Sequence alignment for CL0130

PF04258

SPPL3_MOUSE/60-369STNNSIQTIDSTQALFLPIGASVSLLVMFFFFDSVQ............................................
SPP2A_MOUSE/213-494RKKKDDYLTFSPLTVVVFVVICCIMIVLLYFFYRWL............................................
SPP2B_HUMAN/213-500KQEDEAVDVTPVMTCVFVVMCCSMLVLLYYFYDL..............................................
HM13_MOUSE/62-345SSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQ...EYIN....................................
Q9CAD4_ARATH/241-517DGGSGVVEINSISAIFFVVLASGFLVILYKLMSYWF............................................
Q9LQ94_ARATH/239-595GSKFRTILYSGHPPCSNLLTAKEKCPHSFVIYLKLQDGSDELLQLSTTSSRGVVEVTVISAIL.............FVVV
Q9MA44_ARATH/240-519GAEEETLDISAMGAVIFVISASTFLVLLFFFMSSWF............................................
Q93346_CAEEL/222-596FHRPSGGPFDASFAIIWMISMTCVAGGGIWAFNRHRAGKDVTLASQSVDDDTSSPSNDSETKG..............FLD
O81062_ARATH/47-318KDTPPTETMSKEHAMRFPLVGSAMLLSLFLLFKFLSK...DLVN....................................
Q9VPQ7_DROME/71-354STGEKADTMTKKDAMYFPLIASAALFGLYLFFKIFQK...VHIN....................................
IMP2_CAEEL/55-445KKRLIEGSITMREARKFPISASLVLFGLYLFFKPAAERFLWVARVFQILRVPEEYVQKINSTIISYTANTTTTGPSEPFL
YL8H_SCHPO/25-277EEPEEKQLINKRLAVLFPIFGGVTLVLMYLALRYLSK...EYIQ....................................
Q9VBL1_DROME/96-403EPTDKFATLDTMHALCLPLGASISLLIMFFFFDS..............................................
YKK0_YEAST/145-505KSKRFFDMMDEKHAIILPLTSGCTLLALYFVIKKLHLNWLKYV.VKILNFNITLLNIPAGTFV..............YSY

PF06550

Q97CT3_THEVO/10-286------------MLIFVAASIMALLLAVAVYNSEPS.ISHRSPT------------------------------------
Q9HM09_THEAC/1-278------------MTIFVLSSLLAILLAVAIYNSEPSSYAHRSPT------------------------------------
Q9HQ23_HALSA/15-306------------VALFVVVQVGALALVEPFQSAGLQ..STENPQ------------------------------------
Q8TIY9_METAC/27-303------------AGLILIVQVLALLLSMPMEINDMQ..AFEDPT------------------------------------
Q8PYF3_METMA/18-294------------AGLILIVQILSLLLSTPMETNEMQ..AFEDPT------------------------------------

PF01080

SPE4_CAEEL/5-465RSISSELVRSSQLRWTLFSVIANMSLTLSIWIGVYNMEVNSELSKTYFLDPSFEQTTGNLL-------------------
HOP1_CAEEL/1-349MPRTKRVYSGKTITGVLYPVAICMLFVAINVKLSQPEQQEQS.KVVYGLFHS......YDT-------------------
PSN1_RAT/70-459DEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDG.QLIYTPFTEDTETVGQRA-------------------
PSN_DROME/92-532EEEQGLKYGAQHVIKLFVPVSLCMLVVVATINSISFYNSTDV.YLLYTPFHEQSPEPSVKF-------------------
PSN2_RAT/76-439EEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNG.QLIYTPFTEDTPSVGQRL-------------------
PSN_CAEEL/38-435VEEAELKYGASHVIHLFVPVSLCMALVVFTMNTITFYSQNNGRHLLYTPFVRETDSIVEKG-------------------

PF01478

LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
Q8VQ80_BACLI/101-205--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
LEP4_NEIGO/134-243--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8GBD6_YEREN/122-231--------------------------------------------------------------------------------
Q8E192_STRA5/8-102--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
P94648_CHLLI/90-200--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
LEP4_PECCC/135-244--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRT5/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
HOPD_ECOLX/9-119--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q9ZIU7_SALTI/78-184--------------------------------------------------------------------------------
LEP4_AERSA/139-248--------------------------------------------------------------------------------
Q8ZWV8_PYRAE/8-110--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Y902_METJA/9-134--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q8DA80_VIBVU/9-110--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q9S5E3_ECOLX/119-229--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q8KYA3_STAAU/91-187--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q933W3_ECOLX/68-175--------------------------------------------------------------------------------
Q8DVF1_STRMU/96-190--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8CNZ3_STAES/98-194--------------------------------------------------------------------------------
Q87AA6_XYLFT/133-242--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_THETN/104-208--------------------------------------------------------------------------------
LEP4_BURPS/126-235--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q8K6R2_STRP3/88-182--------------------------------------------------------------------------------
Q8VRL2_THETH/101-317--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRAJA/13-114--------------------------------------------------------------------------------
Q89UH6_BRAJA/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
O66151_AGGAC/10-109--------------------------------------------------------------------------------
O07379_9ZZZZ/78-183--------------------------------------------------------------------------------
O32576_ECOLX/98-207--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
O68839_VIBCL/134-244--------------------------------------------------------------------------------
Q57382_ECOLX/116-222--------------------------------------------------------------------------------
Q9L719_CAUCE/10-114--------------------------------------------------------------------------------
Q89HG8_BRAJA/40-149--------------------------------------------------------------------------------
Q8X252_METMI/5-130--------------------------------------------------------------------------------
Q8DNN1_STRR6/96-190--------------------------------------------------------------------------------
LEP4_ERWCH/136-245--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
Q8NKW5_METVO/5-130--------------------------------------------------------------------------------
Q92BG4_LISIN/101-204--------------------------------------------------------------------------------
Q9CE22_LACLA/97-191--------------------------------------------------------------------------------
Q8CZX6_YERPE/153-262--------------------------------------------------------------------------------
Q8PWB1_METMA/12-138--------------------------------------------------------------------------------
P95002_MYCTU/4-113--------------------------------------------------------------------------------
LEP4_LEGPN/135-244--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_DICNO/138-247--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q04904_ECOLX/71-179--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q93R20_GLUDI/111-221--------------------------------------------------------------------------------
LEP4_KLEPN/124-227--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q8KRY3_AGGAC/90-200--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q8KQJ2_HAEDC/11-110--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_THETN/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------

PF04258

SPPL3_MOUSE/60-369.................VVFTICTAVLATI...................AFAFLLLPMCQYLTR..............PC
SPP2A_MOUSE/213-494................VYVMIAIFCIASSMS....................LYNCLSALIH..................R
SPP2B_HUMAN/213-500...............LVYVVIGIFCLASATG....................LYSCLAPCVRRLPFGKC...........R
HM13_MOUSE/62-345...............L..LLSMYFFVLGIL...................ALSHTIS.PFMN..KFFPA...........N
Q9CAD4_ARATH/241-517................VELLVVVFCIGGVE...................GL.QTCLVALLSRWFQRAA............
Q9LQ94_ARATH/239-595ASCFLIMLYKLMSFWFIEVLVVLFCIGGVE.....................QYLIEPSCTDVESFVGAIRGCKLVWSLYS
Q9MA44_ARATH/240-519................ILILTIFFVIGGMQG....................MHNINVTLITRRCS..............K
Q93346_CAEEL/222-596RFGGIITICLMMTTLCGVLLLGYFFRPVLV....................IFFNIFLVIFGTCSLYGCIRGFLSNFKFVG
O81062_ARATH/47-318...............A..VLTAYFFVLGIV...................ALSATLL.PAIR..RFLP.NPWN.DNLIVWR
Q9VPQ7_DROME/71-354...............Y..LLTGYFFVLGVI...................ALAHLLS.PVIN..SLMPA...........A
IMP2_CAEEL/55-445LRLASRIPQERVPEAIQNAATYAYTNLPTIQKAECMQLLTFLICFEGVNAFASLLKPFVTAFLKKMPLVPSFLRFNAPYL
YL8H_SCHPO/25-277...............L..ILQGYASLASII...........................CFVR...................
Q9VBL1_DROME/96-403...................MQLLFAVCTAIIA...............TVALAFLLLPMCQYIIR..............PC
YKK0_YEAST/145-505FLNSLFRNLSHLASWNPLVVLPRYRVTIADD.................NEDLNKIGGFVTNLNYKDGLTNSVVHKKTLDE

PF06550

Q97CT3_THEVO/10-286---------------YGLSYIFVYIVAAFL---------------------FS.FVIIYLGRRKKLRIFRIIYSVVVAYV
Q9HM09_THEAC/1-278---------------YGIGYVFVYIIAAFL---------------------FS.FVIIYLGRKKKLRIFKVIYSIVVAYV
Q9HQ23_HALSA/15-306---------------NPLNSVV.YVAFLLV---------------------ATGGILLVIKYDKQWILRGVVLVTSGL.V
Q8TIY9_METAC/27-303---------------QVSNSIY.YIVMILV---------------------FTLFVLIAIKKNMKWIISLLIYLAIVS.T
Q8PYF3_METMA/18-294---------------QVSNSIY.YIVMILT---------------------FTLFVLIAIKKNMKWVISLLIYLAILS.T

PF01080

SPE4_CAEEL/5-465---------------LDGFINGVGTILVLG--------------------CVSFIMLAFVLFDFRRIVKAWLTLSCLLIL
HOP1_CAEEL/1-349---------------ADSGTITLYLIGFLI--------------------LTTSLGVFCYQMKFYKAIKVYVLANSIGIL
PSN1_RAT/70-459---------------LHSILNAAIMISVIV--------------------VMTILLVVLYKYRCYKVIHAWLIVSSLLLL
PSN_DROME/92-532---------------WSALANSLILMSVVV--------------------VMTFLLIVLYKKRCYRIIHGWLILSSFMLL
PSN2_RAT/76-439---------------LNSVLNTLIMISVIV--------------------VMTIFLVVLYKYRCYKFIHGWLIMSSLMLL
PSN_CAEEL/38-435---------------LMSLGNALVMLCVVV--------------------LMTVLLIVFYKYKFYKLIHGWLIVSSFLLL

PF01478

LEP4_BACSU/100-204---------------VVFISLLIIV..AVT--------------------------------------------------
Q9HWA5_PSEAE/4-110---------------LALALWASVC..GYQ--------------------------------------------------
Q8FME5_COREF/77-189---------------AAAAVGCTLL..MVI--------------------------------------------------
Q9CPF6_PASMU/89-199---------------ASYVSIAICI..AVI--------------------------------------------------
Q9RSQ9_DEIRA/109-347---------------MVLFTILLVG..SAI--------------------------------------------------
Q97HN8_CLOAB/64-168---------------CVIATMLFLA..ALI--------------------------------------------------
Q8XQX7_RALSO/14-117---------------VVLAVLVITS.....--------------------------------------------------
Q8VQ80_BACLI/101-205---------------LALISLLLIV..FVS--------------------------------------------------
LEP4_HAEIN/90-200---------------GLTLIILWTI..SYL--------------------------------------------------
LEP4_NEIGO/134-243---------------LILTAFLISL..TFI--------------------------------------------------
Q8TMQ5_METAC/5-101---------------ILISLFLVLA..CYT--------------------------------------------------
Q8GBD6_YEREN/122-231---------------LLLSWTLIAL..TMI--------------------------------------------------
Q8E192_STRA5/8-102---------------FISLCMSFIL..SYY--------------------------------------------------
Q8NQ30_CORGL/4-110---------------FLVGLWCAVL..AVI--------------------------------------------------
Q98BF9_RHILO/11-116---------------VVFPFCMLFA..AIS--------------------------------------------------
P94648_CHLLI/90-200---------------AGFASTLLLL..ALI--------------------------------------------------
Y421_METTH/12-138---------------FIALLACFYA..SYS--------------------------------------------------
LEP4_PECCC/135-244---------------LILLSFLLVL..TVI--------------------------------------------------
Q8CXM1_OCEIH/104-208---------------LLLTSLLVII..CIS--------------------------------------------------
A9CKJ3_AGRT5/8-113---------------LILPLCLCFA..ALN--------------------------------------------------
Q8TXH1_METKA/6-112---------------LAGLAVATVA..AIT--------------------------------------------------
Q8DLL0_THEEB/89-199---------------WLLSAWLLAL..ALI--------------------------------------------------
YC8A_METJA/6-148---------------LYGLICSIYG..AVE--------------------------------------------------
HOPD_ECOLX/9-119---------------ILYACLSVLL..FLW--------------------------------------------------
Q9XAP1_STRCO/112-224---------------LLLAPVGVLL..AVV--------------------------------------------------
LEP4_MYXXD/113-222---------------LVLVSLLVPL..AFI--------------------------------------------------
LEP4_XANCP/133-242---------------IVLSCFLVAM..SGI--------------------------------------------------
Q9ZIU7_SALTI/78-184---------------LFMCSFLLQL..GVM--------------------------------------------------
LEP4_AERSA/139-248---------------LLLTWVLVAL..TFI--------------------------------------------------
Q8ZWV8_PYRAE/8-110---------------IALGVVLAAA..SWQ--------------------------------------------------
Q8TLD4_METAC/26-152---------------LFAMAFLLYS..CYS--------------------------------------------------
O67535_AQUAE/105-214---------------YFFFSALLVM..SII--------------------------------------------------
Q988A4_RHILO/13-122---------------IALAVVLGAI..SIA--------------------------------------------------
Y902_METJA/9-134---------------IVGAIGLLIA..SIY--------------------------------------------------
Q8XVK3_RALSO/140-249---------------AALLWFLIAG..SMI--------------------------------------------------
Q87I88_VIBPA/13-110---------------LVNVLLIFYG.....--------------------------------------------------
Q8F6L1_LEPIN/127-232---------------LFLCGHLLIS..CLT--------------------------------------------------
Q891G5_CLOTE/115-221---------------SIFICFLIIV..SVI--------------------------------------------------
Q8DA80_VIBVU/9-110---------------IALLLLLAMV..VLS--------------------------------------------------
Q9K8H1_BACHD/15-120---------------LALVSLFSII..FVS--------------------------------------------------
LEP4_PSEAE/136-245---------------LLLTWGLLAM..SLI--------------------------------------------------
Q8XI34_CLOPE/100-206---------------IVLITFLIVI..SFI--------------------------------------------------
Q9S5E3_ECOLX/119-229---------------LFLFSILLCL..AVI--------------------------------------------------
Q8EJP8_SHEON/157-266---------------AILTFVLIAL..TGI--------------------------------------------------
Q8KYA3_STAAU/91-187---------------ITTYVFLLIF..TMT--------------------------------------------------
Q9CMH2_PASMU/11-110---------------CITMILLIIL..SWT--------------------------------------------------
Q92T43_RHIME/12-117---------------VVFPFSLALA..ALS--------------------------------------------------
HOPD_SALTY/9-119---------------IFYASFSLLL..GIY--------------------------------------------------
Q933W3_ECOLX/68-175---------------LLMAGCMTLM..TLT--------------------------------------------------
Q8DVF1_STRMU/96-190---------------VCLLFMGVLL..SLY--------------------------------------------------
Q8FT27_COREF/8-114---------------AVFVVWVGVL..AAW--------------------------------------------------
Q8CNZ3_STAES/98-194---------------LITFLFLLTM..CLY--------------------------------------------------
Q87AA6_XYLFT/133-242---------------IVFSCFLVAL..AGI--------------------------------------------------
Q8THK9_METAC/8-134---------------AACLPFLLYS..SYL--------------------------------------------------
Q8RAF7_THETN/104-208---------------MFLSSVLISA..SFI--------------------------------------------------
LEP4_BURPS/126-235---------------FGLCAALLAM..SAI--------------------------------------------------
PPPA_ECOLI/130-240---------------MILSAWLIAA..SVI--------------------------------------------------
Q8K6R2_STRP3/88-182---------------CYLLLFSLLF..SLF--------------------------------------------------
Q8VRL2_THETH/101-317---------------FLFLAFLVAL..AFI--------------------------------------------------
Q92YL6_RHIME/12-116---------------LLFAGAMTYA..GIR--------------------------------------------------
Q89PI9_BRAJA/13-114---------------LLQILLLLYV..ATI--------------------------------------------------
Q89UH6_BRAJA/9-113---------------LLFPALMAFA..AAS--------------------------------------------------
Q87M36_VIBPA/5-111---------------LVIWSLLIAI..GVS--------------------------------------------------
O66151_AGGAC/10-109---------------IIMLLLLITL..SIT--------------------------------------------------
O07379_9ZZZZ/78-183---------------VLILSFILQM..AVT--------------------------------------------------
O32576_ECOLX/98-207---------------WLFISMLLVL..AVI--------------------------------------------------
Q8Y6Y1_LISMO/101-204---------------YIIYYFLAFF..FIT--------------------------------------------------
O68839_VIBCL/134-244---------------LFFSYVLIAA..TFI--------------------------------------------------
Q57382_ECOLX/116-222---------------SLLFLCLVFL..ALI--------------------------------------------------
Q9L719_CAUCE/10-114---------------LIFPALAIVG..ALK--------------------------------------------------
Q89HG8_BRAJA/40-149---------------AFLAALMLAI..ATH--------------------------------------------------
Q8X252_METMI/5-130---------------IIGVIGLLLA..SVQ--------------------------------------------------
Q8DNN1_STRR6/96-190---------------VILITAGLTL..GIY--------------------------------------------------
LEP4_ERWCH/136-245---------------LLCFGIFVAL..AAI--------------------------------------------------
Q8YXA0_NOSS1/108-226---------------WTFCGWLLAL..SLI--------------------------------------------------
Q9X222_THEMA/103-204---------------CVIASALIAI..SLI--------------------------------------------------
Q8NKW5_METVO/5-130---------------AIGLLGLLIA..SIQ--------------------------------------------------
Q92BG4_LISIN/101-204---------------CIIYYFLAFF..FVT--------------------------------------------------
Q9CE22_LACLA/97-191---------------FLLIILSLIL..SAF--------------------------------------------------
Q8CZX6_YERPE/153-262---------------LVLIWSLTAL..AFI--------------------------------------------------
Q8PWB1_METMA/12-138---------------LFTMPFLLYG..CYT--------------------------------------------------
P95002_MYCTU/4-113---------------AAVLAWMGVL..CVC--------------------------------------------------
LEP4_LEGPN/135-244---------------LLAIWILISL..VFI--------------------------------------------------
LEP4_VIBCH/112-221---------------LGLYFILFNL..FVI--------------------------------------------------
Q989C3_RHILO/11-122---------------ALAIPLLARI..AWL--------------------------------------------------
LEP4_DICNO/138-247---------------LVFTWTLIAL..CFI--------------------------------------------------
LEP4_ECOLI/81-190---------------FLYFCFVLTL..SVI--------------------------------------------------
Q04904_ECOLX/71-179---------------IVFYAFLTLM..ACI--------------------------------------------------
Q9ABP2_CAUCR/121-230---------------ALMGWSLLLI..ATI--------------------------------------------------
Q93R20_GLUDI/111-221---------------CLFGWWLLVL..AAI--------------------------------------------------
LEP4_KLEPN/124-227---------------LILLSLLLIL..AAI--------------------------------------------------
Q8Y1N3_RALSO/10-114---------------LSLLVLVVTA..AVH--------------------------------------------------
Q88QB9_PSEPK/4-110---------------IVLLLWLALC..SEQ--------------------------------------------------
Y83C_METJA/9-115---------------IINFILLLLA..AIT--------------------------------------------------
Q8KRY3_AGGAC/90-200---------------ALYGALLIVI..SLV--------------------------------------------------
Q87VV0_PSESM/5-111---------------FFLLVWFAIC..AEQ--------------------------------------------------
O29326_ARCFU/8-129---------------LVVLGFLLYA..CKL--------------------------------------------------
Q8KQJ2_HAEDC/11-110---------------SFIVLLLIWL..SYT--------------------------------------------------
Q97FF6_CLOAB/100-211---------------IVLFSFLFII..SII--------------------------------------------------
Q8RHE5_FUSNN/7-119---------------ILLYILLFLV..MYI--------------------------------------------------
Q980Y8_SULSO/10-125---------------FLSIIMLIHT..SIL--------------------------------------------------
Q8R8E5_THETN/6-111---------------LSLPVVVLTAYAAWT--------------------------------------------------
LEP4_SYNY3/108-223---------------WILISFLISL..TLI--------------------------------------------------

PF04258

SPPL3_MOUSE/60-369SPQNKISF........------------------............GCCGRFTAA-------ELLSF-----SLSVMLVL
SPP2A_MOUSE/213-494MPCGQCTI........------------------.....L......CCGKNIKVS-------LIFLS-----GLCISVAV
SPP2B_HUMAN/213-500IPNNSLPY........------------------.............FHKRPQAR-------MLLLA-----LFCVAVSV
HM13_MOUSE/62-345FPNRQYQL......LF------------------TQGSGENK..EEIINYEFDTK-------DLVCL-----GLSSVVGV
Q9CAD4_ARATH/241-517..DTYVKV........------------------............PFLGPISYL-------TLAVS-----PFCIVFAV
Q9LQ94_ARATH/239-595HGMYSSSLIN..IFLW------------------FRRFGESY.VKVPFLGAVSYL-------TLAIC-----PFCIAFAV
Q9MA44_ARATH/240-519CGQKNLKL........------------------............PLLGNTSIL-------SLVVL-----LFCFVVAI
Q93346_CAEEL/222-596HRWYNAKM.....EWF------------------PTCGGR........IHQYKYS-------EAFIG-----IICLSFCV
O81062_ARATH/47-318FPYFKS..........------------------.............LEVEFTKS-------QVVAG-----IPGTFFCA
Q9VPQ7_DROME/71-354VPKVPFHI......LF------------------TKGEGKHK..EDIVNYKFSTH-------DIVCL-----VISSAIGV
IMP2_CAEEL/55-445FSLKKGNKE...MEEG------------------DIEDAKKKETEYLFKIDFDRY-------DIIAL-----LMCSPILI
YL8H_SCHPO/25-277................------------------............SFNPKTTFG-------KITAT-----MSSIAIAL
Q9VBL1_DROME/96-403TDGKRFSF........------------------............GFCGRFTAA-------ELFSF-----TLSVSIVC
YKK0_YEAST/145-505IEKDHWMKHFYRRELV------------------EPKDIKSK..RQISNMYLNSA-------LIVSF-----VLSIVSTV

PF06550

Q97CT3_THEVO/10-286IFYVFLIL--------------------------------------LSIFLDNLY-------AILAI-----SVAIAISY
Q9HM09_THEAC/1-278IFYVFLIL--------------------------------------LSIFLYNVY-------AIFTV-----SIVVAIVF
Q9HQ23_HALSA/15-306ASYVFAVA--------------------------------------IPAV.VVAG-------.VNLA-----VWGPALAL
Q8TIY9_METAC/27-303LYYVFFAL--------------------------------------FTLIPALAG-------LENIA-----SLLLSIGL
Q8PYF3_METMA/18-294LYYVFFAL--------------------------------------LTLIPSLAG-------LENII-----SILLSTGL

PF01080

SPE4_CAEEL/5-465FGVSAQTLHDMFSQVFDQDDNNQYYMTIVLIVVPTVVYGFGGIYAFFSNSSLILH-------QIFVV-----TNCSLISV
HOP1_CAEEL/1-349LVYSVFHFQRIAEAQS.......IPVSVPTFFFLILQFGGLGITCLHWKSHRRLH-------QFYLI-----MLAGLTAI
PSN1_RAT/70-459FFFSFIYLGEVFKTYN.......VAVDYITVALLIWNFGVVGMIAIHWKGPLRLQ-------QAYLI-----MISALMAL
PSN_DROME/92-532FIFTYLYLEELLRAYN.......IPMDYPTALLIMWNFGVVGMMSIHWQGPLRLQ-------QGYLI-----FVAALMAL
PSN2_RAT/76-439FLFTYIYLGEVFKTYN.......VAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQ-------QAYLI-----VISALMAL
PSN_CAEEL/38-435FLFTTIYVQEVLKSFD.......VSPSALLVLFGLGNYGVLGMMCIHWKGPLRLQ-------QFYLI-----TMSALMAL

PF01478

LEP4_BACSU/100-204----------------------------------------------DIHFMLIPN.......RILIF.....FLPFLAAA
Q9HWA5_PSEAE/4-110----------------------------------------------DIKRLRVSN.......WLILG.....GFLISFVY
Q8FME5_COREF/77-189----------------------------------------------DLAVCRLPD.......RLVAAT..LLALVLGFLA
Q9CPF6_PASMU/89-199----------------------------------------------DWRYQLISV.......QLCYC.....LFWIGVVA
Q9RSQ9_DEIRA/109-347----------------------------------------------DLDTMTLPD.......ELTLP.....GTLLGVLF
Q97HN8_CLOAB/64-168----------------------------------------------DFKTKNVYF.......FITII.....SFLFSTVF
Q8XQX7_RALSO/14-117----------------------------------------------DLRSRRVPN.......WLVAV.....GLVLSIVL
Q8VQ80_BACLI/101-205----------------------------------------------DVTHMIIPD.......AVLCF.....FLPVFAVG
LEP4_HAEIN/90-200----------------------------------------------DWHYQLIST.......TPCLW.....LLTLGLFG
LEP4_NEIGO/134-243----------------------------------------------DADTQYLPD.......SMTLP.....LIWLGLIF
Q8TMQ5_METAC/5-101----------------------------------------------DLRYRRVSN.......RSCFL.....MFVISVPF
Q8GBD6_YEREN/122-231----------------------------------------------DIDHLLLPD.......NLTLP.....LLWAGLLF
Q8E192_STRA5/8-102----------------------------------------------DIKYQEYPI.......FLWIL.....FTISTIIL
Q8NQ30_CORGL/4-110----------------------------------------------DIKYRRLPD.......VLTLP.....GALLI...
Q98BF9_RHILO/11-116----------------------------------------------DMLSMTIAN.......RVSVL.....LVVVFALV
P94648_CHLLI/90-200----------------------------------------------DWDTTLLPD.......WVVLP.....LGLAGLFG
Y421_METTH/12-138----------------------------------------------DIKRGIIPN.......RLTFP.....VIGLGLLL
LEP4_PECCC/135-244----------------------------------------------DIKTLLLPD.......ELTLS.....LLWMGLLF
Q8CXM1_OCEIH/104-208----------------------------------------------DFIYMVIPN.......KLLLF.....FLPIFIIL
A9CKJ3_AGRT5/8-113----------------------------------------------DLFSMTIPN.......VITVV.....LLLSFAFI
Q8TXH1_METKA/6-112----------------------------------------------DLKWGIVPN.......RLTYP.....AIVAGAIY
Q8DLL0_THEEB/89-199----------------------------------------------DLDTMTLPH.......PLTKW.....GLITGLLA
YC8A_METJA/6-148----------------------------------------------DWRKREVTD.......FLWIS.....MLWVGVFI
HOPD_ECOLX/9-119----------------------------------------------DAKHGLLPD.......RFTCP.....LLWSGLLF
Q9XAP1_STRCO/112-224----------------------------------------------DLKVRRLPD.......PLTLPLAGAALVLLGLTA
LEP4_MYXXD/113-222----------------------------------------------DLDHWILPL.......SMTVP.....GMLAGIAL
LEP4_XANCP/133-242----------------------------------------------DLRHKLLPD.......QLTLP.....LMWLGLVG
Q9ZIU7_SALTI/78-184----------------------------------------------DATSGWLPR.......PFTAA.....CLCSGLLF
LEP4_AERSA/139-248----------------------------------------------DLDKMLLPD.......QLTLP.....LLWGGLLF
Q8ZWV8_PYRAE/8-110----------------------------------------------DVRTREIDAWIFAVGALPAAA.....LIYMNFPY
Q8TLD4_METAC/26-152----------------------------------------------DLKARRVSN.......GVWKY.....MLVSGSVF
O67535_AQUAE/105-214----------------------------------------------DWYYFILPP.......GINIG.....GLVLGILV
Q988A4_RHILO/13-122----------------------------------------------DFRRQIIPD.......GLNLA.....LAGIGLSY
Y902_METJA/9-134----------------------------------------------DLKSREIED.......YVWVS.....MVIFGLIY
Q8XVK3_RALSO/140-249----------------------------------------------DADTQLLPD.......AITQP.....LLWLGLLV
Q87I88_VIBPA/13-110----------------------------------------------DIRYRIVKH.......RFLLI.....IFITSLL.
Q8F6L1_LEPIN/127-232----------------------------------------------DAFHFSLDY.......ENLPW.....ILCFGVIS
Q891G5_CLOTE/115-221----------------------------------------------DFKTMYVYF.......SIILI.....TIFLRIGI
Q8DA80_VIBVU/9-110----------------------------------------------DVLKRKIYN.......ANLAV.....LVIVSTYY
Q9K8H1_BACHD/15-120----------------------------------------------DLVYMIIPD.......RIILF.....FAILFVLF
LEP4_PSEAE/136-245----------------------------------------------DADHQLLPD.......VLVLP.....LLWLGLIA
Q8XI34_CLOPE/100-206----------------------------------------------DYDTQDVYA.......VTTYP.....AVILGIIF
Q9S5E3_ECOLX/119-229----------------------------------------------DFDHLLLPD.......SLVYI.....MLWGGLLA
Q8EJP8_SHEON/157-266----------------------------------------------DLDEMLLPD.......QMTLP.....LLWLGLLI
Q8KYA3_STAAU/91-187----------------------------------------------DITSLMLDC.......RLIII.....YCIVSLSL
Q9CMH2_PASMU/11-110----------------------------------------------DIKSRIISN.......KIVFL.....LLLVMV..
Q92T43_RHIME/12-117----------------------------------------------DLLTMTIPN.......RVSLV.....LLVSFFFV
HOPD_SALTY/9-119----------------------------------------------DARTGLLPD.......RFTCP.....LLWGGLLY
Q933W3_ECOLX/68-175----------------------------------------------DATSCRLPR.......PFTLT.....FLMLGVAF
Q8DVF1_STRMU/96-190----------------------------------------------DLQDQSYPL.......TLWIG.....FTFLLMFI
Q8FT27_COREF/8-114----------------------------------------------DLRTRRLPD.......ALTLP.....GALMI...
Q8CNZ3_STAES/98-194----------------------------------------------DIHSMHIDM.......RLLFV.....YTVVSVFT
Q87AA6_XYLFT/133-242----------------------------------------------DLRTRLLPD.......QLTLM.....LMWLGLIG
Q8THK9_METAC/8-134----------------------------------------------DLETRRVPN.......RIWKL.....MLFSLSGF
Q8RAF7_THETN/104-208----------------------------------------------DLEHKIIPN.......SIIIA.....GFIGALIF
LEP4_BURPS/126-235----------------------------------------------DMQTGFLPD.......SLTLP.....LLWAGLCV
PPPA_ECOLI/130-240----------------------------------------------DLDHQWLPD.......VFTQG.....VLWTGLIA
Q8K6R2_STRP3/88-182----------------------------------------------DWRSQEYPF.......ILWLF.....SFVSLLLF
Q8VRL2_THETH/101-317----------------------------------------------DVDTFELPD.......PLTYG.....LLFLGLLA
Q92YL6_RHIME/12-116----------------------------------------------DVATMTISN.......RVVVF.....LVIAFAIL
Q89PI9_BRAJA/13-114----------------------------------------------DVATRLIRN.......EICLV.....LAFLGIVT
Q89UH6_BRAJA/9-113----------------------------------------------DLFTMTISN.......RVSLA.....LVAGFFAL
Q87M36_VIBPA/5-111----------------------------------------------DAQKHRIPN.......KAVLL.....LLVAVTAN
O66151_AGGAC/10-109----------------------------------------------DIRSRLISN.......RVVLF.....LLLVII..
O07379_9ZZZZ/78-183----------------------------------------------DALTGLLPG.......TFTRR.....FLIAGMLS
O32576_ECOLX/98-207----------------------------------------------DCHTALLPD.......VLTLP.....LLWLGLLF
Q8Y6Y1_LISMO/101-204----------------------------------------------DIFYLYVPN.......SILIV.....FFCVLATI
O68839_VIBCL/134-244----------------------------------------------DFDTLLLPD.......QLTLP.....LLWGGIAL
Q57382_ECOLX/116-222----------------------------------------------DLRENWLPA.......CVTYP.....LFWAGMIT
Q9L719_CAUCE/10-114----------------------------------------------DLTSYTIPN.......WISLA.....LIAAFVPA
Q89HG8_BRAJA/40-149----------------------------------------------DARHYLIPN.......ELTGT.....AFALALLR
Q8X252_METMI/5-130----------------------------------------------DFRSREIED.......YIWIV.....LAVFGILF
Q8DNN1_STRR6/96-190----------------------------------------------DFRHQEYPL.......LVWMT.....FHLILIAS
LEP4_ERWCH/136-245----------------------------------------------DARTQLLPD.......VMTLP.....LLWGGLLF
Q8YXA0_NOSS1/108-226----------------------------------------------DLDTMTLPN.......PLTKS.....GLVLGLVF
Q9X222_THEMA/103-204----------------------------------------------DLETYLIPD.......YLNFT.....VLIFSFVV
Q8NKW5_METVO/5-130----------------------------------------------DIKSREIEN.......YIWIG.....MAVIGLLL
Q92BG4_LISIN/101-204----------------------------------------------DILYLHVPN.......SVMIL.....FFLVLLTC
Q9CE22_LACLA/97-191----------------------------------------------DYRQHSFPF.......VIWFI.....FALSFILI
Q8CZX6_YERPE/153-262----------------------------------------------DFDTYLLPD.......CMTIP.....LLWLGLLI
Q8PWB1_METMA/12-138----------------------------------------------DLKERRVSN.......KVWKY.....MLASGSVF
P95002_MYCTU/4-113----------------------------------------------DVRQRRLPN.......WLTLP.....GAGVILLF
LEP4_LEGPN/135-244----------------------------------------------DLDHQLLPD.......SLTLG.....LLWIGLIA
LEP4_VIBCH/112-221----------------------------------------------DFKSMLLPN.......LLTYP.....IFMLAFIY
Q989C3_RHILO/11-122----------------------------------------------DFTTQKIAN.......RDALL.....LLCLGAGS
LEP4_DICNO/138-247----------------------------------------------DAEHQLLPD.......RLTLP.....LLWLGILA
LEP4_ECOLI/81-190----------------------------------------------DFRTQLLPD.......KLTLP.....LLWLGLVF
Q04904_ECOLX/71-179----------------------------------------------DLLSFLLPR.......LYTVT.....FIFSGLLY
Q9ABP2_CAUCR/121-230----------------------------------------------DTEHLWLPD.......RLTLP.....FGALGVIA
Q93R20_GLUDI/111-221----------------------------------------------DLKSFRLPD.......TLTVP.....LIAAGLGL
LEP4_KLEPN/124-227----------------------------------------------DAQTQLLPD.......GLTLP.....LMWAGLLF
Q8Y1N3_RALSO/10-114----------------------------------------------DVRTRRIPN.......RLVAA.....GLAAALIA
Q88QB9_PSEPK/4-110----------------------------------------------DVRQRQISN.......VLTLG.....AAGCALAW
Y83C_METJA/9-115----------------------------------------------DIKERIIPH.......KYTIA.....MIIINLVV
Q8KRY3_AGGAC/90-200----------------------------------------------DWHYRLISP.......ALCQA.....LFALGLGA
Q87VV0_PSESM/5-111----------------------------------------------DARRKEILN.......GLTLG.....AAALAAGY
O29326_ARCFU/8-129----------------------------------------------DLESRIVPN.......RVWKR.....MLLVSLPI
Q8KQJ2_HAEDC/11-110----------------------------------------------DIRSRIITN.......KVVLA.....LFCAIL..
Q97FF6_CLOAB/100-211----------------------------------------------DLDTTNVYL.......CTTLP.....GIISGIIF
Q8RHE5_FUSNN/7-119----------------------------------------------DINKKYIPN.......VLNFS.....ILVLSIFI
Q980Y8_SULSO/10-125----------------------------------------------DLKYREVDP.......KIWIY.....YSPLCLFI
Q8R8E5_THETN/6-111----------------------------------------------DCKRKEIDN.......WVPAA.....ILTYGIIL
LEP4_SYNY3/108-223----------------------------------------------DWDTMTLPN.......SLTKP.....GLVLGLLF

PF04258

SPPL3_MOUSE/60-369I.WVLTG..H..WLLM------DALAMGLCVAMIAFVRLP-SLKVSCLLLSGLLIYDVFWVFFS----------------
SPP2A_MOUSE/213-494VWAVFRNEDRWAWILQ------DILGIAFCLNLIKTMKLP-NFMSCVILLGLLLIYDVFFVFIT----------------
SPP2B_HUMAN/213-500VWGVFRNEDQWAWVLQ------DALGIAFCLYMLKTIRLP-TFKACTLLLLVLFLYDIFFVFIT----------------
HM13_MOUSE/62-345W.YLLRK..H..WIAN------NLFGLAFSLNGVELLHLN-NVSTGCILLGGLFIYDIFWVF..----------------
Q9CAD4_ARATH/241-517LWAVYRVH.SFAWIGQ------DVLGIALIITVLQIVHVP-NLKVGTVLLSCAFLYDIFWVFVS----------------
Q9LQ94_ARATH/239-595FWAVKRQY.SYAWIGQ------DILGISLIITVLQIVRVP-NLKVGFVLLSCAFMYDIFWVFVS----------------
Q9MA44_ARATH/240-519LWFMNRKTSH.AWAGQ------DIFGICMMINVLQVARLP-NIRVATILLCCAFFYDIFWVFIS----------------
Q93346_CAEEL/222-596TWFIIRRQPY.AFILL------DVINMALCMHVLKCLRLP-SLKWISILMLCMFVYDAFMVFGT----------------
O81062_ARATH/47-318W.YAWKK..H..WLAN------NILGLSFCIQGIEMLSLG-SFKTGAILLAGLFFYDIFWVF..----------------
Q9VPQ7_DROME/71-354W.YLLKK..H..WIAN------NLFGLAFAINGVEMLHLN-NFVTGVILLSGLFFYDIFWVF..----------------
IMP2_CAEEL/55-445S.HLLKR..H..WITN------NIIGVSFSILGIERLHLA-SFKAGSLLLVGLFFYDIFWVF..----------------
YL8H_SCHPO/25-277F.YFKTK..H..WMAS------NILAWALAANSISIMRID-SYNTGALLLGALFFYDIYFVF..----------------
Q9VBL1_DROME/96-403I.WVLTG..H..WLLM------DAMGMGLCVAFIAFVRLP-SLKVSTLLLTGLLIYDVFWVFLS----------------
YKK0_YEAST/145-505YFYL..SPND..WLIS------NAVSMNMAIWSIAQLKLK-NLKSGALILIALFFYDICFVF..----------------

PF06550

Q97CT3_THEVO/10-286FYLLLFKNE---WYIT------DTAGFFLAVGIASIWGITFGVWAAVAFLVVFEIYDYIAVY------------------
Q9HM09_THEAC/1-278FYMILFRNE---WYVT------DLAGFFLSVGISSIWGITFGVWAAVAFLIAFEIYDYIAVY------------------
Q9HQ23_HALSA/15-306VGALYAYPE---WWVI------DAAGAIMGMGAAALFGISFGVLPAIVLLTALAVYDAISVY------------------
Q8TIY9_METAC/27-303TVLLYKYPE---WYVI------DLLGVCIAGGVSALIGISLSIIPVVVLLILLAVYDAISVY------------------
Q8PYF3_METMA/18-294TLLLYKYPE---WYVI------DILGVCIAAGVSALIGISLSVIPVVVLLILLAVYDAISVY------------------

PF01080

SPE4_CAEEL/5-465F-YLRVFPSKTTWFVLWIVLFWDLFAVLAPMGPLKKVQEKASDYSKCVLNLIMFSANEKRLTAGSNQEETNEGEESTIRR
HOP1_CAEEL/1-349F-ILNILPDWTVWMALTAISFWDIVAVLTPCGPLKMLVETANRRGDDKFPAILYNSSSYVNEVD.........SP....D
PSN1_RAT/70-459V-FIKYLPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNM......AEGDPEAQRR
PSN_DROME/92-532V-FIKYLPEWTAWAVLAAISIWDLIAVLSPRGPLRILVETAQERNEQIFPALIYSSTVVYALVNTVTPQQSQATASSSPS
PSN2_RAT/76-439V-FIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSA.MVWTVG........MAK.....
PSN_CAEEL/38-435V-FIKYLPEWTVWFVLFVISVWDLVAVLTPKGPLRYLVETAQERNEPIFPALIYSSGVIYPYVLVTAVEN..TTDPREPT

PF01478

LEP4_BACSU/100-204R.............LI------S.PLDSWYAGLLGA.........AAGFLFLAVI.........................
Q9HWA5_PSEAE/4-110LYV.........KESS------L.TGATVNMAMTAL.........FIGVCLSLP..........................
Q8FME5_COREF/77-189S............AAV------GGTWNDWVRALLAG.........LVLLLGYFA..........................
Q9CPF6_PASMU/89-199A............YVE------V.SPLHLEQSLQSA.........LTGFFAFYCLYH.......................
Q9RSQ9_DEIRA/109-347GLAGAGLYAQEGQL..------..GLPNVAQAVEGA.........LMGAGVIVLISVYGSWVLRRFRERQWPEAPIGYQQ
Q97HN8_CLOAB/64-168VM...........ITY------F.SGNCIEDYVVGA.........VAMGIISYI..........................
Q8XQX7_RALSO/14-117VKF.........GSVV------A.LAYDWRDVWLGG.........AIALAGFLP..........................
Q8VQ80_BACLI/101-205R.............FL------V.PLEQWHSSLSGA.........MAGGMLPLLT.........................
LEP4_HAEIN/90-200A............DNN------F.SLLTLSESIKSA.........ASFFIVFYVIYW.......................
LEP4_NEIGO/134-243N.............LD------G.GFVPLQSAVLGA.........VAGYSSLWLLCA.......................
Q8TMQ5_METAC/5-101I...............------..VQLISVRYVITV.........GLIFLIIFF..........................
Q8GBD6_YEREN/122-231H.............LF------D.DILPLSDAVIGA.........VSGYLILWSLYW.......................
Q8E192_STRA5/8-102..............TP------I.TKVSIVLCLFGI.........LAEVVDINI..........................
Q8NQ30_CORGL/4-110..............NL------W.ALTIYPQWMLGG.........LVWAGIYFL..........................
Q98BF9_RHILO/11-116AP...........LTG------M.EWAAYGWHFAAG.........ALVLAVTFG..........................
P94648_CHLLI/90-200SHAGF....TGKASSP------AQHPPPWCLACSAG.........LTGRSSVSG..........................
Y421_METTH/12-138NGA........RALME------S.DPWIFIYTAIFT.........AGIFALGYI..........................
LEP4_PECCC/135-244N.............LS------G.TFVSLNDAVVGA.........MAGYLSLWLLYW.......................
Q8CXM1_OCEIH/104-208R.............LL------L.PLDPWWSMFTGA.........AIGFGIIFLI.........................
A9CKJ3_AGRT5/8-113AP...........FAG------M.DFQTFGLSLAGG.........LIVFLGCFA..........................
Q8TXH1_METKA/6-112A.............AV------I.DPSHLGYALLDA.........GVAFGVTLV..........................
Q8DLL0_THEEB/89-199R............GLT------T.GLGGITEGIIAA.........VIGIWLFDLIRW.......................
YC8A_METJA/6-148..............HL------L.YNKSLLLFFIEI.........FAVLFITLSVRYEKFNKLVYIGVFLFLLS......
HOPD_ECOLX/9-119S.............QV------C.NPDCLADALWGA.........IIGYGTFAVIYW.......................
Q9XAP1_STRCO/112-224L.............VP------E.HAGECTTALLGAL......ALGAGYLVLFL..........................
LEP4_MYXXD/113-222A.............FP------L.GMDAFRDALMGA.........AVGFLSFRMMEY.......................
LEP4_XANCP/133-242S.............MD------N.LYMPAKPALLGA.........AVGYVSLWTVWW.......................
Q9ZIU7_SALTI/78-184C.............LA------F.HREPELRFMETA.........AMAVVMGSICH........................
LEP4_AERSA/139-248N.............LL------G.GYVPLGDAVIGA.........MAGYLVLWSLYW.......................
Q8ZWV8_PYRAE/8-110PFY........LFS..------.......................LAVSLVLAS..........................
Q8TLD4_METAC/26-152VIY.........ELFT------G.GTPYLKALFLSG.........VVVFISVYI..........................
O67535_AQUAE/105-214S.............PF------R.QDITPKESIIGA.........VVGVLIPFVIYL.......................
Q988A4_RHILO/13-122Q.............LA------A.DADAMPQRLLFA.........AATFAAAWLLRR.......................
Y902_METJA/9-134NGYLS.....FISHDM------LYVIQSIVGFIVCF.........FLGFFMFLL..........................
Q8XVK3_RALSO/140-249N.............LF------S.MFARLPDAVIGA.........TAGYLFLWAIYW.......................
Q87I88_VIBPA/13-110..............SL------F.FTPEPLTQLAVS.........TSVFICFFI..........................
Q8F6L1_LEPIN/127-232IFL.........LDGK------L.PGLNDLFVLGGF.........FFTFLVLF...........................
Q891G5_CLOTE/115-221FFL.........EGDK------I.NFIFYNYFLAGF.........IPAMIICII..........................
Q8DA80_VIBVU/9-110R.............HQ------L.PDAMWLDATLYA.........LLALLIGML..........................
Q9K8H1_BACHD/15-120R.............AT------LAPLNPWWDAWAGA.........VVGYILLFI..........................
LEP4_PSEAE/136-245N.............HF------G.LFASLDDALFGA.........VFGYLSLWSVFW.......................
Q8XI34_CLOPE/100-206ALIEK....FYFGEN.------.....LLNYFMGLV.........ISALVIFLI..........................
Q9S5E3_ECOLX/119-229A............AFE------L.SPITLKDAVISI.........CGTWITLSTIVQ.......................
Q8EJP8_SHEON/157-266N.............LN------H.TFTSPADAMIGA.........AAGYLSLWSIFW.......................
Q8KYA3_STAAU/91-187................------..SMIYPVAFIIIS.........MTTHIFYFL..........................
Q9CMH2_PASMU/11-110..............PL------A.WIQHKQIFFLPA.........LLTLVIGFL..........................
Q92T43_RHIME/12-117AP...........LAG------L.DLAQLGLHTVAA.........GLIFAVSFA..........................
HOPD_SALTY/9-119H.............QI------C.LPERLPDALWGA.........IAGYGGFALIYW.......................
Q933W3_ECOLX/68-175..............RL------W.QGDAAIALACAL.........FWFLLLSLLRRY.......................
Q8DVF1_STRMU/96-190..............YP------L.NLISLILFLFGI.........FAALKNINI..........................
Q8FT27_COREF/8-114..............TG------W.AVVVDPWLLLGG.........AGWFLLYLV..........................
Q8CNZ3_STAES/98-194................------..TQTYFGNFIMIF.........LISHVIYLF..........................
Q87AA6_XYLFT/133-242S.............AD------N.LFMAAKPALLGA.........AVGYLSLWIVAA.......................
Q8THK9_METAC/8-134LIY.........EIVE------G.GILFMLQLVFSF.........FSSFFLAYL..........................
Q8RAF7_THETN/104-208R.............LL------M.YSYGFLDYILGF.........LLGGGILLL..........................
LEP4_BURPS/126-235N.............LW------G.TFASLRAAVIGA.........IAGYLFLWCILW.......................
PPPA_ECOLI/130-240A............WAQ------Q.SPLTLQDAVTGV.........LVGFITFYSLRW.......................
Q8K6R2_STRP3/88-182..............YS------I.NYLSLILLLLGL.........LAHLRPFSI..........................
Q8VRL2_THETH/101-317S............WAL------A.FPLPFRESLDGSLMAAGGLALVAGYGNLFLRRFREARAEVPVGPHQVQSAALFGAL
Q92YL6_RHIME/12-116AP...........AAG------L.NLATVMSSVVVA.........SAVLACTFV..........................
Q89PI9_BRAJA/13-114..............QL------P.NAIQIAESLIAA.........AILFLLLFV..........................
Q89UH6_BRAJA/9-113AL...........SGG------M.APYEMLGHVGAG.........ALVLVVAFT..........................
Q87M36_VIBPA/5-111V.............LY------S.PSVSLLDHAYGG.........LVAFAVCFA..........................
O66151_AGGAC/10-109..............PF------S.LLKYQTIFVIPA.........LCTLIIGFL..........................
O07379_9ZZZZ/78-183QI...........TTD------I.WWFRTTEFATAA.........IVLFCLHKLVNR.......................
O32576_ECOLX/98-207S.............LQ------R.GVVTLEEAVVGA.........VSGYLCLWGLYW.......................
Q8Y6Y1_LISMO/101-204A............ILY------N.QSLMDLIYSGGI.........SCLFYLLFF..........................
O68839_VIBCL/134-244A.............LL------GFSPVSLSDAVIGA.........MAGYLSLWSIYW.......................
Q57382_ECOLX/116-222P...............------..GFASSDDKIFGA.........FTGFLIMYISMK.......................
Q9L719_CAUCE/10-114AL...........VSG------A.PLSQIGLCLAVG.........LGALVLGMG..........................
Q89HG8_BRAJA/40-149AGAF.......VPDVG------LEALIWPLARAAAV.........ALPLLLLMV..........................
Q8X252_METMI/5-130AIYSA.....ITLSNY------SILINSISGFVICF.........ILGYMMFLS..........................
Q8DNN1_STRR6/96-190..............SG------W.NLVMVSFLILGI.........LAHFIDIRM..........................
LEP4_ERWCH/136-245N.............LA------D.TFVPLEQAVVGA.........VAGYLSLWLIYW.......................
Q8YXA0_NOSS1/108-226QMIVGY...AADPTLS------G.LIRHLMMGIVGA.........VLGLWLFEAIAL.......................
Q9X222_THEMA/103-204A...............------..LRTSFLEHLISF.........LIVTIMFLI..........................
Q8NKW5_METVO/5-130STYLS.....FTTGNF------MPIISSISGFIICF.........IIGYLMFVL..........................
Q92BG4_LISIN/101-204Y............ISF------Q.QPAVSLIYSSLI.........SNCFYLLFF..........................
Q9CE22_LACLA/97-191..............FP------L.SPLFYFWLILAV.........LAEKFNLRV..........................
Q8CZX6_YERPE/153-262N.............ID------T.VFAPLTSAVLGA.........VSGYLFLWLSYW.......................
Q8PWB1_METMA/12-138VIY.........EVFT------G.GLPYVKSLILSS.........VIVFISIYI..........................
P95002_MYCTU/4-113A............GLA------GRGVPALAGAAALA.........GVYLLVHLA..........................
LEP4_LEGPN/135-244N.............TQ------N.VFVSLDVAVLSC.........AGAYLALWLFIN.......................
LEP4_VIBCH/112-221..............VQ------QNPALTVESSIIGG.........FAAFIISYVSNF.......................
Q989C3_RHILO/11-122LLL........LSLQS------G.SWWDMGLSAIAA.........LVLFVGLFP..........................
LEP4_DICNO/138-247A.............LF------N.VFINLESSVIGA.........MIGYLSLWSVYW.......................
LEP4_ECOLI/81-190N.............AQ------Y.GLIDLHDAVYGA.........VAGYGVLWCVYW.......................
Q04904_ECOLX/71-179..............QT------W.NNNILSGLFCAM.........LMFFIMLFVRLYFAY....................
Q9ABP2_CAUCR/121-230T.............LA------I.GEVPVWTPLVGA.........AVGFGGLALIAW.......................
Q93R20_GLUDI/111-221A.............AL------G.GAAPVLWHALAA.........AAGYGVFRGI.........................
LEP4_KLEPN/124-227N.............LS------A.TYVPLAEAVVGA.........MAGYLSLWSVYW.......................
Q8Y1N3_RALSO/10-114QC...........AML------G.PVAGALAWLGGA.........AAGMGLCIG..........................
Q88QB9_PSEPK/4-110LFS.........TGHS------W.IGAEASEAGWAL.........AIVMLLTLP..........................
Y83C_METJA/9-115GY..........YY..------..FGFNAIIAFFST.........LILCLILSI..........................
Q8KRY3_AGGAC/90-200A............YWQ------L.GTLTLAQSLQSA.........VIFFGVFYAIYH.......................
Q87VV0_PSESM/5-111LAV.........TGLT------W.LGSPPLEGALAL.........VLALALTLP..........................
O29326_ARCFU/8-129TVY.........QLFL------G.KHLIFEYMIAGI.........FVVMVIALSY.........................
Q8KQJ2_HAEDC/11-110..............PF------S.WFTQGMVYPMPA.........LICLVIGFV..........................
Q97FF6_CLOAB/100-211IAINI....FYKNHIY------G.YLFAAFLYSGVI.........VLINIITKK..........................
Q8RHE5_FUSNN/7-119CGI.........DKVD------I.FFIGASCYTLPI.........LIFYGYISD..........................
Q980Y8_SULSO/10-125I.............FS------F.HNLFLPIYLYSF.........IITNLLFLI..........................
Q8R8E5_THETN/6-111N.............AF------L.NPVGFIESIVYM.........LTAFAILFTI.........................
LEP4_SYNY3/108-223HLLL.......GWQRG------H.WIVPLVEAIASA.........VLGLWLFDLIRM.......................

PF04258

SPPL3_MOUSE/60-369--------------------------------------------------AYIF..NSNVMVKVATQPADNP-----LDV
SPP2A_MOUSE/213-494--------------------------------------------------PFITKNGESIMVELAAGPFENA-----E..
SPP2B_HUMAN/213-500--------------------------------------------------PFLTKSGSSIMVEVATGPSDSA-----TR.
HM13_MOUSE/62-345--------------------------------------------------......GTNVMVTVAKS.FEA.-----...
Q9CAD4_ARATH/241-517--------------------------------------------------KKLF..HESVMIVVARGDKSGE-----D..
Q9LQ94_ARATH/239-595--------------------------------------------------KWWF.R.ESVMIVVARGDRSGE-----D..
Q9MA44_ARATH/240-519--------------------------------------------------PLIF.K.QSVMIAVARGSKDTG-----E..
Q93346_CAEEL/222-596--------------------------------------------------PYMTTNGCSVMLEVATGLSCAA-----KGK
O81062_ARATH/47-318--------------------------------------------------......FTPVMVSVAKS.FDA.-----...
Q9VPQ7_DROME/71-354--------------------------------------------------......GTNVMVTVAKS.FEA.-----...
IMP2_CAEEL/55-445--------------------------------------------------......GTDVMTSVAKG.IDA.-----...
YL8H_SCHPO/25-277--------------------------------------------------......GTEVMVTVATG.IDI.-----...
Q9VBL1_DROME/96-403--------------------------------------------------SYIF..STNVMVKVATRPADNP-----VGI
YKK0_YEAST/145-505--------------------------------------------------......GTDVMVTVATN.LDI.-----...

PF06550

Q97CT3_THEVO/10-286--------------------------------------------------------KTKHMISLARYAVDS---------
Q9HM09_THEAC/1-278--------------------------------------------------------KTRHMISLARYAVDS---------
Q9HQ23_HALSA/15-306--------------------------------------------------------GTEHMLTLASGVMEL---------
Q8TIY9_METAC/27-303--------------------------------------------------------KTKHMIAMAEGVMDL---------
Q8PYF3_METMA/18-294--------------------------------------------------------KTKHMITMAEGVMDL---------

PF01080

SPE4_CAEEL/5-465TVKQTIEYYTKREAQDDEFYQKIRQRRAAINPDSVPTEHSPLVEAEPSPIELKEKNSTEELSDDESDTSETS.....SGS
HOP1_CAEEL/1-349TTR.................................................SN.STPLTEFNNSSSSRLLE.....S..
PSN1_RAT/70-459VPK.N...............................PKYSTQ......GTEREETQDTGTGSDDGGFSEEWE.....A..
PSN_DROME/92-532SSNST...TTTRATQ...........NSLASPEAAAASGQRT..........GN.SHPRQNQRDDGSVLATEGMPLVTFK
PSN2_RAT/76-439.LD................................PSSQGAL........QLPY...DPEMEEDSYDSFGEP.....S..
PSN_CAEEL/38-435SSDSN.....................TSTAFPGEASCSSETP........KRPKVKRIPQKVQIESNTTAST.....T..

PF01478

LEP4_BACSU/100-204..........................................................................AAI...
Q9HWA5_PSEAE/4-110...........................................................................GY...
Q8FME5_COREF/77-189................................................................................
Q9CPF6_PASMU/89-199.......................................................................LSKGIY...
Q9RSQ9_DEIRA/109-347ISLGLLAGAWLGPWWGLGVALLSAAVNVAAKKAVRIPELLTLGGFLVSLALSSAGTGPGLLDMLRGGLMAAGAVSLVCGV
Q97HN8_CLOAB/64-168...........................................................................FA...
Q8XQX7_RALSO/14-117...........................................................................LY...
Q8VQ80_BACLI/101-205..........................................................................LLL...
LEP4_HAEIN/90-200.......................................................................LAKFYY...
LEP4_NEIGO/134-243.......................................................................VYKLLT...
Q8TMQ5_METAC/5-101...........................................................................AF...
Q8GBD6_YEREN/122-231.......................................................................AFWWVT...
Q8E192_STRA5/8-102................................................................................
Q8NQ30_CORGL/4-110..........................................................................TAV...
Q98BF9_RHILO/11-116...........................................................................LF...
P94648_CHLLI/90-200................................................................................
Y421_METTH/12-138...........................................................................LW...
LEP4_PECCC/135-244.......................................................................AFKYAT...
Q8CXM1_OCEIH/104-208..........................................................................ILI...
A9CKJ3_AGRT5/8-113...........................................................................LF...
Q8TXH1_METKA/6-112...........................................................................LN...
Q8DLL0_THEEB/89-199.......................................................................GGAIAF...
YC8A_METJA/6-148......................................................FILFKSYFALSFLVFYLIGIFLY...
HOPD_ECOLX/9-119.......................................................................GYRILR...
Q9XAP1_STRCO/112-224................................................................................
LEP4_MYXXD/113-222.......................................................................VGWKVF...
LEP4_XANCP/133-242.......................................................................LFKQLT...
Q9ZIU7_SALTI/78-184.........................................................................GVNR...
LEP4_AERSA/139-248.......................................................................AFKLLT...
Q8ZWV8_PYRAE/8-110...........................................................................VM...
Q8TLD4_METAC/26-152...........................................................................LF...
O67535_AQUAE/105-214.......................................................................YYVKFR...
Q988A4_RHILO/13-122.......................................................................GHFLMT...
Y902_METJA/9-134................................................................................
Q8XVK3_RALSO/140-249.......................................................................AYKLLR...
Q87I88_VIBPA/13-110...........................................................................LW...
Q8F6L1_LEPIN/127-232...........................................................................FF...
Q891G5_CLOTE/115-221...........................................................................IL...
Q8DA80_VIBVU/9-110...........................................................................LW...
Q9K8H1_BACHD/15-120................................................................................
LEP4_PSEAE/136-245.......................................................................LFKLVT...
Q8XI34_CLOPE/100-206...........................................................................SK...
Q9S5E3_ECOLX/119-229.......................................................................LFIFIR...
Q8EJP8_SHEON/157-266.......................................................................LFKLLT...
Q8KYA3_STAAU/91-187................................................................................
Q9CMH2_PASMU/11-110...........................................................................LF...
Q92T43_RHIME/12-117...........................................................................LF...
HOPD_SALTY/9-119.......................................................................GYRLRY...
Q933W3_ECOLX/68-175........................................................................TSYRK...
Q8DVF1_STRMU/96-190................................................................................
Q8FT27_COREF/8-114..........................................................................TAG...
Q8CNZ3_STAES/98-194................................................................................
Q87AA6_XYLFT/133-242.......................................................................LFKLIF...
Q8THK9_METAC/8-134...........................................................................LF...
Q8RAF7_THETN/104-208................................................................................
LEP4_BURPS/126-235.......................................................................LFKLLR...
PPPA_ECOLI/130-240.......................................................................IAGIVL...
Q8K6R2_STRP3/88-182................................................................................
Q8VRL2_THETH/101-317LGPGVGMALAFLAWALSARTGRPVVLPDRLTLPLLPLAFLLAPALGLDFLESLKGSLLAAGGLALAGGLYWAFRPLP...
Q92YL6_RHIME/12-116...........................................................................LF...
Q89PI9_BRAJA/13-114...........................................................................LY...
Q89UH6_BRAJA/9-113...........................................................................CF...
Q87M36_VIBPA/5-111...........................................................................LY...
O66151_AGGAC/10-109...........................................................................LF...
O07379_9ZZZZ/78-183.......................................................................HRLNI....
O32576_ECOLX/98-207.......................................................................LFRFAT...
Q8Y6Y1_LISMO/101-204...........................................................................II...
O68839_VIBCL/134-244.......................................................................LFKLLT...
Q57382_ECOLX/116-222.......................................................................LVSALR...
Q9L719_CAUCE/10-114...........................................................................MF...
Q89HG8_BRAJA/40-149...........................................................................LY...
Q8X252_METMI/5-130................................................................................
Q8DNN1_STRR6/96-190................................................................................
LEP4_ERWCH/136-245.......................................................................AFRLLS...
Q8YXA0_NOSS1/108-226........................................................................LGVVF...
Q9X222_THEMA/103-204................................................................................
Q8NKW5_METVO/5-130................................................................................
Q92BG4_LISIN/101-204...........................................................................IL...
Q9CE22_LACLA/97-191................................................................................
Q8CZX6_YERPE/153-262.......................................................................LFKIVR...
Q8PWB1_METMA/12-138...........................................................................LF...
P95002_MYCTU/4-113................................................................................
LEP4_LEGPN/135-244.......................................................................LFYLMT...
LEP4_VIBCH/112-221.......................................................................IVRLFK...
Q989C3_RHILO/11-122...........................................................................FW...
LEP4_DICNO/138-247.......................................................................LFKLIT...
LEP4_ECOLI/81-190.......................................................................GVWLVC...
Q04904_ECOLX/71-179.....................................................................KNGTESF....
Q9ABP2_CAUCR/121-230.......................................................................LYKTVR...
Q93R20_GLUDI/111-221.........................................................................SLLY...
LEP4_KLEPN/124-227.......................................................................VFRLLS...
Q8Y1N3_RALSO/10-114...........................................................................LY...
Q88QB9_PSEPK/4-110...........................................................................GY...
Y83C_METJA/9-115................................................................................
Q8KRY3_AGGAC/90-200.......................................................................AAKWYY...
Q87VV0_PSESM/5-111...........................................................................GY...
O29326_ARCFU/8-129..........................................................................ALY...
Q8KQJ2_HAEDC/11-110...........................................................................LF...
Q97FF6_CLOAB/100-211...........................................................................II...
Q8RHE5_FUSNN/7-119...........................................................................IL...
Q980Y8_SULSO/10-125...........................................................................LY...
Q8R8E5_THETN/6-111..........................................................................YII...
LEP4_SYNY3/108-223.......................................................................GGSLLL...

PF04258

SPPL3_MOUSE/60-369LSRKLHLGPNVGRDVPRLSLP----GKLVFPSS............TG-----------------SHFSMLGIGDIVMPGL
SPP2A_MOUSE/213-494..................KLP----VVIRVPKLMGYSVMS....VCS-----------------VPVSVLGFGDIIVPGL
SPP2B_HUMAN/213-500.................EKLP----MVLKVPRLNSSPLA.....LCD-----------------RPFSLLGFGDILVPGL
HM13_MOUSE/62-345....................P----IKLVFPQD.LLEKG.....LEA-----------------DNFAMLGLGDIVIPGI
Q9CAD4_ARATH/241-517..................GIP----MLLKIPRM.FDP.........W-----------------GGYSIIGFGDILLPGL
Q9LQ94_ARATH/239-595..................GIP----MLLKIPRMFD..........PW-----------------GGYSIIGFGDIILPGL
Q9MA44_ARATH/240-519..................SIP----MLLRIPRLSD..........PW-----------------GGYNMIGFGDILFPGL
Q93346_CAEEL/222-596NKGYPVP..PIEQESVPEKFP----MLMQVAHFNPMNECLDMEIELG-----------------FQFTILGLGDIVMPGY
O81062_ARATH/47-318....................P----IKLLFPT......G.....DAL-----------------RPYSMLGLGDIVIPGI
Q9VPQ7_DROME/71-354....................P----IKLVFPQD.LIENG.....LNA-----------------SNFAMLGLGDIVIPGI
IMP2_CAEEL/55-445....................P----ILLQFPQD.IYRNGI....MEA-----------------SKHSMLGLGDIVIPGI
YL8H_SCHPO/25-277....................P----AKYVLPQF...........KNP-----------------TRLSMLGLGDIVMPGL
Q9VBL1_DROME/96-403VARKLHL.GGIVRDTPKLNLP----GKLVFPSLH...........NT-----------------GHFSMLGLGDVVMPGL
YKK0_YEAST/145-505....................P----VKLSLPVKFNTA.......QNN-----------------FNFSILGLGDIALPGM

PF06550

Q97CT3_THEVO/10-286------------------DLP----MLFVIPENRDFTMKNVTFENRGE...........---..GNALMIGFGDIALPSI
Q9HM09_THEAC/1-278------------------DLP----MLFVLPENSGFTMRGLSFDNRGD...........---..GNVLMIGFGDIALPSI
Q9HQ23_HALSA/15-306------------------RLP----IVLVVPTTLAYSFVEDAAETADEAEAGEREAAAP---ADRPAYFIGLGDAVMPSI
Q8TIY9_METAC/27-303------------------KLP----ILFIIPKHLNYSFITEGFKEGEKREA........---.....FFMGLGDAVMPTL
Q8PYF3_METMA/18-294------------------KLP----ILFIIPKHRDYSFIKESFKEGETREA........---.....FFMGLGDAVMPSL

PF01080

SPE4_CAEEL/5-465SNLSSSDSSTTVSTSDISTAE....ECDQKEWDDLVS....NSLPNNDKRPATAADAL....NDGEVLRLGFGDFVFYSL
HOP1_CAEEL/1-349...............DSLLRP....PVIPRQIREVR..........................EVEGTIRLGMGDFVFYSL
PSN1_RAT/70-459.............QRDSHLGPHRSTPESRAAVQELSG....SILTS....ED..........PEERGVKLGLGDFIFYSV
PSN_DROME/92-532SNLRGNAEAAGFTQEWSANLS....ERVARRQIEVQSTQSGNAQRSNEYRTVTAPDQNHPDGQEERGIKLGLGDFIFYSV
PSN2_RAT/76-439...................YP....EAFEAPQPGYP..........GEEPEE..........EEERGVKLGLGDFIFYSV
PSN_CAEEL/38-435.............QNSGVRVE....RELAAERPTVQD....ANFHR...HEE...........EERGVKLGLGDFIFYSV

PF01478

LEP4_BACSU/100-204..................THG-------------------------------------------....GVGGGDIK----
Q9HWA5_PSEAE/4-110..................LLG-------------------------------------------....RLGAADVK----
Q8FME5_COREF/77-189..................LAF-------------------------------------------IAPAGLGLGDVK----
Q9CPF6_PASMU/89-199..................RKE-------------------------------------------....LLGKGDYW----
Q9RSQ9_DEIRA/109-347YWWIYWRRNKQAEDDGTDDEQ-------------------------------------------SDPVAMGFGDVK----
Q97HN8_CLOAB/64-168..................LFK-------------------------------------------....VIGLGDVE----
Q8XQX7_RALSO/14-117..................ALG-------------------------------------------....WMGAGDVK----
Q8VQ80_BACLI/101-205..................TKG-------------------------------------------....GIGWGDVK----
LEP4_HAEIN/90-200..................GKE-------------------------------------------....AFGRGDYW----
LEP4_NEIGO/134-243..................GKT-------------------------------------------....GMGNGDFK----
Q8TMQ5_METAC/5-101..................KKG-------------------------------------------....CFGGGDAK----
Q8GBD6_YEREN/122-231..................RRE-------------------------------------------....VLGYGDFK----
Q8E192_STRA5/8-102.....................-------------------------------------------......GSGDFL----
Q8NQ30_CORGL/4-110..................LVG-------------------------------------------....GIGGGDIK----
Q98BF9_RHILO/11-116..................AMG-------------------------------------------....GMGGGDAK----
P94648_CHLLI/90-200..................ATS-------------------------------------------....GIGGGDLK----
Y421_METTH/12-138..................RMV-------------------------------------------....AWAGGDVK----
LEP4_PECCC/135-244..................GKE-------------------------------------------....ALGYGDFK----
Q8CXM1_OCEIH/104-208..................SRG-------------------------------------------....GMGAGDMK----
A9CKJ3_AGRT5/8-113..................AAN-------------------------------------------....VMGGGDAK----
Q8TXH1_METKA/6-112..................VLG-------------------------------------------....VLGGGDVK----
Q8DLL0_THEEB/89-199..................NQE-------------------------------------------....VMGGGDGK----
YC8A_METJA/6-148..................YLN-------------------------------------------....FMGGGDCK----
HOPD_ECOLX/9-119..................HKE-------------------------------------------....GLGYGDVK----
Q9XAP1_STRCO/112-224.....................-------------------------------------------INPAGMGFGDVK----
LEP4_MYXXD/113-222..................QRE-------------------------------------------....ALGAGDKY----
LEP4_XANCP/133-242..................GKE-------------------------------------------....GMGHGDFK----
Q9ZIU7_SALTI/78-184..................RRP-------------------------------------------....QLGVGDVW----
LEP4_AERSA/139-248..................GKE-------------------------------------------....GMGYGDFK----
Q8ZWV8_PYRAE/8-110..................RFL-------------------------------------------....GSGYADSI----
Q8TLD4_METAC/26-152..................HLG-------------------------------------------....AFGGGDAK----
O67535_AQUAE/105-214..................KIE-------------------------------------------....GLGFGDVI----
Q988A4_RHILO/13-122..................GRI-------------------------------------------....GLGLGDVK----
Y902_METJA/9-134.....................-------------------------------------------....GVGGGDGK----
Q8XVK3_RALSO/140-249..................GRE-------------------------------------------....GMGYGDFK----
Q87I88_VIBPA/13-110..................LIN-------------------------------------------....IVGGGDVK----
Q8F6L1_LEPIN/127-232..................FPG-------------------------------------------....GIGFGDVL----
Q891G5_CLOTE/115-221..................LTN-------------------------------------------....GMGWGDVE----
Q8DA80_VIBVU/9-110..................QRR-------------------------------------------....LLGAGDVK----
Q9K8H1_BACHD/15-120..................VYL-------------------------------------------IYPNGIGGGDVK----
LEP4_PSEAE/136-245..................GKE-------------------------------------------....GMGYGDFK----
Q8XI34_CLOPE/100-206..................LTG-------------------------------------------....AMGSGDIE----
Q9S5E3_ECOLX/119-229..................KKE-------------------------------------------....GLGAGDIK----
Q8EJP8_SHEON/157-266..................GKE-------------------------------------------....GMGYGDFK----
Q8KYA3_STAAU/91-187..................FRA-------------------------------------------....YIGYGDVL----
Q9CMH2_PASMU/11-110..................TFG-------------------------------------------....VMGAGDIK----
Q92T43_RHIME/12-117..................AAN-------------------------------------------....VMGGGDAK----
HOPD_SALTY/9-119..................QKE-------------------------------------------....GLGYGDVK----
Q933W3_ECOLX/68-175..................GVE-------------------------------------------....TLGLGDVF----
Q8DVF1_STRMU/96-190.....................-------------------------------------------......GSGDFL----
Q8FT27_COREF/8-114..................VVG-------------------------------------------....GIGGGDIK----
Q8CNZ3_STAES/98-194..................ASK-------------------------------------------....FIGYGDIL----
Q87AA6_XYLFT/133-242..................NKE-------------------------------------------....GMGHGDFK----
Q8THK9_METAC/8-134..................RLR-------------------------------------------....VFGGADAK----
Q8RAF7_THETN/104-208..................ISL-------------------------------------------LSGGEMGGGDVK----
LEP4_BURPS/126-235..................GIE-------------------------------------------....GIGYGDLK----
PPPA_ECOLI/130-240..................RKE-------------------------------------------....ALGMGDVL----
Q8K6R2_STRP3/88-182.....................-------------------------------------------......GAGDFF----
Q8VRL2_THETH/101-317..................EEE-------------------------------------------EEPVAMGYGDVK----
Q92YL6_RHIME/12-116..................AAG-------------------------------------------....WIGGGDAK----
Q89PI9_BRAJA/13-114..................TRG-------------------------------------------....GIGGGDVK----
Q89UH6_BRAJA/9-113..................AMG-------------------------------------------....WVGGGDAK----
Q87M36_VIBPA/5-111..................LVK-------------------------------------------....AMAGGDVK----
O66151_AGGAC/10-109..................SLR-------------------------------------------....FIGAGDIK----
O07379_9ZZZZ/78-183.....................-------------------------------------------......GTGDLW----
O32576_ECOLX/98-207..................GRE-------------------------------------------....GLGYGDFK----
Q8Y6Y1_LISMO/101-204..................FRK-------------------------------------------....GIGLGDIK----
O68839_VIBCL/134-244..................GKE-------------------------------------------....GMGYGDFK----
Q57382_ECOLX/116-222..................KED-------------------------------------------....VFAGGDIA----
Q9L719_CAUCE/10-114..................AAG-------------------------------------------....WIGGGDGK----
Q89HG8_BRAJA/40-149..................RRW-------------------------------------------RGRDGLGLGDVK----
Q8X252_METMI/5-130.....................-------------------------------------------....GIGGGDGK----
Q8DNN1_STRR6/96-190.....................-------------------------------------------......GAGDFL----
LEP4_ERWCH/136-245..................GRE-------------------------------------------....ALGHGDFK----
Q8YXA0_NOSS1/108-226..................QKE-------------------------------------------....AMGAGDAK----
Q9X222_THEMA/103-204..................LKA-------------------------------------------MYRDGLGAGDVI----
Q8NKW5_METVO/5-130.....................-------------------------------------------....GIGGADGK----
Q92BG4_LISIN/101-204..................FRK-------------------------------------------....GIGLGDIK----
Q9CE22_LACLA/97-191.....................-------------------------------------------......GSGDFL----
Q8CZX6_YERPE/153-262..................GVD-------------------------------------------....GMGYGDFK----
Q8PWB1_METMA/12-138..................QLG-------------------------------------------....AFGGGDAK----
P95002_MYCTU/4-113..................LPA-------------------------------------------....AMGAGDVK----
LEP4_LEGPN/135-244..................CKV-------------------------------------------....CMGHGDFK----
LEP4_VIBCH/112-221..................RID-------------------------------------------....VMGGGDIK----
Q989C3_RHILO/11-122..................VLR-------------------------------------------....KVGAGDVK----
LEP4_DICNO/138-247..................GRE-------------------------------------------....GMGYGDFK----
LEP4_ECOLI/81-190..................HKE-------------------------------------------....GLGYGDFK----
Q04904_ECOLX/71-179.....................-------------------------------------------......GMGDVL----
Q9ABP2_CAUCR/121-230..................GFD-------------------------------------------....GMGGGDPR----
Q93R20_GLUDI/111-221..................RRA-------------------------------------------RGHDGLGGGDAK----
LEP4_KLEPN/124-227..................GKE-------------------------------------------....ALGYGDFK----
Q8Y1N3_RALSO/10-114..................LLR-------------------------------------------....GMGAGDVK----
Q88QB9_PSEPK/4-110..................MLG-------------------------------------------....RFGADDVK----
Y83C_METJA/9-115.....................-------------------------------------------....GMGGGDVK----
Q8KRY3_AGGAC/90-200..................RQE-------------------------------------------....ALGRGDYW----
Q87VV0_PSESM/5-111..................TLG-------------------------------------------....RLGAADVK----
O29326_ARCFU/8-129..................LIG-------------------------------------------....AYGGADAK----
Q8KQJ2_HAEDC/11-110..................MLG-------------------------------------------....VIGAGDAK----
Q97FF6_CLOAB/100-211..................DMP-------------------------------------------....AFGSGDAE----
Q8RHE5_FUSNN/7-119..................KKE-------------------------------------------....VFGFDDIK----
Q980Y8_SULSO/10-125..................KLS-------------------------------------------....LLGGADLF----
Q8R8E5_THETN/6-111..................TNG-------------------------------------------....QLGGGDVK----
LEP4_SYNY3/108-223..................GRE-------------------------------------------....GMGDGDPK----

PF04258

SPPL3_MOUSE/60-369LLCFVLRY--DNYKKQASGDSCGAPGPANISGRMQKVS.YF-HCTLIGYFVG-------LLTATVASRIHR.AAQPALLY
SPP2A_MOUSE/213-494LIAYCRRF--DVQT....................GSSI.YY-ISSTIAYAVG-------MIITFVVLMVMK.TGQPALLY
SPP2B_HUMAN/213-500LVAYCHRF--DIQV...................QSSRV.YF-VACTIAYGVG-------LLVTFVALALMQ.RGQPALLY
HM13_MOUSE/62-345FIALLLRF--DISL..................KKNTHT.YF-YTSFAAYIFG-------LGLTIFIMHIFK.HAQPALLY
Q9CAD4_ARATH/241-517LIAFALRY--DWLA..................NKTLRTGYF-IWAMVAYGLG-------LLITYVALNLMDGHGQPALLY
Q9LQ94_ARATH/239-595LVTFALRY--DWLA..................NKRLKSGYF-LGTMSAYGLG-------LLITYIALNLMDGHGQPALLY
Q9MA44_ARATH/240-519LICFIFRF--DKEN.................NKGVSNG.YF-PWLMFGYGLG-------LFLTYLGLYVMNGHGQPALLY
Q93346_CAEEL/222-596LVAHCFTM--NGFS..................ERVRLI.YG-FISVVGYGIG-------LIVTFLALALMK.TAQPALIY
O81062_ARATH/47-318FVALALRF--DVSR..................RRQPQ..YF-TSAFIGYAVG-------VILTIVVMNWFQ.AAQPALLY
Q9VPQ7_DROME/71-354FIALLLRF--DDSK..................KRKTRI.YF-YSTLIAYFLG-------LLATIFVMHVFK.HAQPALLY
IMP2_CAEEL/55-445FIALLRRF--DYRVVQTTAE......SKAPQGSLKGRY.YF-VVTVVAYMAG-------LFITMAVMHHFK.AAQPALLY
YL8H_SCHPO/25-277MLALMYRF--DLHYYIN...........STSQPKKHST.YF-RNTFIAYGLG-------LGVTNFALYYFK.AAQPALLY
Q9VBL1_DROME/96-403LLCFVLRY--DAYKKAQGVTSD..PTLSPPRGVGSRLT.YF-HCSLLGYFLG-------LLTATVSSEVFK.AAQPALLY
YKK0_YEAST/145-505FIAMCYKY--DIWKWHLDHD.....DTEFHFLNWSYVGKYF-ITAMVSYVAS-------LVSAMVSLSIFN.TAQPALLY

PF06550

Q97CT3_THEVO/10-286LVVSSALY--GISN------------------IL.....YFTLLPLGGGLIG-------MAVLYF.--CNRDRPAPGLPY
Q9HM09_THEAC/1-278MVVSSAIY--GISH------------------IL.....FFTVLPLAGGLIG-------MAVLYF.--WNRDRPAPGLPY
Q9HQ23_HALSA/15-306MVASAAFF--LDTP------------------PVVAGIELAPLTAMAGTLVG-------LLVLMRM--VFAGRAHAGLPL
Q8TIY9_METAC/27-303LVVSANVF--LEN.------------------...GGLSYPVLGAMLGTLVG-------HIFLSIL--VMRGKPQAGLPF
Q8PYF3_METMA/18-294LVVSANVF--IEN.------------------...GGISYPVLGAMLGTLAG-------HVILSIL--VMRGKPQAGLPF

PF01080

SPE4_CAEEL/5-465LIGQAAAS..GCP--------------------------FAVISAALGILFG-------LVVTLTVFSTEE-STTPALPL
HOP1_CAEEL/1-349MLGNTVQT..CPL--------------------------PTVVACFVSNLVG-------LTITLPIVTLSQ-TALPALPF
PSN1_RAT/70-459LVGKASATASGDW--------------------------NTTIACFVAILIG-------LCLTLLLLAIFK-KALPALPI
PSN_DROME/92-532LVGKASSY..GDW--------------------------TTTIACFVAILIG-------LCLTLLLLAIWR-KALPALPI
PSN2_RAT/76-439LVGKAAATGNGDW--------------------------STTLACFIAILIG-------LCLTLLLLAVFK-KALPALPI
PSN_CAEEL/38-435LLGKASSY..FDW--------------------------NTTIACYVAILIG-------LCFTLVLLAVFK-RALPALPI

PF01478

LEP4_BACSU/100-204------------------------------------------LFAVIGFVLG.......VKML.................
Q9HWA5_PSEAE/4-110------------------------------------------YLAALGLASD.......PLTV.................
Q8FME5_COREF/77-189------------------------------------------FAAVVGVFLGW....FSWQHV.................
Q9CPF6_PASMU/89-199------------------------------------------LMLGLGSMSH.......FAWL.................
Q9RSQ9_DEIRA/109-347------------------------------------------LAAVIGAFLG.......WERL.................
Q97HN8_CLOAB/64-168------------------------------------------IFIICGISIG.......FYKS.................
Q8XQX7_RALSO/14-117------------------------------------------FFAVAGLLAG.......WHGL.................
Q8VQ80_BACLI/101-205------------------------------------------LFAVIGMALG.......SRLL.................
LEP4_HAEIN/90-200------------------------------------------LAMALGSFIH.......LETL.................
LEP4_NEIGO/134-243------------------------------------------LIAALGAWLG.......ISAL.................
Q8TMQ5_METAC/5-101------------------------------------------SLILISLLFP............................
Q8GBD6_YEREN/122-231------------------------------------------LLAALGAWLG.......WMAL.................
Q8E192_STRA5/8-102------------------------------------------YLATIGLSLP.......LHQM.................
Q8NQ30_CORGL/4-110------------------------------------------LALGLGTAVAALGMQALMVAI.................
Q98BF9_RHILO/11-116------------------------------------------LLAATAVWMG.......LNIH.................
P94648_CHLLI/90-200------------------------------------------LLAALGAWWG.......VVDV.................
Y421_METTH/12-138------------------------------------------LFTAVTSLLP.......FQPSLVSYSFLGTAFPVTASY
LEP4_PECCC/135-244------------------------------------------LLAALGAWLG.......WQAL.................
Q8CXM1_OCEIH/104-208------------------------------------------LLGLAGIVLG.......VEKI.................
A9CKJ3_AGRT5/8-113------------------------------------------LLTGAAVWYG.......FNIS.................
Q8TXH1_METKA/6-112------------------------------------------LLPSLTLFLH.......RGDRIT...............
Q8DLL0_THEEB/89-199------------------------------------------LAAMIGAWLG.......WQGL.................
YC8A_METJA/6-148------------------------------------------FLMGLSYLKG.......MFFT.................
HOPD_ECOLX/9-119------------------------------------------FLAALGAWHT.......WTFL.................
Q9XAP1_STRCO/112-224------------------------------------------LALTAGAVLGW....YGWPTL.................
LEP4_MYXXD/113-222------------------------------------------LVAMLGAFLT.......WRAL.................
LEP4_XANCP/133-242------------------------------------------LLAALGAWCG.......LKGI.................
Q9ZIU7_SALTI/78-184------------------------------------------LVCALVGWMG.......VTDA.................
LEP4_AERSA/139-248------------------------------------------LLAALGAWLG.......WQAL.................
Q8ZWV8_PYRAE/8-110------------------------------------------AMALIGSAPP.......VPPFP................
Q8TLD4_METAC/26-152------------------------------------------GLLVLSILFP.......LYPIFQFSGEAYPLLGRPLIG
O67535_AQUAE/105-214------------------------------------------LLGFIGSVSG.......VYGV.................
Q988A4_RHILO/13-122------------------------------------------MLAAASCWIS.......PLLL.................
Y902_METJA/9-134------------------------------------------LIMGLGALIP.......KYNMPIHTPLGAILNYLYLPS
Q8XVK3_RALSO/140-249------------------------------------------LMGALGAWFG.......WQAL.................
Q87I88_VIBPA/13-110------------------------------------------LIGVLFLGVN.......DEYM.................
Q8F6L1_LEPIN/127-232------------------------------------------FAPIYAFIAG.......HPWW.................
Q891G5_CLOTE/115-221------------------------------------------VIFIAGLFLG.......IKLC.................
Q8DA80_VIBVU/9-110------------------------------------------L.AVICVWMV.......FPNW.................
Q9K8H1_BACHD/15-120------------------------------------------LFTVLGFVLG.......WKLT.................
LEP4_PSEAE/136-245------------------------------------------LLAMLGAWGG.......WQIL.................
Q8XI34_CLOPE/100-206------------------------------------------IHAIAGIFLG.......WKLA.................
Q9S5E3_ECOLX/119-229------------------------------------------LICALAAWIG.......WYNI.................
Q8EJP8_SHEON/157-266------------------------------------------LLAVFGAWLG.......WQML.................
Q8KYA3_STAAU/91-187------------------------------------------LISALSLFFP.......LQFT.................
Q9CMH2_PASMU/11-110------------------------------------------LMSVLMLTIP.......HSQI.................
Q92T43_RHIME/12-117------------------------------------------LLTASAAWFG.......FNES.................
HOPD_SALTY/9-119------------------------------------------YLAALGAWHC.......WETL.................
Q933W3_ECOLX/68-175------------------------------------------LIAGVAMWSS.......ANST.................
Q8DVF1_STRMU/96-190------------------------------------------YLATLALSLN.......LQQI.................
Q8FT27_COREF/8-114------------------------------------------FALGLGTVAATGSVEGWLLAV.................
Q8CNZ3_STAES/98-194------------------------------------------LFNILGLIFP.......LNFF.................
Q87AA6_XYLFT/133-242------------------------------------------MLGALGAWCG.......LKGI.................
Q8THK9_METAC/8-134------------------------------------------ALIVIGTLVP.......VYPVLDFYGYTFPLLGFPPVG
Q8RAF7_THETN/104-208------------------------------------------LMALIGFFIG.......WKLV.................
LEP4_BURPS/126-235------------------------------------------LLAALGAWLG.......WEAL.................
PPPA_ECOLI/130-240------------------------------------------LFAALGGWVG.......ALSL.................
Q8K6R2_STRP3/88-182------------------------------------------YLASLALVLD.......LTSL.................
Q8VRL2_THETH/101-317------------------------------------------LLGALGAWLG.......PYAF.................
Q92YL6_RHIME/12-116------------------------------------------LLPVAVLWLG.......ADLA.................
Q89PI9_BRAJA/13-114------------------------------------------LLTALAIGFP.......LTGV.................
Q89UH6_BRAJA/9-113------------------------------------------VAASVALWFG.......FAQL.................
Q87M36_VIBPA/5-111------------------------------------------LLAVIGAWLG.......LSNLWE...............
O66151_AGGAC/10-109------------------------------------------LASVLMLAVP.......SDEV.................
O07379_9ZZZZ/78-183------------------------------------------LIAGITAWSG.......LYNA.................
O32576_ECOLX/98-207------------------------------------------LAAALGAWMG.......WQAL.................
Q8Y6Y1_LISMO/101-204------------------------------------------ILIILSTFLG.......FKIG.................
O68839_VIBCL/134-244------------------------------------------LLAALGAWLG.......WQQL.................
Q57382_ECOLX/116-222------------------------------------------LATAAGAWLG.......IDKM.................
Q9L719_CAUCE/10-114------------------------------------------LFAVCALWLG.......WPAA.................
Q89HG8_BRAJA/40-149------------------------------------------LAAVCGAWLD............................
Q8X252_METMI/5-130------------------------------------------ILIGLGALVP.......KFQMPIYTSLGTLLNLNYIPN
Q8DNN1_STRR6/96-190------------------------------------------FLASCALVFS.......VTEL.................
LEP4_ERWCH/136-245------------------------------------------LLAALGAWLG.......WQAL.................
Q8YXA0_NOSS1/108-226------------------------------------------LAAMMGAWLG.......WRYL.................
Q9X222_THEMA/103-204------------------------------------------LAMGIGFLLS.......PVPS.................
Q8NKW5_METVO/5-130------------------------------------------ILMGMGALIP.......SYAFPVYSSLQPLYTMEYIPW
Q92BG4_LISIN/101-204------------------------------------------ILIILSSFLG.......FEMG.................
Q9CE22_LACLA/97-191------------------------------------------WFFTASFSLT.......FLNE.................
Q8CZX6_YERPE/153-262------------------------------------------LMAALGAWFG.......VSAV.................
Q8PWB1_METMA/12-138------------------------------------------GLIVLSILFP.......LYPVFLFSGKVYPLLGLPPIG
P95002_MYCTU/4-113------------------------------------------LAIGLGGLTGCFGVEVWFLAA.................
LEP4_LEGPN/135-244------------------------------------------LFAAFGAWLG.......WMYL.................
LEP4_VIBCH/112-221------------------------------------------LYTAIGTLIG.......VEFV.................
Q989C3_RHILO/11-122------------------------------------------LMAVVPFLVG.......GNDLVG...............
LEP4_DICNO/138-247------------------------------------------LLACLCAWQG.......AWML.................
LEP4_ECOLI/81-190------------------------------------------LLAAAGAWCG.......WQTL.................
Q04904_ECOLX/71-179------------------------------------------LIAGTGVWFP.......TPEI.................
Q9ABP2_CAUCR/121-230------------------------------------------LLGAIGAWVG.......WQGL.................
Q93R20_GLUDI/111-221------------------------------------------LLAAGGAWLG.......PESL.................
LEP4_KLEPN/124-227------------------------------------------LLAALGAWLG.......WQAL.................
Q8Y1N3_RALSO/10-114------------------------------------------LMGAIGAFTG.......PLAA.................
Q88QB9_PSEPK/4-110------------------------------------------LMGALALATS.......PQYV.................
Y83C_METJA/9-115------------------------------------------LFTALAPIFA.......YPNSFVFY..........IPK
Q8KRY3_AGGAC/90-200------------------------------------------LALGLGVFLP.......AQQL.................
Q87VV0_PSESM/5-111------------------------------------------LMTALALASN.......TAYL.................
O29326_ARCFU/8-129------------------------------------------AIMALAVIFP.......FYPTFNGFPL......LGPSF
Q8KQJ2_HAEDC/11-110------------------------------------------LMAVLMLAVP.......PEYT.................
Q97FF6_CLOAB/100-211------------------------------------------VLLMCGLFLG.......MKLG.................
Q8RHE5_FUSNN/7-119------------------------------------------LIIPLGGLLY.......LGEINFF.............L
Q980Y8_SULSO/10-125------------------------------------------LNVILSLANA.......SVISLVPSRF......LVIGL
Q8R8E5_THETN/6-111------------------------------------------LLTALAFFFG.......SDI..................
LEP4_SYNY3/108-223------------------------------------------LASMVGAWLG.......WPSL.................

PF04258

SPPL3_MOUSE/60-369LVPFTLLPLL-TMAYLKGDLRRMWS
SPP2A_MOUSE/213-494LVPCTLITVS-VVAWSRKEMKKFWK
SPP2B_HUMAN/213-500LVPCTLVTSC-AVALWRRELGVFWT
HM13_MOUSE/62-345LVPACIGFPV-LVALAKGEVAEMFS
Q9CAD4_ARATH/241-517IVPFTLGKLE-NFAT...SLSFALS
Q9LQ94_ARATH/239-595IVPFILGTLF-VLGHKRGDLKTLWT
Q9MA44_ARATH/240-519LVPCTLGITV-ILGLVRKELRDLWN
Q93346_CAEEL/222-596LVPSTLFPII-MLALCRGEFLKIWN
O81062_ARATH/47-318IVPAVIGFLA-SHCIWNGDIKPLLA
Q9VPQ7_DROME/71-354LVPACMGTPL-LVALIRGELKVLFA
IMP2_CAEEL/55-445LVPCCLFVPL-LLAVIRGELSALWN
YL8H_SCHPO/25-277LSPACIVAPL-LTAWYRDELKTLFS
Q9VBL1_DROME/96-403LVPFTLLPLL-LMAYLKGDLRRMWS
YKK0_YEAST/145-505IVPSLLISTI-LVACWNKDFKQFWN

PF06550

Q97CT3_THEVO/10-286INTGTIAGFL-IAFVMFKV------
Q9HM09_THEAC/1-278INTGTIAGFL-IAFLAFRV------
Q9HQ23_HALSA/15-306LNGGAIAGYL-VGAVAAGI------
Q8TIY9_METAC/27-303LNSGAIIGFF-IGVLFSGA------
Q8PYF3_METMA/18-294LNSGAILGFF-AGVLLSGA------

PF01080

SPE4_CAEEL/5-465PVICGTFCYF-SSMFFWEQLYG---
HOP1_CAEEL/1-349PLAIAAIFYF-SSHIALTPFTD---
PSN1_RAT/70-459SITFGLIFYF-ATDYLVQPFMD---
PSN_DROME/92-532SITFGLIFCF-ATSAVVKPFME---
PSN2_RAT/76-439SITFGLIFYF-STDNLVRPFMD---
PSN_CAEEL/38-435SIFSGLIFYF-CTRWIITPFVT---

PF01478

LEP4_BACSU/100-204..AAAFFFSV.LIGALYGA------
Q9HWA5_PSEAE/4-110..LYSLAFGC.LLCIALFI------
Q8FME5_COREF/77-189..AIGTLLAF.VLNVVVAV------
Q9CPF6_PASMU/89-199..PLWLFLAC.VMGLGYVC------
Q9RSQ9_DEIRA/109-347..LLAVVVAI.FAGAVLGL------
Q97HN8_CLOAB/64-168..IEVLILSI.FLCGIYGI------
Q8XQX7_RALSO/14-117..VAIWLVSS.VLAGVHAL------
Q8VQ80_BACLI/101-205..VLAFFLSA.AAGTVLGL------
LEP4_HAEIN/90-200..PHFLLLAS.VLGICFSL------
LEP4_NEIGO/134-243..PVLIFVSS.LIGLVAAI------
Q8TMQ5_METAC/5-101..DPVLIIWIMFISSVIVI------
Q8GBD6_YEREN/122-231..PSLLLTAS.LTGIAFAL------
Q8E192_STRA5/8-102..LFIIQIGA.WLGIIYCL------
Q8NQ30_CORGL/4-110..VGSSLISV.LLGGIFAA------
Q98BF9_RHILO/11-116.LVEYLVVST.LIGGLLTI------
P94648_CHLLI/90-200..LYMMMLAS.VITVVWNL------
Y421_METTH/12-138PFPLTVIINS.ILALLPFL------
LEP4_PECCC/135-244..PNLVLVAA.LSGLVVTL------
Q8CXM1_OCEIH/104-208..ILAFFLAC.IIGSVISI------
A9CKJ3_AGRT5/8-113.LVEFLLAVT.LVGGALTV------
Q8TXH1_METKA/6-112TGIDVLFNSI.LLYAPFAL------
Q8DLL0_THEEB/89-199..LVTFFLAC.ALGGLMGG------
YC8A_METJA/6-148..FIIFLNAI.LFVIPYCI------
HOPD_ECOLX/9-119..PRLVFLAASFACGAVVV------
Q9XAP1_STRCO/112-224..MLGTFAGF.LLGALYGG------
LEP4_MYXXD/113-222..LGVLLFAS.MQGAVVGI------
LEP4_XANCP/133-242..LPIILISS.LVGAVLGS------
Q9ZIU7_SALTI/78-184..LQAAFFGL.SGFMLWQW------
LEP4_AERSA/139-248..PIVLLLSS.LVGAIFGI------
Q8ZWV8_PYRAE/8-110TAFIVILAGS.VLLPVHMV------
Q8TLD4_METAC/26-152LFTLTVLGNALLLTALIPL------
O67535_AQUAE/105-214..FSALFIGS.FLGLLYAL------
Q988A4_RHILO/13-122..PVLLFIAS.ASALLFVG------
Y902_METJA/9-134FPIMVVINAM.FFSITLPI------
Q8XVK3_RALSO/140-249..PLLVLLSS.VVGLVFGV------
Q87I88_VIBPA/13-110..LAAIVAIG.LLGGIQIL------
Q8F6L1_LEPIN/127-232..MFFLNASY.IPAVLFTI------
Q891G5_CLOTE/115-221..FLLTFLSF.FIGAIISV------
Q8DA80_VIBVU/9-110..GELILLSA.LGAGVLAI------
Q9K8H1_BACHD/15-120..LVAIMLSS.LCGAIGGG------
LEP4_PSEAE/136-245..PLTILLSS.LVGAILGV------
Q8XI34_CLOPE/100-206..IINIFLSF.IIGGIIAV------
Q9S5E3_ECOLX/119-229..PFLLVISS.IIGGVMFI------
Q8EJP8_SHEON/157-266..PLVILLSS.LVGAFVGI------
Q8KYA3_STAAU/91-187..IYVILFTF.VIAGLVAL------
Q9CMH2_PASMU/11-110..IYFFLFTA.FSGLFLII------
Q92T43_RHIME/12-117.LVTFLVYVS.FFGGFLTL------
HOPD_SALTY/9-119..PLLVFLAAMLACGGFGV------
Q933W3_ECOLX/68-175..PWIIGIAA.TGTMVCMS------
Q8DVF1_STRMU/96-190..IWIIQIAS.LLGILYSL------
Q8FT27_COREF/8-114..VGSSLLTL.LLAGVTLS------
Q8CNZ3_STAES/98-194..FFIVVFTF.IIGGIFAI------
Q87AA6_XYLFT/133-242..LPIILISS.LAGVVLGS------
Q8THK9_METAC/8-134LFSLTVLENSVLLTAIIPL------
Q8RAF7_THETN/104-208..LLNLLLGV.VLGALAGV------
LEP4_BURPS/126-235..PQVVLIAA.VAGAAVGL------
PPPA_ECOLI/130-240..PNVALIAS.CCGLIYAV------
Q8K6R2_STRP3/88-182..IWLIQLAS.LAGITACL------
Q8VRL2_THETH/101-317..LALFLGV..FAGALLGL------
Q92YL6_RHIME/12-116..LPFILYTS.VIGAALTV------
Q89PI9_BRAJA/13-114..IQLLTVTA.LAGGILAL------
Q89UH6_BRAJA/9-113..MNFLLYAS.LFGGALTL------
Q87M36_VIBPA/5-111ASIGIILAGG.IVGIFYLM------
O66151_AGGAC/10-109..FSFFFFTT.FAGLGLII------
O07379_9ZZZZ/78-183..IWCVLLGT.GGFVLWHS------
O32576_ECOLX/98-207..PSILLFAS.VSGLIVTV------
Q8Y6Y1_LISMO/101-204..YYIFFLAI.IMGTIILL------
O68839_VIBCL/134-244..PVIVLLSS.VVGVIFGL------
Q57382_ECOLX/116-222..PFFLILSS.FIFILYSL------
Q9L719_CAUCE/10-114..LTFMLYTG.LAGGVLTF------
Q89HG8_BRAJA/40-149..LATVAAVI.ELAALLAI------
Q8X252_METMI/5-130FPIMVFINGI.FFMVFLPF------
Q8DNN1_STRR6/96-190..LILIQFAS.ATGILAFL------
LEP4_ERWCH/136-245..PNLVLIAS.LTGLTATL------
Q8YXA0_NOSS1/108-226..LLAGLIAC.TLGALVGV------
Q9X222_THEMA/103-204..IFAILIAS.ISGILYAL------
Q8NKW5_METVO/5-130FPLLVFFNGV.ILMIVLPI------
Q92BG4_LISIN/101-204..YIVFFLSI.VLGAIILL------
Q9CE22_LACLA/97-191..MLLLQIAC.SLGIIYYL------
Q8CZX6_YERPE/153-262..PFLILFSS.FFGLVAYA------
Q8PWB1_METMA/12-138LFTFTVLENALLITVLVPL------
P95002_MYCTU/4-113..LAAPLLTA.VCGVMVTP------
LEP4_LEGPN/135-244..PIILLISS.ITGAIIGL------
LEP4_VIBCH/112-221..PYLFLLSS.IIAFIHWF------
Q989C3_RHILO/11-122FSILLLLFAL.ATAVVVKN------
LEP4_DICNO/138-247..PIILFSAA.ILGMIYAL------
LEP4_ECOLI/81-190..PMILLIAS.LGGIGYAI------
Q04904_ECOLX/71-179.ACSIVFIAV.IGGIIFFT------
Q9ABP2_CAUCR/121-230..PSVLVWAC.VAGLSVAI------
Q93R20_GLUDI/111-221..PHVVFLGAVLTLCAVAI------
LEP4_KLEPN/124-227..PQTLLLAS.PA......------
Q8Y1N3_RALSO/10-114..LHVGLASC.VAGGVLAV------
Q88QB9_PSEPK/4-110..LGTFIGAG.VTVLVWLL------
Y83C_METJA/9-115YILYLIAISM.FIAAVFPM------
Q8KRY3_AGGAC/90-200..PVFLFLAC.FFGLLYAA------
Q87VV0_PSESM/5-111..LCTFIGAG.VAMLAWAL------
O29326_ARCFU/8-129SFAFSTLANS.VIAAPFLL------
Q8KQJ2_HAEDC/11-110..IFFLFFTT.CAGLGLII------
Q97FF6_CLOAB/100-211..MFMLFISF.VLAGFVSI------
Q8RHE5_FUSNN/7-119QIYIFYLLVF.SLATLYII------
Q980Y8_SULSO/10-125EPLVIVLYSS.IIILIFSL------
Q8R8E5_THETN/6-111..MVLLLIAG.ITATAYGV------
LEP4_SYNY3/108-223..LLTTFIAC.FIGSIYGG------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window