Sequence alignment for CL0130

PF04258

SIPL5_ARATH/240-524--GAEEETLD......ISAMGAVIFVISASTFLVLL-------FFFMSSW---------....FIL..............
SPP2A_MOUSE/214-499--KKKDDYLT......FSPLTVVVFVVICCIMIVLL-------YFFYRW.---------....LVY..............
SIP_ARATH/47-323--KDTPPTET......MSKEHAMRFPLVGSAMLLSL-------FLLFKFL---------SKDLVNA..............
SPP2B_HUMAN/213-505--KQEDEAVD......VTPVMTCVFVVMCCSMLVLL-------YYFYDL.---------....LVY..............
Q9VPQ7_DROME/71-359--STGEKADT......MTKKDAMYFPLIASAALFGL-------YLFFKIF---------QKVHINY..............
Q9VBL1_DROME/96-408--EPTDKFAT......LDTMHALCLPLGASISLLIM-------FFFFDS.---------....MQL..............
SIPL4_ARATH/241-527--TSSRGVVE......VTVISAILFVVVASCFLIML-------YKLMSFW---------....FIE..............
SIPL2_ARATH/242-525--GGS.GVVE......INSISAIFFVVLASGFLVIL-------YKLMSYW---------....FVE..............
YL8H_SCHPO/31-282--QL............INKRLAVLFPIFGGVTLVLM-------YLALRYL---------SKEYIQL..............
YKK0_YEAST/145-510--KSKRFFDM......MDEKHAIILPLTSGCTLLAL-------YFVIKKL---------HLNWLKY..............
SPPL3_MOUSE/60-374--STNNSIQT......IDSTQALFLPIGASVSLLVM-------FFFFDS.---------....VQV..............
IMP2_CAEEL/55-450--KKRLIEGS......ITMREARKFPISASLVLFGL-------YLFFKPA---------AERFLWVARVFQILRVPEEYV
HM13_MOUSE/62-350--SSSDMPET......ITSRDAARFPIIASCTLLGL-------YLFFKIF---------SQEYINL..............
Q93346_CAEEL/275-601--SPSNDSETKGFLDRFGGIITICLMMTTLCGVLLL-------GYFFRPV---------....LVI..............

PF06550

Q9HM09_THEAC/1-278-----MTIFV------LSSLLAILLAVAIYNSEPSS-------YAHRSPT---------YGIGYVF--------------
Q9HQ23_HALSA/15-306-----VALFV------VVQVGALALVEPFQSAGLQ.-------.STENPQ---------NPLNSVV--------------
Q8TIY9_METAC/27-303-----AGLIL------IVQVLALLLSMPMEINDMQ.-------.AFEDPT---------QVSNSIY--------------

PF01080

D3B5F5_POLPA/149-528...SDQMVSI------AIPVFFTMVVVTAVIRAISVPDNQSSPPPANRID.........IPAGFKY--------------
G4VJ47_SCHMA/58-484YYGAKQIISL------FIPVTVCMLFVVAVASTVDF.......YG..HTD..........QY.LLY--------------
T1KI16_TETUR/103-479KYGASHVIKL------FIPVSICMLIVVASIGSLQF.......YT..KTN..........QY.LLY--------------
K7J3W8_NASVI/92-490KYGAVHVIKL------FVPVSLCMLVVVATISSIGF.......YT..TKG..........VY.LVY--------------
A0A068XH02_HYMMI/46-488RVGAKQIISL------FIPVTICMFFVAFISKNVPF.......FS..TTD..........AH.SVY--------------
W5JK58_ANODA/96-499KYGAQHVIKL------FVPVTLCMLVVVATISSINF.......YT..IKD..........VY.LVY--------------
E9FSB0_DAPPU/62-438KYGAAHVIKL------FVPVSLCMMVVVATISSVTY.......YT..QKG..........IY.LVY--------------
C3Z2C5_BRAFL/88-496KYGAKHVIML------FAPVSLCMAVVVATISSITF.......YT..EKN..........GY.LIY--------------
H2TY46_TAKRU/29-412KYGAKHVIML------FIPVTLCMVVVVTTIKSVSF.......YS..EKS..........DQQLIY--------------
H3AT04_LATCH/77-455KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..KKN..........GQ.LIY--------------
I1HEG8_BRADI/69-507...GEEVLAV------MSPVSICMALVVLLISIL..........SPPSSPASPSAPPPVTAATLVY--------------
W4XU10_STRPU/68-474KYGAKHVIML------FVPVSLCMLVVVATISTVSF.......YT..ESG.........DVY.LIY--------------
G7Y344_CLOSI/42-431VFGAKQVIRL------FIPVTICMFFVVLVATTVDY.......YA..STE..........TY.LIY--------------
B7Q2V0_IXOSC/41-421KYGAKHVIRL------FVPVSLCMLVVVATISSISF.......YR..HTN..........TY.LVY--------------
PSN1_RAT/76-458KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..RKD..........GQ.LIY--------------
T1JMG4_STRMM/67-438KYGAKHVIKL------FVPVTLCMLVVVATISSVTF.......YT..QRG..........KF...Y--------------
T1G6P3_HELRO/9-376QYGAESIIML------FIPVSICISFVIASVQALDF.......YK..EEG..........LP.LPF--------------
D7LLE1_ARALL/15-389...GEELIAI------LTPVSICMFTVVLLVCILN........SDPSSSS.ASFS....SIATAAY--------------
A2G9L8_TRIVA/13-428.IYSKRIYKI------AVPVILTLVIDVWLTRTLEEKFDNTALSTSFASV................--------------
F6RA92_CIOIN/37-422RYGASTVISL------FIPVTLCMLVVVATITSVSY.......YTDQSQQ..........QF.LVY--------------
I3IV36_ORENI/95-480KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..QND..........GQRLIY--------------
H2Z6F8_CIOSA/7-395RYGANTVISL------FIPVTLCMLVVVATITSVSY.......YTDQSQG..........QY.LVY--------------
K1PKB7_CRAGI/84-479LYGAKHVIML------FVPVSLCMAVVVATISSVTF.......YT..EKG..........GY.LVY--------------
S2K404_MUCC1/83-504.FYTLQIYRI------IKPVVACIILSIFWVKVS.........YSGSSDY....SPTRPNYVNLTP--------------
H3FRQ2_PRIPA/66-481KYGAEHVIRL------FVPVSICMALVILTMKMMSY.......YS..IVQ.........PEMGFVY--------------
E0VJ41_PEDHC/87-467KYGAKHVIKL------FAPVSLCMLVVVATISSIKF.......YT..TSD..........MY.FVY--------------
E2AIY0_CAMFO/93-484KYGAAHVIKL------FVPVSLCMLVVVATISSVHF.......YT..TKG..........MY.LVY--------------
F4PRZ5_DICFS/219-583..YSKAMVSI------ALPVSISMAIVISAVRLSEEARNFKSVSPL.................IQY--------------
B0WS38_CULQU/61-516KYGAQHVIKL------FVPVTLCMLVVVATISSINF.......YS..TKD..........VY.LVY--------------
A0A068YDE2_ECHMU/45-476RIGAKQIISL------FIPVSICMFLVVFISKTVPY.......FS..TTD..........VY.LIY--------------
E2BSL4_HARSA/95-504KSGVVHVINL------FIPVSLCMLVVVATISSVNF.......YT..TKG..........MY.LVY--------------
H9J5W9_BOMMO/68-456KYGARHVIKL------FVPVTLCMLVVVATISSINF.......YS..VKD..........VY.LAY--------------
G3Q8S2_GASAC/77-448KYGAKHVIML------FIPVTLCMLVVVVTIKSVSF.......YT..EKT..........NQTLIY--------------
F6GSZ0_VITVI/15-427...GEEIIRI------ISPVSICMFLVVLLVTILN........SDTSSSS.SSVS....TIATIAY--------------
B4QRZ4_DROSI/98-517KYGAQHVIKL------FVPVSLCMLVVVATINSISF.......YN..STD..........VY.LLY--------------
SPE4_CAEEL/11-464LVRSSQLRWT------LFSVIANMSLTLSIWIGV.........YNMEVNS..........ELSKTY--------------
C7J054_ORYSJ/30-449...GEDITRI------VTPVSTCMLLVVLLVSLL..........SSPSSP.SPFT....AAFSAAA--------------
T1HN85_RHOPR/7-402KYGAAHVIKL------FVPVSLCLLVVVATMNNITF.......YS..TRD..........IY.LLY--------------
A9S846_PHYPA/9-467..VGGEIVGI------VTPVSICMFLVVTLVHIL..........DPRGED.APVS....NIAMMVY--------------
E3N426_CAERE/9-463FRRSSQLQWT------LFSVIVNMSLTLSIWIGI.........YQMQVNS..........ELSKLY--------------
D8LTV7_ECTSI/63-572AYSANSFMAV------VKPVTLCMTLSAFITVSL.........YSDAEGA........TNSALSVY--------------
H3CB70_TETNG/22-406KYGAKHVIML------FVPVTLCMVVVVTTIKSVSF.......YS..EKS..........KQQLIY--------------
G2J6Q7_CAEBR/9-477LRRSSQLQWT------LFSVVVNMSLTLAIWIGI.........YHMEVNS..........ELSKMY--------------
I1N8G3_SOYBN/8-407.WLGVEIIGV------MSPVSICMFLVVLLVYSL..........SSPSTTATTIA....TAANLVY--------------
G3W888_SARHA/88-452KYGAKHVIML------FVPVTLCMVVVVATIKSVRF.......YT..EKN..........GQ.LIY--------------
PSN_CAEEL/44-434KYGASHVIHL------FVPVSLCMALVVFTMNTITF.......YS..QNN.........GRH.LLY--------------
F2CQD9_HORVD/22-450...GEEVLAV------MSPVSICMALVVLLITLL..........APPSSP..PSAPPPVTAATLVY--------------
W5N759_LEPOC/69-512KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..QKD..........GQ.LIY--------------
Q7PR98_ANOGA/98-513KYGAQHVIKL------FVPVTLCMMVVVATISSINF.......YT..IKD..........VY.LVY--------------
M1CAI2_SOLTU/15-421...GEEIVRI------VTPVSICMLLVVILVSVLN........NDSDSSG.PSFT....SIATVAY--------------
W1NQ31_AMBTC/9-446..VGVEIIGV------MAPVSACMFLVVLLVYNM..........SSQGSD.STIR....TAATLVY--------------
K3WL66_PYTUL/82-563MHGINSFWAI------VFPVCVTMIIASLAVVNYR........NSSIEAS.........MQTYLVY--------------
A2DZ73_TRIVA/13-381.FYARKVAKI------AVPVVLTLILDAVCIRFIERTHGSAELNRNFVDT................--------------
G0NCU3_CAEBE/9-464VRRSAQLQWT------LFSVIANMSLTLSIWIGI.........YRMEVNS..........ELSKMY--------------
U9UMQ1_RHIID/178-561KFYMQQIYKI------IKPVVLCILLSVLWVKISILAPNFRPQHPTQQII................--------------
T1EFZ6_HELRO/89-576KYGAGHVIQL------FIPVSLCMAAVVCGINFIEF.......YN..VKD..........VY.LMY--------------
B7QGI2_IXOSC/14-384...MRQVITL------ICALSICMASVACLVRIL.........KPSKNDG..............MS--------------
A0A0H5S0W0_BRUMA/94-527KYGAQHVIHL------FVPVSICMVFVIFTMNTVGY.......YT..RKD.........GQY.LIY--------------
S2J107_MUCC1/49-424QFYVEQLTLL------FYPLIVTFALTCWIEITLNI.......DSSQISN...........PLMVY--------------
D3B4U3_POLPA/99-477...SNMIIAI------LKPVTITMFLVVWAVRSINAKNNILGQYVGGGSM...........GMLVY--------------
H2VWC4_CAEJA/11-477LNRSSQLKWT------LFSVIVNMLLTLSVWIGV.........YGMEVNS..........ELSRLY--------------
A9VBA9_MONBE/203-602KYDAESVLAL------IKPVSACMIVVIATIRSITY.......FS..QND..........TQ.FAY--------------
F2TYS0_SALR5/109-504KYGAESVLAL------IKPVSVCMIVVIATIRSVAY.......FS..TND..........TQ.FVY--------------
E1G929_LOALO/15-397...KKMVERL------LIPVTLNILLTLIVWIGV.........YHTKTDS..........NSVFYY--------------
H3FRQ2_PRIPA/544-933KYGAEHVIRL------FVPVSVCMAVVVLTMNTVEF.......YSEPVTA.........SDATSLY--------------

PF01478

C9R6J1_AGGAD/91-199--------------------------------------------------------------------------------
FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRFC/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_CALS4/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_CALS4/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524.............................................................ILTIFFVIGGMQ--GMHNI
SPP2A_MOUSE/214-499.............................................................VMIAIFCIASSM--SLYNC
SIP_ARATH/47-323.............................................................VLTAYFFVLGIV--ALSAT
SPP2B_HUMAN/213-505.............................................................VVIGIFCLASAT--GLYSC
Q9VPQ7_DROME/71-359.............................................................LLTGYFFVLGVI--ALAHL
Q9VBL1_DROME/96-408.............................................................LFAVCTAIIATV--ALAFL
SIPL4_ARATH/241-527.............................................................VLVVLFCIGGVE--GLQTC
SIPL2_ARATH/242-525.............................................................LLVVVFCIGGVE--GLQTC
YL8H_SCHPO/31-282.............................................................ILQGYASLASII--CFVRS
YKK0_YEAST/145-510..........................................................VVKILNFNITLLNIP--AGTFV
SPPL3_MOUSE/60-374.............................................................VFTICTAVLATI--AFAFL
IMP2_CAEEL/55-450QKINSTIISYTANTTTTGPSEPFLLRLASRIPQERVPEAIQNAATYAYTNLPTIQKAECMQLLTFLICFEGVN--AFASL
HM13_MOUSE/62-350.............................................................LLSMYFFVLGIL--ALSHT
Q93346_CAEEL/275-601.............................................................FFNIFLVIFGTC--SLYGC

PF06550

Q9HM09_THEAC/1-278----------------------------------------------------------VYIIAAFLFS.FVII--YLGRK
Q9HQ23_HALSA/15-306----------------------------------------------------------.YVAFLLVATGGILL--VIKYD
Q8TIY9_METAC/27-303----------------------------------------------------------.YIVMILVFTLFVLI--AIKKN

PF01080

D3B5F5_POLPA/149-528---------------------------------D.......TDPNIQQVFLNTLINSLIFLGVVVLSTVIMVI--LYKFK
G4VJ47_SCHMA/58-484---------------------------------TPFHT...PDADIGTQTWQTIANTLIFMSVVVVMTCVLVL--LFKYQ
T1KI16_TETUR/103-479---------------------------------TPFTD...QKADTTTRVWHSFANAFIFLIVIVVMTFVLIL--LYTYR
K7J3W8_NASVI/92-490---------------------------------TPFHE...ETNDSGTKAWQAVANSLILMAVVVFMTVILIV--LYKYR
A0A068XH02_HYMMI/46-488---------------------------------APFNT...PNADIGTQTWQTLVNVAIILTFVIVITFILVL--LFKFK
W5JK58_ANODA/96-499---------------------------------TPFHE...LADDTGTKIWNALANSLILMTVIVIMTILLIV--LYKHR
E9FSB0_DAPPU/62-438---------------------------------TPFHE...DSPDTGTKVWNAVANAAILLGVIVVMTVFLIM--LYKYR
C3Z2C5_BRAFL/88-496---------------------------------TPFHE...EGASTASKVGDSLANAAIMVGVILVMTVFLVI--LYKYR
H2TY46_TAKRU/29-412---------------------------------TPFTE...NTSSVGRRLLNSVLNTIIMISVIVVMTIFLVV--LYKYR
H3AT04_LATCH/77-455---------------------------------TPFSE...DTDTVGQRALNSILNAAIMISVIIVMTLLLVL--LYKCR
I1HEG8_BRADI/69-507---------------------------------LES.....PSDSPGQKLVGALLDAAVFVALVAVVTFVLVA--LYYYR
W4XU10_STRPU/68-474---------------------------------TPFHE...KSDQAGTKAWNALANALIIIGIVLIMTIFLVV--LYKYR
G7Y344_CLOSI/42-431---------------------------------TPFHT...PDADLGTRTWQTIANTLIFMSVIIVMTCVLVL--LFKYQ
B7Q2V0_IXOSC/41-421---------------------------------TPFTD...QTVDTGTKVWQSFANAFILMGVIVVMTILLIL--LYKFR
PSN1_RAT/76-458---------------------------------TPFTE...DTETVGQRALHSILNAAIMISVIVVMTILLVV--LYKYR
T1JMG4_STRMM/67-438---------------------------------TPFHE...NTTDPGTKAWQSLANAFILMGVIVVMTVFLIL--LYKYK
T1G6P3_HELRO/9-376---------------------------------TPFVPE..EKDEVKDTLWKSLANSLIIVGVVIIMTILLFL--LFKYR
D7LLE1_ARALL/15-389---------------------------------AES.....DSDSSWDKFVGALLNSVVFVAAITVATFVLVL--LFYLR
A2G9L8_TRIVA/13-428---------------------------------.......VSQSSGGVSTAVAIYIAIGFIVAIALVTGLLLL--LYWFN
F6RA92_CIOIN/37-422---------------------------------TPFHT...TNAAPAQVVWESIANSLIMIGVIVVMTVFLVL--LYKYR
I3IV36_ORENI/95-480---------------------------------TPFPE...DTDTVGQRALNSILNATIMITVIIVMTLVLVM--LYKYR
H2Z6F8_CIOSA/7-395---------------------------------TPFHT...QNAGTAQVVWESIANSLIMISVIVVMTIFLVL--LYKYR
K1PKB7_CRAGI/84-479---------------------------------TPFHDGDKADADTGTKVWQSVANALILLGVICVMTIVLLL--LYKFR
S2K404_MUCC1/83-504---------------------------------STSSSSTDGSTSSGPSIANSFTNAAIIIGQIIGVTILIVF--LFKKG
H3FRQ2_PRIPA/66-481---------------------------------TPFHTN..AGDDTSTRVLSGLGNALIMICFIVVMTFGLIL--LYKFK
E0VJ41_PEDHC/87-467---------------------------------TPFHE...TDSNPGTKAWNAVANSLILIAVIVVMTIVLII--LYKKR
E2AIY0_CAMFO/93-484---------------------------------TPFHE...DSSDTSTKVWQAFANSLILMSVIVFMTVILII--LYKYR
F4PRZ5_DICFS/219-583---------------------------------DVR.....EDPATQTLVWGTIINSLILVGIIFLSSVIMFA--LYYFK
B0WS38_CULQU/61-516---------------------------------TPFHE...LSDDTGTKIWNALANSLILMTVIVIMTILLIV--LYKRR
A0A068YDE2_ECHMU/45-476---------------------------------TPFHT...PNADIGTQTWQTLANVVIFLSVIVVMTFLLVL--LFKFK
E2BSL4_HARSA/95-504---------------------------------TPFHE...DSSDTSTKVWQAFANSLILMSVIVFMTVILII--LYKYK
H9J5W9_BOMMO/68-456---------------------------------TPFHE...ESPYASTKVWNALANSMILLCVIALMTVLLIV--LYKKK
G3Q8S2_GASAC/77-448---------------------------------TPFTE...NTASVGRRLLNSVLNTIIMISVIVVMTIFLVV--LYKYR
F6GSZ0_VITVI/15-427---------------------------------SED.....SSDSTWDKFKGALLNSLVFVGVVTVVTFLLVL--LFYLR
B4QRZ4_DROSI/98-517---------------------------------TPFHE...QSPEPSVKFWSALANSLILMSVVVVMTFLLIV--LYKKR
SPE4_CAEEL/11-464---------------------------------FLDPS...FEQTTGNLLLDGFINGVGTILVLGCVSFIMLA--FVLFD
C7J054_ORYSJ/30-449---------------------------------G........PGGGGDDITTALITAVTFVVAVTAATFLLAF--LFYLR
T1HN85_RHOPR/7-402---------------------------------TPFHE...RSSDPGTKMWNALANATILLSVIVLMTVLLIL--LYKYR
A9S846_PHYPA/9-467---------------------------------NEQ.....ASDSFSEKLGGALLNAIVFVVIVTLVTFMLVA--LFYYR
E3N426_CAERE/9-463---------------------------------FLDDS...FERTTGNTTLDGLINGFATILVLGCVSFVMLA--FVLYD
D8LTV7_ECTSI/63-572---------------------------------EVYDESTTTLDPSSVRLGKSFVNALIIVLVLAAATFVIVW--MYWMR
H3CB70_TETNG/22-406---------------------------------TPFSE...DTSSVGQRLLHSVLNTVIMISVIVVMTVFLVV--LYKYR
G2J6Q7_CAEBR/9-477---------------------------------FLDDS...FNWTTGNPALDGLINGFCTILVLGCVSFVMLA--FVLYD
I1N8G3_SOYBN/8-407---------------------------------AEN.....PSDTAAQKLEGAVLNAVVFIVFIALATFLLVL--LYYYN
G3W888_SARHA/88-452---------------------------------TPFTE...DTPSIGQRLLNSVLNTLIMISVIVVMTIFLVV--LYKHR
PSN_CAEEL/44-434---------------------------------TPFVR...ETDSIVEKGLMSLGNALVMLCVVVLMTVLLIV--FYKYK
F2CQD9_HORVD/22-450---------------------------------LES.....PSDSPAQKLVGALLDAVVFIALVAVVTFVLVA--LYYYR
W5N759_LEPOC/69-512---------------------------------TPFPE...ETETVGQRALNSILNAAIMISVIVVMTLLLVV--LYKYR
Q7PR98_ANOGA/98-513---------------------------------TPFHE...LTDDTGTKIWNALANSLILMTVIVIMTILLIV--LYKHR
M1CAI2_SOLTU/15-421---------------------------------NES.....SSDSNWDKLKGAILNALVFVVVVTAVTFLLVL--LFYFR
W1NQ31_AMBTC/9-446---------------------------------LEK.....STDSNTQKFEGALLNAGVFVILIALVTFLLVM--LYYYR
K3WL66_PYTUL/82-563---------------------------------GSS.....DQDSGAQQLGMSLVNAVVIIGAIAVLTFGMAL--LYKYN
A2DZ73_TRIVA/13-381---------------------------------.......MSRNDSGISVTASIWSAVGIIFMIIVVTAILLT--LYYFG
G0NCU3_CAEBE/9-464---------------------------------FLDDS...FNWTTGSPTLDGLINGFCTILVLGGVSFIMLA--FVLYD
U9UMQ1_RHIID/178-561---------------------------------.....DTSEDASESAQIFNSFLTAAVIIGNIIVVTIIIVC--LFKYG
T1EFZ6_HELRO/89-576---------------------------------TPFEQSVTPETSTGTRIWQSLANALIMLSVVIVMTVVLLL--LYKYR
B7QGI2_IXOSC/14-384---------------------------------QPYVRYPVEYDAEPVLLMNSFANAFSFLSMIMIVNCTLVL--LYKGG
A0A0H5S0W0_BRUMA/94-527---------------------------------TPFTK...ETDNTGEKLIMSFGNAFIILGVVVTMTVLLIF--LYKFR
S2J107_MUCC1/49-424---------------------------------DEL.....PSDSVGTRLGGSVLNAIIVVCGITLMTFMFVL--CFKYR
D3B4U3_POLPA/99-477---------------------------------NES.....SDDSTGQKIWGSLLNGLVFLVVIVLTTVAFVL--LYKYR
H2VWC4_CAEJA/11-477---------------------------------FLDTA...SNSTTGNPVLDGAINGMFTIVVLGIVSFVMLG--FVLYD
A9VBA9_MONBE/203-602---------------------------------TPFESNGGAGESSGERFGGAVLNALIVVGIVIVMTFILVM--LYIYE
F2TYS0_SALR5/109-504---------------------------------TPYESN.NPNASNSEKFGGAILNALIIIGIVVGMTCVLLL--LYKYR
E1G929_LOALO/15-397---------------------------------MLDPG...HNRTTGNEIVDGMVNGIGCVLMLAVISFALLA--MALYD
H3FRQ2_PRIPA/544-933---------------------------------TPFLSD..EEDDTSTRVLSALGNAGIMIGVIVVMTFVLIL--LYKYK

PF01478

C9R6J1_AGGAD/91-199---------------------------------------------------------------.LYGALLIAI..SLVDW
FLAK_METJA/5-130---------------------------------------------------------------IVGAIGLLIA..SIYDL
FLAK_METMP/5-130---------------------------------------------------------------IIGVIGLLLA..SVQDF
LEP4_BACSU/100-204---------------------------------------------------------------VVFISLLIIV..AVTDI
Q9HWA5_PSEAE/4-110---------------------------------------------------------------LALALWASVC..GYQDI
Q8FME5_COREF/77-189---------------------------------------------------------------AAAAVGCTLL..MVIDL
Q9CPF6_PASMU/89-199---------------------------------------------------------------ASYVSIAICI..AVIDW
Q9RSQ9_DEIRA/109-347---------------------------------------------------------------MVLFTILLVG..SAIDL
Q97HN8_CLOAB/64-168---------------------------------------------------------------CVIATMLFLA..ALIDF
Q8XQX7_RALSO/14-117---------------------------------------------------------------VVLAVLVITS.....DL
LEP4_HAEIN/90-200---------------------------------------------------------------GLTLIILWTI..SYLDW
Q8TMQ5_METAC/5-101---------------------------------------------------------------ILISLFLVLA..CYTDL
Q8NQ30_CORGL/4-110---------------------------------------------------------------FLVGLWCAVL..AVIDI
Q98BF9_RHILO/11-116---------------------------------------------------------------VVFPFCMLFA..AISDM
Y421_METTH/12-138---------------------------------------------------------------FIALLACFYA..SYSDI
Q8CXM1_OCEIH/104-208---------------------------------------------------------------LLLTSLLVII..CISDF
A9CKJ3_AGRFC/8-113---------------------------------------------------------------LILPLCLCFA..ALNDL
Q8TXH1_METKA/6-112---------------------------------------------------------------LAGLAVATVA..AITDL
Q8DLL0_THEEB/89-199---------------------------------------------------------------WLLSAWLLAL..ALIDL
YC8A_METJA/6-148---------------------------------------------------------------LYGLICSIYG..AVEDW
Q9XAP1_STRCO/112-224---------------------------------------------------------------LLLAPVGVLL..AVVDL
LEP4_MYXXD/113-222---------------------------------------------------------------LVLVSLLVPL..AFIDL
LEP4_XANCP/133-242---------------------------------------------------------------IVLSCFLVAM..SGIDL
Q8TLD4_METAC/26-152---------------------------------------------------------------LFAMAFLLYS..CYSDL
O67535_AQUAE/105-214---------------------------------------------------------------YFFFSALLVM..SIIDW
Q988A4_RHILO/13-122---------------------------------------------------------------IALAVVLGAI..SIADF
Q8XVK3_RALSO/140-249---------------------------------------------------------------AALLWFLIAG..SMIDA
Q87I88_VIBPA/13-110---------------------------------------------------------------LVNVLLIFYG.....DI
Q8F6L1_LEPIN/127-232---------------------------------------------------------------LFLCGHLLIS..CLTDA
Q891G5_CLOTE/115-221---------------------------------------------------------------SIFICFLIIV..SVIDF
Q9K8H1_BACHD/15-120---------------------------------------------------------------LALVSLFSII..FVSDL
LEP4_PSEAE/136-245---------------------------------------------------------------LLLTWGLLAM..SLIDA
Q8XI34_CLOPE/100-206---------------------------------------------------------------IVLITFLIVI..SFIDY
Q8EJP8_SHEON/157-266---------------------------------------------------------------AILTFVLIAL..TGIDL
Q9CMH2_PASMU/11-110---------------------------------------------------------------CITMILLIIL..SWTDI
Q92T43_RHIME/12-117---------------------------------------------------------------VVFPFSLALA..ALSDL
HOPD_SALTY/9-119---------------------------------------------------------------IFYASFSLLL..GIYDA
Q8FT27_COREF/8-114---------------------------------------------------------------AVFVVWVGVL..AAWDL
Q8THK9_METAC/8-134---------------------------------------------------------------AACLPFLLYS..SYLDL
Q8RAF7_CALS4/104-208---------------------------------------------------------------MFLSSVLISA..SFIDL
PPPA_ECOLI/130-240---------------------------------------------------------------MILSAWLIAA..SVIDL
Q92YL6_RHIME/12-116---------------------------------------------------------------LLFAGAMTYA..GIRDV
Q89PI9_BRADU/13-114---------------------------------------------------------------LLQILLLLYV..ATIDV
Q89UH6_BRADU/9-113---------------------------------------------------------------LLFPALMAFA..AASDL
Q87M36_VIBPA/5-111---------------------------------------------------------------LVIWSLLIAI..GVSDA
Q8Y6Y1_LISMO/101-204---------------------------------------------------------------YIIYYFLAFF..FITDI
Q89HG8_BRADU/40-149---------------------------------------------------------------AFLAALMLAI..ATHDA
Q8YXA0_NOSS1/108-226---------------------------------------------------------------WTFCGWLLAL..SLIDL
Q9X222_THEMA/103-204---------------------------------------------------------------CVIASALIAI..SLIDL
LEP4_VIBCH/112-221---------------------------------------------------------------LGLYFILFNL..FVIDF
Q989C3_RHILO/11-122---------------------------------------------------------------ALAIPLLARI..AWLDF
LEP4_ECOLI/81-190---------------------------------------------------------------FLYFCFVLTL..SVIDF
Q9ABP2_CAUCR/121-230---------------------------------------------------------------ALMGWSLLLI..ATIDT
Q8Y1N3_RALSO/10-114---------------------------------------------------------------LSLLVLVVTA..AVHDV
Q88QB9_PSEPK/4-110---------------------------------------------------------------IVLLLWLALC..SEQDV
Y83C_METJA/9-115---------------------------------------------------------------IINFILLLLA..AITDI
Q87VV0_PSESM/5-111---------------------------------------------------------------FFLLVWFAIC..AEQDA
O29326_ARCFU/8-129---------------------------------------------------------------LVVLGFLLYA..CKLDL
Q97FF6_CLOAB/100-211---------------------------------------------------------------IVLFSFLFII..SIIDL
Q8RHE5_FUSNN/7-119---------------------------------------------------------------ILLYILLFLV..MYIDI
Q980Y8_SULSO/10-125---------------------------------------------------------------FLSIIMLIHT..SILDL
Q8R8E5_CALS4/6-111---------------------------------------------------------------LSLPVVVLTAYAAWTDC
LEP4_SYNY3/108-223---------------------------------------------------------------WILISFLISL..TLIDW
A0KPV9_AERHH/142-247---------------------------------------------------------------....WVLVAL..TFIDL
A5EXL5_DICNV/138-247---------------------------------------------------------------LVFTWTLIAL..CFIDA
A9H675_GLUDA/111-216---------------------------------------------------------------CLFGWWLLVL..AAIDL
C9R2X4_AGGAD/10-108---------------------------------------------------------------IIMLLLLITL..SITDI
E0SLF4_DICD3/139-243---------------------------------------------------------------...FGTLLAL..AAIDA
G1UB88_HAEDU/13-108---------------------------------------------------------------..IVLLLIWL..SYTDI
H7C7G6_CAUCR/11-113---------------------------------------------------------------.IFPALAIVG..ALKDL
H9L4S3_VIBCH/135-244---------------------------------------------------------------.FFSYVLIAA..TFIDF
I6Y9M6_MYCTU/5-108---------------------------------------------------------------.AVLAWMGVL..CVCDV
LEP4_BURPS/162-269---------------------------------------------------------------..LCAALLAM..SAIDM
Q0WIM7_YERPE/129-236---------------------------------------------------------------LVLIWSLTAL..AFIDF
Q5F692_NEIG1/134-242---------------------------------------------------------------LILTAFLISL..TFIDA
Q5ZVB6_LEGPH/138-246---------------------------------------------------------------.LAIWILISL..VFIDL
Q65GL0_BACLD/102-205---------------------------------------------------------------.ALISLLLIV..FVSDV
Q7MJZ8_VIBVY/10-109---------------------------------------------------------------.ALLLLLAMV..VLSDV
Q9PAI1_XYLFA/133-241---------------------------------------------------------------IVFSCFLVAL..AGIDL

PF04258

SIPL5_ARATH/240-524NVTLIT..RR.CSK-----CGQKNLK..................................LPLL...-------......
SPP2A_MOUSE/214-499LSALIH..RMPCGQ-----CTILCCG.........................................-------......
SIP_ARATH/47-323LLPAIR..RFLPNP-----WNDNLIV..................................WRFPY..-------......
SPP2B_HUMAN/213-505LAPCVR..RLPFGK-----CRIPNNS..................................LPYFH..-------......
Q9VPQ7_DROME/71-359LSPVIN..SLMPAA-----VPKVPFH..................................ILFTK..-------......
Q9VBL1_DROME/96-408LLPMCQ..YIIRPC-----TDGKRFS..................................FGFC...-------......
SIPL4_ARATH/241-527LVSLLSCFRW.FRR-----FGESYVK..................................VPFL...-------......
SIPL2_ARATH/242-525LVALLS..RW.FQR-----AADTYVK..................................VPFL...-------......
YL8H_SCHPO/31-282FNPKTT........-----................................................-------......
YKK0_YEAST/145-510YSYFLN..SLFRNL-----SHLASWNPLVVLPRYRVTIADDNEDLNKIGGFVTNLNYKDGLTNSVVH-------KKTLDE
SPPL3_MOUSE/60-374LLPMCQ..YLTRPC-----SPQNKIS..................................FGCC...-------......
IMP2_CAEEL/55-450LKPFVT...AFLKK-----MPLVPSF..................................LRFNAPY-------LFSLKK
HM13_MOUSE/62-350ISPFMN..KFFPAN-----FPNRQYQ..................................LLFTQ..-------......
Q93346_CAEEL/275-601IRGFLS..NFKFVG-----HRWYNAK..................................MEWFP..-------......

PF06550

Q9HM09_THEAC/1-278KKLRIF--KVIYSI-----VVAYVIF----------------------------------YVFLILL-------SI----
Q9HQ23_HALSA/15-306KQWILR--GVVLVT-----SGL.VAS----------------------------------YVFAVAI-------PA----
Q8TIY9_METAC/27-303MKWIIS--LLIYLA-----IVS.TLY----------------------------------YVFFALF-------TL----

PF01080

D3B5F5_POLPA/149-528FMKALY--GWLMAT-----SILLLGV----------------------------------FGGFLFI.......LILTYV
G4VJ47_SCHMA/58-484CYKFIR--GWIIMT-----TIFLLFL----------------------------------ISFTFFA.......EVLRAM
T1KI16_TETUR/103-479FYKVIY--GWLVLS-----SSLLLFL----------------------------------FMFIYLS.......VVLQKY
K7J3W8_NASVI/92-490FYKTIH--AWLIIS-----SLILLFL----------------------------------FTSLYCE.......EVLKAY
A0A068XH02_HYMMI/46-488CYKFLT--GWLIMA-----TFVVVFL----------------------------------ASFTFFA.......QLLQVS
W5JK58_ANODA/96-499CYKVIH--GWLILS-----SLLLLFL----------------------------------FSGLYLF.......EILRAY
E9FSB0_DAPPU/62-438CYKIIH--GWLIMS-----SLMLLFI----------------------------------FAYLYLG.......EVLRTY
C3Z2C5_BRAFL/88-496CYKFIH--GWLILS-----SLMLLFL----------------------------------FAYIYLG.......EVLQAY
H2TY46_TAKRU/29-412CYKFIH--GWLILS-----SLMLLFW----------------------------------FSFMYLG.......EVFKTY
H3AT04_LATCH/77-455CYKVIH--GWLIIS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
I1HEG8_BRADI/69-507CTGFLK--NYMRFS-----AFFVLFS----------------------------------MGGAIAI.......TILRRL
W4XU10_STRPU/68-474CYKVIH--GWLVLS-----SLLLLFF----------------------------------FTFFYLQ.......ELLVTY
G7Y344_CLOSI/42-431CYRFIH--GWLILT-----TFMLLFL----------------------------------ISFLFFT.......EIIRAM
B7Q2V0_IXOSC/41-421CYKVIH--AWLIVS-----SLLLVFL----------------------------------FAYIYLG.......EVLRAY
PSN1_RAT/76-458CYKVIH--AWLIVS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
T1JMG4_STRMM/67-438CYKVIH--GWLILS-----SLMLLFL----------------------------------FAYIYLG.......EVLRAY
T1G6P3_HELRO/9-376CYKVCA--FWMFLA-----TLLLLFI----------------------------------FSYIYYS.......EFCRYL
D7LLE1_ARALL/15-389CVKFLK--FYMGFS-----AFIVLGN----------------------------------LGGEILV.......LLIDRF
A2G9L8_TRIVA/13-428CVKCIY--VWMVVA-----VSLLLSY----------------------------------YVYLAVG.......KIPSLY
F6RA92_CIOIN/37-422CYKVIH--GWLILS-----TLLLVFL----------------------------------FAYLYLA.......EVLRAY
I3IV36_ORENI/95-480CYKVIQ--GWLFLS-----SLLLLFF----------------------------------FSYIYLK.......EVFKTY
H2Z6F8_CIOSA/7-395CYKVIH--GWLILS-----SLLLLFL----------------------------------FAYLYLA.......EVLRAY
K1PKB7_CRAGI/84-479CYKVIH--GWLIAS-----SLMLLFL----------------------------------FSYIYLG.......VVLQAY
S2K404_MUCC1/83-504WIKVLI--GFFMVI-----VLLLLGF----------------------------------MTYLLLL.......NLIQVF
H3FRQ2_PRIPA/66-481CYRFIH--GWLMMS-----SLMLLTM----------------------------------FSMVYVS.......ELMKMN
E0VJ41_PEDHC/87-467CYKTIH--GWLIAS-----SLMLLFL----------------------------------FSYLYLE.......EVLRAY
E2AIY0_CAMFO/93-484FYKVIH--GWLIIS-----SLLLLSM----------------------------------FSILYCE.......QVLKAY
F4PRZ5_DICFS/219-583FMKALY--GWLMAT-----SILLLGV----------------------------------FGGFLFI.......LLMTYA
B0WS38_CULQU/61-516CYKIIH--GWLIMS-----SLMLLFL----------------------------------FSYLYME.......EVLRAY
A0A068YDE2_ECHMU/45-476CYKCLT--GWLVAT-----TFLLVFV----------------------------------ISFTFFT.......ELLRAS
E2BSL4_HARSA/95-504FYKVIH--GWLIIS-----SLLLLSL----------------------------------FSILYCE.......QVLKAY
H9J5W9_BOMMO/68-456CYKTIH--GWLILS-----SLILLFL----------------------------------FSYLYIE.......EALIAY
G3Q8S2_GASAC/77-448CYKFIH--GWLILS-----SLMLLFW----------------------------------LSFMYLS.......EVFKTY
F6GSZ0_VITVI/15-427CTKFLK--YYMGFS-----SFIVLGF----------------------------------MGGEITL.......FLIQDF
B4QRZ4_DROSI/98-517CYRIIH--GWLILS-----SFMLLFI----------------------------------FTYLYLE.......ELLRAY
SPE4_CAEEL/11-464FRRIVK--AWLTLS-----CLLILFG----------------------------------VSAQTLH.......DMFSQV
C7J054_ORYSJ/30-449CTPCLR--AYLGFS-----SLSVLLL----------------------------------LGGHVAL.......LLLSRL
T1HN85_RHOPR/7-402CYKIIH--GWLIMS-----SLILLSI----------------------------------FSYIYLL.......EVLRAY
A9S846_PHYPA/9-467CTRCLR--VYMGIS-----AFTVLAW----------------------------------MGGIVAV.......QIIKLY
E3N426_CAERE/9-463FQRVVK--AWLTLS-----CMLILFG----------------------------------VSGQTLY.......DLFTQI
D8LTV7_ECTSI/63-572CMRCLV--GYMAMS-----SAVLLGV----------------------------------MGGAVWA.......AALEVY
H3CB70_TETNG/22-406CYKFIH--GWLILS-----SLMLLFW----------------------------------FSFMYLG.......EVFRTY
G2J6Q7_CAEBR/9-477FRRIVK--SWLTFS-----CLLILFG----------------------------------VSGQTIY.......DLFSQI
I1N8G3_SOYBN/8-407CTAFLL--HYTRFS-----TFFVLAA----------------------------------MGGSILL.......SLLERF
G3W888_SARHA/88-452CYKFIH--GWLILS-----SLMLLFL----------------------------------FTYIYLG.......EVLKTY
PSN_CAEEL/44-434FYKLIH--GWLIVS-----SFLLLFL----------------------------------FTTIYVQ.......EVLKSF
F2CQD9_HORVD/22-450CTGFLK--NYMRFS-----AFFVLFS----------------------------------MGGAIAV.......ALLRRL
W5N759_LEPOC/69-512CYKVIH--GWLIIS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
Q7PR98_ANOGA/98-513CYKVIH--GWLILS-----SLLLLFL----------------------------------FSGLYLF.......EILRAY
M1CAI2_SOLTU/15-421CTKFLK--YYMGFS-----SFLVLGF----------------------------------MGGEICL.......FLIGKF
W1NQ31_AMBTC/9-446FTGFLK--NYMRFS-----AFFVLGS----------------------------------MGGPIFL.......SIIEQF
K3WL66_PYTUL/82-563CMKFLG--GYIMFA-----STAILSF----------------------------------VGGQLVD.......SIVNDQ
A2DZ73_TRIVA/13-381CMKIIF--GWLILA-----VSLLLSM----------------------------------YFLVGFG.......TYPSIV
G0NCU3_CAEBE/9-464FRRIVK--LWLTFS-----CILILFG----------------------------------VSGQTIY.......DLFVQV
U9UMQ1_RHIID/178-561FIKILI--GFFMVV-----VLLLLGF----------------------------------MGYLLMM.......AILQVF
T1EFZ6_HELRO/89-576CYKFIA--GWLFMS-----SFMLLFF----------------------------------FTFIFYS.......ELCRTM
B7QGI2_IXOSC/14-384YTNVIK--AWLMTG-----SGVLLFV----------------------------------VTYYYMG.......RCVYYF
A0A0H5S0W0_BRUMA/94-527FYRVIS--AWLVLS-----SLILLSL----------------------------------FTFMYLQ.......EVFKSY
S2J107_MUCC1/49-424LYKFLF--FWLGLS-----VLSILGV----------------------------------TASALWI.......EMLNVY
D3B4U3_POLPA/99-477CLKAIY--AWLFLS-----VGILLAS----------------------------------MGSYVFM.......AMLEAN
H2VWC4_CAEJA/11-477FQNLVK--TWLIFS-----CLLILFG----------------------------------VSGQTFY.......DLFSQL
A9VBA9_MONBE/203-602YYKIIY--GWLALS-----ALLLLYF----------------------------------FSYQYIECVMCTRRQVLIAH
F2TYS0_SALR5/109-504CYKAIH--GWLLLS-----SLLLLFF----------------------------------FSYQFVD.......QVLRAY
E1G929_LOALO/15-397YKCLVQ--MWLYMS-----CVLIIFG----------------------------------VFASFLV.......DLFKAF
H3FRQ2_PRIPA/544-933CYKCLH--GWMISS-----SFMMLTL----------------------------------ISGTYVM.......HVLENH

PF01478

C9R6J1_AGGAD/91-199HYRLIS--PALCQA.....LFTLGLG------------------------------------------------------
FLAK_METJA/5-130KSREIE--DYVWVS.....MVIFGLI------------------------------------------------------
FLAK_METMP/5-130RSREIE--DYIWIV.....LAVFGIL------------------------------------------------------
LEP4_BACSU/100-204HFMLIP--NRILIF.....FLPFLAA------------------------------------------------------
Q9HWA5_PSEAE/4-110KRLRVS--NWLILG.....GFLISFV------------------------------------------------------
Q8FME5_COREF/77-189AVCRLP--DRLVAAT..LLALVLGFL------------------------------------------------------
Q9CPF6_PASMU/89-199RYQLIS--VQLCYC.....LFWIGVV------------------------------------------------------
Q9RSQ9_DEIRA/109-347DTMTLP--DELTLP.....GTLLGVL------------------------------------------------------
Q97HN8_CLOAB/64-168KTKNVY--FFITII.....SFLFSTV------------------------------------------------------
Q8XQX7_RALSO/14-117RSRRVP--NWLVAV.....GLVLSIV------------------------------------------------------
LEP4_HAEIN/90-200HYQLIS--TTPCLW.....LLTLGLF------------------------------------------------------
Q8TMQ5_METAC/5-101RYRRVS--NRSCFL.....MFVISVP------------------------------------------------------
Q8NQ30_CORGL/4-110KYRRLP--DVLTLP.....GALLI..------------------------------------------------------
Q98BF9_RHILO/11-116LSMTIA--NRVSVL.....LVVVFAL------------------------------------------------------
Y421_METTH/12-138KRGIIP--NRLTFP.....VIGLGLL------------------------------------------------------
Q8CXM1_OCEIH/104-208IYMVIP--NKLLLF.....FLPIFII------------------------------------------------------
A9CKJ3_AGRFC/8-113FSMTIP--NVITVV.....LLLSFAF------------------------------------------------------
Q8TXH1_METKA/6-112KWGIVP--NRLTYP.....AIVAGAI------------------------------------------------------
Q8DLL0_THEEB/89-199DTMTLP--HPLTKW.....GLITGLL------------------------------------------------------
YC8A_METJA/6-148RKREVT--DFLWIS.....MLWVGVF------------------------------------------------------
Q9XAP1_STRCO/112-224KVRRLP--DPLTLPLAGAALVLLGLT------------------------------------------------------
LEP4_MYXXD/113-222DHWILP--LSMTVP.....GMLAGIA------------------------------------------------------
LEP4_XANCP/133-242RHKLLP--DQLTLP.....LMWLGLV------------------------------------------------------
Q8TLD4_METAC/26-152KARRVS--NGVWKY.....MLVSGSV------------------------------------------------------
O67535_AQUAE/105-214YYFILP--PGINIG.....GLVLGIL------------------------------------------------------
Q988A4_RHILO/13-122RRQIIP--DGLNLA.....LAGIGLS------------------------------------------------------
Q8XVK3_RALSO/140-249DTQLLP--DAITQP.....LLWLGLL------------------------------------------------------
Q87I88_VIBPA/13-110RYRIVK--HRFLLI.....IFITSLL------------------------------------------------------
Q8F6L1_LEPIN/127-232FHFSLD--YENLPW.....ILCFGVI------------------------------------------------------
Q891G5_CLOTE/115-221KTMYVY--FSIILI.....TIFLRIG------------------------------------------------------
Q9K8H1_BACHD/15-120VYMIIP--DRIILF.....FAILFVL------------------------------------------------------
LEP4_PSEAE/136-245DHQLLP--DVLVLP.....LLWLGLI------------------------------------------------------
Q8XI34_CLOPE/100-206DTQDVY--AVTTYP.....AVILGII------------------------------------------------------
Q8EJP8_SHEON/157-266DEMLLP--DQMTLP.....LLWLGLL------------------------------------------------------
Q9CMH2_PASMU/11-110KSRIIS--NKIVFL.....LLLVMV.------------------------------------------------------
Q92T43_RHIME/12-117LTMTIP--NRVSLV.....LLVSFFF------------------------------------------------------
HOPD_SALTY/9-119RTGLLP--DRFTCP.....LLWGGLL------------------------------------------------------
Q8FT27_COREF/8-114RTRRLP--DALTLP.....GALMI..------------------------------------------------------
Q8THK9_METAC/8-134ETRRVP--NRIWKL.....MLFSLSG------------------------------------------------------
Q8RAF7_CALS4/104-208EHKIIP--NSIIIA.....GFIGALI------------------------------------------------------
PPPA_ECOLI/130-240DHQWLP--DVFTQG.....VLWTGLI------------------------------------------------------
Q92YL6_RHIME/12-116ATMTIS--NRVVVF.....LVIAFAI------------------------------------------------------
Q89PI9_BRADU/13-114ATRLIR--NEICLV.....LAFLGIV------------------------------------------------------
Q89UH6_BRADU/9-113FTMTIS--NRVSLA.....LVAGFFA------------------------------------------------------
Q87M36_VIBPA/5-111QKHRIP--NKAVLL.....LLVAVTA------------------------------------------------------
Q8Y6Y1_LISMO/101-204FYLYVP--NSILIV.....FFCVLAT------------------------------------------------------
Q89HG8_BRADU/40-149RHYLIP--NELTGT.....AFALALL------------------------------------------------------
Q8YXA0_NOSS1/108-226DTMTLP--NPLTKS.....GLVLGLV------------------------------------------------------
Q9X222_THEMA/103-204ETYLIP--DYLNFT.....VLIFSFV------------------------------------------------------
LEP4_VIBCH/112-221KSMLLP--NLLTYP.....IFMLAFI------------------------------------------------------
Q989C3_RHILO/11-122TTQKIA--NRDALL.....LLCLGAG------------------------------------------------------
LEP4_ECOLI/81-190RTQLLP--DKLTLP.....LLWLGLV------------------------------------------------------
Q9ABP2_CAUCR/121-230EHLWLP--DRLTLP.....FGALGVI------------------------------------------------------
Q8Y1N3_RALSO/10-114RTRRIP--NRLVAA.....GLAAALI------------------------------------------------------
Q88QB9_PSEPK/4-110RQRQIS--NVLTLG.....AAGCALA------------------------------------------------------
Y83C_METJA/9-115KERIIP--HKYTIA.....MIIINLV------------------------------------------------------
Q87VV0_PSESM/5-111RRKEIL--NGLTLG.....AAALAAG------------------------------------------------------
O29326_ARCFU/8-129ESRIVP--NRVWKR.....MLLVSLP------------------------------------------------------
Q97FF6_CLOAB/100-211DTTNVY--LCTTLP.....GIISGII------------------------------------------------------
Q8RHE5_FUSNN/7-119NKKYIP--NVLNFS.....ILVLSIF------------------------------------------------------
Q980Y8_SULSO/10-125KYREVD--PKIWIY.....YSPLCLF------------------------------------------------------
Q8R8E5_CALS4/6-111KRKEID--NWVPAA.....ILTYGII------------------------------------------------------
LEP4_SYNY3/108-223DTMTLP--NSLTKP.....GLVLGLL------------------------------------------------------
A0KPV9_AERHH/142-247DKMLLP--DQLTLP.....LLWGGLL------------------------------------------------------
A5EXL5_DICNV/138-247EHQLLP--DRLTLP.....LLWLGIL------------------------------------------------------
A9H675_GLUDA/111-216KSFRLP--DTLTVP.....LIAAGLG------------------------------------------------------
C9R2X4_AGGAD/10-108RSRLIS--NRVVLF.....LLLVIIP------------------------------------------------------
E0SLF4_DICD3/139-243RTQLLP--DVMTLP.....LLWGGLL------------------------------------------------------
G1UB88_HAEDU/13-108RSRIIT--NKVVLA.....LFCAILP------------------------------------------------------
H7C7G6_CAUCR/11-113TSYTIP--NWISLA.....LIAAFVP------------------------------------------------------
H9L4S3_VIBCH/135-244DTLLLP--DQLTLP.....LLWGGIA------------------------------------------------------
I6Y9M6_MYCTU/5-108RQRRLP--NWLTLP.....GAGVILL------------------------------------------------------
LEP4_BURPS/162-269QTGFLP--DSLTLP.....LLWAGLC------------------------------------------------------
Q0WIM7_YERPE/129-236DTYLLP--DCMTIP.....LLWLGLL------------------------------------------------------
Q5F692_NEIG1/134-242DTQYLP--DSMTLP.....LIWLGLI------------------------------------------------------
Q5ZVB6_LEGPH/138-246DHQLLP--DSLTLG.....LLWIGLI------------------------------------------------------
Q65GL0_BACLD/102-205THMIIP--DAVLCF.....FLPVFAV------------------------------------------------------
Q7MJZ8_VIBVY/10-109LKRKIY--NANLAV.....LVFVSTY------------------------------------------------------
Q9PAI1_XYLFA/133-241RTRLLP--DQLTLM.....LMWLGLI------------------------------------------------------

PF04258

SIPL5_ARATH/240-524.............................GNTSILSLVVLLFCFV-----VAILWFMNRKTS.HAWAGQDIFGICMMINV
SPP2A_MOUSE/214-499.............................KNIKVSLIFLSGLCIS-----VAVVWAVFRNEDRWAWILQDILGIAFCLNL
SIP_ARATH/47-323..................FKSLE......VEFTKSQVVAGIPGTF-----FCAWYAWKKH.....WLANNILGLSFCIQG
SPP2B_HUMAN/213-505.............................KRPQARMLLLALFCVA-----VSVVWGVFRNEDQWAWVLQDALGIAFCLYM
Q9VPQ7_DROME/71-359............GEGKHKEDIVN......YKFSTHDIVCLVISSA-----IGVWYLLKKH.....WIANNLFGLAFAING
Q9VBL1_DROME/96-408.............................GRFTAAELFSFTLSVS-----IVCIWVLTGH.....WLLMDAMGMGLCVAF
SIPL4_ARATH/241-527.............................GAVSYLTLAICPFCIA-----FAVFWAVKRQYS.YAWIGQDILGISLIITV
SIPL2_ARATH/242-525.............................GPISYLTLAVSPFCIV-----FAVLWAVYRVHS.FAWIGQDVLGIALIITV
YL8H_SCHPO/31-282.................................FGKITATMSSIA-----IALFYFKTKH.....WMASNILAWALAANS
YKK0_YEAST/145-510IEKDHWMKHFYRRELVEPKDIKSKRQISNMYLNSALIVSFVLSIV-----STVYFYLSPND....WLISNAVSMNMAIWS
SPPL3_MOUSE/60-374.............................GRFTAAELLSFSLSVM-----LVLIWVLTGH.....WLLMDALAMGLCVAM
IMP2_CAEEL/55-450GNKEMEEGDIEDAKKKETEYLFK......IDFDRYDIIALLMCSP-----ILISHLLKRH.....WITNNIIGVSFSILG
HM13_MOUSE/62-350............GSGENKEEIIN......YEFDTKDLVCLGLSSV-----VGVWYLLRKH.....WIANNLFGLAFSLNG
Q93346_CAEEL/275-601.......................TCGGRIHQYKYSEAFIGIICLS-----FCVTWFIIRRQP.YAFILLDVINMALCMHV

PF06550

Q9HM09_THEAC/1-278-----------------------------FLYNVYAIFTVSIVVA-----IVFFYMILFRNE---WYVTDLAGFFLSVGI
Q9HQ23_HALSA/15-306-----------------------------V.VVAG.VNLAVWGPA-----LALVGALYAYPE---WWVIDAAGAIMGMGA
Q8TIY9_METAC/27-303-----------------------------IPALAGLENIASLLLS-----IGLTVLLYKYPE---WYVIDLLGVCIAGGV

PF01080

D3B5F5_POLPA/149-528.......N---------------------IALDYLTFVFVVWNFS.AGGIVCIFW..FCP-----KYLNQAYLICLSAFL
G4VJ47_SCHMA/58-484.......G---------------------VFVDYITVAFALWNFG.VVGMIVIHW..RGP-----LVLQQAYLIFISAQI
T1KI16_TETUR/103-479.......N---------------------LPVDYISVSIFIWNFG.ILGMICIHW..KGP-----LIVQQAYLLVVSALM
K7J3W8_NASVI/92-490.......N---------------------IPMDIITLAIGLWNFG.VVGMVCIHW..QGP-----LSLQQAYLIFIAALM
A0A068XH02_HYMMI/46-488.......R---------------------IFFDNITFAILLWNFG.VLGLISIHW..RGP-----LVLQQAYLIFNSVVV
W5JK58_ANODA/96-499.......N---------------------VPMDWFTAGLLVWNFG.VVGMISIHW..QGP-----LRLQQGYLIFVAALM
E9FSB0_DAPPU/62-438.......N---------------------IPLDYISLLFIMWNFG.VVGMIAIHW..KAP-----LHLQQAYLIFVAALM
C3Z2C5_BRAFL/88-496.......N---------------------IPCDYITLAIVMWNFG.AVGMVCIHW..KGP-----LLLQQAYLIVISALM
H2TY46_TAKRU/29-412.......N---------------------VAMDYPTVGLLIWNFG.AVGMICIHW..KGP-----LQLQQIYLILISALM
H3AT04_LATCH/77-455.......N---------------------VAMDYITVALIIWNFG.VVGMICIHW..KGP-----LRLQQAYLIMISALM
I1HEG8_BRADI/69-507.......D---------------------VPLDAPTALLLLFNAS.AVGVLSVFA.SAVP-----ILVRQGYMVTLAVIV
W4XU10_STRPU/68-474.......N---------------------IPMDYFTIAVIMWNFG.MVGMVSIHW..KGP-----LRLQQLYLIVISALM
G7Y344_CLOSI/42-431.......G---------------------IFVDYITMAFILWNFG.VVGMVVIHW..RGP-----LILQQAYLIFISAQI
B7Q2V0_IXOSC/41-421.......N---------------------VPMDYLTVALVMWNFG.VVGMISIHW..KGP-----LLLQQAYLILVSALM
PSN1_RAT/76-458.......N---------------------VAVDYITVALLIWNFG.VVGMIAIHW..KGP-----LRLQQAYLIMISALM
T1JMG4_STRMM/67-438.......N---------------------VPMDYITLVFIMWNFG.VVGMICIHW..KGP-----LLLQQAYLIVVAALM
T1G6P3_HELRO/9-376.......N---------------------TATDFISTGFNLWNFG.LMGILAIHW..KSP-----LIVQQFYLIVVSALM
D7LLE1_ARALL/15-389.......R---------------------FPIDSITFLILLFNFS.VVGVFAVFM.SKFS-----ILITQGYLVWIGVLV
A2G9L8_TRIVA/13-428.......N---------------------IPIDYIAVVIFLLNGV.VVGGMSIFW..RAP-----PIVTQAFMIWISVMT
F6RA92_CIOIN/37-422.......N---------------------TAVDYITVVIVLWNFG.VVGMICIHW..KGP-----LLLQQAYLIIVSSLM
I3IV36_ORENI/95-480.......N---------------------LAMDYITLAIIIWNFG.VVGMMCIHW..KGP-----LRLQQAYLIMISALM
H2Z6F8_CIOSA/7-395.......N---------------------TPMDYITVAVVLWNFG.VVGMICIHW..KGP-----LLLQQAYLIVVSSLM
K1PKB7_CRAGI/84-479.......N---------------------VAMDYITVALLMWNFG.VVGMICIHW..KGP-----LFLQQAYLIVISALM
S2K404_MUCC1/83-504.......S---------------------IALDYITLVFALWNFA.VVGLVSIFW..KGP-----LWLQQSYLTIMSSLM
H3FRQ2_PRIPA/66-481.......N---------------------CCVSWPTVLIGLFNFA.AMGMICIHW..KGP-----LLMQQAYLISVSALM
E0VJ41_PEDHC/87-467.......N---------------------IPMDYFTLTIIMWNFG.VVGMICIHW..KGP-----LLLQQAYLIFIAALM
E2AIY0_CAMFO/93-484.......N---------------------IPMDLFTLGIGLWNFG.VVGMICIHW..QGP-----LQLQQAYLIFISALM
F4PRZ5_DICFS/219-583.......N---------------------VGLDYFTFSFIVWNFS.AGGMVCLFW..FCP-----QYLTRAYLVSISSLM
B0WS38_CULQU/61-516.......N---------------------IPFDYPTALLLMWNFG.VVGMISIHW..QGP-----LRLQQGYLIFIAALM
A0A068YDE2_ECHMU/45-476.......M---------------------IFFDNITFAILLWNFG.VLGLISIHW..RSP-----LILQQAYLIFNSVQM
E2BSL4_HARSA/95-504.......N---------------------IPMDFFTLSIGLWNFG.AVGMICIHW..QGP-----LQLQQAYLIFISALM
H9J5W9_BOMMO/68-456.......N---------------------IPMDYITLGFVLWNFG.VMGMIVIHW..KGP-----LRLQQAYLIFIAALM
G3Q8S2_GASAC/77-448.......N---------------------LAVDYPTVGVIIWNFG.TVGMICIHW..KGP-----LQLQQAYLILISALM
F6GSZ0_VITVI/15-427.......S---------------------FPIDCITFLVVLFNFT.VVGVLAVFM.SKMA-----ILVTQGYLVVIGMLV
B4QRZ4_DROSI/98-517.......N---------------------IPMDYPTALLIMWNFG.VVGMMSIHW..QGP-----LRLQQGYLIFVAALM
SPE4_CAEEL/11-464FDQDDNNQ---------------------YYMTIVLIVVPTVVYG.FGGIYAFFS..NSS-----LILHQIFVVTNCSLI
C7J054_ORYSJ/30-449.......R---------------------LPLDAASFALLLPNAAAALALAALSP.ASVP-----IALHQAALVAIAVLT
T1HN85_RHOPR/7-402.......N---------------------IPFDFITLCLFMWNFG.TMGMICIHW..KGP-----LHMQQAYLIFLAALM
A9S846_PHYPA/9-467.......S---------------------IPIDVITFLICTINFA.SVGVAAVFF.CRMP-----IMVTQGYLIVIGMLV
E3N426_CAERE/9-463LDQNDENQ---------------------YILTVALTVIPTTIYG.VLGIYAFFA..NGS-----LALHQFFVISNCSLI
D8LTV7_ECTSI/63-572.......Q---------------------LPCDAFTYYGVLWNFA.VVGVVAIFYQKGIP-----TVVTQAYLVATSIIM
H3CB70_TETNG/22-406.......N---------------------VAVDYPTVALLLWNFG.AVGMVCIHW..KGP-----LQLQQLYLILVSALM
G2J6Q7_CAEBR/9-477FDQNDENQ---------------------FILTVALTVIPTVVYG.CLGIYAFLA..NGS-----LLLHQFFVVSNCSLI
I1N8G3_SOYBN/8-407.......S---------------------VPLDAVTSFLLLFNFA.VVGVLSVFAGGGLP-----ILLRQCYTVCLGIIV
G3W888_SARHA/88-452.......N---------------------VAMDYPTLFLVIWNFG.AVGMICIHW..KGP-----LVLQQAYLIMISALM
PSN_CAEEL/44-434.......D---------------------VSPSALLVLFGLGNYG.VLGMMCIHW..KGP-----LRLQQFYLITMSALM
F2CQD9_HORVD/22-450.......D---------------------APLDAPTALLLLFNAS.AVGVLSVFA.SAVP-----ILVRQGYMVALAVIV
W5N759_LEPOC/69-512.......N---------------------VGMDYITLAVIIWNFG.VVGMICIHW..KGP-----LRLQQAYLIMISALM
Q7PR98_ANOGA/98-513.......N---------------------VPMDWFTAGLLVWNFG.VVGMISIHW..QGP-----LRLQQGYLIFVAALM
M1CAI2_SOLTU/15-421.......R---------------------IPIDCVTFALSLFNFT.VVGVLAVFM.SKTA-----IIITQVYLVVIGVLV
W1NQ31_AMBTC/9-446.......S---------------------IPIDSITCFILLFNFC.VIGVLSVFS.GGVP-----IIVRQVYMVLLGIIV
K3WL66_PYTUL/82-563L......G---------------------WPVDWITFLFVMINFG.FVGVISIFYQKGTP-----KFVQNGYLVLVSVIL
A2DZ73_TRIVA/13-381.......N---------------------IPVDYLSLAVFLLNLV.VVGNMSIFW..RAP-----QRITQAFLVLISILT
G0NCU3_CAEBE/9-464FDQNDENG---------------------FLMTVFCTVIPTVVYG.CLGIYAFLA..NGS-----LLLHQFFVVSNCSLI
U9UMQ1_RHIID/178-561.......Q---------------------IPMDYVTLSFALWNFA.AVGLISVFW..KGP-----LLLQQTYLTIMSSLM
T1EFZ6_HELRO/89-576.......N---------------------IPMDYITTAVFLWNFG.VLGIMCIHW..KGP-----LLLQQFFLIVVSALM
B7QGI2_IXOSC/14-384.......N---------------------FPMDHLSCSFIVWNIG.MTGMGTLYY..KGP-----FVMHQGFVIYVSILM
A0A0H5S0W0_BRUMA/94-527.......N---------------------VPVDYILICIFIWNYG.VMGMICIHW..KGP-----LRMQQGYLIMMSALM
S2J107_MUCC1/49-424.......N---------------------MPMDYLTMLFCTWNVA.VVGVVAIFW..KSP-----LWVQQVYLVLVSAAT
D3B4U3_POLPA/99-477.......N---------------------LALDYITFAFIMFNFS.VGGIIAVFW..YAP-----VLMNQGYLVLISTLM
H2VWC4_CAEJA/11-477VDQETENG---------------------RNLTLVLTILPTLVYG.LAGIVAFLA..NGS-----LLLHQCFVVSNCSLI
A9VBA9_MONBE/203-602.......N---------------------ASIDWITMAFIIWNFG.TVGFIAIFW..RSP-----LAVQQVYLVIVSALM
F2TYS0_SALR5/109-504.......N---------------------STLDWITMVVSIWNFG.VVGLICIHW..KGP-----LLLQQVYLVAVSALM
E1G929_LOALO/15-397GLQTAPP.---------------------.....IFTALIVITYG.TVGILVFFT.KKTP-----LYMHQFYVICNCSLV
H3FRQ2_PRIPA/544-933.......N---------------------WCMSNATALFGLFNYA.AMGMICIHW..KGP-----LLMQQAYLISVSALM

PF01478

C9R6J1_AGGAD/91-199-----------------------------------------------------------------AA............Y
FLAK_METJA/5-130-----------------------------------------------------------------YN...........G.
FLAK_METMP/5-130-----------------------------------------------------------------FAIY.SA.IT.LSN.
LEP4_BACSU/100-204-----------------------------------------------------------------AR.............
Q9HWA5_PSEAE/4-110-----------------------------------------------------------------YL....Y.V....KE
Q8FME5_COREF/77-189-----------------------------------------------------------------AS............A
Q9CPF6_PASMU/89-199-----------------------------------------------------------------AA............Y
Q9RSQ9_DEIRA/109-347-----------------------------------------------------------------FGLAGAGLYAQEGQL
Q97HN8_CLOAB/64-168-----------------------------------------------------------------FV...........MI
Q8XQX7_RALSO/14-117-----------------------------------------------------------------LV....K.F....GS
LEP4_HAEIN/90-200-----------------------------------------------------------------GA............D
Q8TMQ5_METAC/5-101-----------------------------------------------------------------FI.............
Q8NQ30_CORGL/4-110-----------------------------------------------------------------...............
Q98BF9_RHILO/11-116-----------------------------------------------------------------VA...........PL
Y421_METTH/12-138-----------------------------------------------------------------LNG...A.R....AL
Q8CXM1_OCEIH/104-208-----------------------------------------------------------------LR.............
A9CKJ3_AGRFC/8-113-----------------------------------------------------------------IA...........PF
Q8TXH1_METKA/6-112-----------------------------------------------------------------YA.............
Q8DLL0_THEEB/89-199-----------------------------------------------------------------AR............G
YC8A_METJA/6-148-----------------------------------------------------------------I..............
Q9XAP1_STRCO/112-224-----------------------------------------------------------------AL.............
LEP4_MYXXD/113-222-----------------------------------------------------------------LA.............
LEP4_XANCP/133-242-----------------------------------------------------------------GS.............
Q8TLD4_METAC/26-152-----------------------------------------------------------------FV....I.Y....EL
O67535_AQUAE/105-214-----------------------------------------------------------------VS.............
Q988A4_RHILO/13-122-----------------------------------------------------------------YQ.............
Q8XVK3_RALSO/140-249-----------------------------------------------------------------VN.............
Q87I88_VIBPA/13-110-----------------------------------------------------------------...............
Q8F6L1_LEPIN/127-232-----------------------------------------------------------------SI....F.L....LD
Q891G5_CLOTE/115-221-----------------------------------------------------------------IF....F.L....EG
Q9K8H1_BACHD/15-120-----------------------------------------------------------------FR.............
LEP4_PSEAE/136-245-----------------------------------------------------------------AN.............
Q8XI34_CLOPE/100-206-----------------------------------------------------------------FALI.EK.FY..FGE
Q8EJP8_SHEON/157-266-----------------------------------------------------------------IN.............
Q9CMH2_PASMU/11-110-----------------------------------------------------------------...............
Q92T43_RHIME/12-117-----------------------------------------------------------------VA...........PL
HOPD_SALTY/9-119-----------------------------------------------------------------YH.............
Q8FT27_COREF/8-114-----------------------------------------------------------------...............
Q8THK9_METAC/8-134-----------------------------------------------------------------FL....I.Y....EI
Q8RAF7_CALS4/104-208-----------------------------------------------------------------FR.............
PPPA_ECOLI/130-240-----------------------------------------------------------------AA............W
Q92YL6_RHIME/12-116-----------------------------------------------------------------LA...........PA
Q89PI9_BRADU/13-114-----------------------------------------------------------------T..............
Q89UH6_BRADU/9-113-----------------------------------------------------------------LA...........LS
Q87M36_VIBPA/5-111-----------------------------------------------------------------NV.............
Q8Y6Y1_LISMO/101-204-----------------------------------------------------------------IA............I
Q89HG8_BRADU/40-149-----------------------------------------------------------------RAG...A.F...VPD
Q8YXA0_NOSS1/108-226-----------------------------------------------------------------FQMI.VG.YA.ADPT
Q9X222_THEMA/103-204-----------------------------------------------------------------VA.............
LEP4_VIBCH/112-221-----------------------------------------------------------------Y..............
Q989C3_RHILO/11-122-----------------------------------------------------------------SLL...L.L....SL
LEP4_ECOLI/81-190-----------------------------------------------------------------FN.............
Q9ABP2_CAUCR/121-230-----------------------------------------------------------------AT.............
Q8Y1N3_RALSO/10-114-----------------------------------------------------------------AQ...........CA
Q88QB9_PSEPK/4-110-----------------------------------------------------------------WL....F.S....TG
Y83C_METJA/9-115-----------------------------------------------------------------VG....Y......YY
Q87VV0_PSESM/5-111-----------------------------------------------------------------YL....A.V....TG
O29326_ARCFU/8-129-----------------------------------------------------------------IT....V.Y....QL
Q97FF6_CLOAB/100-211-----------------------------------------------------------------FIAI.NI.FY..KNH
Q8RHE5_FUSNN/7-119-----------------------------------------------------------------IC....G.I....DK
Q980Y8_SULSO/10-125-----------------------------------------------------------------II.............
Q8R8E5_CALS4/6-111-----------------------------------------------------------------LN.............
LEP4_SYNY3/108-223-----------------------------------------------------------------FHL...L.L...GWQ
A0KPV9_AERHH/142-247-----------------------------------------------------------------FN.............
A5EXL5_DICNV/138-247-----------------------------------------------------------------AA.............
A9H675_GLUDA/111-216-----------------------------------------------------------------LA.............
C9R2X4_AGGAD/10-108-----------------------------------------------------------------FS............L
E0SLF4_DICD3/139-243-----------------------------------------------------------------FN.............
G1UB88_HAEDU/13-108-----------------------------------------------------------------FS............W
H7C7G6_CAUCR/11-113-----------------------------------------------------------------AA............L
H9L4S3_VIBCH/135-244-----------------------------------------------------------------LA............L
I6Y9M6_MYCTU/5-108-----------------------------------------------------------------FA............G
LEP4_BURPS/162-269-----------------------------------------------------------------VN.............
Q0WIM7_YERPE/129-236-----------------------------------------------------------------IN.............
Q5F692_NEIG1/134-242-----------------------------------------------------------------FN.............
Q5ZVB6_LEGPH/138-246-----------------------------------------------------------------AN.............
Q65GL0_BACLD/102-205-----------------------------------------------------------------GR.............
Q7MJZ8_VIBVY/10-109-----------------------------------------------------------------YR.............
Q9PAI1_XYLFA/133-241-----------------------------------------------------------------GS.............

PF04258

SIPL5_ARATH/240-524LQV-ARLP-NIRVATI---LLCCAFFY--DIFWVFISPLIFK..QSVMIAVARGSKDT...............-------
SPP2A_MOUSE/214-499IKT-MKLP-NFMSCVI---LLGLLLIY--DVFFVFITPFITKNGESIMVELAAGPFEN...............-------
SIP_ARATH/47-323IEM-LSLG-SFKTGAI---LLAGLFFY--DIFWVFF........TPVMVSVAK....................-------
SPP2B_HUMAN/213-505LKT-IRLP-TFKACTL---LLLVLFLY--DIFFVFITPFLTKSGSSIMVEVATGPSDSAT.............-------
Q9VPQ7_DROME/71-359VEM-LHLN-NFVTGVI---LLSGLFFY--DIFWVFG........TNVMVTVAK....................-------
Q9VBL1_DROME/96-408IAF-VRLP-SLKVSTL---LLTGLLIY--DVFWVFLSSYIFS..TNVMVKVATRPADNPVGIVARKLHLG.GI-------
SIPL4_ARATH/241-527LQI-VRVP-NLKVGFV---LLSCAFMY--DIFWVFVSKWWFR..ESVMIVVARGDRSG...............-------
SIPL2_ARATH/242-525LQI-VHVP-NLKVGTV---LLSCAFLY--DIFWVFVSKKLFH..ESVMIVVARGDKSG...............-------
YL8H_SCHPO/31-282ISI-MRID-SYNTGAL---LLGALFFY--DIYFVFG........TEVMVTVAT....................-------
YKK0_YEAST/145-510IAQ-LKLK-NLKSGAL---ILIALFFY--DICFVFG........TDVMVTVAT....................-------
SPPL3_MOUSE/60-374IAF-VRLP-SLKVSCL---LLSGLLIY--DVFWVFFSAYIFN..SNVMVKVATQPADNPLDVLSRKLHLGPNV-------
IMP2_CAEEL/55-450IER-LHLA-SFKAGSL---LLVGLFFY--DIFWVFG........TDVMTSVAK....................-------
HM13_MOUSE/62-350VEL-LHLN-NVSTGCI---LLGGLFIY--DIFWVFG........TNVMVTVAK....................-------
Q93346_CAEEL/275-601LKC-LRLP-SLKWISI---LMLCMFVY--DAFMVFGTPYMTTNGCSVMLEVATGLSCAAKGKNKGYPVP..PI-------

PF06550

Q9HM09_THEAC/1-278SSI-WGITFGVWAAVA---FLIAFEIY--DYIAVYK--------TRHMISLARYAV------------------------
Q9HQ23_HALSA/15-306AAL-FGISFGVLPAIV---LLTALAVY--DAISVYG--------TEHMLTLASGVM------------------------
Q8TIY9_METAC/27-303SAL-IGISLSIIPVVV---LLILLAVY--DAISVYK--------TKHMIAMAEGVM------------------------

PF01080

D3B5F5_POLPA/149-528ALF-LAR.FPSWTTWA---ILVLVSIY..DIFAVLCPGGP----LQQLIETARKRGESI.PALIYNASVFIG........
G4VJ47_SCHMA/58-484SLM-FLKYLPKWTCWL---VLAALSVW..DIVAVLCPNGP----LRLLVEMAHERQQPLFPALLYSTTTVYLVKKHQPVE
T1KI16_TETUR/103-479ALV-LIKYIPEWTVWV---ILAVISVW..DLVAVLCPKGP----LRILVETAQSRNESIFPSLIYSSAVTYF........
K7J3W8_NASVI/92-490ALV-FIKYLPEWTAWA---VLAVISIW..DLIAVLTPKGP----LRILVETAQERNESIFPALIYSSTVMYAFTMNFTGY
A0A068XH02_HYMMI/46-488ALT-LLRFLPKWTCWV---LLGAISIW..DLIAVLCPRGP----LRMLVEMAQERNLPLFPAIIYSTAAAYIADT.....
W5JK58_ANODA/96-499ALV-FIKYLPEWTTWV---VLAVISIW..DLIAVLTPKGP----LRILVETAQERNEQIFPALIYSSTIMYSYL......
E9FSB0_DAPPU/62-438ALV-FIKYLPEWTTWV---VLGVISIW..DLVAVLSPRGP----LRILVETAQSRNEPLFPALIYSSTVAYM........
C3Z2C5_BRAFL/88-496ALV-FIKYLPDWTTWF---ILGAISLY..DLVAVLCPKGP----LKVLVETAQERNEPIFPALIYSSTMMWF........
H2TY46_TAKRU/29-412ALV-FIKYLPEWSAWV---ILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWA........
H3AT04_LATCH/77-455ALV-FIKYLPEWTGWL---ILVVISVY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSTMVWL........
I1HEG8_BRADI/69-507AAW-LSR.LPEWTTWI---MLVALAVY..DLVAVLAPRGP----LRMLVELASSRDDEL.PALIYESRPTVGPAERSSSY
W4XU10_STRPU/68-474ALI-FIKYLPEWTLWT---ILAAIAVY..DLFAVLCPKGP----LRMLVETAQERDEQIFPALIYSSTMVWL........
G7Y344_CLOSI/42-431ALM-FLKYLPKWTCWV---LLGALAVW..DLVAVLCPRGP----LRMLVEMAHEREQPLFPALLYSTTAVY.........
B7Q2V0_IXOSC/41-421ALV-FIKYLPDWTAWV---VLGVISVW..DLIAVLCPKGP----LRILVETAQERNEPIFPALIYSSAMVWNV.......
PSN1_RAT/76-458ALV-FIKYLPEWTAWL---ILAVISVY..DLVAVLCPKGP----LRMLVETAQERNETLFPALIYSSTMVWL........
T1JMG4_STRMM/67-438ALV-FIKYLPDWTTWV---VLGVISVW..DLIAVLCPKGP----LRILVETAQERNEPIFPALIYSSTVVY.........
T1G6P3_HELRO/9-376ALT-FIKHLPGWTAWA---LLIVISVW..DLIAVLTPKGP----LKGLVNISSERRENLFPALVYSSTPFS.........
D7LLE1_ARALL/15-389AYF-FTL.LPEWTTWV---LLVALALY..DIAAVLLPVGP----LRLLVEMAISRDEDI.PALVYEARPVIRNDSR....
A2G9L8_TRIVA/13-428ACV-FLT.LPDWTVWI---LLVLLIIW..DCCVVLCPNGL----LHLLIKKSQERGDAI.PALVYSSAAFFWKEADDG..
F6RA92_CIOIN/37-422ALV-FIKYLPEWTAWV---ILGFISIY..DLLAVLCPKGP----LRMLVETAQSRNESLFPALIYSSGMMWT........
I3IV36_ORENI/95-480ALV-FIKYLPEWTAWL---ILAVISVY..DLLAVLCPKGP----LRILVETAQERNEPIFPALIYSSTMVWL........
H2Z6F8_CIOSA/7-395ALV-FIKYLPEWTAWL---ILGLISIY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSGMMWT........
K1PKB7_CRAGI/84-479ALV-FIKYLPDWTTWV---VLGVMVIW..DLVAVLCPKGP----LRILVETAQERNEPIFPALIYSSTMIWSV.......
S2K404_MUCC1/83-504AFS-LTG.LEQWTTWI---LLGLLAIWAIDLIAVLCPFGP----LRLLIESSRNQQREV.PALLYSVNAVWFMMASN..D
H3FRQ2_PRIPA/66-481ALM-FIKMLPDWTVWA---LLFLISVW..DLIAVLCPKGP----LNMLVKMSQERNEPIFPALIYSSGILLPY.......
E0VJ41_PEDHC/87-467ALV-FIKYLPEWTAWV---VLAVISIW..DLIAVLTPRGP----LRILVETAQERNEQIFPALIYSSTFMYNY.......
E2AIY0_CAMFO/93-484ALV-FIKYLPEWTAWV---VLGVISIW..DLIAVLTPKGP----LRILVETAQERNESIFPALIYSSTILYSFTVTYAGY
F4PRZ5_DICFS/219-583AIF-ISR.MPEWSTWS---ILTIVSLY..DIFTVLSPGGP----LKKLIDLAKERGDEI.PALVYNGSVSIG........
B0WS38_CULQU/61-516ALV-FIKYLPEWTTWV---VLAVISIW..DLIAVLTPKGP----LRILVETAHERNEQIFPALIYSSTIMYSYM......
A0A068YDE2_ECHMU/45-476ALI-FLKFLPKWTCWV---LLGALAIW..DLIAVLCPRGP----LRMLVEMAQERNQPLFPAMVYSTTTAYIATTQP...
E2BSL4_HARSA/95-504ALV-FIKYLPEWTAWA---VLGVISIW..DLIAVLTPNGP----LRILVETAQERNESIFPALIYSSTILYSFTVSYAGY
H9J5W9_BOMMO/68-456ALV-FIKYLPEWTTWA---VLAVISIW..DLVAVLTPKGP----LRILVETAQERNEPIFPALIYSSTVMYCM.......
G3Q8S2_GASAC/77-448ALV-FIKFLPEWSAWL---ILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWT........
F6GSZ0_VITVI/15-427AYW-FTL.LPEWTTWV---LLVAMALY..DLAAVLLPGGP----LRLLVELAISRDEDI.PALVYEARPVTYQDSCPGGG
B4QRZ4_DROSI/98-517ALV-FIKYLPEWTAWA---VLAAISIW..DLIAVLSPRGP----LRILVETAQERNEQIFPALIYSSTVVYALVNT....
SPE4_CAEEL/11-464SVF-YLRVFPSKTTWF---VLWIVLFW..DLFAVLAPMGP----LKKVQEKASDYSKCVLNLIMFSANEKRLTAGSNQEE
C7J054_ORYSJ/30-449AFW-FTL.LPEWTTWA---LLVAMAVY..DLAAVLLPGGP----LRLLLELAIERNEEI.PALVYEARPVDPRHGHNWRL
T1HN85_RHOPR/7-402ALI-FIKYLPEWTTWV---VLAVISVW..DLFAVLTPKGP----LRILVETAQERNEQIFPALIYSSTVIYSL.......
A9S846_PHYPA/9-467AFW-FTK.LPEWTTWV---LLLAMAAY..DVVAVLTPRGP----LNLLVELAIERDEDI.PALIYEARPTVSGRMQMPPS
E3N426_CAERE/9-463SVF-YLRAFPRYTTWF---VLWMVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKFLMFAAEDKRETAGIDATE
D8LTV7_ECTSI/63-572AWQ-LSR.FEEWTGWC---LLVVLALY..DLCAVLTPCGP----LKALVNLMQEYEEPM.PGLLYEAELPAGPPRRRRPE
H3CB70_TETNG/22-406AL.-FIKYLPEWSAWV---ILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWT........
G2J6Q7_CAEBR/9-477AVF-YLRAFPKHTTWF---VLWTVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKILMFAAEDKRESAGMDMAQ
I1N8G3_SOYBN/8-407AAW-FTK.LPEWTTWT---VLVALALY..DLVAVLAPGGP----LKLLVELESSRNEEL.PALVYEARPTVNTRNHAAAV
G3W888_SARHA/88-452ALV-FIKYLPEWSAWV---ILGAISVY..DLVAVLCPKGP----LRMLVETAQERNEPIFPALIYSSAMVWT........
PSN_CAEEL/44-434ALV-FIKYLPEWTVWF---VLFVISVW..DLVAVLTPKGP----LRYLVETAQERNEPIFPALIYSSGVIYPYVL.....
F2CQD9_HORVD/22-450AAW-LSR.LPEWTTWI---MLLALAVY..DLVAVLAPRGP----LRMLVELASSRDDEL.PALIYESRPTVGPAETSSSY
W5N759_LEPOC/69-512ALV-FIKYLPEWTAWL---ILAVISVY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSTMVWL........
Q7PR98_ANOGA/98-513ALV-FIKYLPEWTTWA---VLAVISIW..DLIAVLTPKGP----LRILVETAQERNEQIFPALIYSSTIMYSYL......
M1CAI2_SOLTU/15-421AYW-FTL.LPEWTTWV---LLVAMSLY..DLAAVLLPGGP----LRLLVELAISRDEDI.PALVYEARPIINPDSVQRGA
W1NQ31_AMBTC/9-446AVW-FTK.LPEWTTWV---ILVALALY..DLVAVLAPGGP----LKMLVDLASSREEEL.PALIYEARPTISTGSGPRES
K3WL66_PYTUL/82-563AWE-FSM.WPMWTTIT---FCFMFAIY..DLCAVLTPCGP----LKCLINLIQEKQAPL.PGLLYEADVRDGVTNQPHQQ
A2DZ73_TRIVA/13-381SIV-FRY.LPDWTVWI---LLVLLIIY..DACVVLCPNGL----LILLLKKSEERGDAI.PALLYSAAAWEEADPEKGNQ
G0NCU3_CAEBE/9-464SVF-YLRAFPRYTTWF---VLWTVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKFLMFAAENKRASAGMDMLE
U9UMQ1_RHIID/178-561AFS-LTN.LSSWTTWI---LLALLAIW..DLIAVLCPFGP----LRILVESSRNDKREI.PALLYSVNAVWLMASPGLSN
T1EFZ6_HELRO/89-576ALT-FIKHLPDWTTWV---LLAVISIW..DLVAVLAPKGP----LRSLVKLAQERNDPIFPALIYSTTMAWL........
B7QGI2_IXOSC/14-384AVV-LEESFPEWTAWI---LMILVSLW..DMFAVLCVIGP----LRMLIETAHERNEPLFPALLFSTSSAWCY.......
A0A0H5S0W0_BRUMA/94-527ALI-FIKYLPEWTVWT---VLAVISIW..DLVAVLCPKGP----LRILVETAQERNEPIFPALIYSSGLLYAYTL.....
S2J107_MUCC1/49-424SIS-MLR.MPPWTTWT---VLIAVAIY..DLFAVLCPAGP----LRLLITMAEERQENI.PALVYSAGMASFDTEDDFIG
D3B4U3_POLPA/99-477AIS-ISR.LPDWTTWV---ILSVISIY..DLFAVLCPRGP----LKVLVETAQERNETI.PALIYNANFEPPSRPESIPK
H2VWC4_CAEJA/11-477AVF-YLRAFPRHTTWF---VLFIVLFW..DLFAVLTPMGP----LKRVQEKASDYSNNILKFLMFAADDNRQSAGADRAE
A9VBA9_MONBE/203-602ALV-LIKNLPDWTTWV---LLAAIAIY..DLFAVLSPCGP----LKCLVEVAQERNQPLFPSLIYSSTMMWT........
F2TYS0_SALR5/109-504ALV-LIKNLPDWTTWV---VLAAIAIY..DLVAVLSPCGP----LKALVETAQERDEPLFPALIYSSTMAWI........
E1G929_LOALO/15-397SVF-YLRMFPTHTAWF---VLVCIIIW..DTFAVLAPVGP----LRRINEKAHEYSDQVLRFLMFTAEDKNDEPYEEITV
H3FRQ2_PRIPA/544-933ALM-FIKMLPDWTAFA---LLVLISIW..DLVAVLCPKGP----LNMLVKMSQERNEPIFPALIYSSGILLPY.......

PF01478

C9R6J1_AGGAD/91-199WQI.GTLTLEQSLQSA...VVFFGVFYAIYH.................................................
FLAK_METJA/5-130YLS.FISHDMLYVIQS...IVGFIVCFFL...................................................
FLAK_METMP/5-130YSI.LINSISGFVICF...ILGYMMFLS....................................................
LEP4_BACSU/100-204LIS.PLDSWYAGLLGA...AAGFLFLAVI...................................................
Q9HWA5_PSEAE/4-110SSL.TGATVNMAMTAL...FIGVCLSLP....................................................
Q8FME5_COREF/77-189AVGGTWNDWVRALLAG...LVLLLGYFA....................................................
Q9CPF6_PASMU/89-199VEV.SPLHLEQSLQSA...LTGFFAFYCLY..................................................
Q9RSQ9_DEIRA/109-347....GLPNVAQAVEGA...LMGAGVIVLISVYGSWVLRRFRERQWPEAPIGYQQISLGLLAGAWLGPWWGLGVALLSAAV
Q97HN8_CLOAB/64-168TYF.SGNCIEDYVVGA...VAMGIISYI....................................................
Q8XQX7_RALSO/14-117VVA.LAYDWRDVWLGG...AIALAGFLP....................................................
LEP4_HAEIN/90-200NNF.SLLTLSESIKSA...ASFFIVFYVIY..................................................
Q8TMQ5_METAC/5-101....VQLISVRYVITV...GLIFLIIFF....................................................
Q8NQ30_CORGL/4-110NLW.ALTIYPQWMLGG...LVWAGIYFL....................................................
Q98BF9_RHILO/11-116TGM.EWAAYGWHFAAG...ALVLAVTFG....................................................
Y421_METTH/12-138MES.DPWIFIYTAIFT...AGIFALGYI....................................................
Q8CXM1_OCEIH/104-208LLL.PLDPWWSMFTGA...AIGFGIIFLI...................................................
A9CKJ3_AGRFC/8-113AGM.DFQTFGLSLAGG...LIVFLGCFA....................................................
Q8TXH1_METKA/6-112AVI.DPSHLGYALLDA...GVAFGVTLV....................................................
Q8DLL0_THEEB/89-199LTT.GLGGITEGIIAA...VIGIWLFDLIR..................................................
YC8A_METJA/6-148HLL.YNKSLLLFFIEI...FAVLFITLSVRYEKFNKLV..........................................
Q9XAP1_STRCO/112-224VPE.HAGECTTALLGALALGAGYLVLFL....................................................
LEP4_MYXXD/113-222FPL.GMDAFRDALMGA...AVGFLSFRMME..................................................
LEP4_XANCP/133-242MDN.LYMPAKPALLGA...AVGYVSLWTVW..................................................
Q8TLD4_METAC/26-152FTG.GTPYLKALFLSG...VVVFISVYI....................................................
O67535_AQUAE/105-214PFR.QDITPKESIIGA...VVGVLIPFVIY..................................................
Q988A4_RHILO/13-122LAA.DADAMPQRLLFA...AATFAAAWLLR..................................................
Q8XVK3_RALSO/140-249LFS.MFARLPDAVIGA...TAGYLFLWAIY..................................................
Q87I88_VIBPA/13-110SLF.FTPEPLTQLAVS...TSVFICFFI....................................................
Q8F6L1_LEPIN/127-232GKL.PGLNDLFVLGGF...FFTFLVLF.....................................................
Q891G5_CLOTE/115-221DKI.NFIFYNYFLAGF...IPAMIICII....................................................
Q9K8H1_BACHD/15-120ATLAPLNPWWDAWAGA...VVGYILLFI....................................................
LEP4_PSEAE/136-245HFG.LFASLDDALFGA...VFGYLSLWSVF..................................................
Q8XI34_CLOPE/100-206N......LLNYFMGLV...ISALVIFLI....................................................
Q8EJP8_SHEON/157-266LNH.TFTSPADAMIGA...AAGYLSLWSIF..................................................
Q9CMH2_PASMU/11-110PLA.WIQHKQIFFLPA...LLTLVIGFL....................................................
Q92T43_RHIME/12-117AGL.DLAQLGLHTVAA...GLIFAVSFA....................................................
HOPD_SALTY/9-119QIC.LPERLPDALWGA...IAGYGGFALIY..................................................
Q8FT27_COREF/8-114TGW.AVVVDPWLLLGG...AGWFLLYLV....................................................
Q8THK9_METAC/8-134VEG.GILFMLQLVFSF...FSSFFLAYL....................................................
Q8RAF7_CALS4/104-208LLM.YSYGFLDYILGF...LLGGGILLL....................................................
PPPA_ECOLI/130-240AQQ.SPLTLQDAVTGV...LVGFITFYSLR..................................................
Q92YL6_RHIME/12-116AGL.NLATVMSSVVVA...SAVLACTFV....................................................
Q89PI9_BRADU/13-114QLP.NAIQIAESLIAA...AILFLLLFV....................................................
Q89UH6_BRADU/9-113GGM.APYEMLGHVGAG...ALVLVVAFT....................................................
Q87M36_VIBPA/5-111LYS.PSVSLLDHAYGG...LVAFAVCFA....................................................
Q8Y6Y1_LISMO/101-204LYN.QSLMDLIYSGGI...SCLFYLLFF....................................................
Q89HG8_BRADU/40-149VGLEALIWPLARAAAV...ALPLLLLMV....................................................
Q8YXA0_NOSS1/108-226LSG.LIRHLMMGIVGA...VLGLWLFEAIA..................................................
Q9X222_THEMA/103-204....LRTSFLEHLISF...LIVTIMFLI....................................................
LEP4_VIBCH/112-221VQQNPALTVESSIIGG...FAAFIISYVSN..................................................
Q989C3_RHILO/11-122QSG.SWWDMGLSAIAA...LVLFVGLFP....................................................
LEP4_ECOLI/81-190AQY.GLIDLHDAVYGA...VAGYGVLWCVY..................................................
Q9ABP2_CAUCR/121-230LAI.GEVPVWTPLVGA...AVGFGGLALIA..................................................
Q8Y1N3_RALSO/10-114MLG.PVAGALAWLGGA...AAGMGLCIG....................................................
Q88QB9_PSEPK/4-110HSW.IGAEASEAGWAL...AIVMLLTLP....................................................
Y83C_METJA/9-115....FGFNAIIAFFST...LILCLILSI....................................................
Q87VV0_PSESM/5-111LTW.LGSPPLEGALAL...VLALALTLP....................................................
O29326_ARCFU/8-129FLG.KHLIFEYMIAGI...FVVMVIALSY...................................................
Q97FF6_CLOAB/100-211IYG.YLFAAFLYSGVI...VLINIITKK....................................................
Q8RHE5_FUSNN/7-119VDI.FFIGASCYTLPI...LIFYGYISD....................................................
Q980Y8_SULSO/10-125FSF.HNLFLPIYLYSF...IITNLLFLI....................................................
Q8R8E5_CALS4/6-111AFL.NPVGFIESIVYM...LTAFAILFTI...................................................
LEP4_SYNY3/108-223RGH.WIVPLVEAIASA...VLGLWLFDLIR..................................................
A0KPV9_AERHH/142-247LAG.GFIPLADAVIGA...MAGYLVLWSLY..................................................
A5EXL5_DICNV/138-247LFN.VFINLESSVIGA...MIGYLSLWSVY..................................................
A9H675_GLUDA/111-216ALG.GAAPVLWHALAA...AAGYGVFRGI...................................................
C9R2X4_AGGAD/10-108.....LKYQTIFVIPA...LCTLIIGFL....................................................
E0SLF4_DICD3/139-243LAD.TFVPLEQAVVGA...MAGYLSLWLIY..................................................
G1UB88_HAEDU/13-108FTQ.GMVYPMPALICL...VIGFVLFML....................................................
H7C7G6_CAUCR/11-113VSG.APLSQIGLCLAV...GLGALVLGM....................................................
H9L4S3_VIBCH/135-244LGF.SPVSLSDAVIGA...MAGYLSLWSIY..................................................
I6Y9M6_MYCTU/5-108....LAGRGVPALAGA...AALAGVYLLV...................................................
LEP4_BURPS/162-269LWG.TFASLRAAVIGA...IAGYLFLWCIL..................................................
Q0WIM7_YERPE/129-236IDT.VFAPLTSAVLGA...VSGYLFLWL....................................................
Q5F692_NEIG1/134-242LDG.GFVPLQSAVLGA...VAGYSSLWLLC..................................................
Q5ZVB6_LEGPH/138-246TQN.VFVSLDVAVLSC...AGAYLALWLFI..................................................
Q65GL0_BACLD/102-205FLV.PLEQWHSSLSGA...MAGGMLPLLT...................................................
Q7MJZ8_VIBVY/10-109HQL.PDAMWLDATLYA...LLALLIGML....................................................
Q9PAI1_XYLFA/133-241TDN.LFMAAKPALLGA...VVGYLSLWIVA..................................................

PF04258

SIPL5_ARATH/240-524----------------.....GESIPMLLRI....PR......L------------------------------------
SPP2A_MOUSE/214-499----------------.....AEKLPVVIRV....PKLMGYSVM------------------------------------
SIP_ARATH/47-323----------------.....SFDAPIKLLF....PT.......------------------------------------
SPP2B_HUMAN/213-505----------------.....REKLPMVLKV....PR.LNSSPL------------------------------------
Q9VPQ7_DROME/71-359----------------.....SFEAPIKLVF....PQ..DLIEN------------------------------------
Q9VBL1_DROME/96-408----------------VRDTPKLNLPGKLVF....PS.......------------------------------------
SIPL4_ARATH/241-527----------------.....EDGIPMLLKI....PR......M------------------------------------
SIPL2_ARATH/242-525----------------.....EDGIPMLLKI....PR......M------------------------------------
YL8H_SCHPO/31-282----------------.....GIDIPAKYVL....PQ.......------------------------------------
YKK0_YEAST/145-510----------------.....NLDIPVKLSL....PV...KFNT------------------------------------
SPPL3_MOUSE/60-374----------------GRDVPRLSLPGKLVF....PS.......------------------------------------
IMP2_CAEEL/55-450----------------.....GIDAPILLQF....PQ.DIYRNG------------------------------------
HM13_MOUSE/62-350----------------.....SFEAPIKLVF....PQ..DLLEK------------------------------------
Q93346_CAEEL/275-601----------------EQESVPEKFPMLMQVAHFNPMNECLDME------------------------------------

PF06550

Q9HM09_THEAC/1-278---------------------DSDLPMLFVL----PENSGFTMR------------------------------------
Q9HQ23_HALSA/15-306---------------------ELRLPIVLVV----PTTLAYSFV------------------------------------
Q8TIY9_METAC/27-303---------------------DLKLPILFII----PKHLNYSFI------------------------------------

PF01080

D3B5F5_POLPA/149-528................MAESESIEMNTTTTATQQQLLQNNTNNS......................QKPSPFPTPTSIPI
G4VJ47_SCHMA/58-484KVENDQQFVGSTITCSVDARNEALNINCTTQPCPTTSELVASDN....................................
T1KI16_TETUR/103-479................TGMADGGEKSALTNQEVDQNRPTQQDQ.....................................
K7J3W8_NASVI/92-490VAA.............ATMANGDTAAGDS......ISSPARVQP......................QTQRSSVSSDT...
A0A068XH02_HYMMI/46-488................VRPSSATTTMNTKEEEIPLKTADERAEAQTLVNLNEMPPVSLRRRHPESFSMTPPHDSGYETRS
W5JK58_ANODA/96-499................GTHTDPDRPAPLSGERAIGTAGGSASAG.........................ATNYGAVE...
E9FSB0_DAPPU/62-438................AVMATDQSSTSNSTSNNETAANGPRSPT....................................
C3Z2C5_BRAFL/88-496................VGMADSDPEAKKKKKKKKKRRGDGDAQG......................AAPAGAVGGEE...
H2TY46_TAKRU/29-412................VGMAKPVDAPHSG...........RETE......................QLSPHSPAETE...
H3AT04_LATCH/77-455................VGMADPDPEARRKEPEDS......RREA......................EASTNHTASAT...
I1HEG8_BRADI/69-507APA.............MWSEEMQLPADSARSGVNQYERAGQQDNLGSAMVEMRDLGGSRSRVHQTTSSSGSMLQMGNLEA
W4XU10_STRPU/68-474................VGMADIDSPPPKSKAKQEPPVEEHTAEE......................NATATGTTVSG...
G7Y344_CLOSI/42-431................LITASTSANANGSEAEGSDSNAEVPLMS....................................
B7Q2V0_IXOSC/41-421................VTMADRDPFYSSQNQHASQSDASSGTSR......................RPCSTFPRMRG...
PSN1_RAT/76-458................VNMAEGDPEAQRRVPKNPKYSTQGTERE......................ETQDTGTGSDD...
T1JMG4_STRMM/67-438................SMMADRETGVEERSNTANNTGQAGNASP....................................
T1G6P3_HELRO/9-376................AVVATSSTSQDDIHTEVYHVSTATAASG......................DHVYNGNNYDD...
D7LLE1_ARALL/15-389LVQ.............RRVWRERRSNDAENHANRNEVRAVRSEEVEE.................................
A2G9L8_TRIVA/13-428................EEQNEEGEDHENLDNYDEEYDSASEDES......................TDPDSSASSDDALP
F6RA92_CIOIN/37-422................VGMAQNAPAPNQQPRGNGSFSTLGVWVH......................SDNTSSTSQGS...
I3IV36_ORENI/95-480................VNMADTDRPNRNSTEAASPQQEPQEAPV......................ASPVPSSPSQD...
H2Z6F8_CIOSA/7-395................VGMAQETSRPNAQVSDVPMVGTKSVGST......................DTSSTSGGS.....
K1PKB7_CRAGI/84-479................VGMADDGSDKKKKKKKKSKKKPEAATAE....................................
S2K404_MUCC1/83-504HFR.............LSNSMLGTATSTVHETISSPNNNDMRLSVQLHSPSSFIQQNFRKSHDGFMRLPDDSHLTLDSS.
H3FRQ2_PRIPA/66-481................TIMMSMVEEQERKHVEEGEDGGGGGGEG......................GETTGERRESA...
E0VJ41_PEDHC/87-467................VNMTSEETKNPTS...........SLKE......................SNSTRNFEEDP...
E2AIY0_CAMFO/93-484VQA.............ATMASEDTVASPT...........RSQV......................DNQNNRASNDT...
F4PRZ5_DICFS/219-583................MASSKNNTTPTTKTTTNDDTMSDTSSNS......................SSSSSSSSSS....
B0WS38_CULQU/61-516................GTHSDPSEEALTRGERAIGTGSTGTVTT......................SYGSTGTPVHS...
A0A068YDE2_ECHMU/45-476................VAMMGDEETHSTHLGPAVKPTEEHACLS......................QPSPQQPSSLAPLL
E2BSL4_HARSA/95-504VQA.............ATMAGSDATSGDTTTSGNNTTSPTRDRT......................DNQCSYASGDT...
H9J5W9_BOMMO/68-456................AAASPAPGAAGERELRPLQPHGTVEGEG......................RDGTEAGGG.....
G3Q8S2_GASAC/77-448................VGMASPPEAQRSGQETGRASQAPTYERE....................................
F6GSZ0_VITVI/15-427VAQ.............RRAWRERRGVGSNLSENSNNLATSDVNV......................NPDVASNSTLGTCL
B4QRZ4_DROSI/98-517................VTPQQSQATASSSPSSSNSTTTTRATQN......................SLASPEAAAAS...
SPE4_CAEEL/11-464TNE................GEESTIRRTVKQTIEYYTKREAQDD......................EFYQKIRQRRAAIN
C7J054_ORYSJ/30-449WRE.............RTQSGAELDANSTVEVLGEVLGTNLGAS......................SAGNLGVSAIRSDE
T1HN85_RHOPR/7-402................INKISDEDNAQRG...........KTSS......................SVSTPQVNYSA...
A9S846_PHYPA/9-467PAQ.............MGSDAERPRVRRWNRRASRSSNPSPDTELG....................ESPMSSGNASQRDS
E3N426_CAERE/9-463DSS.............ENLNDERKLRKDVKQLIELYSKKEAQDD......................EFLRKIRQRRTAIN
D8LTV7_ECTSI/63-572NDR.............RAPSQQQARREQPGATGGPQEGDVSSSP......................RAPVGTATMGGGGL
H3CB70_TETNG/22-406................VGMAKPTEAPPPGAETGEEGTPTEGTLR......................EEGPRPLPEAE...
G2J6Q7_CAEBR/9-477DSQ.............ENLNDERKLRKDVKELIQLYSKQDEKDD......................EFLQKIRQRRNAIN
I1N8G3_SOYBN/8-407GFI.............VAGVSDSETSRIELQVVSRVNSNNNNNL......................SSNNDNGENGINDE
G3W888_SARHA/88-452................VGMAKVDTPTKGALPKDQEQVWEQDEDS......................SDTSGDHSYSE...
PSN_CAEEL/44-434................VTAVENTTDPREPTSSDSNTSTAFPGEA......................SCSSETPKRPK...
F2CQD9_HORVD/22-450APA.............MWSEESQHHDSAARSGPNLYDRVGQHDDSAPAMVEMRDLG..........STSRDMATSNQAVT
W5N759_LEPOC/69-512................VGMADGESQAKKKEEPNSSELDDQGSRW......................ESSRTHGQSAS...
Q7PR98_ANOGA/98-513................GTHTDPDRAAPLSGERTIGTGPGSAGGG......................SRQAGGYGAVN...
M1CAI2_SOLTU/15-421VVQ.............RRVWRERRDNDIGSDENLDSRSNLNSTV......................YSSLESSSGLESLP
W1NQ31_AMBTC/9-446AMNLLVGGVSESSETMYSQSQSALSVELQPSRSFVQSSDGIDSH......................RASETCGYSTVTVD
K3WL66_PYTUL/82-563PAA.............AAPRARKSPRPAAATASSSSLGEASQSS......................SSVHASGNSSS...
A2DZ73_TRIVA/13-381NNE.............EGDGNEGNQEDPAEQADNQDNNEEEEEE......................EEAE..........
G0NCU3_CAEBE/9-464GSE.............EP.NEERKIRQNVSQLIQMYSKKEEKDD......................EFLQKIRQRRTAIN
U9UMQ1_RHIID/178-561KFR.............KSLSSVSSFQATSGEEIPLSENIRYNRG....................................
T1EFZ6_HELRO/89-576................VEPSSGAYEADNDGGADAEADVDGEGDN......................VIEIHDDQVPEGQI
B7QGI2_IXOSC/14-384................DLSAQTPTNAEKLPRRLLNFRGSTNTED......................SFVVSRMKAIQEIR
A0A0H5S0W0_BRUMA/94-527................IGTAMMEQDTSCVTGNTQSESGNPGSST......................GSTNGSLPSTAELL
S2J107_MUCC1/49-424GYR.............TQESNRASKNHKKWLPFTNANKGYRPIH....................................
D3B4U3_POLPA/99-477PPQ.............QQQQQQSASSSSSQQARSRRNNNNGGED......................QQEDEFGQQ.....
H2VWC4_CAEJA/11-477EVN................EGDGTIRRGVKQLIAMYSKQEAQDE......................EFAQKIRQRRSAWN
A9VBA9_MONBE/203-602................VTMADVGDSSSNSATIESQPRVADGGAS......................TRGTEMTSMS....
F2TYS0_SALR5/109-504................VNMADTGERTQTQSTSLTNGAQTQPQQQ......................QQQQQRGGTATS..
E1G929_LOALO/15-397NKS.............FIKRKQQKMRE.....................................................
H3FRQ2_PRIPA/544-933................TIMLRKLAGKSNEEVEGGAKGEEEAASG......................VS............

PF01478

C9R6J1_AGGAD/91-199...............AAKW.........................------------------------------------
FLAK_METJA/5-130.................G..........................------------------------------------
FLAK_METMP/5-130............................................------------------------------------
LEP4_BACSU/100-204............................................------------------------------------
Q9HWA5_PSEAE/4-110............................................------------------------------------
Q8FME5_COREF/77-189............................................------------------------------------
Q9CPF6_PASMU/89-199.................H.LS.......................------------------------------------
Q9RSQ9_DEIRA/109-347NVAAKKAVRIPELLTLGGFLVSLALSSAGTGPGLLDMLRGGLMA------------------------------------
Q97HN8_CLOAB/64-168............................................------------------------------------
Q8XQX7_RALSO/14-117............................................------------------------------------
LEP4_HAEIN/90-200.................W.LA.......................------------------------------------
Q8TMQ5_METAC/5-101............................................------------------------------------
Q8NQ30_CORGL/4-110............................................------------------------------------
Q98BF9_RHILO/11-116............................................------------------------------------
Y421_METTH/12-138............................................------------------------------------
Q8CXM1_OCEIH/104-208............................................------------------------------------
A9CKJ3_AGRFC/8-113............................................------------------------------------
Q8TXH1_METKA/6-112............................................------------------------------------
Q8DLL0_THEEB/89-199.................W.GG.......................------------------------------------
YC8A_METJA/6-148........YIGVFLFLLS.FILFKSYFAL.........SFLVFY------------------------------------
Q9XAP1_STRCO/112-224............................................------------------------------------
LEP4_MYXXD/113-222.................Y.VG.......................------------------------------------
LEP4_XANCP/133-242.................W.LF.......................------------------------------------
Q8TLD4_METAC/26-152............................................------------------------------------
O67535_AQUAE/105-214.................L.YY.......................------------------------------------
Q988A4_RHILO/13-122.................R.GH.......................------------------------------------
Q8XVK3_RALSO/140-249.................W.AY.......................------------------------------------
Q87I88_VIBPA/13-110............................................------------------------------------
Q8F6L1_LEPIN/127-232............................................------------------------------------
Q891G5_CLOTE/115-221............................................------------------------------------
Q9K8H1_BACHD/15-120............................................------------------------------------
LEP4_PSEAE/136-245.................W.LF.......................------------------------------------
Q8XI34_CLOPE/100-206............................................------------------------------------
Q8EJP8_SHEON/157-266.................W.LF.......................------------------------------------
Q9CMH2_PASMU/11-110............................................------------------------------------
Q92T43_RHIME/12-117............................................------------------------------------
HOPD_SALTY/9-119.................W.GY.......................------------------------------------
Q8FT27_COREF/8-114............................................------------------------------------
Q8THK9_METAC/8-134............................................------------------------------------
Q8RAF7_CALS4/104-208............................................------------------------------------
PPPA_ECOLI/130-240.................W.IA.......................------------------------------------
Q92YL6_RHIME/12-116............................................------------------------------------
Q89PI9_BRADU/13-114............................................------------------------------------
Q89UH6_BRADU/9-113............................................------------------------------------
Q87M36_VIBPA/5-111............................................------------------------------------
Q8Y6Y1_LISMO/101-204............................................------------------------------------
Q89HG8_BRADU/40-149............................................------------------------------------
Q8YXA0_NOSS1/108-226.................L.L........................------------------------------------
Q9X222_THEMA/103-204............................................------------------------------------
LEP4_VIBCH/112-221.................F.IV.......................------------------------------------
Q989C3_RHILO/11-122............................................------------------------------------
LEP4_ECOLI/81-190.................W.GV.......................------------------------------------
Q9ABP2_CAUCR/121-230.................W.LY.......................------------------------------------
Q8Y1N3_RALSO/10-114............................................------------------------------------
Q88QB9_PSEPK/4-110............................................------------------------------------
Y83C_METJA/9-115............................................------------------------------------
Q87VV0_PSESM/5-111............................................------------------------------------
O29326_ARCFU/8-129............................................------------------------------------
Q97FF6_CLOAB/100-211............................................------------------------------------
Q8RHE5_FUSNN/7-119............................................------------------------------------
Q980Y8_SULSO/10-125............................................------------------------------------
Q8R8E5_CALS4/6-111............................................------------------------------------
LEP4_SYNY3/108-223.................M.GG.......................------------------------------------
A0KPV9_AERHH/142-247.................W.AF.......................------------------------------------
A5EXL5_DICNV/138-247.................W.LF.......................------------------------------------
A9H675_GLUDA/111-216............................................------------------------------------
C9R2X4_AGGAD/10-108............................................------------------------------------
E0SLF4_DICD3/139-243.................W.AF.......................------------------------------------
G1UB88_HAEDU/13-108............................................------------------------------------
H7C7G6_CAUCR/11-113............................................------------------------------------
H9L4S3_VIBCH/135-244.................W.LF.......................------------------------------------
I6Y9M6_MYCTU/5-108............................................------------------------------------
LEP4_BURPS/162-269.................W.LF.......................------------------------------------
Q0WIM7_YERPE/129-236............................................------------------------------------
Q5F692_NEIG1/134-242.................A.VY.......................------------------------------------
Q5ZVB6_LEGPH/138-246.................N.LF.......................------------------------------------
Q65GL0_BACLD/102-205............................................------------------------------------
Q7MJZ8_VIBVY/10-109............................................------------------------------------
Q9PAI1_XYLFA/133-241.................A.LF.......................------------------------------------

PF04258

SIPL5_ARATH/240-524--------------------------------------------------------------------------------
SPP2A_MOUSE/214-499--------------------------------------------------------------------------------
SIP_ARATH/47-323--------------------------------------------------------------------------------
SPP2B_HUMAN/213-505--------------------------------------------------------------------------------
Q9VPQ7_DROME/71-359--------------------------------------------------------------------------------
Q9VBL1_DROME/96-408--------------------------------------------------------------------------------
SIPL4_ARATH/241-527--------------------------------------------------------------------------------
SIPL2_ARATH/242-525--------------------------------------------------------------------------------
YL8H_SCHPO/31-282--------------------------------------------------------------------------------
YKK0_YEAST/145-510--------------------------------------------------------------------------------
SPPL3_MOUSE/60-374--------------------------------------------------------------------------------
IMP2_CAEEL/55-450--------------------------------------------------------------------------------
HM13_MOUSE/62-350--------------------------------------------------------------------------------
Q93346_CAEEL/275-601--------------------------------------------------------------------------------

PF06550

Q9HM09_THEAC/1-278--------------------------------------------------------------------------------
Q9HQ23_HALSA/15-306--------------------------------------------------------------------------------
Q8TIY9_METAC/27-303--------------------------------------------------------------------------------

PF01080

D3B5F5_POLPA/149-528NLPS............................................................................
G4VJ47_SCHMA/58-484................................................................................
T1KI16_TETUR/103-479................................................................................
K7J3W8_NASVI/92-490................................................................................
A0A068XH02_HYMMI/46-488QTHPNGAMND......................................................................
W5JK58_ANODA/96-499................................................................................
E9FSB0_DAPPU/62-438................................................................................
C3Z2C5_BRAFL/88-496................................................................................
H2TY46_TAKRU/29-412.............................................................................PET
H3AT04_LATCH/77-455................................................................................
I1HEG8_BRADI/69-507GQISNQGGSAQHAVIQ................................................................
W4XU10_STRPU/68-474............................................................................QEDQ
G7Y344_CLOSI/42-431................................................................................
B7Q2V0_IXOSC/41-421................................................................................
PSN1_RAT/76-458................................................................................
T1JMG4_STRMM/67-438................................................................................
T1G6P3_HELRO/9-376................................................................................
D7LLE1_ARALL/15-389................................................................................
A2G9L8_TRIVA/13-428INPDEFVGLSNNPEDQPPP.............................................................
F6RA92_CIOIN/37-422................................................................................
I3IV36_ORENI/95-480................................................................................
H2Z6F8_CIOSA/7-395................................................................................
K1PKB7_CRAGI/84-479................................................................................
S2K404_MUCC1/83-504................................................................................
H3FRQ2_PRIPA/66-481................................................................................
E0VJ41_PEDHC/87-467................................................................................
E2AIY0_CAMFO/93-484................................................................................
F4PRZ5_DICFS/219-583................................................................................
B0WS38_CULQU/61-516.................................MSQSSTPAHQPANQQQRQQQQPPPPRPDNAEGTPLVSYRENAAVRTA
A0A068YDE2_ECHMU/45-476EMGNLSGNSTQPSGMAN...............................................................
E2BSL4_HARSA/95-504................................................................................
H9J5W9_BOMMO/68-456................................................................................
G3Q8S2_GASAC/77-448................................................................................
F6GSZ0_VITVI/15-427SVGSGEQETSLVNAE.................................................................
B4QRZ4_DROSI/98-517...............................................................GQRTGNSHPRQNQRDDG
SPE4_CAEEL/11-464PDSVPTEHSPLVEAEPSP...IEL........................................................
C7J054_ORYSJ/30-449RVGLAGDARNLRLGTSMPNL............................................................
T1HN85_RHOPR/7-402.............................................................................LRM
A9S846_PHYPA/9-467TLTAAVDDSQNLITGPPTEPEVGIIGSRLISSTGEGGALHAVSIILHENSHMDDDTVPLV....................
E3N426_CAERE/9-463PDSALTETSP.VHTEPSDAL.IQL........................................................
D8LTV7_ECTSI/63-572ADLAGGGDEEGG....................................................................
H3CB70_TETNG/22-406......................................................................LEEDPGPASR
G2J6Q7_CAEBR/9-477PDSGSTAHSPMVTTEPSPIVL...........................................................
I1N8G3_SOYBN/8-407WERSPLVGGMRF....................................................................
G3W888_SARHA/88-452................................................................................
PSN_CAEEL/44-434................................................................................
F2CQD9_HORVD/22-450GQTSNQGGSAQHAVIQIE..............................................................
W5N759_LEPOC/69-512..........................................................................PADSHS
Q7PR98_ANOGA/98-513..........................................................................NHGPTQ
M1CAI2_SOLTU/15-421SIGERTAVDVE.....................................................................
W1NQ31_AMBTC/9-446GNSSSFGGYGAQRADHG...............................................................
K3WL66_PYTUL/82-563................................................................................
A2DZ73_TRIVA/13-381................................................................................
G0NCU3_CAEBE/9-464PDSGLTGHSPLVHTQPSPTTPLRL........................................................
U9UMQ1_RHIID/178-561................................................................................
T1EFZ6_HELRO/89-576PEGHVPEGHVHEGHVPESHVPESHVPEGHVPEGHVPEGHILSSDKAGTSANVDYVNLEHFTTEITIAAEK..........
B7QGI2_IXOSC/14-384RQEDVLCSHHHHHTHQPRH.............................................................
A0A0H5S0W0_BRUMA/94-527PANDANEKRGFPQGK........................................................IIRRFAPTR
S2J107_MUCC1/49-424................................................................................
D3B4U3_POLPA/99-477................................................................................
H2VWC4_CAEJA/11-477PDSGLTEQSPLVETEPSPSVPTEH........................................................
A9VBA9_MONBE/203-602................................................................................
F2TYS0_SALR5/109-504................................................................................
E1G929_LOALO/15-397................................................................................
H3FRQ2_PRIPA/544-933................................................................................

PF01478

C9R6J1_AGGAD/91-199--------------------------------------------------------------------------------
FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRFC/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_CALS4/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_CALS4/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524--------------------------------------SDPW-----------------------------GG-------
SPP2A_MOUSE/214-499--------------------------------------SVCS-----------------------------VP-------
SIP_ARATH/47-323--------------------------------------GDAL-----------------------------RP-------
SPP2B_HUMAN/213-505--------------------------------------ALCD-----------------------------RP-------
Q9VPQ7_DROME/71-359--------------------------------------GLNA-----------------------------SN-------
Q9VBL1_DROME/96-408--------------------------------------LHNT-----------------------------GH-------
SIPL4_ARATH/241-527--------------------------------------FDPW-----------------------------GG-------
SIPL2_ARATH/242-525--------------------------------------FDPW-----------------------------GG-------
YL8H_SCHPO/31-282--------------------------------------FKNP-----------------------------TR-------
YKK0_YEAST/145-510--------------------------------------AQNN-----------------------------FN-------
SPPL3_MOUSE/60-374--------------------------------------.STG-----------------------------SH-------
IMP2_CAEEL/55-450--------------------------------------IMEA-----------------------------SK-------
HM13_MOUSE/62-350--------------------------------------GLEA-----------------------------DN-------
Q93346_CAEEL/275-601--------------------------------------IELG-----------------------------FQ-------

PF06550

Q9HM09_THEAC/1-278--------------------------------------GLSFDN-----------RGD.............GN-------
Q9HQ23_HALSA/15-306--------------------------------------EDAAET-----------ADEAEAGEREAAAPADRP-------
Q8TIY9_METAC/27-303--------------------------------------TEGFKE-----------GEKREA............-------

PF01080

D3B5F5_POLPA/149-528......................................QSEMIE...........PKSSPNSESMSTGVSTSE......L
G4VJ47_SCHMA/58-484......................................SNQPMT...........GNSRNMLNIPNNTSRTDAIVVDTPD
T1KI16_TETUR/103-479......................................NIREGQ...........ASSSSQSPSSTQPAQPEA......D
K7J3W8_NASVI/92-490.......EEGGFTREWVETHADR...............SARRAQ...........EVRENAQTNSRGSAEVNG......A
A0A068XH02_HYMMI/46-488......................................ERRVKS...........NQSHQPMDSSNSHQEWHN......P
W5JK58_ANODA/96-499......DQTAGFTQDWAATTNQR...............VTRRQI...........EVQANIASNPSRPEYRTV......T
E9FSB0_DAPPU/62-438........DGGFTPAWNQEAEQR...............TEARRH...........RVQAAAAEAPRAAPQPQP......V
C3Z2C5_BRAFL/88-496........EGGFGQDWNESRGFQ...............PTRRPN...........RGGNASDASVNSEDARQA......A
H2TY46_TAKRU/29-412DREFCHGDDGGVHAKWCTSKQYR...............ISGSPI...........NPPRAAIIHQSGPVPVHK......G
H3AT04_LATCH/77-455.....PADDGGFTQDWVQQQNET..........LGDMHSTMETR...........AAVQALPNNNPIPEDP.........
I1HEG8_BRADI/69-507......................................IEQPEE...........EERAPLVSAASANSAVAN......E
W4XU10_STRPU/68-474TVSSDQEVNGGFDTVF......................TERRER...........DLERSANSSVTSEDRRAA......V
G7Y344_CLOSI/42-431......................................EYRHST...........GDQRNSSDLPSANVTTSE......Q
B7Q2V0_IXOSC/41-421......................................SGRSRR...........RSQRGSMANSGTLAALGS......S
PSN1_RAT/76-458.........GGFSEEWEAQRDSH..........LGPHRSTPESR...........AAVQELSGSILTSEDP.........
T1JMG4_STRMM/67-438.....EDQEAGFSREW......................LVRRGT...........GNNVTRIDENGRRSQRRS......M
T1G6P3_HELRO/9-376......................................DSTNLA...........YMNRFIHSKPDRKDEPKI......S
D7LLE1_ARALL/15-389......................................EHVGSS...........ERAEISVPLIDRRPEQAE......N
A2G9L8_TRIVA/13-428......................................QPKPEQ...........QPESELAQPAGEPTKPKK......K
F6RA92_CIOIN/37-422........DTGFDVAWQRRHNRNSGEVIIT........SNETRN...........QARQQLGPPPEGSEEA.........
I3IV36_ORENI/95-480........DGGFTQSWVSQQEHR..........LGPLQSTEETR...........REIQQMPSARPPVEEDD........
H2Z6F8_CIOSA/7-395........EAGFGVSWQRHHDSEVTCCFYLNKYCVVITSNETRE...........HARQQLGDPPEEP............
K1PKB7_CRAGI/84-479PDQVEAELDGGF..........................LEERPT...........RQLSQSTEETARAVRAARVLGDTEN
S2K404_MUCC1/83-504......................................SNPFAT...........QTTLQAPDDTDRPSTPRQ......E
H3FRQ2_PRIPA/66-481......................................NNQPST...........SSSVPSSSSASTSVLIPA......G
E0VJ41_PEDHC/87-467........ESGFVRGWMNPQR.................AKRRNE...........EIQQSEVRFHPQQSEGHS......N
E2AIY0_CAMFO/93-484.......EEGGFTPEWVETHGER...............SARRAQ...........EVRENSSREGTTRQQENR......V
F4PRZ5_DICFS/219-583......................................SSSNIQ...........KSTSSSSISTGLSTEPSD......T
B0WS38_CULQU/61-516VGQGHPDQSGGFTQEWADASGQR...............VTRRQI...........EVQANIASNPNRPEYRTV......T
A0A068YDE2_ECHMU/45-476......................................DLSHSE...........GQQSNQGEGNTNQQEQCD......F
E2BSL4_HARSA/95-504.......EEEGFTNEWVETHGER...............SARRAQ...........EVRENDETRGTNRRQQEN......R
H9J5W9_BOMMO/68-456........EAGFDAAWRERRDEG...............AAPRRL...........RVDSAPPRYVTRLDPPHA......P
G3Q8S2_GASAC/77-448....CRDPQGCWFEPWLFHEEAEQ..............SSRRAE...........PENRQSQLFPEDDLE..........
F6GSZ0_VITVI/15-427......................................EGRVSE...........GNSELVVPLIDHRINVGE......H
B4QRZ4_DROSI/98-517SVLATEAEAAGFTQEWSANLSER...............VARRQI...........EVQSTQSGNAQRSNEYRT......V
SPE4_CAEEL/11-464......................................KEKNST...........EELSDDESDTSETSSGSS......N
C7J054_ORYSJ/30-449......................................SSDSAS...........AQVEVLPASPEISVSVPEMRVPLIQ
T1HN85_RHOPR/7-402IQLSVELREDGFSADWADGLEAR...............VEGRQR...........AVAAHEASSGFQPRQPTR......I
A9S846_PHYPA/9-467......................................QQQTNS...........PSSPATLGRSEAEFDHRS......R
E3N426_CAERE/9-463......................................KSKNSD...........EEHTDDESDTTESSTTTS.......
D8LTV7_ECTSI/63-572......................................RGADDE...........TPAAPVSAEAAAVVEPQS......S
H3CB70_TETNG/22-406GSESCRLRPLGPGRSWKFL...................ELQTPE...........QVWTRLTDH................
G2J6Q7_CAEBR/9-477......................................KEKNSD...........EELFDNESDTTESSSESS.......
I1N8G3_SOYBN/8-407......................................GEVVVD...........EGMSPLVEMSGVGENEEE......G
G3W888_SARHA/88-452......................................TYDSPR...........CTPLHVPSYAVEELEEE........
PSN_CAEEL/44-434......................................VKRIPQ...........KVQIESNTTASTTQNSGV......R
F2CQD9_HORVD/22-450......................................RRQEEE...........LETAPLVSAASANPTVAN......E
W5N759_LEPOC/69-512LCVHTHIPRYGELINFLSSSGQNRILTISLKFRSSQLHGDGDLNVVRKASYFLLGKEVVHFSSSNPEHISTPQKLGCESS
Q7PR98_ANOGA/98-513TGATVEDQTAGFTQDWAATANQR...............VTRRQI...........EVQANIANNPSRPEYRTV......T
M1CAI2_SOLTU/15-421......................................DGLVSR...........SDSELAAPLIQHRINVRM......N
W1NQ31_AMBTC/9-446......................................EIEHVN...........EEMSPLVIRGGESHDLSH......A
K3WL66_PYTUL/82-563......................................SSSNHQ...........RAARPTPAPIQPRPAPVA......P
A2DZ73_TRIVA/13-381......................................NNQPQE...........NANGEAQNGNQNNNKKKK......N
G0NCU3_CAEBE/9-464......................................KEHNSD...........VEHTDDESDTTESSSSSS.......
U9UMQ1_RHIID/178-561......................................EGGVSD...........EGGINCDGTDENSQIPRRQSSSLQP
T1EFZ6_HELRO/89-576......................................KSDEPD...........QQERPAEEQGEPQAKQKR......S
B7QGI2_IXOSC/14-384......................................HRQRRQ...........DAAAPEDT.................
A0A0H5S0W0_BRUMA/94-527TANDQGVENAGLNTEQSDNNSKN...............IGKGRT...........AASFNKGGESGGTQRVTV......Q
S2J107_MUCC1/49-424......................................NNELDE...........NATLSIALSTLEQSRDVE......R
D3B4U3_POLPA/99-477......................................QQQQED...........DAQVDVNNNDEEVPPIEE......L
H2VWC4_CAEJA/11-477......................................QQEEKE...........DKQMDSESSSESCSESAS.......
A9VBA9_MONBE/203-602......................................SQPRAR...........QGSRADSEADDGARDIST......F
F2TYS0_SALR5/109-504......................................SSSHGH...........HRRRSRQSSSSPNADDVE......L
E1G929_LOALO/15-397......................................RHERRS...........KTKLDSEAENEHLRQRKM......L
H3FRQ2_PRIPA/544-933......................................CGESRQ...........NRSRVGPSSDEEKGTREK......A

PF01478

C9R6J1_AGGAD/91-199--------------------------------------.....YY.....................RQE....-------
FLAK_METJA/5-130--------------------------------------....FFM.....................FLL....-------
FLAK_METMP/5-130--------------------------------------...................................-------
LEP4_BACSU/100-204--------------------------------------....AAI.....................THG....-------
Q9HWA5_PSEAE/4-110--------------------------------------.....GY.....................LLG....-------
Q8FME5_COREF/77-189--------------------------------------............................LAFIA..-------
Q9CPF6_PASMU/89-199--------------------------------------...KGIY.....................RKE....-------
Q9RSQ9_DEIRA/109-347--------------------------------------AGAVSLVCGVYWWIYWRRNKQAEDDGTDDEQSD..-------
Q97HN8_CLOAB/64-168--------------------------------------.....FA.....................LFK....-------
Q8XQX7_RALSO/14-117--------------------------------------.....LY.....................ALG....-------
LEP4_HAEIN/90-200--------------------------------------...KFYY.....................GKE....-------
Q8TMQ5_METAC/5-101--------------------------------------.....AF.....................KKG....-------
Q8NQ30_CORGL/4-110--------------------------------------....TAV.....................LVG....-------
Q98BF9_RHILO/11-116--------------------------------------.....LF.....................AMG....-------
Y421_METTH/12-138--------------------------------------.....LW.....................RMV....-------
Q8CXM1_OCEIH/104-208--------------------------------------....ILI.....................SRG....-------
A9CKJ3_AGRFC/8-113--------------------------------------.....LF.....................AAN....-------
Q8TXH1_METKA/6-112--------------------------------------.....LN.....................VLG....-------
Q8DLL0_THEEB/89-199--------------------------------------...AIAF.....................NQE....-------
YC8A_METJA/6-148--------------------------------------LIGIFLY.....................YLN....-------
Q9XAP1_STRCO/112-224--------------------------------------...............................IN..-------
LEP4_MYXXD/113-222--------------------------------------...WKVF.....................QRE....-------
LEP4_XANCP/133-242--------------------------------------...KQLT.....................GKE....-------
Q8TLD4_METAC/26-152--------------------------------------.....LF.....................HLG....-------
O67535_AQUAE/105-214--------------------------------------...VKFR.....................KIE....-------
Q988A4_RHILO/13-122--------------------------------------...FLMT.....................GRI....-------
Q8XVK3_RALSO/140-249--------------------------------------...KLLR.....................GRE....-------
Q87I88_VIBPA/13-110--------------------------------------.....LW.....................LIN....-------
Q8F6L1_LEPIN/127-232--------------------------------------.....FF.....................FPG....-------
Q891G5_CLOTE/115-221--------------------------------------.....IL.....................LTN....-------
Q9K8H1_BACHD/15-120--------------------------------------............................VYLIY..-------
LEP4_PSEAE/136-245--------------------------------------...KLVT.....................GKE....-------
Q8XI34_CLOPE/100-206--------------------------------------.....SK.....................LTG....-------
Q8EJP8_SHEON/157-266--------------------------------------...KLLT.....................GKE....-------
Q9CMH2_PASMU/11-110--------------------------------------.....LF.....................TFG....-------
Q92T43_RHIME/12-117--------------------------------------.....LF.....................AAN....-------
HOPD_SALTY/9-119--------------------------------------...RLRY.....................QKE....-------
Q8FT27_COREF/8-114--------------------------------------....TAG.....................VVG....-------
Q8THK9_METAC/8-134--------------------------------------.....LF.....................RLR....-------
Q8RAF7_CALS4/104-208--------------------------------------............................ISLLS..-------
PPPA_ECOLI/130-240--------------------------------------...GIVL.....................RKE....-------
Q92YL6_RHIME/12-116--------------------------------------.....LF.....................AAG....-------
Q89PI9_BRADU/13-114--------------------------------------.....LY.....................TRG....-------
Q89UH6_BRADU/9-113--------------------------------------.....CF.....................AMG....-------
Q87M36_VIBPA/5-111--------------------------------------.....LY.....................LVK....-------
Q8Y6Y1_LISMO/101-204--------------------------------------.....II.....................FRK....-------
Q89HG8_BRADU/40-149--------------------------------------.....LY.....................RRWRG..-------
Q8YXA0_NOSS1/108-226--------------------------------------...GVVF.....................QKE....-------
Q9X222_THEMA/103-204--------------------------------------............................LKAMY..-------
LEP4_VIBCH/112-221--------------------------------------...RLFK.....................RID....-------
Q989C3_RHILO/11-122--------------------------------------.....FW.....................VLR....-------
LEP4_ECOLI/81-190--------------------------------------...WLVC.....................HKE....-------
Q9ABP2_CAUCR/121-230--------------------------------------...KTVR.....................GFD....-------
Q8Y1N3_RALSO/10-114--------------------------------------.....LY.....................LLR....-------
Q88QB9_PSEPK/4-110--------------------------------------.....GY.....................MLG....-------
Y83C_METJA/9-115--------------------------------------...................................-------
Q87VV0_PSESM/5-111--------------------------------------.....GY.....................TLG....-------
O29326_ARCFU/8-129--------------------------------------....ALY.....................LIG....-------
Q97FF6_CLOAB/100-211--------------------------------------.....II.....................DMP....-------
Q8RHE5_FUSNN/7-119--------------------------------------.....IL.....................KKE....-------
Q980Y8_SULSO/10-125--------------------------------------.....LY.....................KLS....-------
Q8R8E5_CALS4/6-111--------------------------------------....YII.....................TNG....-------
LEP4_SYNY3/108-223--------------------------------------...SLLL.....................GRE....-------
A0KPV9_AERHH/142-247--------------------------------------...KLLT.....................GKE....-------
A5EXL5_DICNV/138-247--------------------------------------...KLIT.....................GRE....-------
A9H675_GLUDA/111-216--------------------------------------....SLL.....................YRRAR.G-------
C9R2X4_AGGAD/10-108--------------------------------------.....LF.....................SLR....-------
E0SLF4_DICD3/139-243--------------------------------------...RLLS.....................GRE....-------
G1UB88_HAEDU/13-108--------------------------------------..............................G....-------
H7C7G6_CAUCR/11-113--------------------------------------....GMF.....................AAG....-------
H9L4S3_VIBCH/135-244--------------------------------------...KLLT.....................GKE....-------
I6Y9M6_MYCTU/5-108--------------------------------------....HLA.....................LPA....-------
LEP4_BURPS/162-269--------------------------------------...KLLR.....................GIE....-------
Q0WIM7_YERPE/129-236--------------------------------------....SYW.....................LFKIVRG-------
Q5F692_NEIG1/134-242--------------------------------------...KLLT.....................GKT....-------
Q5ZVB6_LEGPH/138-246--------------------------------------...YLMT.....................GKV....-------
Q65GL0_BACLD/102-205--------------------------------------....LLL.....................TKG....-------
Q7MJZ8_VIBVY/10-109--------------------------------------.....LW.....................QRR....-------
Q9PAI1_XYLFA/133-241--------------------------------------...KLIF.....................NKE....-------

PF04258

SIPL5_ARATH/240-524--------------------------------------------------------------------------------
SPP2A_MOUSE/214-499--------------------------------------------------------------------------------
SIP_ARATH/47-323--------------------------------------------------------------------------------
SPP2B_HUMAN/213-505--------------------------------------------------------------------------------
Q9VPQ7_DROME/71-359--------------------------------------------------------------------------------
Q9VBL1_DROME/96-408--------------------------------------------------------------------------------
SIPL4_ARATH/241-527--------------------------------------------------------------------------------
SIPL2_ARATH/242-525--------------------------------------------------------------------------------
YL8H_SCHPO/31-282--------------------------------------------------------------------------------
YKK0_YEAST/145-510--------------------------------------------------------------------------------
SPPL3_MOUSE/60-374--------------------------------------------------------------------------------
IMP2_CAEEL/55-450--------------------------------------------------------------------------------
HM13_MOUSE/62-350--------------------------------------------------------------------------------
Q93346_CAEEL/275-601--------------------------------------------------------------------------------

PF06550

Q9HM09_THEAC/1-278--------------------------------------------------------------------------------
Q9HQ23_HALSA/15-306--------------------------------------------------------------------------------
Q8TIY9_METAC/27-303--------------------------------------------------------------------------------

PF01080

D3B5F5_POLPA/149-528SESTDSVTLEKGR...................................................................
G4VJ47_SCHMA/58-484DNTINNDARNNNETISQAPHET..........................................................
T1KI16_TETUR/103-479IPPISFRGQDNLRPDLAGVDEF.........EE...............................................
K7J3W8_NASVI/92-490SQQANQQQMMMMQ...................................................................
A0A068XH02_HYMMI/46-488SPSLTTGANEFSSHEMVTSGEQ..........................................................
W5JK58_ANODA/96-499AESNRTGTNDPSQPALPMYAVQE.........................................................
E9FSB0_DAPPU/62-438TEEIDDDE........................................................................
C3Z2C5_BRAFL/88-496QNLSNGRLSPSGNQQQQQQQQQMEEDEDE...................................................
H2TY46_TAKRU/29-412GD..............................................................................
H3AT04_LATCH/77-455................................................................................
I1HEG8_BRADI/69-507EHRQISSSDPPDEDFEMFESSK..........................................................
W4XU10_STRPU/68-474RALRQNNGPSNRQPPVDEEEE...........................................................
G7Y344_CLOSI/42-431LPERHLRRMTESIADHSGNSTD..........................................................
B7Q2V0_IXOSC/41-421QGSAPEVDDLPRQEE.................................................................
PSN1_RAT/76-458................................................................................
T1JMG4_STRMM/67-438PNPVTNQDEE......................................................................
T1G6P3_HELRO/9-376STIYNA..........................................................................
D7LLE1_ARALL/15-389SETF........LEGIGLGSSG..........................................................
A2G9L8_TRIVA/13-428RPNQDNQHGDPENPDKRKKKSGSAKSTPTSE.................................................
F6RA92_CIOIN/37-422................................................................................
I3IV36_ORENI/95-480................................................................................
H2Z6F8_CIOSA/7-395................................................................................
K1PKB7_CRAGI/84-479GQRTNSPRNPTREEEEEEEE............................................................
S2K404_MUCC1/83-504EATRKATEPENDEEDAERS.............................................................
H3FRQ2_PRIPA/66-481ESKQKRPQVRRVPPPAREERRE.........EEGV.............................................
E0VJ41_PEDHC/87-467PGPVGTNAVTVEE...................................................................
E2AIY0_CAMFO/93-484RFSQEQGTVTE.....................................................................
F4PRZ5_DICFS/219-583PMEVNYST........................................................................
B0WS38_CULQU/61-516AGARGGTGDSQQVPLYEQP.............................................................
A0A068YDE2_ECHMU/45-476TPPLTVDSVEPRLHEMQSGHGG..........................................................
E2BSL4_HARSA/95-504SVEIQSQVAPPPPPPPPM..............................................................
H9J5W9_BOMMO/68-456HAPPHAPDLD......................................................................
G3Q8S2_GASAC/77-448................................................................................
F6GSZ0_VITVI/15-427GQEDSVSTENLPFEGIGLGSSG..........................................................
B4QRZ4_DROSI/98-517TAPDQNHPDGQ.....................................................................
SPE4_CAEEL/11-464LSSSDSSTT..........VST.........SDIS.............................................
C7J054_ORYSJ/30-449PRPERTRDEEDDEDGIGLSSSG..........................................................
T1HN85_RHOPR/7-402STQNPQGVPHAQDEE.................................................................
A9S846_PHYPA/9-467PMNGATQHSEDGDEETGIGLSG..........................................................
E3N426_CAERE/9-463..SSD..............VTT.........SEVS.............................................
D8LTV7_ECTSI/63-572SPGGDHSSARRPGADSAGASESVAAPLLELVESGTAAVAVGDASADGSGTRSGREQGKRRLATVRRGIRGGGCLDPEPPG
H3CB70_TETNG/22-406................................................................................
G2J6Q7_CAEBR/9-477.TSSESV............FSS.........SDVS.............................................
I1N8G3_SOYBN/8-407EGVRRKIGER......................................................................
G3W888_SARHA/88-452................................................................................
PSN_CAEEL/44-434VERELAAERPTVQDANFHRHEE..........................................................
F2CQD9_HORVD/22-450EHTQISSSEPPEEEFEMFESSR..........................................................
W5N759_LEPOC/69-512PSAG............................................................................
Q7PR98_ANOGA/98-513AEATRAGQDPQLGGALYDQA............................................................
M1CAI2_SOLTU/15-421LQ..EGPSDDFALEGIGLGSSG..........................................................
W1NQ31_AMBTC/9-446TERVEENHERDRAGVHERGRRGEGRILEFEASR...............................................
K3WL66_PYTUL/82-563AASSDLATVTENFNRPRNVMES.........DFSTYDCETMDALIELLANFYRTFSPEDVWKAPQVAEKFFATQDRLWLL
A2DZ73_TRIVA/13-381MSKRDNE.........................................................................
G0NCU3_CAEBE/9-464.SSGEVSTE..........VSS.........SEVS.............................................
U9UMQ1_RHIID/178-561QSQPPNNVSYDDEEDERS..............................................................
T1EFZ6_HELRO/89-576KHRQHSKQQNRPKGPSQQQNEQ.........QQIG.............................................
B7QGI2_IXOSC/14-384................................................................................
A0A0H5S0W0_BRUMA/94-527NTEVNPAG............LQ.........NERF.............................................
S2J107_MUCC1/49-424RNSNEAGQDEDEEEDELN..............................................................
D3B4U3_POLPA/99-477EPEQEKR.........................................................................
H2VWC4_CAEJA/11-477IASGDSNADDKEKEEEDDEYQS.........SNIE.............................................
A9VBA9_MONBE/203-602AAPRGETRSTNQAAPASQPSFQ.........PDDE.............................................
F2TYS0_SALR5/109-504LADIGGSPAPNRARTAASRPPA.........NQGD.............................................
E1G929_LOALO/15-397CSKSDTQVEICSKFRAASD.............................................................
H3FRQ2_PRIPA/544-933GCDEKVVVIRSGASQSPEDYEE.........EEEE.............................................

PF01478

C9R6J1_AGGAD/91-199--------------------------------------------------------------------------------
FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRFC/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_CALS4/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_CALS4/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524-------------------------------------------------------------------YNMIGFGDILFPG
SPP2A_MOUSE/214-499-------------------------------------------------------------------VSVLGFGDIIVPG
SIP_ARATH/47-323-------------------------------------------------------------------YSMLGLGDIVIPG
SPP2B_HUMAN/213-505-------------------------------------------------------------------FSLLGFGDILVPG
Q9VPQ7_DROME/71-359-------------------------------------------------------------------FAMLGLGDIVIPG
Q9VBL1_DROME/96-408-------------------------------------------------------------------FSMLGLGDVVMPG
SIPL4_ARATH/241-527-------------------------------------------------------------------YSIIGFGDIILPG
SIPL2_ARATH/242-525-------------------------------------------------------------------YSIIGFGDILLPG
YL8H_SCHPO/31-282-------------------------------------------------------------------LSMLGLGDIVMPG
YKK0_YEAST/145-510-------------------------------------------------------------------FSILGLGDIALPG
SPPL3_MOUSE/60-374-------------------------------------------------------------------FSMLGIGDIVMPG
IMP2_CAEEL/55-450-------------------------------------------------------------------HSMLGLGDIVIPG
HM13_MOUSE/62-350-------------------------------------------------------------------FAMLGLGDIVIPG
Q93346_CAEEL/275-601-------------------------------------------------------------------FTILGLGDIVMPG

PF06550

Q9HM09_THEAC/1-278-------------------------------------------------------------------VLMIGFGDIALPS
Q9HQ23_HALSA/15-306-------------------------------------------------------------------AYFIGLGDAVMPS
Q8TIY9_METAC/27-303-------------------------------------------------------------------.FFMGLGDAVMPT

PF01080

D3B5F5_POLPA/149-528...................................................................GIKLGLGDFVFYS
G4VJ47_SCHMA/58-484..........DTLVAGRPNRWQELQADLIDRDS..............................K...GVKLGLGDFVFYS
T1KI16_TETUR/103-479...............................EE..............................R...GVKLGLGDFIFYS
K7J3W8_NASVI/92-490...............................EE..............................R...GVKLGLGDFIFYG
A0A068XH02_HYMMI/46-488.............LETPNEWLRDVQEDVIDRED..............................R...GVKLGLGDFVFYS
W5JK58_ANODA/96-499...............................EE..............................R...GIKLGLGDFIFYS
E9FSB0_DAPPU/62-438...............................EE..............................R...GIKLGLGDFIFYS
C3Z2C5_BRAFL/88-496...............................EE..............................R...GVKLGLGDFIFYS
H2TY46_TAKRU/29-412...............................QA..............................G...GVKLGLGDFIFYS
H3AT04_LATCH/77-455...............................EE..............................S...TYSFALG...LLS
I1HEG8_BRADI/69-507...................................................................GIKLGLGDFVFYS
W4XU10_STRPU/68-474...............................EE..............................R...GVKLGLGDFIFYS
G7Y344_CLOSI/42-431................AASRWRQIHLDLRDREE..............................R...GVKLGLGDFVFYS
B7Q2V0_IXOSC/41-421...............................EE..............................R...GVKLGLGDFIFYS
PSN1_RAT/76-458...............................EE..............................R...GVKLGLGDFIFYS
T1JMG4_STRMM/67-438...............................EE..............................R...GVKLGLGDFIFYS
T1G6P3_HELRO/9-376...................................................................GIKLGLGDFIFYS
D7LLE1_ARALL/15-389...................................................................AIKLGLGDFIFYS
A2G9L8_TRIVA/13-428...................................................................GVKLGLGDFIFYG
F6RA92_CIOIN/37-422...............................ED..............................K...GVKLGLGDFIFYS
I3IV36_ORENI/95-480...............................EE..............................R...GVKLGLGDFIFYS
H2Z6F8_CIOSA/7-395...............................ED..............................K...GVKLGLGDFIFYS
K1PKB7_CRAGI/84-479...............................EE..............................R...GVKLGLGDFIFYG
S2K404_MUCC1/83-504...................................................................GLKLGLGDFVFYS
H3FRQ2_PRIPA/66-481..........SRARTAGDRRVVSESRSTEEVEE..............................R...GIKLGLGDFIFYS
E0VJ41_PEDHC/87-467...............................EE..............................R...GVKLGLGDFIFYS
E2AIY0_CAMFO/93-484...............................EE..............................R...GVKLGLGDFIFYS
F4PRZ5_DICFS/219-583...................................................................KIQLGLGDLVFYS
B0WS38_CULQU/61-516...............................EE..............................R...GIKLGLGDFIFYS
A0A068YDE2_ECHMU/45-476...........EQPESANDHLRDLQENVIEREE..............................R...GVKLGLGDFIFYS
E2BSL4_HARSA/95-504...............................EE..............................R...GVKLGLGDFIFYS
H9J5W9_BOMMO/68-456...............................EE..............................K...GVKLGLGDFIFYS
G3Q8S2_GASAC/77-448...............................ED..............................R...GVKLGLGDFIFYS
F6GSZ0_VITVI/15-427...................................................................AIKLGLGDFIFYS
B4QRZ4_DROSI/98-517...............................EE..............................R...GIKLGLGDFIFYS
SPE4_CAEEL/11-464..........TAEECDQKEWDDLVSNS....LPNNDKRPATAADALNDG.................EVLRLGFGDFVFYS
C7J054_ORYSJ/30-449...................................................................AIKLGLGDFIFYS
T1HN85_RHOPR/7-402...............................EE..............................R...GVKLGLGDFIFYS
A9S846_PHYPA/9-467...................................................................AIKLGLGDFVFYS
E3N426_CAERE/9-463..........TAEEVAPEEWNELMEQQEKQAEFDQRYVPVTAADALNDG.................ETVRLGFGDFVFYS
D8LTV7_ECTSI/63-572WRTVQAEKKLELFSPVPTSSRAAAAAENDEDEE..............................EMGVSIKLGLGDFVFYS
H3CB70_TETNG/22-406...............................QQ..............................G...GVKLGLGDFIFYS
G2J6Q7_CAEBR/9-477..........TAAECAPEEWNELIHQQN...EFDQNDATVTAADALNDGVKSKNSGRLFSEICRFPETVRLGFGDFVFYS
I1N8G3_SOYBN/8-407...................................................................GIKFGLGDFVFYS
G3W888_SARHA/88-452...............................EE..............................R...GVKLGLGDFIFYS
PSN_CAEEL/44-434...............................EE..............................R...GVKLGLGDFIFYS
F2CQD9_HORVD/22-450...................................................................GIKLGLGDFVFYS
W5N759_LEPOC/69-512...............................KE.................LGVGDADALCLPG....GVKLGLGDFIFYS
Q7PR98_ANOGA/98-513...............................EE..............................R...GIKLGLGDFIFYS
M1CAI2_SOLTU/15-421...................................................................AIKLGLGDFIFYS
W1NQ31_AMBTC/9-446...................................................................GIKLGLGDFIFYS
K3WL66_PYTUL/82-563IFHKYRVCSCSIEIPCAVQARQDAKRRAAEEED..............................DDDKTIKLGLGDFIFYS
A2DZ73_TRIVA/13-381...................................................................GIKLGLGDFVFYG
G0NCU3_CAEBE/9-464..........TADECAPEEWNQLVQE.....VVPEAKAQVTAADALNDG.................ETVRLGFGDFVFYS
U9UMQ1_RHIID/178-561...................................................................GLKLGLGDFVFYS
T1EFZ6_HELRO/89-576..........RLGHPESFEQFKQQVARLDKMED..............................S...GVKLGLGDFIFYS
B7QGI2_IXOSC/14-384...................................................................GMKMGLGDFIFYS
A0A0H5S0W0_BRUMA/94-527..........P....................DE..............................K...GIKLGLGDFIFYS
S2J107_MUCC1/49-424...................................................................AIKLGLGDFIFYS
D3B4U3_POLPA/99-477...................................................................SLKLGLGDFVFYS
H2VWC4_CAEJA/11-477..........TAEECDMETWQQLVNEANA..KQGDNKSNLTAADALNDG.................ETVRLGFGDFVFYS
A9VBA9_MONBE/203-602..........D....................DS..................................GVKLGLGDFIFYS
F2TYS0_SALR5/109-504..........D....................EE.................H............T...GVKLGLGDFIFYS
E1G929_LOALO/15-397...............................EQRNDGTKFTVYDALNDGS.................SVRLGMGDFVFYS
H3FRQ2_PRIPA/544-933..........E....................EE..............................S...GVKLGLGDFIFYS

PF01478

C9R6J1_AGGAD/91-199-------------------------------------------------------------------..ALGRGDYWLAL
FLAK_METJA/5-130-------------------------------------------------------------------..GVGGGDGKLIM
FLAK_METMP/5-130-------------------------------------------------------------------..GIGGGDGKILI
LEP4_BACSU/100-204-------------------------------------------------------------------..GVGGGDIKLFA
Q9HWA5_PSEAE/4-110-------------------------------------------------------------------..RLGAADVKYLA
Q8FME5_COREF/77-189-------------------------------------------------------------------PAGLGLGDVKFAA
Q9CPF6_PASMU/89-199-------------------------------------------------------------------..LLGKGDYWLML
Q9RSQ9_DEIRA/109-347-------------------------------------------------------------------PVAMGFGDVKLAA
Q97HN8_CLOAB/64-168-------------------------------------------------------------------..VIGLGDVEIFI
Q8XQX7_RALSO/14-117-------------------------------------------------------------------..WMGAGDVKFFA
LEP4_HAEIN/90-200-------------------------------------------------------------------..AFGRGDYWLAM
Q8TMQ5_METAC/5-101-------------------------------------------------------------------..CFGGGDAKSLI
Q8NQ30_CORGL/4-110-------------------------------------------------------------------..GIGGGDIKLAL
Q98BF9_RHILO/11-116-------------------------------------------------------------------..GMGGGDAKLLA
Y421_METTH/12-138-------------------------------------------------------------------..AWAGGDVKLFT
Q8CXM1_OCEIH/104-208-------------------------------------------------------------------..GMGAGDMKLLG
A9CKJ3_AGRFC/8-113-------------------------------------------------------------------..VMGGGDAKLLT
Q8TXH1_METKA/6-112-------------------------------------------------------------------..VLGGGDVKLLP
Q8DLL0_THEEB/89-199-------------------------------------------------------------------..VMGGGDGKLAA
YC8A_METJA/6-148-------------------------------------------------------------------..FMGGGDCKFLM
Q9XAP1_STRCO/112-224-------------------------------------------------------------------PAGMGFGDVKLAL
LEP4_MYXXD/113-222-------------------------------------------------------------------..ALGAGDKYLVA
LEP4_XANCP/133-242-------------------------------------------------------------------..GMGHGDFKLLA
Q8TLD4_METAC/26-152-------------------------------------------------------------------..AFGGGDAKGLL
O67535_AQUAE/105-214-------------------------------------------------------------------..GLGFGDVILLG
Q988A4_RHILO/13-122-------------------------------------------------------------------..GLGLGDVKMLA
Q8XVK3_RALSO/140-249-------------------------------------------------------------------..GMGYGDFKLMG
Q87I88_VIBPA/13-110-------------------------------------------------------------------..IVGGGDVKLIG
Q8F6L1_LEPIN/127-232-------------------------------------------------------------------..GIGFGDVLFAP
Q891G5_CLOTE/115-221-------------------------------------------------------------------..GMGWGDVEVIF
Q9K8H1_BACHD/15-120-------------------------------------------------------------------PNGIGGGDVKLFT
LEP4_PSEAE/136-245-------------------------------------------------------------------..GMGYGDFKLLA
Q8XI34_CLOPE/100-206-------------------------------------------------------------------..AMGSGDIEIHA
Q8EJP8_SHEON/157-266-------------------------------------------------------------------..GMGYGDFKLLA
Q9CMH2_PASMU/11-110-------------------------------------------------------------------..VMGAGDIKLMS
Q92T43_RHIME/12-117-------------------------------------------------------------------..VMGGGDAKLLT
HOPD_SALTY/9-119-------------------------------------------------------------------..GLGYGDVKYLA
Q8FT27_COREF/8-114-------------------------------------------------------------------..GIGGGDIKFAL
Q8THK9_METAC/8-134-------------------------------------------------------------------..VFGGADAKALI
Q8RAF7_CALS4/104-208-------------------------------------------------------------------GGEMGGGDVKLMA
PPPA_ECOLI/130-240-------------------------------------------------------------------..ALGMGDVLLFA
Q92YL6_RHIME/12-116-------------------------------------------------------------------..WIGGGDAKLLP
Q89PI9_BRADU/13-114-------------------------------------------------------------------..GIGGGDVKLLT
Q89UH6_BRADU/9-113-------------------------------------------------------------------..WVGGGDAKVAA
Q87M36_VIBPA/5-111-------------------------------------------------------------------..AMAGGDVKLLA
Q8Y6Y1_LISMO/101-204-------------------------------------------------------------------..GIGLGDIKILI
Q89HG8_BRADU/40-149-------------------------------------------------------------------RDGLGLGDVKLAA
Q8YXA0_NOSS1/108-226-------------------------------------------------------------------..AMGAGDAKLAA
Q9X222_THEMA/103-204-------------------------------------------------------------------RDGLGAGDVILAM
LEP4_VIBCH/112-221-------------------------------------------------------------------..VMGGGDIKLYT
Q989C3_RHILO/11-122-------------------------------------------------------------------..KVGAGDVKLMA
LEP4_ECOLI/81-190-------------------------------------------------------------------..GLGYGDFKLLA
Q9ABP2_CAUCR/121-230-------------------------------------------------------------------..GMGGGDPRLLG
Q8Y1N3_RALSO/10-114-------------------------------------------------------------------..GMGAGDVKLMG
Q88QB9_PSEPK/4-110-------------------------------------------------------------------..RFGADDVKLMG
Y83C_METJA/9-115-------------------------------------------------------------------..GMGGGDVKLFT
Q87VV0_PSESM/5-111-------------------------------------------------------------------..RLGAADVKLMT
O29326_ARCFU/8-129-------------------------------------------------------------------..AYGGADAKAIM
Q97FF6_CLOAB/100-211-------------------------------------------------------------------..AFGSGDAEVLL
Q8RHE5_FUSNN/7-119-------------------------------------------------------------------..VFGFDDIKLII
Q980Y8_SULSO/10-125-------------------------------------------------------------------..LLGGADLFLNV
Q8R8E5_CALS4/6-111-------------------------------------------------------------------..QLGGGDVKLLT
LEP4_SYNY3/108-223-------------------------------------------------------------------..GMGDGDPKLAS
A0KPV9_AERHH/142-247-------------------------------------------------------------------..GMGYGDFKLLA
A5EXL5_DICNV/138-247-------------------------------------------------------------------..GMGYGDFKLLA
A9H675_GLUDA/111-216-------------------------------------------------------------------HDGLGGGDAKLLA
C9R2X4_AGGAD/10-108-------------------------------------------------------------------..FIGAGDIKLAS
E0SLF4_DICD3/139-243-------------------------------------------------------------------..ALGQGDFKLLA
G1UB88_HAEDU/13-108-------------------------------------------------------------------..VIGAGDAKLMA
H7C7G6_CAUCR/11-113-------------------------------------------------------------------..WIGGGDGKLFA
H9L4S3_VIBCH/135-244-------------------------------------------------------------------..GMGYGDFKLLA
I6Y9M6_MYCTU/5-108-------------------------------------------------------------------..AMGAGDVKLAI
LEP4_BURPS/162-269-------------------------------------------------------------------..GIGYGDLKLLA
Q0WIM7_YERPE/129-236-------------------------------------------------------------------VDGMGYGDFKLMA
Q5F692_NEIG1/134-242-------------------------------------------------------------------..GMGNGDFKLIA
Q5ZVB6_LEGPH/138-246-------------------------------------------------------------------..GMGHGDFKLFA
Q65GL0_BACLD/102-205-------------------------------------------------------------------..GIGWGDVKLFA
Q7MJZ8_VIBVY/10-109-------------------------------------------------------------------..LLGAGDVKL.A
Q9PAI1_XYLFA/133-241-------------------------------------------------------------------..GMGHGDFKMLA

PF04258

SIPL5_ARATH/240-524LLICFIFR---FDKENNKGVSN.................GYFPWLMF-GYGLG-------LFLTYLGLYVMNGHGQPALL
SPP2A_MOUSE/214-499LLIAYCRR---FDVQTGSS....................IYYISSTI-AYAVG-------MIITFVVLMVMK.TGQPALL
SIP_ARATH/47-323IFVALALR---FDVSRRRQP...................QYFTSAFI-GYAVG-------VILTIVVMNWFQ.AAQPALL
SPP2B_HUMAN/213-505LLVAYCHR---FDIQVQSSR...................VYFVACTI-AYGVG-------LLVTFVALALMQ.RGQPALL
Q9VPQ7_DROME/71-359IFIALLLR---FDDSKKRKTR..................IYFYSTLI-AYFLG-------LLATIFVMHVFK.HAQPALL
Q9VBL1_DROME/96-408LLLCFVLR---YDAYKKAQGVTSDPTLSP..PRGVGSRLTYFHCSLL-GYFLG-------LLTATVSSEVFK.AAQPALL
SIPL4_ARATH/241-527LLVTFALR---YDWLANKRLKS.................GYFLGTMS-AYGLG-------LLITYIALNLMDGHGQPALL
SIPL2_ARATH/242-525LLIAFALR---YDWLANKTLRT.................GYFIWAMV-AYGLG-------LLITYVALNLMDGHGQPALL
YL8H_SCHPO/31-282LMLALMYR---FDLHYYINSTSQPKKHS...........TYFRNTFI-AYGLG-------LGVTNFALYYFK.AAQPALL
YKK0_YEAST/145-510MFIAMCYK---YDIWKWHLDHDDTEFHFL.NWSYVG...KYFITAMV-SYVAS-------LVSAMVSLSIFN.TAQPALL
SPPL3_MOUSE/60-374LLLCFVLR---YDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLI-GYFVG-------LLTATVASRIHR.AAQPALL
IMP2_CAEEL/55-450IFIALLRR---FDYRVVQTTAESKAPQGSLKGR......YYFVVTVV-AYMAG-------LFITMAVMHHFK.AAQPALL
HM13_MOUSE/62-350IFIALLLR---FDISLKKNTH..................TYFYTSFA-AYIFG-------LGLTIFIMHIFK.HAQPALL
Q93346_CAEEL/275-601YLVAHCFT---MNGFSERVRL..................IYGFISVV-GYGIG-------LIVTFLALALMK.TAQPALI

PF06550

Q9HM09_THEAC/1-278IMVVSSAI---YGISHIL.....----------------FFTVLPLA-GGLIG-------MAVLYF.--WNRDRPAPGLP
Q9HQ23_HALSA/15-306IMVASAAF---FLDTPPVVAGIE----------------LAPLTAMA-GTLVG-------LLVLMRM--VFAGRAHAGLP
Q8TIY9_METAC/27-303LLVVSANV---FLEN....GGLS----------------YPVLGAML-GTLVG-------HIFLSIL--VMRGKPQAGLP

PF01080

D3B5F5_POLPA/149-528VLVGRAAY...KEI-------------------------ILVFICFV.AILTG-------LFITLLLLAVYK-RALPALP
G4VJ47_SCHMA/58-484LLIGRATL..DGDA-------------------------VTVVTCYV.AILVG-------MCITVIVLGITR-QALPALP
T1KI16_TETUR/103-479VLVGKASS..YGDW-------------------------NTTLACFV.SILIG-------LCLTLLLLAFFK-KALPALP
K7J3W8_NASVI/92-490VLVGKASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
A0A068XH02_HYMMI/46-488VLIGRASL..DGDI-------------------------LTAISCYV.AILVG-------MCLTIVALAVAR-RALPALP
W5JK58_ANODA/96-499VLVGKASS..YGDW-------------------------NTTIACFV.AILVG-------LCLTLLLLAIFR-KALPALP
E9FSB0_DAPPU/62-438VLVGKASS..YGDW-------------------------NTTIACFV.AILIG-------LCLTLLLLAIFR-KALPALP
C3Z2C5_BRAFL/88-496VLVGKASS..NGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
H2TY46_TAKRU/29-412VLVGKAAAT.GGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
H3AT04_LATCH/77-455YLMGASSQKSNGGR-------------------------NVLVQIFLHAVSLG-------LCLTLLLLAIFK-KALPALP
I1HEG8_BRADI/69-507VLVGRAAM...YDL-------------------------MTVYACYL.AIIAG-------LGCTLILLSICR-HALPALP
W4XU10_STRPU/68-474VLVGKASA..SGDW-------------------------TTTIACFV.AILIG-------LCLTLILLAIFK-KALPALP
G7Y344_CLOSI/42-431LLIGRAAL..DGDV-------------------------ITVATCYV.AILVG-------MCVTIIVLGITR-RALPALP
B7Q2V0_IXOSC/41-421VLVGKASS..YGDW-------------------------NTTIACFV.AILIG-------LCLTLLLLAIFK-KALPALP
PSN1_RAT/76-458VLVGKASATASGDW-------------------------NTTIACFV.AILIG-------LCLTLLLLAIFK-KALPALP
T1JMG4_STRMM/67-438VLVGKASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFQ-KALPALP
T1G6P3_HELRO/9-376LLVGKVSQ..LEEW-------------------------NTTTACFI.SVLIG-------LSLTILLLVLYE-QALPALP
D7LLE1_ARALL/15-389VLVGRAAM...YDL-------------------------MTVYACYL.AIIAG-------LGITLMLLSVYQ-KALPALP
A2G9L8_TRIVA/13-428ILVTRAAR...VGW-------------------------DIAILDIL.AVMDG-------LALTLICLAYFE-RPLPALP
F6RA92_CIOIN/37-422VLVGKASA..TGDW-------------------------NTTIACFV.AILIG-------LCLTLILLAIYR-KALPALP
I3IV36_ORENI/95-480MLVGKASATASGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
H2Z6F8_CIOSA/7-395VLVGKASA..NGDW-------------------------NTTIACFV.AILIG-------LCLTLILLAIYR-KALPALP
K1PKB7_CRAGI/84-479VLVGKASS..NGDW-------------------------NTTLACFV.AILIG-------LCFTLLLLAIFR-KALPALP
S2K404_MUCC1/83-504VLIARAAM...YDW-------------------------ITTVCCTI.AVLTG-------LTATIFLLAIYK-KALPALP
H3FRQ2_PRIPA/66-481VLVGKASE..SADW-------------------------NTIVACYV.AILVG-------LCATLLLLAVFK-KALPALP
E0VJ41_PEDHC/87-467VLVGKASS..YGDW-------------------------NTTVACFV.AILIG-------LCLTLLLLAVFR-KALPALP
E2AIY0_CAMFO/93-484VLVGKASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
F4PRZ5_DICFS/219-583VLLGRAAL...YDL-------------------------GTIFACFV.AILTG-------LFITLILLIVYK-KAIPALP
B0WS38_CULQU/61-516VLVGKASS..YGDW-------------------------NTTIACFV.AILVG-------LCLTLLLLAIFR-KALPALP
A0A068YDE2_ECHMU/45-476LLIGRASL..DGDV-------------------------LTAVACYI.AILVG-------MCLTIVALGVAR-KALPALP
E2BSL4_HARSA/95-504VLVGKASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLVLLAICK-KALPALP
H9J5W9_BOMMO/68-456VLVGKASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAILK-KALPALP
G3Q8S2_GASAC/77-448VLVGKAAAT.GGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
F6GSZ0_VITVI/15-427VLVGRAAM...YDF-------------------------MTVYACYL.AIIAG-------LGVTLMLLAIYQ-KALPALP
B4QRZ4_DROSI/98-517VLVGKASS..YGDW-------------------------TTTIACFV.AILIG-------LCLTLLLLAIWR-KALPALP
SPE4_CAEEL/11-464LLIGQAAA..SGCP-------------------------FAVISAAL.GILFG-------LVVTLTVFSTEE-STTPALP
C7J054_ORYSJ/30-449VLVGRAAM...YDY-------------------------MTVYACYL.AIIAG-------LGITLLLLAFYR-KALPALP
T1HN85_RHOPR/7-402VLVGKASS..NGDW-------------------------NTTLACFV.AILIG-------LSLTLLLLAIFK-KALPALP
A9S846_PHYPA/9-467VLVGRAAM...YDL-------------------------MTVYACYL.AIVAG-------LGATLILLAVWQ-RALPALP
E3N426_CAERE/9-463LLIGQTAT..GGSA-------------------------LAVACSAL.GILFG-------LVATLTVFSSGE-STTPALP
D8LTV7_ECTSI/63-572VLVSKAAL...YGF-------------------------TAWAACVV.VIVFG-------LGATLVLLAVYR-MALPALP
H3CB70_TETNG/22-406VLVGKAAAT.GGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
G2J6Q7_CAEBR/9-477LLIGQAAT..GGCP-------------------------ISVGFAAF.GILFG-------LIATLTVLSSEE-STTPALP
I1N8G3_SOYBN/8-407VLVGRAAM...YDL-------------------------MTVYACYL.AIISG-------LGCTLILLSMCR-KALPALP
G3W888_SARHA/88-452VLVGKAAATASGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAVFK-KALPALP
PSN_CAEEL/44-434VLLGKASS..YFDW-------------------------NTTIACYV.AILIG-------LCFTLVLLAVFK-RALPALP
F2CQD9_HORVD/22-450VLVGRAAM...YDL-------------------------MTVYACYL.AIIAG-------LGCTLILLSICR-HALPALP
W5N759_LEPOC/69-512VLVGKASATASGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALP
Q7PR98_ANOGA/98-513VLVGKASS..YGDW-------------------------NTTIACFV.AILVG-------LCLTLLLLAIFR-KALPALP
M1CAI2_SOLTU/15-421VLVARAAM...YDF-------------------------MTVYACYL.AIIAG-------LGITLMLLAFYQ-KALPALP
W1NQ31_AMBTC/9-446VLVGRAAM...YDL-------------------------LTVYACYI.AIISG-------LGCTLILLSLCN-HALPALP
K3WL66_PYTUL/82-563VLVGRAAI...YDF-------------------------STFAATFI.CIVMG-------LGGTLFLLAVLH-KALPALP
A2DZ73_TRIVA/13-381ILVSRAAR...IGW-------------------------DITILCIF.AVILG-------LSLTLVCLAVWE-RPLPALP
G0NCU3_CAEBE/9-464LLIGQAAT..GGCP-------------------------VAVALAAF.GILFG-------LIVTLTVLSNDE-STTPALP
U9UMQ1_RHIID/178-561VLVAQAAL...FDW-------------------------ITTVACIV.AVLTG-------LNTTIFLLAIYK-KALPALP
T1EFZ6_HELRO/89-576VLVGKASL..LGDW-------------------------NTTVACFI.AILMG-------LCFTLLLLASFR-KALPALP
B7QGI2_IXOSC/14-384ILVGKASR..HGTV-------------------------SAVVICYI.YVVIG-------IILTLALLVIAQ-KPVPALP
A0A0H5S0W0_BRUMA/94-527VLVGKASS..YGDW-------------------------NTTVACYV.AILIG-------LCFTLILLAVFR-KALPALP
S2J107_MUCC1/49-424VLVGKAAK...TDS-------------------------VTLCLCII.AILTG-------LSLTILILTLNR-KALPALP
D3B4U3_POLPA/99-477VLMGRAAM...FDI-------------------------STVFTCFV.AIITG-------LFATLFLLAIFR-KALPALP
H2VWC4_CAEJA/11-477LLIGQAAA..SGCP-------------------------IAVVFAAA.GILFG-------LLVTLTVLSTEE-STTPALP
A9VBA9_MONBE/203-602VLVGKAAT..AHEW-------------------------TTILACYV.AILIG-------LACTLLLLSIFK-KALPALP
F2TYS0_SALR5/109-504VLVGKAAT..ADKW-------------------------TTIAACYV.GILIG-------LACTLLLLSIFR-KALPALP
E1G929_LOALO/15-397LMVGKAAA..THNA-------------------------MCVIGSMV.GILVG-------LIVTLTILSNDD-ETTPALP
H3FRQ2_PRIPA/544-933VLVGMAVKH.SADW-------------------------NTLVACYV.AILMG-------LCATLLLLAVFK-KALPALP

PF01478

C9R6J1_AGGAD/91-199GL----------------------------------------------GVFLP.......AHQF................
FLAK_METJA/5-130GL----------------------------------------------GALIP.......KYNMPIHTPLGAILNYLYLP
FLAK_METMP/5-130GL----------------------------------------------GALVP.......KFQMPIYTSLGTLLNLNYIP
LEP4_BACSU/100-204VI----------------------------------------------GFVLG.......VKML................
Q9HWA5_PSEAE/4-110AL----------------------------------------------GLASD.......PLTV................
Q8FME5_COREF/77-189VV----------------------------------------------GVFLGW....FSWQHV................
Q9CPF6_PASMU/89-199GL----------------------------------------------GSMSH.......FAWL................
Q9RSQ9_DEIRA/109-347VI----------------------------------------------GAFLG.......WERL................
Q97HN8_CLOAB/64-168IC----------------------------------------------GISIG.......FYKS................
Q8XQX7_RALSO/14-117VA----------------------------------------------GLLAG.......WHGL................
LEP4_HAEIN/90-200AL----------------------------------------------GSFIH.......LETL................
Q8TMQ5_METAC/5-101LI----------------------------------------------SLLFP...........................
Q8NQ30_CORGL/4-110GL----------------------------------------------GTAVAALGMQALMVAI................
Q98BF9_RHILO/11-116AT----------------------------------------------AVWMG.......LNIH................
Y421_METTH/12-138AV----------------------------------------------TSLLP.......FQPSLVSYSFLGTAFPVTAS
Q8CXM1_OCEIH/104-208LA----------------------------------------------GIVLG.......VEKI................
A9CKJ3_AGRFC/8-113GA----------------------------------------------AVWYG.......FNIS................
Q8TXH1_METKA/6-112SL----------------------------------------------TLFLH.......RGDRIT..............
Q8DLL0_THEEB/89-199MI----------------------------------------------GAWLG.......WQGL................
YC8A_METJA/6-148GL----------------------------------------------SYLKG.......MFFT................
Q9XAP1_STRCO/112-224TA----------------------------------------------GAVLGW....YGWPTL................
LEP4_MYXXD/113-222ML----------------------------------------------GAFLT.......WRAL................
LEP4_XANCP/133-242AL----------------------------------------------GAWCG.......LKGI................
Q8TLD4_METAC/26-152VL----------------------------------------------SILFP.......LYPIFQFSGEAYPLLGRPLI
O67535_AQUAE/105-214FI----------------------------------------------GSVSG.......VYGV................
Q988A4_RHILO/13-122AA----------------------------------------------SCWIS.......PLLL................
Q8XVK3_RALSO/140-249AL----------------------------------------------GAWFG.......WQAL................
Q87I88_VIBPA/13-110VL----------------------------------------------FLGVN.......DEYM................
Q8F6L1_LEPIN/127-232IY----------------------------------------------AFIAG.......HPWW................
Q891G5_CLOTE/115-221IA----------------------------------------------GLFLG.......IKLC................
Q9K8H1_BACHD/15-120VL----------------------------------------------GFVLG.......WKLT................
LEP4_PSEAE/136-245ML----------------------------------------------GAWGG.......WQIL................
Q8XI34_CLOPE/100-206IA----------------------------------------------GIFLG.......WKLA................
Q8EJP8_SHEON/157-266VF----------------------------------------------GAWLG.......WQML................
Q9CMH2_PASMU/11-110VL----------------------------------------------MLTIP.......HSQI................
Q92T43_RHIME/12-117AS----------------------------------------------AAWFG.......FNES................
HOPD_SALTY/9-119AL----------------------------------------------GAWHC.......WETL................
Q8FT27_COREF/8-114GL----------------------------------------------GTVAATGSVEGWLLAV................
Q8THK9_METAC/8-134VI----------------------------------------------GTLVP.......VYPVLDFYGYTFPLLGFPPV
Q8RAF7_CALS4/104-208LI----------------------------------------------GFFIG.......WKLV................
PPPA_ECOLI/130-240AL----------------------------------------------GGWVG.......ALSL................
Q92YL6_RHIME/12-116VA----------------------------------------------VLWLG.......ADLA................
Q89PI9_BRADU/13-114AL----------------------------------------------AIGFP.......LTGV................
Q89UH6_BRADU/9-113SV----------------------------------------------ALWFG.......FAQL................
Q87M36_VIBPA/5-111VI----------------------------------------------GAWLG.......LSNLWE..............
Q8Y6Y1_LISMO/101-204IL----------------------------------------------STFLG.......FKIG................
Q89HG8_BRADU/40-149VC----------------------------------------------GAWLD...........................
Q8YXA0_NOSS1/108-226MM----------------------------------------------GAWLG.......WRYL................
Q9X222_THEMA/103-204GI----------------------------------------------GFLLS.......PVPS................
LEP4_VIBCH/112-221AI----------------------------------------------GTLIG.......VEFV................
Q989C3_RHILO/11-122VV----------------------------------------------PFLVG.......GNDLVG..............
LEP4_ECOLI/81-190AA----------------------------------------------GAWCG.......WQTL................
Q9ABP2_CAUCR/121-230AI----------------------------------------------GAWVG.......WQGL................
Q8Y1N3_RALSO/10-114AI----------------------------------------------GAFTG.......PLAA................
Q88QB9_PSEPK/4-110AL----------------------------------------------ALATS.......PQYV................
Y83C_METJA/9-115AL----------------------------------------------APIFA.......YPNSFVFY..........IP
Q87VV0_PSESM/5-111AL----------------------------------------------ALASN.......TAYL................
O29326_ARCFU/8-129AL----------------------------------------------AVIFP.......FYPTFNGFPL......LGPS
Q97FF6_CLOAB/100-211MC----------------------------------------------GLFLG.......MKLG................
Q8RHE5_FUSNN/7-119PL----------------------------------------------GGLLY.......LGEINFF.............
Q980Y8_SULSO/10-125IL----------------------------------------------SLANA.......SVISLVPSRF......LVIG
Q8R8E5_CALS4/6-111AL----------------------------------------------AFFFG.......SDI.................
LEP4_SYNY3/108-223MV----------------------------------------------GAWLG.......WPSL................
A0KPV9_AERHH/142-247AL----------------------------------------------GAWLG.......WQAL................
A5EXL5_DICNV/138-247CL----------------------------------------------CAWQG.......AWML................
A9H675_GLUDA/111-216AG----------------------------------------------GAWLG.......PESL................
C9R2X4_AGGAD/10-108VL----------------------------------------------MLAVP.......SDEV................
E0SLF4_DICD3/139-243AL----------------------------------------------GAWLG.......WQAL................
G1UB88_HAEDU/13-108VL----------------------------------------------MLAVP.......PEYT................
H7C7G6_CAUCR/11-113VC----------------------------------------------ALWLG.......WPAA................
H9L4S3_VIBCH/135-244AL----------------------------------------------GAWLG.......WQQL................
I6Y9M6_MYCTU/5-108GL----------------------------------------------GGLTG.......CFGVE...............
LEP4_BURPS/162-269AL----------------------------------------------GAWLG.......WEAL................
Q0WIM7_YERPE/129-236AL----------------------------------------------GAWFG.......VSAV................
Q5F692_NEIG1/134-242AL----------------------------------------------GAWLG.......ISAL................
Q5ZVB6_LEGPH/138-246AF----------------------------------------------GAWLG.......WMYL................
Q65GL0_BACLD/102-205VI----------------------------------------------GMALG.......SRLL................
Q7MJZ8_VIBVY/10-109VI----------------------------------------------CVWMV.......FPNW................
Q9PAI1_XYLFA/133-241AL----------------------------------------------GAWCG.......LKGI................

PF04258

SIPL5_ARATH/240-524YLVPCTLGITV-ILGLVRKELRDLWNYGTQQ
SPP2A_MOUSE/214-499YLVPCTLITVS-VVAWSRKEMKKFWKGSSYQ
SIP_ARATH/47-323YIVPAVIGFLA-SHCIWNGDIKPLLAFDESK
SPP2B_HUMAN/213-505YLVPCTLVTSC-AVALWRRELGVFWTGSGFA
Q9VPQ7_DROME/71-359YLVPACMGTPL-LVALIRGELKVLFAYEDHP
Q9VBL1_DROME/96-408YLVPFTLLPLL-LMAYLKGDLRRMWSEPFIA
SIPL4_ARATH/241-527YIVPFILGTLF-VLGHKRGDLKTLWTTGEPD
SIPL2_ARATH/242-525YIVPFTLGTML-TLARKRDDLWILWTKGEPE
YL8H_SCHPO/31-282YLSPACIVAPL-LTAWYRDELKTLFSFRSET
YKK0_YEAST/145-510YIVPSLLISTI-LVACWNKDFKQFWNFQYDT
SPPL3_MOUSE/60-374YLVPFTLLPLL-TMAYLKGDLRRMWSEPFHS
IMP2_CAEEL/55-450YLVPCCLFVPL-LLAVIRGELSALWNYDESR
HM13_MOUSE/62-350YLVPACIGFPV-LVALAKGEVAEMFSYEESN
Q93346_CAEEL/275-601YLVPSTLFPII-MLALCRGEFLKIWNGVPVE

PF06550

Q9HM09_THEAC/1-278YINTGTIAGFL-IAFLAFRV-----------
Q9HQ23_HALSA/15-306LLNGGAIAGYL-VGAVAAGI-----------
Q8TIY9_METAC/27-303FLNSGAIIGFF-IGVLFSGA-----------

PF01080

D3B5F5_POLPA/149-528IKMKFNKLLLV-SILLIVH...---------
G4VJ47_SCHMA/58-484ISITCGILFYF-VSSATISPFL---------
T1KI16_TETUR/103-479ISIFFGLTFYF-TTSQLVAPFC---------
K7J3W8_NASVI/92-490ISIAFGLIFYF-ATRVIVAPFA---------
A0A068XH02_HYMMI/46-488ISIICGIIFYF-STAAVITPFI---------
W5JK58_ANODA/96-499ISIFFGLIFCF-VTSVIVKPYT---------
E9FSB0_DAPPU/62-438ISITFGLVFYF-ATSKLVAPFA---------
C3Z2C5_BRAFL/88-496ISITFGLIFNF-ATANLVTPFT---------
H2TY46_TAKRU/29-412ISITFGLIFYF-STDFLVQPFM---------
H3AT04_LATCH/77-455ISITFGIIFYF-ATDNLVRPFM---------
I1HEG8_BRADI/69-507ISIMLGVVFYF-LTRLLMEPFV---------
W4XU10_STRPU/68-474ISIAFGLVFYF-CTSNLVFPFT---------
G7Y344_CLOSI/42-431VSVACGILFYF-VTSTVISPFL---------
B7Q2V0_IXOSC/41-421ISITFGLIFYF-ATSSLVQPFA---------
PSN1_RAT/76-458ISITFGLIFYF-ATDYLVQPFM---------
T1JMG4_STRMM/67-438ISITFGLIFYF-LTKEIVQPFA---------
T1G6P3_HELRO/9-376ISVFFGVAFYF-GGYYTIDPFV---------
D7LLE1_ARALL/15-389VSIMLGVVFYF-LARLLLEVFV---------
A2G9L8_TRIVA/13-428FSLALGIIFYL-IGAYTFRGF.---------
F6RA92_CIOIN/37-422ISITFGLVFYF-STDYVVRPYM---------
I3IV36_ORENI/95-480ISIFFGLVFYF-ATDNLVRPFM---------
H2Z6F8_CIOSA/7-395ISITFGLVFYF-STDYVVRPFM---------
K1PKB7_CRAGI/84-479ISITFGLIFNF-TTSLLVQPFA---------
S2K404_MUCC1/83-504ISIAFGMLFYF-VAKTVLVPYV---------
H3FRQ2_PRIPA/66-481ISITAGLIFYF-STTFLITPFT---------
E0VJ41_PEDHC/87-467ISITFGLIFYF-TTKKIVKPFA---------
E2AIY0_CAMFO/93-484ISITFGLTFYF-ATRVIVAPFA---------
F4PRZ5_DICFS/219-583ISIFIGILFFF-STSKLICPFL---------
B0WS38_CULQU/61-516ISIFFGLIFCF-ATSVIVKPFT---------
A0A068YDE2_ECHMU/45-476ISIACGIVFYF-STAVVITPFI---------
E2BSL4_HARSA/95-504ISITFGLTFYF-ATRVIVAPFA---------
H9J5W9_BOMMO/68-456ISITFGLIFYF-ATRSVVKPFA---------
G3Q8S2_GASAC/77-448ISITFGLVFYF-STGFLVQPFM---------
F6GSZ0_VITVI/15-427VSILLGVLFYF-FTRFLLEAFI---------
B4QRZ4_DROSI/98-517ISITFGLIFCF-ATSAVVKPFM---------
SPE4_CAEEL/11-464LPVICGTFCYF-SSMFFWEQLY---------
C7J054_ORYSJ/30-449VSIALGVVFYV-LTRTLLETFV---------
T1HN85_RHOPR/7-402ISITFGLIFYF-TTTEIVQPFS---------
A9S846_PHYPA/9-467ISISLGVIFYF-LARLVMDPFV---------
E3N426_CAERE/9-463LPVICGTFCYF-ISKFVVDQVY---------
D8LTV7_ECTSI/63-572ISIGFGTVFYL-LTRFSIQPYV---------
H3CB70_TETNG/22-406ISITFGLVFYF-STDFLVQPFM---------
G2J6Q7_CAEBR/9-477LPVICGTFCYF-VSRFLVDS..---------
I1N8G3_SOYBN/8-407ISIALGVLFYF-LTRLLMEPFI---------
G3W888_SARHA/88-452ISITFGLIFYF-STDNLVRPFM---------
PSN_CAEEL/44-434ISIFSGLIFYF-CTRWIITPFV---------
F2CQD9_HORVD/22-450ISIMLGVVFYF-LTRLLMEPFV---------
W5N759_LEPOC/69-512ISITFGLVFYF-ATDNLVRPFM---------
Q7PR98_ANOGA/98-513ISIFFGLIFCF-VTSVIVKPFT---------
M1CAI2_SOLTU/15-421VSVLLGVLFYL-LTRLLLETFV---------
W1NQ31_AMBTC/9-446VSITLGVMFYF-LTRLLMEPFV---------
K3WL66_PYTUL/82-563ISIFLATFFYF-WTYYLFVDFC---------
A2DZ73_TRIVA/13-381FSLALGIVFFI-IGAMTFRQFC---------
G0NCU3_CAEBE/9-464VPVICGTFCYF-ISKLVMDQFY---------
U9UMQ1_RHIID/178-561ISIAFGMLFYF-VARNTLVPY.---------
T1EFZ6_HELRO/89-576VSIAFGLIFYF-ATSQVVLPFM---------
B7QGI2_IXOSC/14-384LSISLGMFAYF-STISFVEPFM---------
A0A0H5S0W0_BRUMA/94-527ISIFCGLIFYF-CTRGIITPFC---------
S2J107_MUCC1/49-424ISILLGCITYA-TAYYMTSPM.---------
D3B4U3_POLPA/99-477ISIAFGILFYF-LTRIFLYPFI---------
H2VWC4_CAEJA/11-477VPVLCGTFCYF-TSKFVWENL.---------
A9VBA9_MONBE/203-602ISIFFGLCFFF-LTSEVLDPLI---------
F2TYS0_SALR5/109-504ISIAFGLVFYF-ATSEVLDPLI---------
E1G929_LOALO/15-397VSITIALLLHF-GIYLFVEPFY---------
H3FRQ2_PRIPA/544-933ISITAGLIFYF-ATSFIITPFT---------

PF01478

C9R6J1_AGGAD/91-199...PVFLFLAC.FFGLLYA.-----------
FLAK_METJA/5-130SFPIMVVINAM.FFSITLPI-----------
FLAK_METMP/5-130NFPIMVFINGI.FFMVFLPF-----------
LEP4_BACSU/100-204...AAAFFFSV.LIGALYGA-----------
Q9HWA5_PSEAE/4-110...LYSLAFGC.LLCIALFI-----------
Q8FME5_COREF/77-189...AIGTLLAF.VLNVVVAV-----------
Q9CPF6_PASMU/89-199...PLWLFLAC.VMGLGYVC-----------
Q9RSQ9_DEIRA/109-347...LLAVVVAI.FAGAVLGL-----------
Q97HN8_CLOAB/64-168...IEVLILSI.FLCGIYGI-----------
Q8XQX7_RALSO/14-117...VAIWLVSS.VLAGVHAL-----------
LEP4_HAEIN/90-200...PHFLLLAS.VLGICFSL-----------
Q8TMQ5_METAC/5-101...DPVLIIWIMFISSVIVI-----------
Q8NQ30_CORGL/4-110...VGSSLISV.LLGGIFAA-----------
Q98BF9_RHILO/11-116..LVEYLVVST.LIGGLLTI-----------
Y421_METTH/12-138YPFPLTVIINS.ILALLPFL-----------
Q8CXM1_OCEIH/104-208...ILAFFLAC.IIGSVISI-----------
A9CKJ3_AGRFC/8-113..LVEFLLAVT.LVGGALTV-----------
Q8TXH1_METKA/6-112.TGIDVLFNSI.LLYAPFAL-----------
Q8DLL0_THEEB/89-199...LVTFFLAC.ALGGLMGG-----------
YC8A_METJA/6-148...FIIFLNAI.LFVIPYCI-----------
Q9XAP1_STRCO/112-224...MLGTFAGF.LLGALYGG-----------
LEP4_MYXXD/113-222...LGVLLFAS.MQGAVVGI-----------
LEP4_XANCP/133-242...LPIILISS.LVGAVLGS-----------
Q8TLD4_METAC/26-152GLFTLTVLGNALLLTALIPL-----------
O67535_AQUAE/105-214...FSALFIGS.FLGLLYAL-----------
Q988A4_RHILO/13-122...PVLLFIAS.ASALLFVG-----------
Q8XVK3_RALSO/140-249...PLLVLLSS.VVGLVFGV-----------
Q87I88_VIBPA/13-110...LAAIVAIG.LLGGIQIL-----------
Q8F6L1_LEPIN/127-232...MFFLNASY.IPAVLFTI-----------
Q891G5_CLOTE/115-221...FLLTFLSF.FIGAIISV-----------
Q9K8H1_BACHD/15-120...LVAIMLSS.LCGAIGGG-----------
LEP4_PSEAE/136-245...PLTILLSS.LVGAILGV-----------
Q8XI34_CLOPE/100-206...IINIFLSF.IIGGIIAV-----------
Q8EJP8_SHEON/157-266...PLVILLSS.LVGAFVGI-----------
Q9CMH2_PASMU/11-110...IYFFLFTA.FSGLFLII-----------
Q92T43_RHIME/12-117..LVTFLVYVS.FFGGFLTL-----------
HOPD_SALTY/9-119...PLLVFLAAMLACGGFGV-----------
Q8FT27_COREF/8-114...VGSSLLTL.LLAGVTLS-----------
Q8THK9_METAC/8-134GLFSLTVLENSVLLTAIIPL-----------
Q8RAF7_CALS4/104-208...LLNLLLGV.VLGALAGV-----------
PPPA_ECOLI/130-240...PNVALIAS.CCGLIYAV-----------
Q92YL6_RHIME/12-116...LPFILYTS.VIGAALTV-----------
Q89PI9_BRADU/13-114...IQLLTVTA.LAGGILAL-----------
Q89UH6_BRADU/9-113...MNFLLYAS.LFGGALTL-----------
Q87M36_VIBPA/5-111.ASIGIILAGG.IVGIFYLM-----------
Q8Y6Y1_LISMO/101-204...YYIFFLAI.IMGTIILL-----------
Q89HG8_BRADU/40-149...LATVAAVI.ELAALLAI-----------
Q8YXA0_NOSS1/108-226...LLAGLIAC.TLGALVGV-----------
Q9X222_THEMA/103-204...IFAILIAS.ISGILYAL-----------
LEP4_VIBCH/112-221...PYLFLLSS.IIAFIHWF-----------
Q989C3_RHILO/11-122.FSILLLLFAL.ATAVVVKN-----------
LEP4_ECOLI/81-190...PMILLIAS.LGGIGYAI-----------
Q9ABP2_CAUCR/121-230...PSVLVWAC.VAGLSVAI-----------
Q8Y1N3_RALSO/10-114...LHVGLASC.VAGGVLAV-----------
Q88QB9_PSEPK/4-110...LGTFIGAG.VTVLVWLL-----------
Y83C_METJA/9-115KYILYLIAISM.FIAAVFPM-----------
Q87VV0_PSESM/5-111...LCTFIGAG.VAMLAWAL-----------
O29326_ARCFU/8-129FSFAFSTLANS.VIAAPFLL-----------
Q97FF6_CLOAB/100-211...MFMLFISF.VLAGFVSI-----------
Q8RHE5_FUSNN/7-119LQIYIFYLLVF.SLATLYII-----------
Q980Y8_SULSO/10-125LEPLVIVLYSS.IIILIFSL-----------
Q8R8E5_CALS4/6-111...MVLLLIAG.ITATAYGV-----------
LEP4_SYNY3/108-223...LLTTFIAC.FIGSIYGG-----------
A0KPV9_AERHH/142-247...PIVLLLSS.LVGAFIGI-----------
A5EXL5_DICNV/138-247...PIILFSAA.ILGMIYAL-----------
A9H675_GLUDA/111-216...PHVVFLGA.VLTL....-----------
C9R2X4_AGGAD/10-108...FSFFFFTT.FAGLGLI.-----------
E0SLF4_DICD3/139-243...PNLVLIAS.LTGLAA..-----------
G1UB88_HAEDU/13-108...IFFLFFTT.CAGLGL..-----------
H7C7G6_CAUCR/11-113...LTFMLYTG.LAGGVLT.-----------
H9L4S3_VIBCH/135-244...PVIVLLSS.VVGVIFGL-----------
I6Y9M6_MYCTU/5-108.VWFLAALAAP.LLTAVCG.-----------
LEP4_BURPS/162-269...PQVVLIAA.VAGAAVGL-----------
Q0WIM7_YERPE/129-236...PFLILFSS.FFGLVA..-----------
Q5F692_NEIG1/134-242...PVLIFVSS.LIGLVAA.-----------
Q5ZVB6_LEGPH/138-246...PLILLISS.ITGAIIGL-----------
Q65GL0_BACLD/102-205...VLAFFLSA.AAGTVLGL-----------
Q7MJZ8_VIBVY/10-109...GELILLSA.LGAGVLA.-----------
Q9PAI1_XYLFA/133-241...LPIILISS.LAGVVLG.-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window