM.DFQT--------------------FGLSLAGG...LIVF
Q8TXH1_METKA/6-112-----------------------------........AVI.DPSH--------------------LGYALLDA...GVAF
Q8DLL0_THEEB/89-199-----------------------------.......GLTT.GLGG--------------------ITEGIIAA...VIGI
YC8A_METJA/6-148-----------------------------........HLL.YNKS--------------------LLLFFIEI...FAVL
Q9XAP1_STRCO/112-224-----------------------------........VPE.HAGE--------------------CTTALLGALALGAGY
LEP4_MYXXD/113-222-----------------------------........FPL.GMDA--------------------FRDALMGA...AVGF
LEP4_XANCP/133-242-----------------------------........MDN.LYMP--------------------AKPALLGA...AVGY
Q8TLD4_METAC/26-152-----------------------------.....YELFTG.GTPY--------------------LKALFLSG...VVVF
O67535_AQUAE/105-214-----------------------------........PFR.QDIT--------------------PKESIIGA...VVGV
Q988A4_RHILO/13-122-----------------------------........LAA.DADA--------------------MPQRLLFA...AATF
Q8XVK3_RALSO/140-249-----------------------------........LFS.MFAR--------------------LPDAVIGA...TAGY
Q87I88_VIBPA/13-110-----------------------------........SLF.FTPE--------------------PLTQLAVS...TSVF
Q8F6L1_LEPIN/127-232-----------------------------.....LLDGKL.PGLN--------------------DLFVLGGF...FFTF
Q891G5_CLOTE/115-221-----------------------------.....LEGDKI.NFIF--------------------YNYFLAGF...IPAM
Q9K8H1_BACHD/15-120-----------------------------........ATLAPLNP--------------------WWDAWAGA...VVGY
LEP4_PSEAE/136-245-----------------------------........HFG.LFAS--------------------LDDALFGA...VFGY
Q8XI34_CLOPE/100-206-----------------------------...FYFGEN......L--------------------LNYFMGLV...ISAL
Q8EJP8_SHEON/157-266-----------------------------........LNH.TFTS--------------------PADAMIGA...AAGY
Q9CMH2_PASMU/11-110-----------------------------........PLA.WIQH--------------------KQIFFLPA...LLTL
Q92T43_RHIME/12-117-----------------------------......PLAGL.DLAQ--------------------LGLHTVAA...GLIF
HOPD_SALTY/9-119-----------------------------........QIC.LPER--------------------LPDALWGA...IAGY
Q8FT27_COREF/8-114-----------------------------........TGW.AVVV--------------------DPWLLLGG...AGWF
Q8THK9_METAC/8-134-----------------------------.....YEIVEG.GILF--------------------MLQLVFSF...FSSF
Q8RAF7_THETN/104-208-----------------------------........LLM.YSYG--------------------FLDYILGF...LLGG
PPPA_ECOLI/130-240-----------------------------.......WAQQ.SPLT--------------------LQDAVTGV...LVGF
Q92YL6_RHIME/12-116-----------------------------......PAAGL.NLAT--------------------VMSSVVVA...SAVL
Q89PI9_BRADU/13-114-----------------------------........QLP.NAIQ--------------------IAESLIAA...AILF
Q89UH6_BRADU/9-113-----------------------------......LSGGM.APYE--------------------MLGHVGAG...ALVL
Q87M36_VIBPA/5-111-----------------------------........LYS.PSVS--------------------LLDHAYGG...LVAF
Q8Y6Y1_LISMO/101-204-----------------------------.......ILYN.QSLM--------------------DLIYSGGI...SCLF
Q89HG8_BRADU/40-149-----------------------------....FVPDVGLEALIW--------------------PLARAAAV...ALPL
Q8YXA0_NOSS1/108-226-----------------------------..YAADPTLSG.LIRH--------------------LMMGIVGA...VLGL
Q9X222_THEMA/103-204-----------------------------............LRTS--------------------FLEHLISF...LIVT
LEP4_VIBCH/112-221-----------------------------........VQQNPALT--------------------VESSIIGG...FAAF
Q989C3_RHILO/11-122-----------------------------.....LSLQSG.SWWD--------------------MGLSAIAA...LVLF
LEP4_ECOLI/81-190-----------------------------........AQY.GLID--------------------LHDAVYGA...VAGY
Q9ABP2_CAUCR/121-230-----------------------------........LAI.GEVP--------------------VWTPLVGA...AVGF
Q8Y1N3_RALSO/10-114-----------------------------......CAMLG.PVAG--------------------ALAWLGGA...AAGM
Q88QB9_PSEPK/4-110-----------------------------.....STGHSW.IGAE--------------------ASEAGWAL...AIVM
Y83C_METJA/9-115-----------------------------......YY....FGFN--------------------AIIAFFST...LILC
Q87VV0_PSESM/5-111-----------------------------.....VTGLTW.LGSP--------------------PLEGALAL...VLAL
O29326_ARCFU/8-129-----------------------------.....YQLFLG.KHLI--------------------FEYMIAGI...FVVM
Q97FF6_CLOAB/100-211-----------------------------...FYKNHIYG.YLFA--------------------AFLYSGVI...VLIN
Q8RHE5_FUSNN/7-119-----------------------------.....IDKVDI.FFIG--------------------ASCYTLPI...LIFY
Q980Y8_SULSO/10-125-----------------------------........FSF.HNLF--------------------LPIYLYSF...IITN
Q8R8E5_THETN/6-111-----------------------------........AFL.NPVG--------------------FIESIVYM...LTAF
LEP4_SYNY3/108-223-----------------------------....LGWQRGH.WIVP--------------------LVEAIASA...VLGL
A0KPV9_AERHH/142-247-----------------------------........LAG.GFIP--------------------LADAVIGA...MAGY
A5EXL5_DICNV/138-247-----------------------------........LFN.VFIN--------------------LESSVIGA...MIGY
A9H675_GLUDA/111-216-----------------------------........ALG.GAAP--------------------VLWHALAA...AAGY
C9R2X4_AGGAD/10-108-----------------------------.......L.....LKY--------------------QTIFVIPA...LCTL
C9R6J1_AGGAD/90-198-----------------------------.......YWQI.GTLT--------------------LEQSLQSA...VVFF
E0SLF4_DICD3/139-243-----------------------------........LAD.TFVP--------------------LEQAVVGA...MAGY
G1UB88_HAEDU/13-108-----------------------------.......WFTQ.GMVY--------------------PMPALICL...VIGF
H7C7G6_CAUCR/11-113-----------------------------.......LVSG.APLS--------------------QIGLCLAV...GLGA
H9L4S3_VIBCH/135-244-----------------------------.......LLGF.SPVS--------------------LSDAVIGA...MAGY
I6Y9M6_MYCTU/5-108-----------------------------.......G....LAGR--------------------GVPALAGA...AALA
LEP4_BURPS/162-269-----------------------------........LWG.TFAS--------------------LRAAVIGA...IAGY
Q0WIM7_YERPE/129-236-----------------------------........IDT.VFAP--------------------LTSAVLGA...VSGY
Q5F692_NEIG1/134-242-----------------------------........LDG.GFVP--------------------LQSAVLGA...VAGY
Q5ZVB6_LEGPH/138-246-----------------------------........TQN.VFVS--------------------LDVAVLSC...AGAY
Q65GL0_BACLD/102-205-----------------------------........FLV.PLEQ--------------------WHSSLSGA...MAGG
Q7MJZ8_VIBVY/10-109-----------------------------........HQL.PDAM--------------------WLDATLYA...LLAL
Q9PAI1_XYLFA/133-241-----------------------------........TDN.LFMA--------------------AKPALLGA...VVGY

PF04258

SIPL5_ARATH/240-524LQVARLP-NIRVATILLCCAFFY--DIFWVFISPLIFK..QSVMIAVARGSKDT...........---------------
SPP2A_MOUSE/214-499IKTMKLP-NFMSCVILLGLLLIY--DVFFVFITPFITKNGESIMVELAAGPFEN...........---------------
SIP_ARATH/47-323IEMLSLG-SFKTGAILLAGLFFY--DIFWVFF........TPVMVSVAK................---------------
SPP2B_HUMAN/213-505LKTIRLP-TFKACTLLLLVLFLY--DIFFVFITPFLTKSGSSIMVEVATGPSDSAT.........---------------
Q9VPQ7_DROME/71-359VEMLHLN-NFVTGVILLSGLFFY--DIFWVFG........TNVMVTVAK................---------------
Q9VBL1_DROME/96-408IAFVRLP-SLKVSTLLLTGLLIY--DVFWVFLSSYIFS..TNVMVKVATRPADNPVGIVARKLHL---------------
SIPL4_ARATH/241-527LQIVRVP-NLKVGFVLLSCAFMY--DIFWVFVSKWWFR..ESVMIVVARGDRSG...........---------------
SIPL2_ARATH/242-525LQIVHVP-NLKVGTVLLSCAFLY--DIFWVFVSKKLFH..ESVMIVVARGDKSG...........---------------
YL8H_SCHPO/31-282ISIMRID-SYNTGALLLGALFFY--DIYFVFG........TEVMVTVAT................---------------
YKK0_YEAST/145-510IAQLKLK-NLKSGALILIALFFY--DICFVFG........TDVMVTVAT................---------------
SPPL3_MOUSE/60-374IAFVRLP-SLKVSCLLLSGLLIY--DVFWVFFSAYIFN..SNVMVKVATQPADNPLDVLSRKLHL---------------
IMP2_CAEEL/55-450IERLHLA-SFKAGSLLLVGLFFY--DIFWVFG........TDVMTSVAK................---------------
HM13_MOUSE/62-350VELLHLN-NVSTGCILLGGLFIY--DIFWVFG........TNVMVTVAK................---------------
Q93346_CAEEL/275-601LKCLRLP-SLKWISILMLCMFVY--DAFMVFGTPYMTTNGCSVMLEVATGLSCAAKGKNKGYPVP---------------

PF06550

Q9HM09_THEAC/1-278SSIWGITFGVWAAVAFLIAFEIY--DYIAVYK--------TRHMISLARYAV----------------------------
Q9HQ23_HALSA/15-306AALFGISFGVLPAIVLLTALAVY--DAISVYG--------TEHMLTLASGVM----------------------------
Q8TIY9_METAC/27-303SALIGISLSIIPVVVLLILLAVY--DAISVYK--------TKHMIAMAEGVM----------------------------

PF01080

D3B5F5_POLPA/149-528ALFLAR.FPSWTTWAILVLVSIY..DIFAVLCPGGP----LQQLIETARKRGESI.PALIYNASVFIG............
G4VJ47_SCHMA/58-484SLMFLKYLPKWTCWLVLAALSVW..DIVAVLCPNGP----LRLLVEMAHERQQPLFPALLYSTTTVYLVKKHQPVEKVEN
E9C2Q6_CAPO3/204-586ALTLIKHLPEWTTWVLLAAIAVY..DLFAVLCPRGP----LKVLVETAQERNEPIFPALIYSSTMAWIA...........
T1KI16_TETUR/103-479ALVLIKYIPEWTVWVILAVISVW..DLVAVLCPKGP----LRILVETAQSRNESIFPSLIYSSAVTYF............
K7J3W8_NASVI/92-490ALVFIKYLPEWTAWAVLAVISIW..DLIAVLTPKGP----LRILVETAQERNESIFPALIYSSTVMYAFTMNFTGYVAA.
U6IMP9_HYMMI/46-488ALTLLRFLPKWTCWVLLGAISIW..DLIAVLCPRGP----LRMLVEMAQERNLPLFPAIIYSTAAAYIADT.........
W5JK58_ANODA/96-499ALVFIKYLPEWTTWVVLAVISIW..DLIAVLTPKGP----LRILVETAQERNEQIFPALIYSSTIMYSYL..........
E9FSB0_DAPPU/62-438ALVFIKYLPEWTTWVVLGVISIW..DLVAVLSPRGP----LRILVETAQSRNEPLFPALIYSSTVAYM............
C5WT76_SORBI/25-446AFWFTM.LPEWTTWALLVAMAIY..DLAAVLLPGGP----LRVLLELAIQRNEEI.PALVYEARPVDPRHGRNWRLWRE.
C3Z2C5_BRAFL/88-496ALVFIKYLPDWTTWFILGAISLY..DLVAVLCPKGP----LKVLVETAQERNEPIFPALIYSSTMMWF............
H2TY46_TAKRU/29-412ALVFIKYLPEWSAWVILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWA............
H3AT04_LATCH/77-455ALVFIKYLPEWTGWLILVVISVY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSTMVWL............
I1HEG8_BRADI/69-507AAWLSR.LPEWTTWIMLVALAVY..DLVAVLAPRGP----LRMLVELASSRDDEL.PALIYESRPTVGPAERSSSYAPA.
W4XU10_STRPU/68-474ALIFIKYLPEWTLWTILAAIAVY..DLFAVLCPKGP----LRMLVETAQERDEQIFPALIYSSTMVWL............
G7Y344_CLOSI/42-431ALMFLKYLPKWTCWVLLGALAVW..DLVAVLCPRGP----LRMLVEMAHEREQPLFPALLYSTTAVY.............
B7Q2V0_IXOSC/41-421ALVFIKYLPDWTAWVVLGVISVW..DLIAVLCPKGP----LRILVETAQERNEPIFPALIYSSAMVWNV...........
PSN1_RAT/76-458ALVFIKYLPEWTAWLILAVISVY..DLVAVLCPKGP----LRMLVETAQERNETLFPALIYSSTMVWL............
T1JMG4_STRMM/67-438ALVFIKYLPDWTTWVVLGVISVW..DLIAVLCPKGP----LRILVETAQERNEPIFPALIYSSTVVY.............
T1G6P3_HELRO/9-376ALTFIKHLPGWTAWALLIVISVW..DLIAVLTPKGP----LKGLVNISSERRENLFPALVYSSTPFS.............
D7LLE1_ARALL/15-389AYFFTL.LPEWTTWVLLVALALY..DIAAVLLPVGP----LRLLVEMAISRDEDI.PALVYEARPVIRNDSR....LVQ.
A2G9L8_TRIVA/13-428ACVFLT.LPDWTVWILLVLLIIW..DCCVVLCPNGL----LHLLIKKSQERGDAI.PALVYSSAAFFWKEADDG......
F6RA92_CIOIN/37-422ALVFIKYLPEWTAWVILGFISIY..DLLAVLCPKGP----LRMLVETAQSRNESLFPALIYSSGMMWT............
I3IV36_ORENI/95-480ALVFIKYLPEWTAWLILAVISVY..DLLAVLCPKGP----LRILVETAQERNEPIFPALIYSSTMVWL............
H2Z6F8_CIOSA/7-395ALVFIKYLPEWTAWLILGLISIY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSGMMWT............
K1PKB7_CRAGI/84-479ALVFIKYLPDWTTWVVLGVMVIW..DLVAVLCPKGP----LRILVETAQERNEPIFPALIYSSTMIWSV...........
S2K404_MUCC1/83-504AFSLTG.LEQWTTWILLGLLAIWAIDLIAVLCPFGP----LRLLIESSRNQQREV.PALLYSVNAVWFMMASN..DHFR.
H3FRQ2_PRIPA/66-481ALMFIKMLPDWTVWALLFLISVW..DLIAVLCPKGP----LNMLVKMSQERNEPIFPALIYSSGILLPY...........
E0VJ41_PEDHC/87-467ALVFIKYLPEWTAWVVLAVISIW..DLIAVLTPRGP----LRILVETAQERNEQIFPALIYSSTFMYNY...........
E2AIY0_CAMFO/93-484ALVFIKYLPEWTAWVVLGVISIW..DLIAVLTPKGP----LRILVETAQERNESIFPALIYSSTILYSFTVTYAGYVQA.
F4PRZ5_DICFS/219-583AIFISR.MPEWSTWSILTIVSLY..DIFTVLSPGGP----LKKLIDLAKERGDEI.PALVYNGSVSIG............
B0WS38_CULQU/61-516ALVFIKYLPEWTTWVVLAVISIW..DLIAVLTPKGP----LRILVETAHERNEQIFPALIYSSTIMYSYM..........
U6HU93_ECHMU/45-476ALIFLKFLPKWTCWVLLGALAIW..DLIAVLCPRGP----LRMLVEMAQERNQPLFPAMVYSTTTAYIATTQP.......
E2BSL4_HARSA/95-504ALVFIKYLPEWTAWAVLGVISIW..DLIAVLTPNGP----LRILVETAQERNESIFPALIYSSTILYSFTVSYAGYVQA.
H9J5W9_BOMMO/68-456ALVFIKYLPEWTTWAVLAVISIW..DLVAVLTPKGP----LRILVETAQERNEPIFPALIYSSTVMYCM...........
G3Q8S2_GASAC/77-448ALVFIKFLPEWSAWLILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWT............
F6GSZ0_VITVI/15-427AYWFTL.LPEWTTWVLLVAMALY..DLAAVLLPGGP----LRLLVELAISRDEDI.PALVYEARPVTYQDSCPGGGVAQ.
B4QRZ4_DROSI/98-517ALVFIKYLPEWTAWAVLAAISIW..DLIAVLSPRGP----LRILVETAQERNEQIFPALIYSSTVVYALVNT........
SPE4_CAEEL/11-464SVFYLRVFPSKTTWFVLWIVLFW..DLFAVLAPMGP----LKKVQEKASDYSKCVLNLIMFSANEKRLTAGSNQEETNE.
C7J054_ORYSJ/30-449AFWFTL.LPEWTTWALLVAMAVY..DLAAVLLPGGP----LRLLLELAIERNEEI.PALVYEARPVDPRHGHNWRLWRE.
T1HN85_RHOPR/7-402ALIFIKYLPEWTTWVVLAVISVW..DLFAVLTPKGP----LRILVETAQERNEQIFPALIYSSTVIYSL...........
A9S846_PHYPA/9-467AFWFTK.LPEWTTWVLLLAMAAY..DVVAVLTPRGP----LNLLVELAIERDEDI.PALIYEARPTVSGRMQMPPSPAQ.
E3N426_CAERE/9-463SVFYLRAFPRYTTWFVLWMVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKFLMFAAEDKRETAGIDATEDSS.
D8LTV7_ECTSI/63-572AWQLSR.FEEWTGWCLLVVLALY..DLCAVLTPCGP----LKALVNLMQEYEEPM.PGLLYEAELPAGPPRRRRPENDR.
H3CB70_TETNG/22-406AL.FIKYLPEWSAWVILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWT............
G2J6Q7_CAEBR/9-477AVFYLRAFPKHTTWFVLWTVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKILMFAAEDKRESAGMDMAQDSQ.
I1N8G3_SOYBN/8-407AAWFTK.LPEWTTWTVLVALALY..DLVAVLAPGGP----LKLLVELESSRNEEL.PALVYEARPTVNTRNHAAAVGFI.
G3W888_SARHA/88-452ALVFIKYLPEWSAWVILGAISVY..DLVAVLCPKGP----LRMLVETAQERNEPIFPALIYSSAMVWT............
PSN_CAEEL/44-434ALVFIKYLPEWTVWFVLFVISVW..DLVAVLTPKGP----LRYLVETAQERNEPIFPALIYSSGVIYPYVL.........
F2CQD9_HORVD/22-450AAWLSR.LPEWTTWIMLLALAVY..DLVAVLAPRGP----LRMLVELASSRDDEL.PALIYESRPTVGPAETSSSYAPA.
W5N759_LEPOC/69-512ALVFIKYLPEWTAWLILAVISVY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSTMVWL............
Q7PR98_ANOGA/98-513ALVFIKYLPEWTTWAVLAVISIW..DLIAVLTPKGP----LRILVETAQERNEQIFPALIYSSTIMYSYL..........
M1CAI2_SOLTU/15-421AYWFTL.LPEWTTWVLLVAMSLY..DLAAVLLPGGP----LRLLVELAISRDEDI.PALVYEARPIINPDSVQRGAVVQ.
W1NQ31_AMBTC/9-446AVWFTK.LPEWTTWVILVALALY..DLVAVLAPGGP----LKMLVDLASSREEEL.PALIYEARPTISTGSGPRESAMNL
K3WL66_PYTUL/82-563AWEFSM.WPMWTTITFCFMFAIY..DLCAVLTPCGP----LKCLINLIQEKQAPL.PGLLYEADVRDGVTNQPHQQPAA.
A2DZ73_TRIVA/13-381SIVFRY.LPDWTVWILLVLLIIY..DACVVLCPNGL----LILLLKKSEERGDAI.PALLYSAAAWEEADPEKGNQNNE.
G0NCU3_CAEBE/9-464SVFYLRAFPRYTTWFVLWTVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKFLMFAAENKRASAGMDMLEGSE.
U9UMQ1_RHIID/178-561AFSLTN.LSSWTTWILLALLAIW..DLIAVLCPFGP----LRILVESSRNDKREI.PALLYSVNAVWLMASPGLSNKFR.
T1EFZ6_HELRO/89-576ALTFIKHLPDWTTWVLLAVISIW..DLVAVLAPKGP----LRSLVKLAQERNDPIFPALIYSTTMAWL............
B7QGI2_IXOSC/14-384AVVLEESFPEWTAWILMILVSLW..DMFAVLCVIGP----LRMLIETAHERNEPLFPALLFSTSSAWCY...........
A8PAF6_BRUMA/94-527ALIFIKYLPEWTVWTVLAVISIW..DLVAVLCPKGP----LRILVETAQERNEPIFPALIYSSGLLYAYTL.........
S2J107_MUCC1/49-424SISMLR.MPPWTTWTVLIAVAIY..DLFAVLCPAGP----LRLLITMAEERQENI.PALVYSAGMASFDTEDDFIGGYR.
D3B4U3_POLPA/99-477AISISR.LPDWTTWVILSVISIY..DLFAVLCPRGP----LKVLVETAQERNETI.PALIYNANFEPPSRPESIPKPPQ.
H2VWC4_CAEJA/11-477AVFYLRAFPRHTTWFVLFIVLFW..DLFAVLTPMGP----LKRVQEKASDYSNNILKFLMFAADDNRQSAGADRAEEVN.
A9VBA9_MONBE/203-602ALVLIKNLPDWTTWVLLAAIAIY..DLFAVLSPCGP----LKCLVEVAQERNQPLFPSLIYSSTMMWT............
F2TYS0_SALR5/109-504ALVLIKNLPDWTTWVVLAAIAIY..DLVAVLSPCGP----LKALVETAQERDEPLFPALIYSSTMAWI............
E1G929_LOALO/15-397SVFYLRMFPTHTAWFVLVCIIIW..DTFAVLAPVGP----LRRINEKAHEYSDQVLRFLMFTAEDKNDEPYEEITVNKS.
H3FRQ2_PRIPA/544-933ALMFIKMLPDWTAFALLVLISIW..DLVAVLCPKGP----LNMLVKMSQERNEPIFPALIYSSGILLPY...........

PF01478

FLAK_METJA/5-130IVCFFLG................--.......................................................
FLAK_METMP/5-130MMFLS..................--.......................................................
LEP4_BACSU/100-204LFLAVI.................--.......................................................
Q9HWA5_PSEAE/4-110CLSLP..................--.......................................................
Q8FME5_COREF/77-189LGYFA..................--.......................................................
Q9CPF6_PASMU/89-199FAFYCLYH...............--.......................................................
Q9RSQ9_DEIRA/109-347GVIVLISVYGSWVLRRFRERQWP--EAPIGYQQISLGLLAGAWLGPWWGLGVALLSAAVNVAAKKAVRIPELLTLGGFLV
Q97HN8_CLOAB/64-168IISYI..................--.......................................................
Q8XQX7_RALSO/14-117AGFLP..................--.......................................................
LEP4_HAEIN/90-200IVFYVIYW...............--.......................................................
Q8TMQ5_METAC/5-101LIIFF..................--.......................................................
Q8NQ30_CORGL/4-110GIYFL..................--.......................................................
Q98BF9_RHILO/11-116AVTFG..................--.......................................................
Y421_METTH/12-138ALGYI..................--.......................................................
Q8CXM1_OCEIH/104-208GIIFLI.................--.......................................................
A9CKJ3_AGRT5/8-113LGCFA..................--.......................................................
Q8TXH1_METKA/6-112GVTLV..................--.......................................................
Q8DLL0_THEEB/89-199WLFDLIRW...............--.......................................................
YC8A_METJA/6-148FITLSVRYEKFNKLVYIGVFLFL--LS.....................................................
Q9XAP1_STRCO/112-224LVLFL..................--.......................................................
LEP4_MYXXD/113-222LSFRMMEY...............--.......................................................
LEP4_XANCP/133-242VSLWTVWW...............--.......................................................
Q8TLD4_METAC/26-152ISVYI..................--.......................................................
O67535_AQUAE/105-214LIPFVIYL...............--.......................................................
Q988A4_RHILO/13-122AAAWLLRR...............--.......................................................
Q8XVK3_RALSO/140-249LFLWAIYW...............--.......................................................
Q87I88_VIBPA/13-110ICFFI..................--.......................................................
Q8F6L1_LEPIN/127-232LVLF...................--.......................................................
Q891G5_CLOTE/115-221IICII..................--.......................................................
Q9K8H1_BACHD/15-120ILLFI..................--.......................................................
LEP4_PSEAE/136-245LSLWSVFW...............--.......................................................
Q8XI34_CLOPE/100-206VIFLI..................--.......................................................
Q8EJP8_SHEON/157-266LSLWSIFW...............--.......................................................
Q9CMH2_PASMU/11-110VIGFL..................--.......................................................
Q92T43_RHIME/12-117AVSFA..................--.......................................................
HOPD_SALTY/9-119GGFALIYW...............--.......................................................
Q8FT27_COREF/8-114LLYLV..................--.......................................................
Q8THK9_METAC/8-134FLAYL..................--.......................................................
Q8RAF7_THETN/104-208GILLL..................--.......................................................
PPPA_ECOLI/130-240ITFYSLRW...............--.......................................................
Q92YL6_RHIME/12-116ACTFV..................--.......................................................
Q89PI9_BRADU/13-114LLLFV..................--.......................................................
Q89UH6_BRADU/9-113VVAFT..................--.......................................................
Q87M36_VIBPA/5-111AVCFA..................--.......................................................
Q8Y6Y1_LISMO/101-204YLLFF..................--.......................................................
Q89HG8_BRADU/40-149LLLMV..................--.......................................................
Q8YXA0_NOSS1/108-226WLFEAIAL...............--.......................................................
Q9X222_THEMA/103-204IMFLI..................--.......................................................
LEP4_VIBCH/112-221IISYVSNF...............--.......................................................
Q989C3_RHILO/11-122VGLFP..................--.......................................................
LEP4_ECOLI/81-190GVLWCVYW...............--.......................................................
Q9ABP2_CAUCR/121-230GGLALIAW...............--.......................................................
Q8Y1N3_RALSO/10-114GLCIG..................--.......................................................
Q88QB9_PSEPK/4-110LLTLP..................--.......................................................
Y83C_METJA/9-115LILSI..................--.......................................................
Q87VV0_PSESM/5-111ALTLP..................--.......................................................
O29326_ARCFU/8-129VIALSY.................--.......................................................
Q97FF6_CLOAB/100-211IITKK..................--.......................................................
Q8RHE5_FUSNN/7-119GYISD..................--.......................................................
Q980Y8_SULSO/10-125LLFLI..................--.......................................................
Q8R8E5_THETN/6-111AILFTI.................--.......................................................
LEP4_SYNY3/108-223WLFDLIRM...............--.......................................................
A0KPV9_AERHH/142-247LVLWSLYW...............--.......................................................
A5EXL5_DICNV/138-247LSLWSVYW...............--.......................................................
A9H675_GLUDA/111-216GVFRGI.................--.......................................................
C9R2X4_AGGAD/10-108IIGFL..................--.......................................................
C9R6J1_AGGAD/90-198GVFYAIYH...............--.......................................................
E0SLF4_DICD3/139-243LSLWLIYW...............--.......................................................
G1UB88_HAEDU/13-108VLFML..................--.......................................................
H7C7G6_CAUCR/11-113LVLGM..................--.......................................................
H9L4S3_VIBCH/135-244LSLWSIYW...............--.......................................................
I6Y9M6_MYCTU/5-108GVYLLV.................--.......................................................
LEP4_BURPS/162-269LFLWCILW...............--.......................................................
Q0WIM7_YERPE/129-236LFLWL..................--.......................................................
Q5F692_NEIG1/134-242SSLWLLCA...............--.......................................................
Q5ZVB6_LEGPH/138-246LALWLFIN...............--.......................................................
Q65GL0_BACLD/102-205MLPLLT.................--.......................................................
Q7MJZ8_VIBVY/10-109LIGML..................--.......................................................
Q9PAI1_XYLFA/133-241LSLWIVAA...............--.......................................................

PF04258

SIPL5_ARATH/240-524------------.........GESIPMLLR---------------------I....PR......L---------------
SPP2A_MOUSE/214-499------------.........AEKLPVVIR---------------------V....PKLMGYSVM---------------
SIP_ARATH/47-323------------.........SFDAPIKLL---------------------F....PT.......---------------
SPP2B_HUMAN/213-505------------.........REKLPMVLK---------------------V....PR.LNSSPL---------------
Q9VPQ7_DROME/71-359------------.........SFEAPIKLV---------------------F....PQ..DLIEN---------------
Q9VBL1_DROME/96-408------------G.GIVRDTPKLNLPGKLV---------------------F....PS.......---------------
SIPL4_ARATH/241-527------------.........EDGIPMLLK---------------------I....PR......M---------------
SIPL2_ARATH/242-525------------.........EDGIPMLLK---------------------I....PR......M---------------
YL8H_SCHPO/31-282------------.........GIDIPAKYV---------------------L....PQ.......---------------
YKK0_YEAST/145-510------------.........NLDIPVKLS---------------------L....PV...KFNT---------------
SPPL3_MOUSE/60-374------------GPNVGRDVPRLSLPGKLV---------------------F....PS.......---------------
IMP2_CAEEL/55-450------------.........GIDAPILLQ---------------------F....PQ.DIYRNG---------------
HM13_MOUSE/62-350------------.........SFEAPIKLV---------------------F....PQ..DLLEK---------------
Q93346_CAEEL/275-601------------..PIEQESVPEKFPMLMQ---------------------VAHFNPMNECLDME---------------

PF06550

Q9HM09_THEAC/1-278---------------------DSDLPMLFV---------------------L----PENSGFTMR---------------
Q9HQ23_HALSA/15-306---------------------ELRLPIVLV---------------------V----PTTLAYSFV---------------
Q8TIY9_METAC/27-303---------------------DLKLPILFI---------------------I----PKHLNYSFI---------------

PF01080

D3B5F5_POLPA/149-528............MAESESIEMNTTTTATQQ---------------------Q----LLQNNTNNS...............
G4VJ47_SCHMA/58-484DQQFVGSTITCSVDARNEALNINCTTQPCP---------------------T----TSELVASDN...............
E9C2Q6_CAPO3/204-586............VAAVDKPVPSEDAEEVPQ---------------------L----QAARNDPEA...............
T1KI16_TETUR/103-479............TGMADGGEKSALTNQEVD---------------------Q----NRPTQQDQ................
K7J3W8_NASVI/92-490............ATMANGDTAAGDS.....---------------------.----ISSPARVQP...............
U6IMP9_HYMMI/46-488............VRPSSATTTMNTKEEEIP---------------------L----KTADERAEAQTLVNLNEMPPVSLR
W5JK58_ANODA/96-499............GTHTDPDRPAPLSGERAI---------------------G----TAGGSASAG...............
E9FSB0_DAPPU/62-438............AVMATDQSSTSNSTSNNE---------------------T----AANGPRSPT...............
C5WT76_SORBI/25-446............GRQPGADLDESSTVEVIG---------------------E----VLGRNL..................
C3Z2C5_BRAFL/88-496............VGMADSDPEAKKKKKKKK---------------------K----RRGDGDAQG...............
H2TY46_TAKRU/29-412............VGMAKPVDAPHSG.....---------------------.----.....RETE...............
H3AT04_LATCH/77-455............VGMADPDPEARRKEPEDS---------------------.----.....RREA...............
I1HEG8_BRADI/69-507............MWSEEMQLPADSARSGVN---------------------Q----YERAGQQDNLGSAMVEMRDLGGSR
W4XU10_STRPU/68-474............VGMADIDSPPPKSKAKQE---------------------P----PVEEHTAEE...............
G7Y344_CLOSI/42-431............LITASTSANANGSEAEGS---------------------D----SNAEVPLMS...............
B7Q2V0_IXOSC/41-421............VTMADRDPFYSSQNQHAS---------------------Q----SDASSGTSR...............
PSN1_RAT/76-458............VNMAEGDPEAQRRVPKNP---------------------K----YSTQGTERE...............
T1JMG4_STRMM/67-438............SMMADRETGVEERSNTAN---------------------N----TGQAGNASP...............
T1G6P3_HELRO/9-376............AVVATSSTSQDDIHTEVY---------------------H----VSTATAASG...............
D7LLE1_ARALL/15-389............RRVWRERRSNDAENHANR---------------------N----EVRAVRSEEVEE............
A2G9L8_TRIVA/13-428............EEQNEEGEDHENLDNYDE---------------------E----YDSASEDES...............
F6RA92_CIOIN/37-422............VGMAQNAPAPNQQPRGNG---------------------S----FSTLGVWVH...............
I3IV36_ORENI/95-480............VNMADTDRPNRNSTEAAS---------------------P----QQEPQEAPV...............
H2Z6F8_CIOSA/7-395............VGMAQETSRPNAQVSDVP---------------------M----VGTKSVGST...............
K1PKB7_CRAGI/84-479............VGMADDGSDKKKKKKKKS---------------------K----KKPEAATAE...............
S2K404_MUCC1/83-504............LSNSMLGTATSTVHETIS---------------------S----PNNNDMRLSVQLHSPSSFIQQNFR
H3FRQ2_PRIPA/66-481............TIMMSMVEEQERKHVEEG---------------------E----DGGGGGGEG...............
E0VJ41_PEDHC/87-467............VNMTSEETKNPTS.....---------------------.----.....SLKE...............
E2AIY0_CAMFO/93-484............ATMASEDTVASPT.....---------------------.----.....RSQV...............
F4PRZ5_DICFS/219-583............MASSKNNTTPTTKTTTND---------------------D----TMSDTSSNS...............
B0WS38_CULQU/61-516............GTHSDPSEEALTRGERAI---------------------G----TGSTGTVTT...............
U6HU93_ECHMU/45-476............VAMMGDEETHSTHLGPAV---------------------K----PTEEHACLS...............
E2BSL4_HARSA/95-504............ATMAGSDATSGDTTTSGN---------------------N----TTSPTRDRT...............
H9J5W9_BOMMO/68-456............AAASPAPGAAGERELRPL---------------------Q----PHGTVEGEG...............
G3Q8S2_GASAC/77-448............VGMASPPEAQRSGQETGR---------------------A----SQAPTYERE...............
F6GSZ0_VITVI/15-427............RRAWRERRGVGSNLSENS---------------------N----NLATSDVNV...............
B4QRZ4_DROSI/98-517............VTPQQSQATASSSPSSSN---------------------S----TTTTRATQN...............
SPE4_CAEEL/11-464...............GEESTIRRTVKQTIE---------------------Y----YTKREAQDD...............
C7J054_ORYSJ/30-449............RTQSGAELDANSTVEVLG---------------------E----VLGTNLGAS...............
T1HN85_RHOPR/7-402............INKISDEDNAQRG.....---------------------.----.....KTSS...............
A9S846_PHYPA/9-467............MGSDAERPRVRRWNRRAS---------------------R----SSNPSPDTELG.............
E3N426_CAERE/9-463............ENLNDERKLRKDVKQLIE---------------------L----YSKKEAQDD...............
D8LTV7_ECTSI/63-572............RAPSQQQARREQPGATGG---------------------P----QEGDVSSSP...............
H3CB70_TETNG/22-406............VGMAKPTEAPPPGAETGE---------------------E----GTPTEGTLR...............
G2J6Q7_CAEBR/9-477............ENLNDERKLRKDVKELIQ---------------------L----YSKQDEKDD...............
I1N8G3_SOYBN/8-407............VAGVSDSETSRIELQVVS---------------------R----VNSNNNNNL...............
G3W888_SARHA/88-452............VGMAKVDTPTKGALPKDQ---------------------E----QVWEQDEDS...............
PSN_CAEEL/44-434............VTAVENTTDPREPTSSDS---------------------N----TSTAFPGEA...............
F2CQD9_HORVD/22-450............MWSEESQHHDSAARSGPN---------------------L----YDRVGQHDDSAPAMVEMRDLG...
W5N759_LEPOC/69-512............VGMADGESQAKKKEEPNS---------------------S----ELDDQGSRW...............
Q7PR98_ANOGA/98-513............GTHTDPDRAAPLSGERTI---------------------G----TGPGSAGGG...............
M1CAI2_SOLTU/15-421............RRVWRERRDNDIGSDENL---------------------D----SRSNLNSTV...............
W1NQ31_AMBTC/9-446LVGGVSESSETMYSQSQSALSVELQPSRSF---------------------V----QSSDGIDSH...............
K3WL66_PYTUL/82-563............AAPRARKSPRPAAATASS---------------------S----SLGEASQSS...............
A2DZ73_TRIVA/13-381............EGDGNEGNQEDPAEQADN---------------------Q----DNNEEEEEE...............
G0NCU3_CAEBE/9-464............EP.NEERKIRQNVSQLIQ---------------------M----YSKKEEKDD...............
U9UMQ1_RHIID/178-561............KSLSSVSSFQATSGEEIP---------------------L----SENIRYNRG...............
T1EFZ6_HELRO/89-576............VEPSSGAYEADNDGGADA---------------------E----ADVDGEGDN...............
B7QGI2_IXOSC/14-384............DLSAQTPTNAEKLPRRLL---------------------N----FRGSTNTED...............
A8PAF6_BRUMA/94-527............IGTAMMEQDTSCVTGNTQ---------------------S----ESGNPGSST...............
S2J107_MUCC1/49-424............TQESNRASKNHKKWLPFT---------------------N----ANKGYRPIH...............
D3B4U3_POLPA/99-477............QQQQQQSASSSSSQQARS---------------------R----RNNNNGGED...............
H2VWC4_CAEJA/11-477...............EGDGTIRRGVKQLIA---------------------M----YSKQEAQDE...............
A9VBA9_MONBE/203-602............VTMADVGDSSSNSATIES---------------------Q----PRVADGGAS...............
F2TYS0_SALR5/109-504............VNMADTGERTQTQSTSLT---------------------N----GAQTQPQQQ...............
E1G929_LOALO/15-397............FIKRKQQKMRE.......---------------------.----........................
H3FRQ2_PRIPA/544-933............TIMLRKLAGKSNEEVEGG---------------------A----KGEEEAASG...............

PF01478

FLAK_METJA/5-130..........................F.FM.....................F----------------------------
FLAK_METMP/5-130....................................................----------------------------
LEP4_BACSU/100-204...........................AAI.....................T----------------------------
Q9HWA5_PSEAE/4-110............................GY.....................L----------------------------
Q8FME5_COREF/77-189...................................................L----------------------------
Q9CPF6_PASMU/89-199........................LSKGIY.....................R----------------------------
Q9RSQ9_DEIRA/109-347SLALSSAGTGPGLLDMLRGGLMAAGAVSLVCGVYWWIYWRRNKQAEDDGTDD----------------------------
Q97HN8_CLOAB/64-168............................FA.....................L----------------------------
Q8XQX7_RALSO/14-117............................LY.....................A----------------------------
LEP4_HAEIN/90-200........................LAKFYY.....................G----------------------------
Q8TMQ5_METAC/5-101............................AF.....................K----------------------------
Q8NQ30_CORGL/4-110...........................TAV.....................L----------------------------
Q98BF9_RHILO/11-116............................LF.....................A----------------------------
Y421_METTH/12-138............................LW.....................R----------------------------
Q8CXM1_OCEIH/104-208...........................ILI.....................S----------------------------
A9CKJ3_AGRT5/8-113............................LF.....................A----------------------------
Q8TXH1_METKA/6-112............................LN.....................V----------------------------
Q8DLL0_THEEB/89-199........................GGAIAF.....................N----------------------------
YC8A_METJA/6-148.......FILFKSYFALSFLVFYLIGIFLY.....................Y----------------------------
Q9XAP1_STRCO/112-224....................................................----------------------------
LEP4_MYXXD/113-222........................VGWKVF.....................Q----------------------------
LEP4_XANCP/133-242........................LFKQLT.....................G----------------------------
Q8TLD4_METAC/26-152............................LF.....................H----------------------------
O67535_AQUAE/105-214........................YYVKFR.....................K----------------------------
Q988A4_RHILO/13-122........................GHFLMT.....................G----------------------------
Q8XVK3_RALSO/140-249........................AYKLLR.....................G----------------------------
Q87I88_VIBPA/13-110............................LW.....................L----------------------------
Q8F6L1_LEPIN/127-232............................FF.....................F----------------------------
Q891G5_CLOTE/115-221............................IL.....................L----------------------------
Q9K8H1_BACHD/15-120...................................................V----------------------------
LEP4_PSEAE/136-245........................LFKLVT.....................G----------------------------
Q8XI34_CLOPE/100-206............................SK.....................L----------------------------
Q8EJP8_SHEON/157-266........................LFKLLT.....................G----------------------------
Q9CMH2_PASMU/11-110............................LF.....................T----------------------------
Q92T43_RHIME/12-117............................LF.....................A----------------------------
HOPD_SALTY/9-119........................GYRLRY.....................Q----------------------------
Q8FT27_COREF/8-114...........................TAG.....................V----------------------------
Q8THK9_METAC/8-134............................LF.....................R----------------------------
Q8RAF7_THETN/104-208...................................................I----------------------------
PPPA_ECOLI/130-240........................IAGIVL.....................R----------------------------
Q92YL6_RHIME/12-116............................LF.....................A----------------------------
Q89PI9_BRADU/13-114............................LY.....................T----------------------------
Q89UH6_BRADU/9-113............................CF.....................A----------------------------
Q87M36_VIBPA/5-111............................LY.....................L----------------------------
Q8Y6Y1_LISMO/101-204............................II.....................F----------------------------
Q89HG8_BRADU/40-149............................LY.....................R----------------------------
Q8YXA0_NOSS1/108-226.........................LGVVF.....................Q----------------------------
Q9X222_THEMA/103-204...................................................L----------------------------
LEP4_VIBCH/112-221........................IVRLFK.....................R----------------------------
Q989C3_RHILO/11-122............................FW.....................V----------------------------
LEP4_ECOLI/81-190........................GVWLVC.....................H----------------------------
Q9ABP2_CAUCR/121-230........................LYKTVR.....................G----------------------------
Q8Y1N3_RALSO/10-114............................LY.....................L----------------------------
Q88QB9_PSEPK/4-110............................GY.....................M----------------------------
Y83C_METJA/9-115....................................................----------------------------
Q87VV0_PSESM/5-111............................GY.....................T----------------------------
O29326_ARCFU/8-129...........................ALY.....................L----------------------------
Q97FF6_CLOAB/100-211............................II.....................D----------------------------
Q8RHE5_FUSNN/7-119............................IL.....................K----------------------------
Q980Y8_SULSO/10-125............................LY.....................K----------------------------
Q8R8E5_THETN/6-111...........................YII.....................T----------------------------
LEP4_SYNY3/108-223........................GGSLLL.....................G----------------------------
A0KPV9_AERHH/142-247........................AFKLLT.....................G----------------------------
A5EXL5_DICNV/138-247........................LFKLIT.....................G----------------------------
A9H675_GLUDA/111-216...........................SLL.....................Y----------------------------
C9R2X4_AGGAD/10-108............................LF.....................S----------------------------
C9R6J1_AGGAD/90-198........................AAKWYY.....................R----------------------------
E0SLF4_DICD3/139-243........................AFRLLS.....................G----------------------------
G1UB88_HAEDU/13-108....................................................----------------------------
H7C7G6_CAUCR/11-113...........................GMF.....................A----------------------------
H9L4S3_VIBCH/135-244........................LFKLLT.....................G----------------------------
I6Y9M6_MYCTU/5-108...........................HLA.....................L----------------------------
LEP4_BURPS/162-269........................LFKLLR.....................G----------------------------
Q0WIM7_YERPE/129-236...........................SYW.....................L----------------------------
Q5F692_NEIG1/134-242........................VYKLLT.....................G----------------------------
Q5ZVB6_LEGPH/138-246........................LFYLMT.....................G----------------------------
Q65GL0_BACLD/102-205...........................LLL.....................T----------------------------
Q7MJZ8_VIBVY/10-109............................LW.....................Q----------------------------
Q9PAI1_XYLFA/133-241........................LFKLIF.....................N----------------------------

PF04258

SIPL5_ARATH/240-524--------------------------------------------------------------------------------
SPP2A_MOUSE/214-499--------------------------------------------------------------------------------
SIP_ARATH/47-323--------------------------------------------------------------------------------
SPP2B_HUMAN/213-505--------------------------------------------------------------------------------
Q9VPQ7_DROME/71-359--------------------------------------------------------------------------------
Q9VBL1_DROME/96-408--------------------------------------------------------------------------------
SIPL4_ARATH/241-527--------------------------------------------------------------------------------
SIPL2_ARATH/242-525--------------------------------------------------------------------------------
YL8H_SCHPO/31-282--------------------------------------------------------------------------------
YKK0_YEAST/145-510--------------------------------------------------------------------------------
SPPL3_MOUSE/60-374--------------------------------------------------------------------------------
IMP2_CAEEL/55-450--------------------------------------------------------------------------------
HM13_MOUSE/62-350--------------------------------------------------------------------------------
Q93346_CAEEL/275-601--------------------------------------------------------------------------------

PF06550

Q9HM09_THEAC/1-278--------------------------------------------------------------------------------
Q9HQ23_HALSA/15-306--------------------------------------------------------------------------------
Q8TIY9_METAC/27-303--------------------------------------------------------------------------------

PF01080

D3B5F5_POLPA/149-528.......QKPSPFPTPTSIPINLPS.......................................................
G4VJ47_SCHMA/58-484................................................................................
E9C2Q6_CAPO3/204-586.......APVSTAQPTAP..............................................................
T1KI16_TETUR/103-479................................................................................
K7J3W8_NASVI/92-490.......QTQRSSVSSDT..............................................................
U6IMP9_HYMMI/46-488RRHPESFSMTPPHDSGYETRSQTHPNGAMND.................................................
W5JK58_ANODA/96-499..........ATNYGAVE..............................................................
E9FSB0_DAPPU/62-438................................................................................
C5WT76_SORBI/25-446.......QANPGNSSSSQVHEAATLAGDVSNSRPRVTLGAAFS.....................................
C3Z2C5_BRAFL/88-496.......AAPAGAVGGEE..............................................................
H2TY46_TAKRU/29-412.......QLSPHSPAETE..............................................................
H3AT04_LATCH/77-455.......EASTNHTASAT..............................................................
I1HEG8_BRADI/69-507SRVHQTTSSSGSMLQMGNLEAGQISNQGGSAQHAVIQ...........................................
W4XU10_STRPU/68-474.......NATATGTTVSG..............................................................
G7Y344_CLOSI/42-431................................................................................
B7Q2V0_IXOSC/41-421.......RPCSTFPRMRG..............................................................
PSN1_RAT/76-458.......ETQDTGTGSDD..............................................................
T1JMG4_STRMM/67-438................................................................................
T1G6P3_HELRO/9-376.......DHVYNGNNYDD..............................................................
D7LLE1_ARALL/15-389................................................................................
A2G9L8_TRIVA/13-428.......TDPDSSASSDDALPINPDEFVGLSNNPEDQPPP........................................
F6RA92_CIOIN/37-422.......SDNTSSTSQGS..............................................................
I3IV36_ORENI/95-480.......ASPVPSSPSQD..............................................................
H2Z6F8_CIOSA/7-395.......DTSSTSGGS................................................................
K1PKB7_CRAGI/84-479................................................................................
S2K404_MUCC1/83-504KSHDGFMRLPDDSHLTLDSS............................................................
H3FRQ2_PRIPA/66-481.......GETTGERRESA..............................................................
E0VJ41_PEDHC/87-467.......SNSTRNFEEDP..............................................................
E2AIY0_CAMFO/93-484.......DNQNNRASNDT..............................................................
F4PRZ5_DICFS/219-583.......SSSSSSSSSS...............................................................
B0WS38_CULQU/61-516.......SYGSTGTPVHS....................................MSQSSTPAHQPANQQQRQQQQPPPPR
U6HU93_ECHMU/45-476.......QPSPQQPSSLAPLLEMGNLSGNSTQPSGMAN..........................................
E2BSL4_HARSA/95-504.......DNQCSYASGDT..............................................................
H9J5W9_BOMMO/68-456.......RDGTEAGGG................................................................
G3Q8S2_GASAC/77-448................................................................................
F6GSZ0_VITVI/15-427.......NPDVASNSTLGTCLSVGSGEQETSLVNAE............................................
B4QRZ4_DROSI/98-517.......SLASPEAAAAS..............................................................
SPE4_CAEEL/11-464.......EFYQKIRQRRAAINPDSVPTEHSPLVEAEPSP...IEL...................................
C7J054_ORYSJ/30-449.......SAGNLGVSAIRSDERVGLAGDARNLRLGTSMPNL.......................................
T1HN85_RHOPR/7-402.......SVSTPQVNYSA..............................................................
A9S846_PHYPA/9-467.......ESPMSSGNASQRDSTLTAAVDDSQNLITGPPTEPEVGIIGSRLISSTGEGGALHAVSIILHENSHMDDDTVPL
E3N426_CAERE/9-463.......EFLRKIRQRRTAINPDSALTETSP.VHTEPSDAL.IQL...................................
D8LTV7_ECTSI/63-572.......RAPVGTATMGGGGLADLAGGGDEEGG...............................................
H3CB70_TETNG/22-406.......EEGPRPLPEAE..............................................................
G2J6Q7_CAEBR/9-477.......EFLQKIRQRRNAINPDSGSTAHSPMVTTEPSPIVL......................................
I1N8G3_SOYBN/8-407.......SSNNDNGENGINDEWERSPLVGGMRF...............................................
G3W888_SARHA/88-452.......SDTSGDHSYSE..............................................................
PSN_CAEEL/44-434.......SCSSETPKRPK..............................................................
F2CQD9_HORVD/22-450.......STSRDMATSNQAVTGQTSNQGGSAQHAVIQIE.........................................
W5N759_LEPOC/69-512.......ESSRTHGQSAS..............................................................
Q7PR98_ANOGA/98-513.......SRQAGGYGAVN..............................................................
M1CAI2_SOLTU/15-421.......YSSLESSSGLESLPSIGERTAVDVE................................................
W1NQ31_AMBTC/9-446.......RASETCGYSTVTVDGNSSSFGGYGAQRADHG..........................................
K3WL66_PYTUL/82-563.......SSVHASGNSSS..............................................................
A2DZ73_TRIVA/13-381.......EEAE.....................................................................
G0NCU3_CAEBE/9-464.......EFLQKIRQRRTAINPDSGLTGHSPLVHTQPSPTTPLRL...................................
U9UMQ1_RHIID/178-561................................................................................
T1EFZ6_HELRO/89-576.......VIEIHDDQVPEGQIPEGHVPEGHVHEGHVPESHVPESHVPEGHVPEGHVPEGHILSSDKAGTSANVDYVNLEH
B7QGI2_IXOSC/14-384.......SFVVSRMKAIQEIRRQEDVLCSHHHHHTHQPRH........................................
A8PAF6_BRUMA/94-527.......GSTNGSLPSTAELLPANDANEKRGFPQGK............................................
S2J107_MUCC1/49-424................................................................................
D3B4U3_POLPA/99-477.......QQEDEFGQQ................................................................
H2VWC4_CAEJA/11-477.......EFAQKIRQRRSAWNPDSGLTEQSPLVETEPSPSVPTEH...................................
A9VBA9_MONBE/203-602.......TRGTEMTSMS...............................................................
F2TYS0_SALR5/109-504.......QQQQQRGGTATS.............................................................
E1G929_LOALO/15-397................................................................................
H3FRQ2_PRIPA/544-933.......VS.......................................................................

PF01478

FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRT5/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_THETN/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_THETN/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
C9R6J1_AGGAD/90-198--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524-----------------------------------------------------------SDPW-----------------
SPP2A_MOUSE/214-499-----------------------------------------------------------SVCS-----------------
SIP_ARATH/47-323-----------------------------------------------------------GDAL-----------------
SPP2B_HUMAN/213-505-----------------------------------------------------------ALCD-----------------
Q9VPQ7_DROME/71-359-----------------------------------------------------------GLNA-----------------
Q9VBL1_DROME/96-408-----------------------------------------------------------LHNT-----------------
SIPL4_ARATH/241-527-----------------------------------------------------------FDPW-----------------
SIPL2_ARATH/242-525-----------------------------------------------------------FDPW-----------------
YL8H_SCHPO/31-282-----------------------------------------------------------FKNP-----------------
YKK0_YEAST/145-510-----------------------------------------------------------AQNN-----------------
SPPL3_MOUSE/60-374-----------------------------------------------------------.STG-----------------
IMP2_CAEEL/55-450-----------------------------------------------------------IMEA-----------------
HM13_MOUSE/62-350-----------------------------------------------------------GLEA-----------------
Q93346_CAEEL/275-601-----------------------------------------------------------IELG-----------------

PF06550

Q9HM09_THEAC/1-278-----------------------------------------------------------GLSFDN-----------RGD.
Q9HQ23_HALSA/15-306-----------------------------------------------------------EDAAET-----------ADEA
Q8TIY9_METAC/27-303-----------------------------------------------------------TEGFKE-----------GEKR

PF01080

D3B5F5_POLPA/149-528...........................................................QSEMIE...........PKSS
G4VJ47_SCHMA/58-484...........................................................SNQPMT...........GNSR
E9C2Q6_CAPO3/204-586...........................................................AAARQR...........RTGT
T1KI16_TETUR/103-479...........................................................NIREGQ...........ASSS
K7J3W8_NASVI/92-490............................EEGGFTREWVETHADR...............SARRAQ...........EVRE
U6IMP9_HYMMI/46-488...........................................................ERRVKS...........NQSH
W5JK58_ANODA/96-499...........................DQTAGFTQDWAATTNQR...............VTRRQI...........EVQA
E9FSB0_DAPPU/62-438.............................DGGFTPAWNQEAEQR...............TEARRH...........RVQA
C5WT76_SORBI/25-446...........................................................SSDSTV...........AQAG
C3Z2C5_BRAFL/88-496.............................EGGFGQDWNESRGFQ...............PTRRPN...........RGGN
H2TY46_TAKRU/29-412..................PETDREFCHGDDGGVHAKWCTSKQYR...............ISGSPI...........NPPR
H3AT04_LATCH/77-455..........................PADDGGFTQDWVQQQNET..........LGDMHSTMETR...........AAVQ
I1HEG8_BRADI/69-507...........................................................IEQPEE...........EERA
W4XU10_STRPU/68-474.................QEDQTVSSDQEVNGGFDTVF......................TERRER...........DLER
G7Y344_CLOSI/42-431...........................................................EYRHST...........GDQR
B7Q2V0_IXOSC/41-421...........................................................SGRSRR...........RSQR
PSN1_RAT/76-458..............................GGFSEEWEAQRDSH..........LGPHRSTPESR...........AAVQ
T1JMG4_STRMM/67-438..........................EDQEAGFSREW......................LVRRGT...........GNNV
T1G6P3_HELRO/9-376...........................................................DSTNLA...........YMNR
D7LLE1_ARALL/15-389...........................................................EHVGSS...........ERAE
A2G9L8_TRIVA/13-428...........................................................QPKPEQ...........QPES
F6RA92_CIOIN/37-422.............................DTGFDVAWQRRHNRNSGEVIIT........SNETRN...........QARQ
I3IV36_ORENI/95-480.............................DGGFTQSWVSQQEHR..........LGPLQSTEETR...........REIQ
H2Z6F8_CIOSA/7-395.............................EAGFGVSWQRHHDSEVTCCFYLNKYCVVITSNETRE...........HARQ
K1PKB7_CRAGI/84-479.....................PDQVEAELDGGF..........................LEERPT...........RQLS
S2K404_MUCC1/83-504...........................................................SNPFAT...........QTTL
H3FRQ2_PRIPA/66-481...........................................................NNQPST...........SSSV
E0VJ41_PEDHC/87-467.............................ESGFVRGWMNPQR.................AKRRNE...........EIQQ
E2AIY0_CAMFO/93-484............................EEGGFTPEWVETHGER...............SARRAQ...........EVRE
F4PRZ5_DICFS/219-583...........................................................SSSNIQ...........KSTS
B0WS38_CULQU/61-516PDNAEGTPLVSYRENAAVRTAVGQGHPDQSGGFTQEWADASGQR...............VTRRQI...........EVQA
U6HU93_ECHMU/45-476...........................................................DLSHSE...........GQQS
E2BSL4_HARSA/95-504............................EEEGFTNEWVETHGER...............SARRAQ...........EVRE
H9J5W9_BOMMO/68-456.............................EAGFDAAWRERRDEG...............AAPRRL...........RVDS
G3Q8S2_GASAC/77-448.........................CRDPQGCWFEPWLFHEEAEQ..............SSRRAE...........PENR
F6GSZ0_VITVI/15-427...........................................................EGRVSE...........GNSE
B4QRZ4_DROSI/98-517....GQRTGNSHPRQNQRDDGSVLATEAEAAGFTQEWSANLSER...............VARRQI...........EVQS
SPE4_CAEEL/11-464...........................................................KEKNST...........EELS
C7J054_ORYSJ/30-449...........................................................SSDSAS...........AQVE
T1HN85_RHOPR/7-402..................LRMIQLSVELREDGFSADWADGLEAR...............VEGRQR...........AVAA
A9S846_PHYPA/9-467V..........................................................QQQTNS...........PSSP
E3N426_CAERE/9-463...........................................................KSKNSD...........EEHT
D8LTV7_ECTSI/63-572...........................................................RGADDE...........TPAA
H3CB70_TETNG/22-406...........LEEDPGPASRGSESCRLRPLGPGRSWKFL...................ELQTPE...........QVWT
G2J6Q7_CAEBR/9-477...........................................................KEKNSD...........EELF
I1N8G3_SOYBN/8-407...........................................................GEVVVD...........EGMS
G3W888_SARHA/88-452...........................................................TYDSPR...........CTPL
PSN_CAEEL/44-434...........................................................VKRIPQ...........KVQI
F2CQD9_HORVD/22-450...........................................................RRQEEE...........LETA
W5N759_LEPOC/69-512...............PADSHSLCVHTHIPRYGELINFLSSSGQNRILTISLKFRSSQLHGDGDLNVVRKASYFLLGKEVV
Q7PR98_ANOGA/98-513...............NHGPTQTGATVEDQTAGFTQDWAATANQR...............VTRRQI...........EVQA
M1CAI2_SOLTU/15-421...........................................................DGLVSR...........SDSE
W1NQ31_AMBTC/9-446...........................................................EIEHVN...........EEMS
K3WL66_PYTUL/82-563...........................................................SSSNHQ...........RAAR
A2DZ73_TRIVA/13-381...........................................................NNQPQE...........NANG
G0NCU3_CAEBE/9-464...........................................................KEHNSD...........VEHT
U9UMQ1_RHIID/178-561...........................................................EGGVSD...........EGGI
T1EFZ6_HELRO/89-576FTTEITIAAEK................................................KSDEPD...........QQER
B7QGI2_IXOSC/14-384...........................................................HRQRRQ...........DAAA
A8PAF6_BRUMA/94-527............IIRRFAPTRTANDQGVENAGLNTEQSDNNSKN...............IGKGRT...........AASF
S2J107_MUCC1/49-424...........................................................NNELDE...........NATL
D3B4U3_POLPA/99-477...........................................................QQQQED...........DAQV
H2VWC4_CAEJA/11-477...........................................................QQEEKE...........DKQM
A9VBA9_MONBE/203-602...........................................................SQPRAR...........QGSR
F2TYS0_SALR5/109-504...........................................................SSSHGH...........HRRR
E1G929_LOALO/15-397...........................................................RHERRS...........KTKL
H3FRQ2_PRIPA/544-933...........................................................CGESRQ...........NRSR

PF01478

FLAK_METJA/5-130-----------------------------------------------------------LL....---------------
FLAK_METMP/5-130-----------------------------------------------------------......---------------
LEP4_BACSU/100-204-----------------------------------------------------------HG....---------------
Q9HWA5_PSEAE/4-110-----------------------------------------------------------LG....---------------
Q8FME5_COREF/77-189-----------------------------------------------------------AFIA..---------------
Q9CPF6_PASMU/89-199-----------------------------------------------------------KE....---------------
Q9RSQ9_DEIRA/109-347-----------------------------------------------------------EQSD..---------------
Q97HN8_CLOAB/64-168-----------------------------------------------------------FK....---------------
Q8XQX7_RALSO/14-117-----------------------------------------------------------LG....---------------
LEP4_HAEIN/90-200-----------------------------------------------------------KE....---------------
Q8TMQ5_METAC/5-101-----------------------------------------------------------KG....---------------
Q8NQ30_CORGL/4-110-----------------------------------------------------------VG....---------------
Q98BF9_RHILO/11-116-----------------------------------------------------------MG....---------------
Y421_METTH/12-138-----------------------------------------------------------MV....---------------
Q8CXM1_OCEIH/104-208-----------------------------------------------------------RG....---------------
A9CKJ3_AGRT5/8-113-----------------------------------------------------------AN....---------------
Q8TXH1_METKA/6-112-----------------------------------------------------------LG....---------------
Q8DLL0_THEEB/89-199-----------------------------------------------------------QE....---------------
YC8A_METJA/6-148-----------------------------------------------------------LN....---------------
Q9XAP1_STRCO/112-224-----------------------------------------------------------..IN..---------------
LEP4_MYXXD/113-222-----------------------------------------------------------RE....---------------
LEP4_XANCP/133-242-----------------------------------------------------------KE....---------------
Q8TLD4_METAC/26-152-----------------------------------------------------------LG....---------------
O67535_AQUAE/105-214-----------------------------------------------------------IE....---------------
Q988A4_RHILO/13-122-----------------------------------------------------------RI....---------------
Q8XVK3_RALSO/140-249-----------------------------------------------------------RE....---------------
Q87I88_VIBPA/13-110-----------------------------------------------------------IN....---------------
Q8F6L1_LEPIN/127-232-----------------------------------------------------------PG....---------------
Q891G5_CLOTE/115-221-----------------------------------------------------------TN....---------------
Q9K8H1_BACHD/15-120-----------------------------------------------------------YLIY..---------------
LEP4_PSEAE/136-245-----------------------------------------------------------KE....---------------
Q8XI34_CLOPE/100-206-----------------------------------------------------------TG....---------------
Q8EJP8_SHEON/157-266-----------------------------------------------------------KE....---------------
Q9CMH2_PASMU/11-110-----------------------------------------------------------FG....---------------
Q92T43_RHIME/12-117-----------------------------------------------------------AN....---------------
HOPD_SALTY/9-119-----------------------------------------------------------KE....---------------
Q8FT27_COREF/8-114-----------------------------------------------------------VG....---------------
Q8THK9_METAC/8-134-----------------------------------------------------------LR....---------------
Q8RAF7_THETN/104-208-----------------------------------------------------------SLLS..---------------
PPPA_ECOLI/130-240-----------------------------------------------------------KE....---------------
Q92YL6_RHIME/12-116-----------------------------------------------------------AG....---------------
Q89PI9_BRADU/13-114-----------------------------------------------------------RG....---------------
Q89UH6_BRADU/9-113-----------------------------------------------------------MG....---------------
Q87M36_VIBPA/5-111-----------------------------------------------------------VK....---------------
Q8Y6Y1_LISMO/101-204-----------------------------------------------------------RK....---------------
Q89HG8_BRADU/40-149-----------------------------------------------------------RWRG..---------------
Q8YXA0_NOSS1/108-226-----------------------------------------------------------KE....---------------
Q9X222_THEMA/103-204-----------------------------------------------------------KAMY..---------------
LEP4_VIBCH/112-221-----------------------------------------------------------ID....---------------
Q989C3_RHILO/11-122-----------------------------------------------------------LR....---------------
LEP4_ECOLI/81-190-----------------------------------------------------------KE....---------------
Q9ABP2_CAUCR/121-230-----------------------------------------------------------FD....---------------
Q8Y1N3_RALSO/10-114-----------------------------------------------------------LR....---------------
Q88QB9_PSEPK/4-110-----------------------------------------------------------LG....---------------
Y83C_METJA/9-115-----------------------------------------------------------......---------------
Q87VV0_PSESM/5-111-----------------------------------------------------------LG....---------------
O29326_ARCFU/8-129-----------------------------------------------------------IG....---------------
Q97FF6_CLOAB/100-211-----------------------------------------------------------MP....---------------
Q8RHE5_FUSNN/7-119-----------------------------------------------------------KE....---------------
Q980Y8_SULSO/10-125-----------------------------------------------------------LS....---------------
Q8R8E5_THETN/6-111-----------------------------------------------------------NG....---------------
LEP4_SYNY3/108-223-----------------------------------------------------------RE....---------------
A0KPV9_AERHH/142-247-----------------------------------------------------------KE....---------------
A5EXL5_DICNV/138-247-----------------------------------------------------------RE....---------------
A9H675_GLUDA/111-216-----------------------------------------------------------RRAR.G---------------
C9R2X4_AGGAD/10-108-----------------------------------------------------------LR....---------------
C9R6J1_AGGAD/90-198-----------------------------------------------------------QE....---------------
E0SLF4_DICD3/139-243-----------------------------------------------------------RE....---------------
G1UB88_HAEDU/13-108-----------------------------------------------------------.G....---------------
H7C7G6_CAUCR/11-113-----------------------------------------------------------AG....---------------
H9L4S3_VIBCH/135-244-----------------------------------------------------------KE....---------------
I6Y9M6_MYCTU/5-108-----------------------------------------------------------PA....---------------
LEP4_BURPS/162-269-----------------------------------------------------------IE....---------------
Q0WIM7_YERPE/129-236-----------------------------------------------------------FKIVRG---------------
Q5F692_NEIG1/134-242-----------------------------------------------------------KT....---------------
Q5ZVB6_LEGPH/138-246-----------------------------------------------------------KV....---------------
Q65GL0_BACLD/102-205-----------------------------------------------------------KG....---------------
Q7MJZ8_VIBVY/10-109-----------------------------------------------------------RR....---------------
Q9PAI1_XYLFA/133-241-----------------------------------------------------------KE....---------------

PF04258

SIPL5_ARATH/240-524------------GG------------------------------------------------------------------
SPP2A_MOUSE/214-499------------VP------------------------------------------------------------------
SIP_ARATH/47-323------------RP------------------------------------------------------------------
SPP2B_HUMAN/213-505------------RP------------------------------------------------------------------
Q9VPQ7_DROME/71-359------------SN------------------------------------------------------------------
Q9VBL1_DROME/96-408------------GH------------------------------------------------------------------
SIPL4_ARATH/241-527------------GG------------------------------------------------------------------
SIPL2_ARATH/242-525------------GG------------------------------------------------------------------
YL8H_SCHPO/31-282------------TR------------------------------------------------------------------
YKK0_YEAST/145-510------------FN------------------------------------------------------------------
SPPL3_MOUSE/60-374------------SH------------------------------------------------------------------
IMP2_CAEEL/55-450------------SK------------------------------------------------------------------
HM13_MOUSE/62-350------------DN------------------------------------------------------------------
Q93346_CAEEL/275-601------------FQ------------------------------------------------------------------

PF06550

Q9HM09_THEAC/1-278............GN------------------------------------------------------------------
Q9HQ23_HALSA/15-306EAGEREAAAPADRP------------------------------------------------------------------
Q8TIY9_METAC/27-303EA............------------------------------------------------------------------

PF01080

D3B5F5_POLPA/149-528PNSESMSTGVSTSE......LSESTDSVTLEKGR..............................................
G4VJ47_SCHMA/58-484NMLNIPNNTSRTDAIVVDTPDDNTINNDARNNNETISQAPHET.....................................
E9C2Q6_CAPO3/204-586NAGAAADEDEATNA......TAAAEQSQDSTAPAEDD...........................................
T1KI16_TETUR/103-479SQSPSSTQPAQPEA......DIPPISFRGQDNLRPDLAGVDEF.........EE..........................
K7J3W8_NASVI/92-490NAQTNSRGSAEVNG......ASQQANQQQMMMMQ..............................................
U6IMP9_HYMMI/46-488QPMDSSNSHQEWHN......PSPSLTTGANEFSSHEMVTSGEQ.....................................
W5JK58_ANODA/96-499NIASNPSRPEYRTV......TAESNRTGTNDPSQPALPMYAVQE....................................
E9FSB0_DAPPU/62-438AAAEAPRAAPQPQP......VTEEIDDDE...................................................
C5WT76_SORBI/25-446EVSALPEHRVAVAEMSVPLIQPRPQRSGEEVEGEDGIGLSSSG.....................................
C3Z2C5_BRAFL/88-496ASDASVNSEDARQA......AQNLSNGRLSPSGNQQQQQQQQQMEEDEDE..............................
H2TY46_TAKRU/29-412AAIIHQSGPVPVHK......GGD.........................................................
H3AT04_LATCH/77-455ALPNNNPIPEDP....................................................................
I1HEG8_BRADI/69-507PLVSAASANSAVAN......EEHRQISSSDPPDEDFEMFESSK.....................................
W4XU10_STRPU/68-474SANSSVTSEDRRAA......VRALRQNNGPSNRQPPVDEEEE......................................
G7Y344_CLOSI/42-431NSSDLPSANVTTSE......QLPERHLRRMTESIADHSGNSTD.....................................
B7Q2V0_IXOSC/41-421GSMANSGTLAALGS......SQGSAPEVDDLPRQEE............................................
PSN1_RAT/76-458ELSGSILTSEDP....................................................................
T1JMG4_STRMM/67-438TRIDENGRRSQRRS......MPNPVTNQDEE.................................................
T1G6P3_HELRO/9-376FIHSKPDRKDEPKI......SSTIYNA.....................................................
D7LLE1_ARALL/15-389ISVPLIDRRPEQAE......NSETF........LEGIGLGSSG.....................................
A2G9L8_TRIVA/13-428ELAQPAGEPTKPKK......KRPNQDNQHGDPENPDKRKKKSGSAKSTPTSE............................
F6RA92_CIOIN/37-422QLGPPPEGSEEA....................................................................
I3IV36_ORENI/95-480QMPSARPPVEEDD...................................................................
H2Z6F8_CIOSA/7-395QLGDPPEEP.......................................................................
K1PKB7_CRAGI/84-479QSTEETARAVRAARVLGDTENGQRTNSPRNPTREEEEEEEE.......................................
S2K404_MUCC1/83-504QAPDDTDRPSTPRQ......EEATRKATEPENDEEDAERS........................................
H3FRQ2_PRIPA/66-481PSSSSASTSVLIPA......GESKQKRPQVRRVPPPAREERRE.........EEGV........................
E0VJ41_PEDHC/87-467SEVRFHPQQSEGHS......NPGPVGTNAVTVEE..............................................
E2AIY0_CAMFO/93-484NSSREGTTRQQENR......VRFSQEQGTVTE................................................
F4PRZ5_DICFS/219-583SSSISTGLSTEPSD......TPMEVNYST...................................................
B0WS38_CULQU/61-516NIASNPNRPEYRTV......TAGARGGTGDSQQVPLYEQP........................................
U6HU93_ECHMU/45-476NQGEGNTNQQEQCD......FTPPLTVDSVEPRLHEMQSGHGG.....................................
E2BSL4_HARSA/95-504NDETRGTNRRQQEN......RSVEIQSQVAPPPPPPPPM.........................................
H9J5W9_BOMMO/68-456APPRYVTRLDPPHA......PHAPPHAPDLD.................................................
G3Q8S2_GASAC/77-448QSQLFPEDDLE.....................................................................
F6GSZ0_VITVI/15-427LVVPLIDHRINVGE......HGQEDSVSTENLPFEGIGLGSSG.....................................
B4QRZ4_DROSI/98-517TQSGNAQRSNEYRT......VTAPDQNHPDGQ................................................
SPE4_CAEEL/11-464DDESDTSETSSGSS......NLSSSDSSTT..........VST.........SDIS........................
C7J054_ORYSJ/30-449VLPASPEISVSVPEMRVPLIQPRPERTRDEEDDEDGIGLSSSG.....................................
T1HN85_RHOPR/7-402HEASSGFQPRQPTR......ISTQNPQGVPHAQDEE............................................
A9S846_PHYPA/9-467ATLGRSEAEFDHRS......RPMNGATQHSEDGDEETGIGLSG.....................................
E3N426_CAERE/9-463DDESDTTESSTTTS.........SSD..............VTT.........SEVS........................
D8LTV7_ECTSI/63-572PVSAEAAAVVEPQS......SSPGGDHSSARRPGADSAGASESVAAPLLELVESGTAAVAVGDASADGSGTRSGREQGKR
H3CB70_TETNG/22-406RLTDH...........................................................................
G2J6Q7_CAEBR/9-477DNESDTTESSSESS........TSSESV............FSS.........SDVS........................
I1N8G3_SOYBN/8-407PLVEMSGVGENEEE......GEGVRRKIGER.................................................
G3W888_SARHA/88-452HVPSYAVEELEEE...................................................................
PSN_CAEEL/44-434ESNTTASTTQNSGV......RVERELAAERPTVQDANFHRHEE.....................................
F2CQD9_HORVD/22-450PLVSAASANPTVAN......EEHTQISSSEPPEEEFEMFESSR.....................................
W5N759_LEPOC/69-512HFSSSNPEHISTPQKLGCESSPSAG.......................................................
Q7PR98_ANOGA/98-513NIANNPSRPEYRTV......TAEATRAGQDPQLGGALYDQA.......................................
M1CAI2_SOLTU/15-421LAAPLIQHRINVRM......NLQ..EGPSDDFALEGIGLGSSG.....................................
W1NQ31_AMBTC/9-446PLVIRGGESHDLSH......ATERVEENHERDRAGVHERGRRGEGRILEFEASR..........................
K3WL66_PYTUL/82-563PTPAPIQPRPAPVA......PAASSDLATVTENFNRPRNVMES.........DFSTYDCETMDALIELLANFYRTFSPED
A2DZ73_TRIVA/13-381EAQNGNQNNNKKKK......NMSKRDNE....................................................
G0NCU3_CAEBE/9-464DDESDTTESSSSSS........SSGEVSTE..........VSS.........SEVS........................
U9UMQ1_RHIID/178-561NCDGTDENSQIPRRQSSSLQPQSQPPNNVSYDDEEDERS.........................................
T1EFZ6_HELRO/89-576PAEEQGEPQAKQKR......SKHRQHSKQQNRPKGPSQQQNEQ.........QQIG........................
B7QGI2_IXOSC/14-384PEDT............................................................................
A8PAF6_BRUMA/94-527NKGGESGGTQRVTV......QNTEVNPAG............LQ.........NERF........................
S2J107_MUCC1/49-424SIALSTLEQSRDVE......RRNSNEAGQDEDEEEDELN.........................................
D3B4U3_POLPA/99-477DVNNNDEEVPPIEE......LEPEQEKR....................................................
H2VWC4_CAEJA/11-477DSESSSESCSESAS.......IASGDSNADDKEKEEEDDEYQS.........SNIE........................
A9VBA9_MONBE/203-602ADSEADDGARDIST......FAAPRGETRSTNQAAPASQPSFQ.........PDDE........................
F2TYS0_SALR5/109-504SRQSSSSPNADDVE......LLADIGGSPAPNRARTAASRPPA.........NQGD........................
E1G929_LOALO/15-397DSEAENEHLRQRKM......LCSKSDTQVEICSKFRAASD........................................
H3FRQ2_PRIPA/544-933VGPSSDEEKGTREK......AGCDEKVVVIRSGASQSPEDYEE.........EEEE........................

PF01478

FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRT5/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_THETN/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_THETN/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
C9R6J1_AGGAD/90-198--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524--------------------------------------------------------------------------------
SPP2A_MOUSE/214-499--------------------------------------------------------------------------------
SIP_ARATH/47-323--------------------------------------------------------------------------------
SPP2B_HUMAN/213-505--------------------------------------------------------------------------------
Q9VPQ7_DROME/71-359--------------------------------------------------------------------------------
Q9VBL1_DROME/96-408--------------------------------------------------------------------------------
SIPL4_ARATH/241-527--------------------------------------------------------------------------------
SIPL2_ARATH/242-525--------------------------------------------------------------------------------
YL8H_SCHPO/31-282--------------------------------------------------------------------------------
YKK0_YEAST/145-510--------------------------------------------------------------------------------
SPPL3_MOUSE/60-374--------------------------------------------------------------------------------
IMP2_CAEEL/55-450--------------------------------------------------------------------------------
HM13_MOUSE/62-350--------------------------------------------------------------------------------
Q93346_CAEEL/275-601--------------------------------------------------------------------------------

PF06550

Q9HM09_THEAC/1-278--------------------------------------------------------------------------------
Q9HQ23_HALSA/15-306--------------------------------------------------------------------------------
Q8TIY9_METAC/27-303--------------------------------------------------------------------------------

PF01080

D3B5F5_POLPA/149-528................................................................................
G4VJ47_SCHMA/58-484...............................DTLVAGRPNRWQELQADLIDRDS..........................
E9C2Q6_CAPO3/204-586....................................................EE..........................
T1KI16_TETUR/103-479....................................................EE..........................
K7J3W8_NASVI/92-490....................................................EE..........................
U6IMP9_HYMMI/46-488..................................LETPNEWLRDVQEDVIDRED..........................
W5JK58_ANODA/96-499....................................................EE..........................
E9FSB0_DAPPU/62-438....................................................EE..........................
C5WT76_SORBI/25-446................................................................................
C3Z2C5_BRAFL/88-496....................................................EE..........................
H2TY46_TAKRU/29-412....................................................QA..........................
H3AT04_LATCH/77-455....................................................EE..........................
I1HEG8_BRADI/69-507................................................................................
W4XU10_STRPU/68-474....................................................EE..........................
G7Y344_CLOSI/42-431.....................................AASRWRQIHLDLRDREE..........................
B7Q2V0_IXOSC/41-421....................................................EE..........................
PSN1_RAT/76-458....................................................EE..........................
T1JMG4_STRMM/67-438....................................................EE..........................
T1G6P3_HELRO/9-376................................................................................
D7LLE1_ARALL/15-389................................................................................
A2G9L8_TRIVA/13-428................................................................................
F6RA92_CIOIN/37-422....................................................ED..........................
I3IV36_ORENI/95-480....................................................EE..........................
H2Z6F8_CIOSA/7-395....................................................ED..........................
K1PKB7_CRAGI/84-479....................................................EE..........................
S2K404_MUCC1/83-504................................................................................
H3FRQ2_PRIPA/66-481...............................SRARTAGDRRVVSESRSTEEVEE..........................
E0VJ41_PEDHC/87-467....................................................EE..........................
E2AIY0_CAMFO/93-484....................................................EE..........................
F4PRZ5_DICFS/219-583................................................................................
B0WS38_CULQU/61-516....................................................EE..........................
U6HU93_ECHMU/45-476................................EQPESANDHLRDLQENVIEREE..........................
E2BSL4_HARSA/95-504....................................................EE..........................
H9J5W9_BOMMO/68-456....................................................EE..........................
G3Q8S2_GASAC/77-448....................................................ED..........................
F6GSZ0_VITVI/15-427................................................................................
B4QRZ4_DROSI/98-517....................................................EE..........................
SPE4_CAEEL/11-464...............................TAEECDQKEWDDLVSNS....LPNNDKRPATAADALNDG..........
C7J054_ORYSJ/30-449................................................................................
T1HN85_RHOPR/7-402....................................................EE..........................
A9S846_PHYPA/9-467................................................................................
E3N426_CAERE/9-463...............................TAEEVAPEEWNELMEQQEKQAEFDQRYVPVTAADALNDG..........
D8LTV7_ECTSI/63-572RLATVRRGIRGGGCLDPEPPGWRTVQAEKKLELFSPVPTSSRAAAAAENDEDEE..........................
H3CB70_TETNG/22-406....................................................QQ..........................
G2J6Q7_CAEBR/9-477...............................TAAECAPEEWNELIHQQN...EFDQNDATVTAADALNDGVKSKNSGRLF
I1N8G3_SOYBN/8-407................................................................................
G3W888_SARHA/88-452....................................................EE..........................
PSN_CAEEL/44-434....................................................EE..........................
F2CQD9_HORVD/22-450................................................................................
W5N759_LEPOC/69-512....................................................KE.................LGVGDADAL
Q7PR98_ANOGA/98-513....................................................EE..........................
M1CAI2_SOLTU/15-421................................................................................
W1NQ31_AMBTC/9-446................................................................................
K3WL66_PYTUL/82-563VWKAPQVAEKFFATQDRLWLLIFHKYRVCSCSIEIPCAVQARQDAKRRAAEEED..........................
A2DZ73_TRIVA/13-381................................................................................
G0NCU3_CAEBE/9-464...............................TADECAPEEWNQLVQE.....VVPEAKAQVTAADALNDG..........
U9UMQ1_RHIID/178-561................................................................................
T1EFZ6_HELRO/89-576...............................RLGHPESFEQFKQQVARLDKMED..........................
B7QGI2_IXOSC/14-384................................................................................
A8PAF6_BRUMA/94-527...............................P....................DE..........................
S2J107_MUCC1/49-424................................................................................
D3B4U3_POLPA/99-477................................................................................
H2VWC4_CAEJA/11-477...............................TAEECDMETWQQLVNEANA..KQGDNKSNLTAADALNDG..........
A9VBA9_MONBE/203-602...............................D....................DS..........................
F2TYS0_SALR5/109-504...............................D....................EE.................H........
E1G929_LOALO/15-397....................................................EQRNDGTKFTVYDALNDGS.........
H3FRQ2_PRIPA/544-933...............................E....................EE..........................

PF01478

FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRT5/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_THETN/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_THETN/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
C9R6J1_AGGAD/90-198--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524--------YNMIGFGDILFPGLLICFIFR---FDKENNKGVSN.................GYFPWLMF-GYGLG------
SPP2A_MOUSE/214-499--------VSVLGFGDIIVPGLLIAYCRR---FDVQTGSS....................IYYISSTI-AYAVG------
SIP_ARATH/47-323--------YSMLGLGDIVIPGIFVALALR---FDVSRRRQP...................QYFTSAFI-GYAVG------
SPP2B_HUMAN/213-505--------FSLLGFGDILVPGLLVAYCHR---FDIQVQSSR...................VYFVACTI-AYGVG------
Q9VPQ7_DROME/71-359--------FAMLGLGDIVIPGIFIALLLR---FDDSKKRKTR..................IYFYSTLI-AYFLG------
Q9VBL1_DROME/96-408--------FSMLGLGDVVMPGLLLCFVLR---YDAYKKAQGVTSDPTLSP..PRGVGSRLTYFHCSLL-GYFLG------
SIPL4_ARATH/241-527--------YSIIGFGDIILPGLLVTFALR---YDWLANKRLKS.................GYFLGTMS-AYGLG------
SIPL2_ARATH/242-525--------YSIIGFGDILLPGLLIAFALR---YDWLANKTLRT.................GYFIWAMV-AYGLG------
YL8H_SCHPO/31-282--------LSMLGLGDIVMPGLMLALMYR---FDLHYYINSTSQPKKHS...........TYFRNTFI-AYGLG------
YKK0_YEAST/145-510--------FSILGLGDIALPGMFIAMCYK---YDIWKWHLDHDDTEFHFL.NWSYVG...KYFITAMV-SYVAS------
SPPL3_MOUSE/60-374--------FSMLGIGDIVMPGLLLCFVLR---YDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLI-GYFVG------
IMP2_CAEEL/55-450--------HSMLGLGDIVIPGIFIALLRR---FDYRVVQTTAESKAPQGSLKGR......YYFVVTVV-AYMAG------
HM13_MOUSE/62-350--------FAMLGLGDIVIPGIFIALLLR---FDISLKKNTH..................TYFYTSFA-AYIFG------
Q93346_CAEEL/275-601--------FTILGLGDIVMPGYLVAHCFT---MNGFSERVRL..................IYGFISVV-GYGIG------

PF06550

Q9HM09_THEAC/1-278--------VLMIGFGDIALPSIMVVSSAI---YGISHIL.....----------------FFTVLPLA-GGLIG------
Q9HQ23_HALSA/15-306--------AYFIGLGDAVMPSIMVASAAF---FLDTPPVVAGIE----------------LAPLTAMA-GTLVG------
Q8TIY9_METAC/27-303--------.FFMGLGDAVMPTLLVVSANV---FLEN....GGLS----------------YPVLGAML-GTLVG------

PF01080

D3B5F5_POLPA/149-528........GIKLGLGDFVFYSVLVGRAAY...KEI-------------------------ILVFICFV.AILTG------
G4VJ47_SCHMA/58-484....K...GVKLGLGDFVFYSLLIGRATL..DGDA-------------------------VTVVTCYV.AILVG------
E9C2Q6_CAPO3/204-586....H...GVKLGLGDFIFYSVLVGKASV..SNNW-------------------------STILSCFF.AILVG------
T1KI16_TETUR/103-479....R...GVKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTLACFV.SILIG------
K7J3W8_NASVI/92-490....R...GVKLGLGDFIFYGVLVGKASS..YGDW-------------------------NTTLACFV.AILIG------
U6IMP9_HYMMI/46-488....R...GVKLGLGDFVFYSVLIGRASL..DGDI-------------------------LTAISCYV.AILVG------
W5JK58_ANODA/96-499....R...GIKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTIACFV.AILVG------
E9FSB0_DAPPU/62-438....R...GIKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTIACFV.AILIG------
C5WT76_SORBI/25-446........AIKLGLGDFIFYSVLVGRAAM...YDY-------------------------MTVYACYL.AIIAG------
C3Z2C5_BRAFL/88-496....R...GVKLGLGDFIFYSVLVGKASS..NGDW-------------------------NTTLACFV.AILIG------
H2TY46_TAKRU/29-412....G...GVKLGLGDFIFYSVLVGKAAAT.GGDW-------------------------NTTLACFV.AILIG------
H3AT04_LATCH/77-455....S...TYSFALG...LLSYLMGASSQKSNGGR-------------------------NVLVQIFLHAVSLG------
I1HEG8_BRADI/69-507........GIKLGLGDFVFYSVLVGRAAM...YDL-------------------------MTVYACYL.AIIAG------
W4XU10_STRPU/68-474....R...GVKLGLGDFIFYSVLVGKASA..SGDW-------------------------TTTIACFV.AILIG------
G7Y344_CLOSI/42-431....R...GVKLGLGDFVFYSLLIGRAAL..DGDV-------------------------ITVATCYV.AILVG------
B7Q2V0_IXOSC/41-421....R...GVKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTIACFV.AILIG------
PSN1_RAT/76-458....R...GVKLGLGDFIFYSVLVGKASATASGDW-------------------------NTTIACFV.AILIG------
T1JMG4_STRMM/67-438....R...GVKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTLACFV.AILIG------
T1G6P3_HELRO/9-376........GIKLGLGDFIFYSLLVGKVSQ..LEEW-------------------------NTTTACFI.SVLIG------
D7LLE1_ARALL/15-389........AIKLGLGDFIFYSVLVGRAAM...YDL-------------------------MTVYACYL.AIIAG------
A2G9L8_TRIVA/13-428........GVKLGLGDFIFYGILVTRAAR...VGW-------------------------DIAILDIL.AVMDG------
F6RA92_CIOIN/37-422....K...GVKLGLGDFIFYSVLVGKASA..TGDW-------------------------NTTIACFV.AILIG------
I3IV36_ORENI/95-480....R...GVKLGLGDFIFYSMLVGKASATASGDW-------------------------NTTLACFV.AILIG------
H2Z6F8_CIOSA/7-395....K...GVKLGLGDFIFYSVLVGKASA..NGDW-------------------------NTTIACFV.AILIG------
K1PKB7_CRAGI/84-479....R...GVKLGLGDFIFYGVLVGKASS..NGDW-------------------------NTTLACFV.AILIG------
S2K404_MUCC1/83-504........GLKLGLGDFVFYSVLIARAAM...YDW-------------------------ITTVCCTI.AVLTG------
H3FRQ2_PRIPA/66-481....R...GIKLGLGDFIFYSVLVGKASE..SADW-------------------------NTIVACYV.AILVG------
E0VJ41_PEDHC/87-467....R...GVKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTVACFV.AILIG------
E2AIY0_CAMFO/93-484....R...GVKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTLACFV.AILIG------
F4PRZ5_DICFS/219-583........KIQLGLGDLVFYSVLLGRAAL...YDL-------------------------GTIFACFV.AILTG------
B0WS38_CULQU/61-516....R...GIKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTIACFV.AILVG------
U6HU93_ECHMU/45-476....R...GVKLGLGDFIFYSLLIGRASL..DGDV-------------------------LTAVACYI.AILVG------
E2BSL4_HARSA/95-504....R...GVKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTLACFV.AILIG------
H9J5W9_BOMMO/68-456....K...GVKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTLACFV.AILIG------
G3Q8S2_GASAC/77-448....R...GVKLGLGDFIFYSVLVGKAAAT.GGDW-------------------------NTTLACFV.AILIG------
F6GSZ0_VITVI/15-427........AIKLGLGDFIFYSVLVGRAAM...YDF-------------------------MTVYACYL.AIIAG------
B4QRZ4_DROSI/98-517....R...GIKLGLGDFIFYSVLVGKASS..YGDW-------------------------TTTIACFV.AILIG------
SPE4_CAEEL/11-464.......EVLRLGFGDFVFYSLLIGQAAA..SGCP-------------------------FAVISAAL.GILFG------
C7J054_ORYSJ/30-449........AIKLGLGDFIFYSVLVGRAAM...YDY-------------------------MTVYACYL.AIIAG------
T1HN85_RHOPR/7-402....R...GVKLGLGDFIFYSVLVGKASS..NGDW-------------------------NTTLACFV.AILIG------
A9S846_PHYPA/9-467........AIKLGLGDFVFYSVLVGRAAM...YDL-------------------------MTVYACYL.AIVAG------
E3N426_CAERE/9-463.......ETVRLGFGDFVFYSLLIGQTAT..GGSA-------------------------LAVACSAL.GILFG------
D8LTV7_ECTSI/63-572....EMGVSIKLGLGDFVFYSVLVSKAAL...YGF-------------------------TAWAACVV.VIVFG------
H3CB70_TETNG/22-406....G...GVKLGLGDFIFYSVLVGKAAAT.GGDW-------------------------NTTLACFV.AILIG------
G2J6Q7_CAEBR/9-477SEICRFPETVRLGFGDFVFYSLLIGQAAT..GGCP-------------------------ISVGFAAF.GILFG------
I1N8G3_SOYBN/8-407........GIKFGLGDFVFYSVLVGRAAM...YDL-------------------------MTVYACYL.AIISG------
G3W888_SARHA/88-452....R...GVKLGLGDFIFYSVLVGKAAATASGDW-------------------------NTTLACFV.AILIG------
PSN_CAEEL/44-434....R...GVKLGLGDFIFYSVLLGKASS..YFDW-------------------------NTTIACYV.AILIG------
F2CQD9_HORVD/22-450........GIKLGLGDFVFYSVLVGRAAM...YDL-------------------------MTVYACYL.AIIAG------
W5N759_LEPOC/69-512CLPG....GVKLGLGDFIFYSVLVGKASATASGDW-------------------------NTTLACFV.AILIG------
Q7PR98_ANOGA/98-513....R...GIKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTIACFV.AILVG------
M1CAI2_SOLTU/15-421........AIKLGLGDFIFYSVLVARAAM...YDF-------------------------MTVYACYL.AIIAG------
W1NQ31_AMBTC/9-446........GIKLGLGDFIFYSVLVGRAAM...YDL-------------------------LTVYACYI.AIISG------
K3WL66_PYTUL/82-563....DDDKTIKLGLGDFIFYSVLVGRAAI...YDF-------------------------STFAATFI.CIVMG------
A2DZ73_TRIVA/13-381........GIKLGLGDFVFYGILVSRAAR...IGW-------------------------DITILCIF.AVILG------
G0NCU3_CAEBE/9-464.......ETVRLGFGDFVFYSLLIGQAAT..GGCP-------------------------VAVALAAF.GILFG------
U9UMQ1_RHIID/178-561........GLKLGLGDFVFYSVLVAQAAL...FDW-------------------------ITTVACIV.AVLTG------
T1EFZ6_HELRO/89-576....S...GVKLGLGDFIFYSVLVGKASL..LGDW-------------------------NTTVACFI.AILMG------
B7QGI2_IXOSC/14-384........GMKMGLGDFIFYSILVGKASR..HGTV-------------------------SAVVICYI.YVVIG------
A8PAF6_BRUMA/94-527....K...GIKLGLGDFIFYSVLVGKASS..YGDW-------------------------NTTVACYV.AILIG------
S2J107_MUCC1/49-424........AIKLGLGDFIFYSVLVGKAAK...TDS-------------------------VTLCLCII.AILTG------
D3B4U3_POLPA/99-477........SLKLGLGDFVFYSVLMGRAAM...FDI-------------------------STVFTCFV.AIITG------
H2VWC4_CAEJA/11-477.......ETVRLGFGDFVFYSLLIGQAAA..SGCP-------------------------IAVVFAAA.GILFG------
A9VBA9_MONBE/203-602........GVKLGLGDFIFYSVLVGKAAT..AHEW-------------------------TTILACYV.AILIG------
F2TYS0_SALR5/109-504....T...GVKLGLGDFIFYSVLVGKAAT..ADKW-------------------------TTIAACYV.GILIG------
E1G929_LOALO/15-397........SVRLGMGDFVFYSLMVGKAAA..THNA-------------------------MCVIGSMV.GILVG------
H3FRQ2_PRIPA/544-933....S...GVKLGLGDFIFYSVLVGMAVKH.SADW-------------------------NTLVACYV.AILMG------

PF01478

FLAK_METJA/5-130--------..GVGGGDGKLIMGL----------------------------------------------GALIP......
FLAK_METMP/5-130--------..GIGGGDGKILIGL----------------------------------------------GALVP......
LEP4_BACSU/100-204--------..GVGGGDIKLFAVI----------------------------------------------GFVLG......
Q9HWA5_PSEAE/4-110--------..RLGAADVKYLAAL----------------------------------------------GLASD......
Q8FME5_COREF/77-189--------PAGLGLGDVKFAAVV----------------------------------------------GVFLGW....F
Q9CPF6_PASMU/89-199--------..LLGKGDYWLMLGL----------------------------------------------GSMSH......
Q9RSQ9_DEIRA/109-347--------PVAMGFGDVKLAAVI----------------------------------------------GAFLG......
Q97HN8_CLOAB/64-168--------..VIGLGDVEIFIIC----------------------------------------------GISIG......
Q8XQX7_RALSO/14-117--------..WMGAGDVKFFAVA----------------------------------------------GLLAG......
LEP4_HAEIN/90-200--------..AFGRGDYWLAMAL----------------------------------------------GSFIH......
Q8TMQ5_METAC/5-101--------..CFGGGDAKSLILI----------------------------------------------SLLFP......
Q8NQ30_CORGL/4-110--------..GIGGGDIKLALGL----------------------------------------------GTAVAALGMQA
Q98BF9_RHILO/11-116--------..GMGGGDAKLLAAT----------------------------------------------AVWMG......
Y421_METTH/12-138--------..AWAGGDVKLFTAV----------------------------------------------TSLLP......
Q8CXM1_OCEIH/104-208--------..GMGAGDMKLLGLA----------------------------------------------GIVLG......
A9CKJ3_AGRT5/8-113--------..VMGGGDAKLLTGA----------------------------------------------AVWYG......
Q8TXH1_METKA/6-112--------..VLGGGDVKLLPSL----------------------------------------------TLFLH......
Q8DLL0_THEEB/89-199--------..VMGGGDGKLAAMI----------------------------------------------GAWLG......
YC8A_METJA/6-148--------..FMGGGDCKFLMGL----------------------------------------------SYLKG......
Q9XAP1_STRCO/112-224--------PAGMGFGDVKLALTA----------------------------------------------GAVLGW....Y
LEP4_MYXXD/113-222--------..ALGAGDKYLVAML----------------------------------------------GAFLT......
LEP4_XANCP/133-242--------..GMGHGDFKLLAAL----------------------------------------------GAWCG......
Q8TLD4_METAC/26-152--------..AFGGGDAKGLLVL----------------------------------------------SILFP......
O67535_AQUAE/105-214--------..GLGFGDVILLGFI----------------------------------------------GSVSG......
Q988A4_RHILO/13-122--------..GLGLGDVKMLAAA----------------------------------------------SCWIS......
Q8XVK3_RALSO/140-249--------..GMGYGDFKLMGAL----------------------------------------------GAWFG......
Q87I88_VIBPA/13-110--------..IVGGGDVKLIGVL----------------------------------------------FLGVN......
Q8F6L1_LEPIN/127-232--------..GIGFGDVLFAPIY----------------------------------------------AFIAG......
Q891G5_CLOTE/115-221--------..GMGWGDVEVIFIA----------------------------------------------GLFLG......
Q9K8H1_BACHD/15-120--------PNGIGGGDVKLFTVL----------------------------------------------GFVLG......
LEP4_PSEAE/136-245--------..GMGYGDFKLLAML----------------------------------------------GAWGG......
Q8XI34_CLOPE/100-206--------..AMGSGDIEIHAIA----------------------------------------------GIFLG......
Q8EJP8_SHEON/157-266--------..GMGYGDFKLLAVF----------------------------------------------GAWLG......
Q9CMH2_PASMU/11-110--------..VMGAGDIKLMSVL----------------------------------------------MLTIP......
Q92T43_RHIME/12-117--------..VMGGGDAKLLTAS----------------------------------------------AAWFG......
HOPD_SALTY/9-119--------..GLGYGDVKYLAAL----------------------------------------------GAWHC......
Q8FT27_COREF/8-114--------..GIGGGDIKFALGL----------------------------------------------GTVAATGSVEG
Q8THK9_METAC/8-134--------..VFGGADAKALIVI----------------------------------------------GTLVP......
Q8RAF7_THETN/104-208--------GGEMGGGDVKLMALI----------------------------------------------GFFIG......
PPPA_ECOLI/130-240--------..ALGMGDVLLFAAL----------------------------------------------GGWVG......
Q92YL6_RHIME/12-116--------..WIGGGDAKLLPVA----------------------------------------------VLWLG......
Q89PI9_BRADU/13-114--------..GIGGGDVKLLTAL----------------------------------------------AIGFP......
Q89UH6_BRADU/9-113--------..WVGGGDAKVAASV----------------------------------------------ALWFG......
Q87M36_VIBPA/5-111--------..AMAGGDVKLLAVI----------------------------------------------GAWLG......
Q8Y6Y1_LISMO/101-204--------..GIGLGDIKILIIL----------------------------------------------STFLG......
Q89HG8_BRADU/40-149--------RDGLGLGDVKLAAVC----------------------------------------------GAWLD......
Q8YXA0_NOSS1/108-226--------..AMGAGDAKLAAMM----------------------------------------------GAWLG......
Q9X222_THEMA/103-204--------RDGLGAGDVILAMGI----------------------------------------------GFLLS......
LEP4_VIBCH/112-221--------..VMGGGDIKLYTAI----------------------------------------------GTLIG......
Q989C3_RHILO/11-122--------..KVGAGDVKLMAVV----------------------------------------------PFLVG......
LEP4_ECOLI/81-190--------..GLGYGDFKLLAAA----------------------------------------------GAWCG......
Q9ABP2_CAUCR/121-230--------..GMGGGDPRLLGAI----------------------------------------------GAWVG......
Q8Y1N3_RALSO/10-114--------..GMGAGDVKLMGAI----------------------------------------------GAFTG......
Q88QB9_PSEPK/4-110--------..RFGADDVKLMGAL----------------------------------------------ALATS......
Y83C_METJA/9-115--------..GMGGGDVKLFTAL----------------------------------------------APIFA......
Q87VV0_PSESM/5-111--------..RLGAADVKLMTAL----------------------------------------------ALASN......
O29326_ARCFU/8-129--------..AYGGADAKAIMAL----------------------------------------------AVIFP......
Q97FF6_CLOAB/100-211--------..AFGSGDAEVLLMC----------------------------------------------GLFLG......
Q8RHE5_FUSNN/7-119--------..VFGFDDIKLIIPL----------------------------------------------GGLLY......
Q980Y8_SULSO/10-125--------..LLGGADLFLNVIL----------------------------------------------SLANA......
Q8R8E5_THETN/6-111--------..QLGGGDVKLLTAL----------------------------------------------AFFFG......
LEP4_SYNY3/108-223--------..GMGDGDPKLASMV----------------------------------------------GAWLG......
A0KPV9_AERHH/142-247--------..GMGYGDFKLLAAL----------------------------------------------GAWLG......
A5EXL5_DICNV/138-247--------..GMGYGDFKLLACL----------------------------------------------CAWQG......
A9H675_GLUDA/111-216--------HDGLGGGDAKLLAAG----------------------------------------------GAWLG......
C9R2X4_AGGAD/10-108--------..FIGAGDIKLASVL----------------------------------------------MLAVP......
C9R6J1_AGGAD/90-198--------..ALGRGDYWLALGL----------------------------------------------GVFLP......
E0SLF4_DICD3/139-243--------..ALGQGDFKLLAAL----------------------------------------------GAWLG......
G1UB88_HAEDU/13-108--------..VIGAGDAKLMAVL----------------------------------------------MLAVP......
H7C7G6_CAUCR/11-113--------..WIGGGDGKLFAVC----------------------------------------------ALWLG......
H9L4S3_VIBCH/135-244--------..GMGYGDFKLLAAL----------------------------------------------GAWLG......
I6Y9M6_MYCTU/5-108--------..AMGAGDVKLAIGL----------------------------------------------GGLTG......
LEP4_BURPS/162-269--------..GIGYGDLKLLAAL----------------------------------------------GAWLG......
Q0WIM7_YERPE/129-236--------VDGMGYGDFKLMAAL----------------------------------------------GAWFG......
Q5F692_NEIG1/134-242--------..GMGNGDFKLIAAL----------------------------------------------GAWLG......
Q5ZVB6_LEGPH/138-246--------..GMGHGDFKLFAAF----------------------------------------------GAWLG......
Q65GL0_BACLD/102-205--------..GIGWGDVKLFAVI----------------------------------------------GMALG......
Q7MJZ8_VIBVY/10-109--------..LLGAGDVKL.AVI----------------------------------------------CVWMV......
Q9PAI1_XYLFA/133-241--------..GMGHGDFKMLAAL----------------------------------------------GAWCG......

PF04258

SIPL5_ARATH/240-524-LFLTYLGLYVMNGHGQPALLYLVPCTLGITV-ILGLVRKELRDLWNYGTQQ
SPP2A_MOUSE/214-499-MIITFVVLMVMK.TGQPALLYLVPCTLITVS-VVAWSRKEMKKFWKGSSYQ
SIP_ARATH/47-323-VILTIVVMNWFQ.AAQPALLYIVPAVIGFLA-SHCIWNGDIKPLLAFDESK
SPP2B_HUMAN/213-505-LLVTFVALALMQ.RGQPALLYLVPCTLVTSC-AVALWRRELGVFWTGSGFA
Q9VPQ7_DROME/71-359-LLATIFVMHVFK.HAQPALLYLVPACMGTPL-LVALIRGELKVLFAYEDHP
Q9VBL1_DROME/96-408-LLTATVSSEVFK.AAQPALLYLVPFTLLPLL-LMAYLKGDLRRMWSEPFIA
SIPL4_ARATH/241-527-LLITYIALNLMDGHGQPALLYIVPFILGTLF-VLGHKRGDLKTLWTTGEPD
SIPL2_ARATH/242-525-LLITYVALNLMDGHGQPALLYIVPFTLGTML-TLARKRDDLWILWTKGEPE
YL8H_SCHPO/31-282-LGVTNFALYYFK.AAQPALLYLSPACIVAPL-LTAWYRDELKTLFSFRSET
YKK0_YEAST/145-510-LVSAMVSLSIFN.TAQPALLYIVPSLLISTI-LVACWNKDFKQFWNFQYDT
SPPL3_MOUSE/60-374-LLTATVASRIHR.AAQPALLYLVPFTLLPLL-TMAYLKGDLRRMWSEPFHS
IMP2_CAEEL/55-450-LFITMAVMHHFK.AAQPALLYLVPCCLFVPL-LLAVIRGELSALWNYDESR
HM13_MOUSE/62-350-LGLTIFIMHIFK.HAQPALLYLVPACIGFPV-LVALAKGEVAEMFSYEESN
Q93346_CAEEL/275-601-LIVTFLALALMK.TAQPALIYLVPSTLFPII-MLALCRGEFLKIWNGVPVE

PF06550

Q9HM09_THEAC/1-278-MAVLYF.--WNRDRPAPGLPYINTGTIAGFL-IAFLAFRV-----------
Q9HQ23_HALSA/15-306-LLVLMRM--VFAGRAHAGLPLLNGGAIAGYL-VGAVAAGI-----------
Q8TIY9_METAC/27-303-HIFLSIL--VMRGKPQAGLPFLNSGAIIGFF-IGVLFSGA-----------

PF01080

D3B5F5_POLPA/149-528-LFITLLLLAVYK-RALPALPIKMKFNKLLLV-SILLIVH...---------
G4VJ47_SCHMA/58-484-MCITVIVLGITR-QALPALPISITCGILFYF-VSSATISPFL---------
E9C2Q6_CAPO3/204-586-LCLTLVLLAIYR-RALPALPISIAFGLLFYY-VSNEVLVPFN---------
T1KI16_TETUR/103-479-LCLTLLLLAFFK-KALPALPISIFFGLTFYF-TTSQLVAPFC---------
K7J3W8_NASVI/92-490-LCLTLLLLAIFK-KALPALPISIAFGLIFYF-ATRVIVAPFA---------
U6IMP9_HYMMI/46-488-MCLTIVALAVAR-RALPALPISIICGIIFYF-STAAVITPFI---------
W5JK58_ANODA/96-499-LCLTLLLLAIFR-KALPALPISIFFGLIFCF-VTSVIVKPYT---------
E9FSB0_DAPPU/62-438-LCLTLLLLAIFR-KALPALPISITFGLVFYF-ATSKLVAPFA---------
C5WT76_SORBI/25-446-LGITLLLLAFFR-KALPALPVSIALGVVFYV-LTRTLLEEFV---------
C3Z2C5_BRAFL/88-496-LCLTLLLLAIFK-KALPALPISITFGLIFNF-ATANLVTPFT---------
H2TY46_TAKRU/29-412-LCLTLLLLAIFK-KALPALPISITFGLIFYF-STDFLVQPFM---------
H3AT04_LATCH/77-455-LCLTLLLLAIFK-KALPALPISITFGIIFYF-ATDNLVRPFM---------
I1HEG8_BRADI/69-507-LGCTLILLSICR-HALPALPISIMLGVVFYF-LTRLLMEPFV---------
W4XU10_STRPU/68-474-LCLTLILLAIFK-KALPALPISIAFGLVFYF-CTSNLVFPFT---------
G7Y344_CLOSI/42-431-MCVTIIVLGITR-RALPALPVSVACGILFYF-VTSTVISPFL---------
B7Q2V0_IXOSC/41-421-LCLTLLLLAIFK-KALPALPISITFGLIFYF-ATSSLVQPFA---------
PSN1_RAT/76-458-LCLTLLLLAIFK-KALPALPISITFGLIFYF-ATDYLVQPFM---------
T1JMG4_STRMM/67-438-LCLTLLLLAIFQ-KALPALPISITFGLIFYF-LTKEIVQPFA---------
T1G6P3_HELRO/9-376-LSLTILLLVLYE-QALPALPISVFFGVAFYF-GGYYTIDPFV---------
D7LLE1_ARALL/15-389-LGITLMLLSVYQ-KALPALPVSIMLGVVFYF-LARLLLEVFV---------
A2G9L8_TRIVA/13-428-LALTLICLAYFE-RPLPALPFSLALGIIFYL-IGAYTFRGF.---------
F6RA92_CIOIN/37-422-LCLTLILLAIYR-KALPALPISITFGLVFYF-STDYVVRPYM---------
I3IV36_ORENI/95-480-LCLTLLLLAIFK-KALPALPISIFFGLVFYF-ATDNLVRPFM---------
H2Z6F8_CIOSA/7-395-LCLTLILLAIYR-KALPALPISITFGLVFYF-STDYVVRPFM---------
K1PKB7_CRAGI/84-479-LCFTLLLLAIFR-KALPALPISITFGLIFNF-TTSLLVQPFA---------
S2K404_MUCC1/83-504-LTATIFLLAIYK-KALPALPISIAFGMLFYF-VAKTVLVPYV---------
H3FRQ2_PRIPA/66-481-LCATLLLLAVFK-KALPALPISITAGLIFYF-STTFLITPFT---------
E0VJ41_PEDHC/87-467-LCLTLLLLAVFR-KALPALPISITFGLIFYF-TTKKIVKPFA---------
E2AIY0_CAMFO/93-484-LCLTLLLLAIFK-KALPALPISITFGLTFYF-ATRVIVAPFA---------
F4PRZ5_DICFS/219-583-LFITLILLIVYK-KAIPALPISIFIGILFFF-STSKLICPFL---------
B0WS38_CULQU/61-516-LCLTLLLLAIFR-KALPALPISIFFGLIFCF-ATSVIVKPFT---------
U6HU93_ECHMU/45-476-MCLTIVALGVAR-KALPALPISIACGIVFYF-STAVVITPFI---------
E2BSL4_HARSA/95-504-LCLTLVLLAICK-KALPALPISITFGLTFYF-ATRVIVAPFA---------
H9J5W9_BOMMO/68-456-LCLTLLLLAILK-KALPALPISITFGLIFYF-ATRSVVKPFA---------
G3Q8S2_GASAC/77-448-LCLTLLLLAIFK-KALPALPISITFGLVFYF-STGFLVQPFM---------
F6GSZ0_VITVI/15-427-LGVTLMLLAIYQ-KALPALPVSILLGVLFYF-FTRFLLEAFI---------
B4QRZ4_DROSI/98-517-LCLTLLLLAIWR-KALPALPISITFGLIFCF-ATSAVVKPFM---------
SPE4_CAEEL/11-464-LVVTLTVFSTEE-STTPALPLPVICGTFCYF-SSMFFWEQLY---------
C7J054_ORYSJ/30-449-LGITLLLLAFYR-KALPALPVSIALGVVFYV-LTRTLLETFV---------
T1HN85_RHOPR/7-402-LSLTLLLLAIFK-KALPALPISITFGLIFYF-TTTEIVQPFS---------
A9S846_PHYPA/9-467-LGATLILLAVWQ-RALPALPISISLGVIFYF-LARLVMDPFV---------
E3N426_CAERE/9-463-LVATLTVFSSGE-STTPALPLPVICGTFCYF-ISKFVVDQVY---------
D8LTV7_ECTSI/63-572-LGATLVLLAVYR-MALPALPISIGFGTVFYL-LTRFSIQPYV---------
H3CB70_TETNG/22-406-LCLTLLLLAIFK-KALPALPISITFGLVFYF-STDFLVQPFM---------
G2J6Q7_CAEBR/9-477-LIATLTVLSSEE-STTPALPLPVICGTFCYF-VSRFLVDS..---------
I1N8G3_SOYBN/8-407-LGCTLILLSMCR-KALPALPISIALGVLFYF-LTRLLMEPFI---------
G3W888_SARHA/88-452-LCLTLLLLAVFK-KALPALPISITFGLIFYF-STDNLVRPFM---------
PSN_CAEEL/44-434-LCFTLVLLAVFK-RALPALPISIFSGLIFYF-CTRWIITPFV---------
F2CQD9_HORVD/22-450-LGCTLILLSICR-HALPALPISIMLGVVFYF-LTRLLMEPFV---------
W5N759_LEPOC/69-512-LCLTLLLLAIFK-KALPALPISITFGLVFYF-ATDNLVRPFM---------
Q7PR98_ANOGA/98-513-LCLTLLLLAIFR-KALPALPISIFFGLIFCF-VTSVIVKPFT---------
M1CAI2_SOLTU/15-421-LGITLMLLAFYQ-KALPALPVSVLLGVLFYL-LTRLLLETFV---------
W1NQ31_AMBTC/9-446-LGCTLILLSLCN-HALPALPVSITLGVMFYF-LTRLLMEPFV---------
K3WL66_PYTUL/82-563-LGGTLFLLAVLH-KALPALPISIFLATFFYF-WTYYLFVDFC---------
A2DZ73_TRIVA/13-381-LSLTLVCLAVWE-RPLPALPFSLALGIVFFI-IGAMTFRQFC---------
G0NCU3_CAEBE/9-464-LIVTLTVLSNDE-STTPALPVPVICGTFCYF-ISKLVMDQFY---------
U9UMQ1_RHIID/178-561-LNTTIFLLAIYK-KALPALPISIAFGMLFYF-VARNTLVPY.---------
T1EFZ6_HELRO/89-576-LCFTLLLLASFR-KALPALPVSIAFGLIFYF-ATSQVVLPFM---------
B7QGI2_IXOSC/14-384-IILTLALLVIAQ-KPVPALPLSISLGMFAYF-STISFVEPFM---------
A8PAF6_BRUMA/94-527-LCFTLILLAVFR-KALPALPISIFCGLIFYF-CTRGIITPFC---------
S2J107_MUCC1/49-424-LSLTILILTLNR-KALPALPISILLGCITYA-TAYYMTSPM.---------
D3B4U3_POLPA/99-477-LFATLFLLAIFR-KALPALPISIAFGILFYF-LTRIFLYPFI---------
H2VWC4_CAEJA/11-477-LLVTLTVLSTEE-STTPALPVPVLCGTFCYF-TSKFVWENL.---------
A9VBA9_MONBE/203-602-LACTLLLLSIFK-KALPALPISIFFGLCFFF-LTSEVLDPLI---------
F2TYS0_SALR5/109-504-LACTLLLLSIFR-KALPALPISIAFGLVFYF-ATSEVLDPLI---------
E1G929_LOALO/15-397-LIVTLTILSNDD-ETTPALPVSITIALLLHF-GIYLFVEPFY---------
H3FRQ2_PRIPA/544-933-LCATLLLLAVFK-KALPALPISITAGLIFYF-ATSFIITPFT---------

PF01478

FLAK_METJA/5-130.KYNMPIHTPLGAILNYLYLPSFPIMVVINAM.FFSITLPI-----------
FLAK_METMP/5-130.KFQMPIYTSLGTLLNLNYIPNFPIMVFINGI.FFMVFLPF-----------
LEP4_BACSU/100-204.VKML...................AAAFFFSV.LIGALYGA-----------
Q9HWA5_PSEAE/4-110.PLTV...................LYSLAFGC.LLCIALFI-----------
Q8FME5_COREF/77-189SWQHV...................AIGTLLAF.VLNVVVAV-----------
Q9CPF6_PASMU/89-199.FAWL...................PLWLFLAC.VMGLGYVC-----------
Q9RSQ9_DEIRA/109-347.WERL...................LLAVVVAI.FAGAVLGL-----------
Q97HN8_CLOAB/64-168.FYKS...................IEVLILSI.FLCGIYGI-----------
Q8XQX7_RALSO/14-117.WHGL...................VAIWLVSS.VLAGVHAL-----------
LEP4_HAEIN/90-200.LETL...................PHFLLLAS.VLGICFSL-----------
Q8TMQ5_METAC/5-101........................DPVLIIWIMFISSVIVI-----------
Q8NQ30_CORGL/4-110LMVAI...................VGSSLISV.LLGGIFAA-----------
Q98BF9_RHILO/11-116.LNIH..................LVEYLVVST.LIGGLLTI-----------
Y421_METTH/12-138.FQPSLVSYSFLGTAFPVTASYPFPLTVIINS.ILALLPFL-----------
Q8CXM1_OCEIH/104-208.VEKI...................ILAFFLAC.IIGSVISI-----------
A9CKJ3_AGRT5/8-113.FNIS..................LVEFLLAVT.LVGGALTV-----------
Q8TXH1_METKA/6-112.RGDRIT...............TGIDVLFNSI.LLYAPFAL-----------
Q8DLL0_THEEB/89-199.WQGL...................LVTFFLAC.ALGGLMGG-----------
YC8A_METJA/6-148.MFFT...................FIIFLNAI.LFVIPYCI-----------
Q9XAP1_STRCO/112-224GWPTL...................MLGTFAGF.LLGALYGG-----------
LEP4_MYXXD/113-222.WRAL...................LGVLLFAS.MQGAVVGI-----------
LEP4_XANCP/133-242.LKGI...................LPIILISS.LVGAVLGS-----------
Q8TLD4_METAC/26-152.LYPIFQFSGEAYPLLGRPLIGLFTLTVLGNALLLTALIPL-----------
O67535_AQUAE/105-214.VYGV...................FSALFIGS.FLGLLYAL-----------
Q988A4_RHILO/13-122.PLLL...................PVLLFIAS.ASALLFVG-----------
Q8XVK3_RALSO/140-249.WQAL...................PLLVLLSS.VVGLVFGV-----------
Q87I88_VIBPA/13-110.DEYM...................LAAIVAIG.LLGGIQIL-----------
Q8F6L1_LEPIN/127-232.HPWW...................MFFLNASY.IPAVLFTI-----------
Q891G5_CLOTE/115-221.IKLC...................FLLTFLSF.FIGAIISV-----------
Q9K8H1_BACHD/15-120.WKLT...................LVAIMLSS.LCGAIGGG-----------
LEP4_PSEAE/136-245.WQIL...................PLTILLSS.LVGAILGV-----------
Q8XI34_CLOPE/100-206.WKLA...................IINIFLSF.IIGGIIAV-----------
Q8EJP8_SHEON/157-266.WQML...................PLVILLSS.LVGAFVGI-----------
Q9CMH2_PASMU/11-110.HSQI...................IYFFLFTA.FSGLFLII-----------
Q92T43_RHIME/12-117.FNES..................LVTFLVYVS.FFGGFLTL-----------
HOPD_SALTY/9-119.WETL...................PLLVFLAAMLACGGFGV-----------
Q8FT27_COREF/8-114WLLAV...................VGSSLLTL.LLAGVTLS-----------
Q8THK9_METAC/8-134.VYPVLDFYGYTFPLLGFPPVGLFSLTVLENSVLLTAIIPL-----------
Q8RAF7_THETN/104-208.WKLV...................LLNLLLGV.VLGALAGV-----------
PPPA_ECOLI/130-240.ALSL...................PNVALIAS.CCGLIYAV-----------
Q92YL6_RHIME/12-116.ADLA...................LPFILYTS.VIGAALTV-----------
Q89PI9_BRADU/13-114.LTGV...................IQLLTVTA.LAGGILAL-----------
Q89UH6_BRADU/9-113.FAQL...................MNFLLYAS.LFGGALTL-----------
Q87M36_VIBPA/5-111.LSNLWE...............ASIGIILAGG.IVGIFYLM-----------
Q8Y6Y1_LISMO/101-204.FKIG...................YYIFFLAI.IMGTIILL-----------
Q89HG8_BRADU/40-149........................LATVAAVI.ELAALLAI-----------
Q8YXA0_NOSS1/108-226.WRYL...................LLAGLIAC.TLGALVGV-----------
Q9X222_THEMA/103-204.PVPS...................IFAILIAS.ISGILYAL-----------
LEP4_VIBCH/112-221.VEFV...................PYLFLLSS.IIAFIHWF-----------
Q989C3_RHILO/11-122.GNDLVG...............FSILLLLFAL.ATAVVVKN-----------
LEP4_ECOLI/81-190.WQTL...................PMILLIAS.LGGIGYAI-----------
Q9ABP2_CAUCR/121-230.WQGL...................PSVLVWAC.VAGLSVAI-----------
Q8Y1N3_RALSO/10-114.PLAA...................LHVGLASC.VAGGVLAV-----------
Q88QB9_PSEPK/4-110.PQYV...................LGTFIGAG.VTVLVWLL-----------
Y83C_METJA/9-115.YPNSFVFY..........IPKYILYLIAISM.FIAAVFPM-----------
Q87VV0_PSESM/5-111.TAYL...................LCTFIGAG.VAMLAWAL-----------
O29326_ARCFU/8-129.FYPTFNGFPL......LGPSFSFAFSTLANS.VIAAPFLL-----------
Q97FF6_CLOAB/100-211.MKLG...................MFMLFISF.VLAGFVSI-----------
Q8RHE5_FUSNN/7-119.LGEINFF.............LQIYIFYLLVF.SLATLYII-----------
Q980Y8_SULSO/10-125.SVISLVPSRF......LVIGLEPLVIVLYSS.IIILIFSL-----------
Q8R8E5_THETN/6-111.SDI....................MVLLLIAG.ITATAYGV-----------
LEP4_SYNY3/108-223.WPSL...................LLTTFIAC.FIGSIYGG-----------
A0KPV9_AERHH/142-247.WQAL...................PIVLLLSS.LVGAFIGI-----------
A5EXL5_DICNV/138-247.AWML...................PIILFSAA.ILGMIYAL-----------
A9H675_GLUDA/111-216.PESL...................PHVVFLGA.VLTL....-----------
C9R2X4_AGGAD/10-108.SDEV...................FSFFFFTT.FAGLGLI.-----------
C9R6J1_AGGAD/90-198.AHQF...................PVFLFLAC.FFGLLYA.-----------
E0SLF4_DICD3/139-243.WQAL...................PNLVLIAS.LTGLAA..-----------
G1UB88_HAEDU/13-108.PEYT...................IFFLFFTT.CAGLGL..-----------
H7C7G6_CAUCR/11-113.WPAA...................LTFMLYTG.LAGGVLT.-----------
H9L4S3_VIBCH/135-244.WQQL...................PVIVLLSS.VVGVIFGL-----------
I6Y9M6_MYCTU/5-108.CFGVE................VWFLAALAAP.LLTAVCG.-----------
LEP4_BURPS/162-269.WEAL...................PQVVLIAA.VAGAAVGL-----------
Q0WIM7_YERPE/129-236.VSAV...................PFLILFSS.FFGLVA..-----------
Q5F692_NEIG1/134-242.ISAL...................PVLIFVSS.LIGLVAA.-----------
Q5ZVB6_LEGPH/138-246.WMYL...................PLILLISS.ITGAIIGL-----------
Q65GL0_BACLD/102-205.SRLL...................VLAFFLSA.AAGTVLGL-----------
Q7MJZ8_VIBVY/10-109.FPNW...................GELILLSA.LGAGVLA.-----------
Q9PAI1_XYLFA/133-241.LKGI...................LPIILISS.LAGVVLG.-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window