Sequence alignment for CL0130

PF04258

SIPL5_ARATH/240-524--GAEEETLD......ISAMGAVIFVISASTFLVLL-------FFFMSSW---------....FIL..............
SPP2A_MOUSE/214-499--KKKDDYLT......FSPLTVVVFVVICCIMIVLL-------YFFYRW.---------....LVY..............
SIP_ARATH/47-323--KDTPPTET......MSKEHAMRFPLVGSAMLLSL-------FLLFKFL---------SKDLVNA..............
SPP2B_HUMAN/213-505--KQEDEAVD......VTPVMTCVFVVMCCSMLVLL-------YYFYDL.---------....LVY..............
Q9VPQ7_DROME/71-359--STGEKADT......MTKKDAMYFPLIASAALFGL-------YLFFKIF---------QKVHINY..............
Q9VBL1_DROME/96-408--EPTDKFAT......LDTMHALCLPLGASISLLIM-------FFFFDS.---------....MQL..............
SIPL4_ARATH/241-527--TSSRGVVE......VTVISAILFVVVASCFLIML-------YKLMSFW---------....FIE..............
SIPL2_ARATH/242-525--GGS.GVVE......INSISAIFFVVLASGFLVIL-------YKLMSYW---------....FVE..............
YL8H_SCHPO/31-282--QL............INKRLAVLFPIFGGVTLVLM-------YLALRYL---------SKEYIQL..............
YKK0_YEAST/145-510--KSKRFFDM......MDEKHAIILPLTSGCTLLAL-------YFVIKKL---------HLNWLKY..............
SPPL3_MOUSE/60-374--STNNSIQT......IDSTQALFLPIGASVSLLVM-------FFFFDS.---------....VQV..............
IMP2_CAEEL/55-450--KKRLIEGS......ITMREARKFPISASLVLFGL-------YLFFKPA---------AERFLWVARVFQILRVPEEYV
HM13_MOUSE/62-350--SSSDMPET......ITSRDAARFPIIASCTLLGL-------YLFFKIF---------SQEYINL..............
Q93346_CAEEL/275-601--SPSNDSETKGFLDRFGGIITICLMMTTLCGVLLL-------GYFFRPV---------....LVI..............

PF06550

Q9HM09_THEAC/1-278-----MTIFV------LSSLLAILLAVAIYNSEPSS-------YAHRSPT---------YGIGYVF--------------
Q9HQ23_HALSA/15-306-----VALFV------VVQVGALALVEPFQSAGLQ.-------.STENPQ---------NPLNSVV--------------
Q8TIY9_METAC/27-303-----AGLIL------IVQVLALLLSMPMEINDMQ.-------.AFEDPT---------QVSNSIY--------------

PF01080

D3B5F5_POLPA/149-528...SDQMVSI------AIPVFFTMVVVTAVIRAISVPDNQSSPPPANRID.........IPAGFKY--------------
G4VJ47_SCHMA/58-484YYGAKQIISL------FIPVTVCMLFVVAVASTVDF.......YG..HTD..........QY.LLY--------------
T1KI16_TETUR/103-479KYGASHVIKL------FIPVSICMLIVVASIGSLQF.......YT..KTN..........QY.LLY--------------
K7J3W8_NASVI/92-490KYGAVHVIKL------FVPVSLCMLVVVATISSIGF.......YT..TKG..........VY.LVY--------------
A0A068XH02_HYMMI/46-488RVGAKQIISL------FIPVTICMFFVAFISKNVPF.......FS..TTD..........AH.SVY--------------
W5JK58_ANODA/96-499KYGAQHVIKL------FVPVTLCMLVVVATISSINF.......YT..IKD..........VY.LVY--------------
E9FSB0_DAPPU/62-438KYGAAHVIKL------FVPVSLCMMVVVATISSVTY.......YT..QKG..........IY.LVY--------------
C5WT76_SORBI/25-446...GEDITRI------VYPVSACMLLVVLLVSLL..........SSPSSP.SPLS....ASIAAAT--------------
C3Z2C5_BRAFL/88-496KYGAKHVIML------FAPVSLCMAVVVATISSITF.......YT..EKN..........GY.LIY--------------
H2TY46_TAKRU/29-412KYGAKHVIML------FIPVTLCMVVVVTTIKSVSF.......YS..EKS..........DQQLIY--------------
H3AT04_LATCH/77-455KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..KKN..........GQ.LIY--------------
I1HEG8_BRADI/69-507...GEEVLAV------MSPVSICMALVVLLISIL..........SPPSSPASPSAPPPVTAATLVY--------------
W4XU10_STRPU/68-474KYGAKHVIML------FVPVSLCMLVVVATISTVSF.......YT..ESG.........DVY.LIY--------------
G7Y344_CLOSI/42-431VFGAKQVIRL------FIPVTICMFFVVLVATTVDY.......YA..STE..........TY.LIY--------------
B7Q2V0_IXOSC/41-421KYGAKHVIRL------FVPVSLCMLVVVATISSISF.......YR..HTN..........TY.LVY--------------
PSN1_RAT/76-458KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..RKD..........GQ.LIY--------------
T1JMG4_STRMM/67-438KYGAKHVIKL------FVPVTLCMLVVVATISSVTF.......YT..QRG..........KF...Y--------------
T1G6P3_HELRO/9-376QYGAESIIML------FIPVSICISFVIASVQALDF.......YK..EEG..........LP.LPF--------------
D7LLE1_ARALL/15-389...GEELIAI------LTPVSICMFTVVLLVCILN........SDPSSSS.ASFS....SIATAAY--------------
A2G9L8_TRIVA/13-428.IYSKRIYKI------AVPVILTLVIDVWLTRTLEEKFDNTALSTSFASV................--------------
F6RA92_CIOIN/37-422RYGASTVISL------FIPVTLCMLVVVATITSVSY.......YTDQSQQ..........QF.LVY--------------
I3IV36_ORENI/95-480KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..QND..........GQRLIY--------------
H2Z6F8_CIOSA/7-395RYGANTVISL------FIPVTLCMLVVVATITSVSY.......YTDQSQG..........QY.LVY--------------
K1PKB7_CRAGI/84-479LYGAKHVIML------FVPVSLCMAVVVATISSVTF.......YT..EKG..........GY.LVY--------------
S2K404_MUCC1/83-504.FYTLQIYRI------IKPVVACIILSIFWVKVS.........YSGSSDY....SPTRPNYVNLTP--------------
H3FRQ2_PRIPA/66-481KYGAEHVIRL------FVPVSICMALVILTMKMMSY.......YS..IVQ.........PEMGFVY--------------
E0VJ41_PEDHC/87-467KYGAKHVIKL------FAPVSLCMLVVVATISSIKF.......YT..TSD..........MY.FVY--------------
E2AIY0_CAMFO/93-484KYGAAHVIKL------FVPVSLCMLVVVATISSVHF.......YT..TKG..........MY.LVY--------------
F4PRZ5_DICFS/219-583..YSKAMVSI------ALPVSISMAIVISAVRLSEEARNFKSVSPL.................IQY--------------
B0WS38_CULQU/61-516KYGAQHVIKL------FVPVTLCMLVVVATISSINF.......YS..TKD..........VY.LVY--------------
A0A068YDE2_ECHMU/45-476RIGAKQIISL------FIPVSICMFLVVFISKTVPY.......FS..TTD..........VY.LIY--------------
E2BSL4_HARSA/95-504KSGVVHVINL------FIPVSLCMLVVVATISSVNF.......YT..TKG..........MY.LVY--------------
H9J5W9_BOMMO/68-456KYGARHVIKL------FVPVTLCMLVVVATISSINF.......YS..VKD..........VY.LAY--------------
G3Q8S2_GASAC/77-448KYGAKHVIML------FIPVTLCMLVVVVTIKSVSF.......YT..EKT..........NQTLIY--------------
F6GSZ0_VITVI/15-427...GEEIIRI------ISPVSICMFLVVLLVTILN........SDTSSSS.SSVS....TIATIAY--------------
B4QRZ4_DROSI/98-517KYGAQHVIKL------FVPVSLCMLVVVATINSISF.......YN..STD..........VY.LLY--------------
SPE4_CAEEL/11-464LVRSSQLRWT------LFSVIANMSLTLSIWIGV.........YNMEVNS..........ELSKTY--------------
C7J054_ORYSJ/30-449...GEDITRI------VTPVSTCMLLVVLLVSLL..........SSPSSP.SPFT....AAFSAAA--------------
T1HN85_RHOPR/7-402KYGAAHVIKL------FVPVSLCLLVVVATMNNITF.......YS..TRD..........IY.LLY--------------
A9S846_PHYPA/9-467..VGGEIVGI------VTPVSICMFLVVTLVHIL..........DPRGED.APVS....NIAMMVY--------------
E3N426_CAERE/9-463FRRSSQLQWT------LFSVIVNMSLTLSIWIGI.........YQMQVNS..........ELSKLY--------------
D8LTV7_ECTSI/63-572AYSANSFMAV------VKPVTLCMTLSAFITVSL.........YSDAEGA........TNSALSVY--------------
H3CB70_TETNG/22-406KYGAKHVIML------FVPVTLCMVVVVTTIKSVSF.......YS..EKS..........KQQLIY--------------
G2J6Q7_CAEBR/9-477LRRSSQLQWT------LFSVVVNMSLTLAIWIGI.........YHMEVNS..........ELSKMY--------------
I1N8G3_SOYBN/8-407.WLGVEIIGV------MSPVSICMFLVVLLVYSL..........SSPSTTATTIA....TAANLVY--------------
G3W888_SARHA/88-452KYGAKHVIML------FVPVTLCMVVVVATIKSVRF.......YT..EKN..........GQ.LIY--------------
PSN_CAEEL/44-434KYGASHVIHL------FVPVSLCMALVVFTMNTITF.......YS..QNN.........GRH.LLY--------------
F2CQD9_HORVD/22-450...GEEVLAV------MSPVSICMALVVLLITLL..........APPSSP..PSAPPPVTAATLVY--------------
W5N759_LEPOC/69-512KYGAKHVIML------FVPVTLCMVVVVATIKSVSF.......YT..QKD..........GQ.LIY--------------
Q7PR98_ANOGA/98-513KYGAQHVIKL------FVPVTLCMMVVVATISSINF.......YT..IKD..........VY.LVY--------------
M1CAI2_SOLTU/15-421...GEEIVRI------VTPVSICMLLVVILVSVLN........NDSDSSG.PSFT....SIATVAY--------------
W1NQ31_AMBTC/9-446..VGVEIIGV------MAPVSACMFLVVLLVYNM..........SSQGSD.STIR....TAATLVY--------------
K3WL66_PYTUL/82-563MHGINSFWAI------VFPVCVTMIIASLAVVNYR........NSSIEAS.........MQTYLVY--------------
A2DZ73_TRIVA/13-381.FYARKVAKI------AVPVVLTLILDAVCIRFIERTHGSAELNRNFVDT................--------------
G0NCU3_CAEBE/9-464VRRSAQLQWT------LFSVIANMSLTLSIWIGI.........YRMEVNS..........ELSKMY--------------
U9UMQ1_RHIID/178-561KFYMQQIYKI------IKPVVLCILLSVLWVKISILAPNFRPQHPTQQII................--------------
T1EFZ6_HELRO/89-576KYGAGHVIQL------FIPVSLCMAAVVCGINFIEF.......YN..VKD..........VY.LMY--------------
B7QGI2_IXOSC/14-384...MRQVITL------ICALSICMASVACLVRIL.........KPSKNDG..............MS--------------
A8PAF6_BRUMA/94-527KYGAQHVIHL------FVPVSICMVFVIFTMNTVGY.......YT..RKD.........GQY.LIY--------------
S2J107_MUCC1/49-424QFYVEQLTLL------FYPLIVTFALTCWIEITLNI.......DSSQISN...........PLMVY--------------
D3B4U3_POLPA/99-477...SNMIIAI------LKPVTITMFLVVWAVRSINAKNNILGQYVGGGSM...........GMLVY--------------
H2VWC4_CAEJA/11-477LNRSSQLKWT------LFSVIVNMLLTLSVWIGV.........YGMEVNS..........ELSRLY--------------
A9VBA9_MONBE/203-602KYDAESVLAL------IKPVSACMIVVIATIRSITY.......FS..QND..........TQ.FAY--------------
F2TYS0_SALR5/109-504KYGAESVLAL------IKPVSVCMIVVIATIRSVAY.......FS..TND..........TQ.FVY--------------
E1G929_LOALO/15-397...KKMVERL------LIPVTLNILLTLIVWIGV.........YHTKTDS..........NSVFYY--------------
H3FRQ2_PRIPA/544-933KYGAEHVIRL------FVPVSVCMAVVVLTMNTVEF.......YSEPVTA.........SDATSLY--------------

PF01478

FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRFC/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_CALS4/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_CALS4/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
C9R6J1_AGGAD/90-198--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524.............................................................ILTIFFVIGGMQ--GMHNI
SPP2A_MOUSE/214-499.............................................................VMIAIFCIASSM--SLYNC
SIP_ARATH/47-323.............................................................VLTAYFFVLGIV--ALSAT
SPP2B_HUMAN/213-505.............................................................VVIGIFCLASAT--GLYSC
Q9VPQ7_DROME/71-359.............................................................LLTGYFFVLGVI--ALAHL
Q9VBL1_DROME/96-408.............................................................LFAVCTAIIATV--ALAFL
SIPL4_ARATH/241-527.............................................................VLVVLFCIGGVE--GLQTC
SIPL2_ARATH/242-525.............................................................LLVVVFCIGGVE--GLQTC
YL8H_SCHPO/31-282.............................................................ILQGYASLASII--CFVRS
YKK0_YEAST/145-510..........................................................VVKILNFNITLLNIP--AGTFV
SPPL3_MOUSE/60-374.............................................................VFTICTAVLATI--AFAFL
IMP2_CAEEL/55-450QKINSTIISYTANTTTTGPSEPFLLRLASRIPQERVPEAIQNAATYAYTNLPTIQKAECMQLLTFLICFEGVN--AFASL
HM13_MOUSE/62-350.............................................................LLSMYFFVLGIL--ALSHT
Q93346_CAEEL/275-601.............................................................FFNIFLVIFGTC--SLYGC

PF06550

Q9HM09_THEAC/1-278----------------------------------------------------------VYIIAAFLFS.FVII--YLGRK
Q9HQ23_HALSA/15-306----------------------------------------------------------.YVAFLLVATGGILL--VIKYD
Q8TIY9_METAC/27-303----------------------------------------------------------.YIVMILVFTLFVLI--AIKKN

PF01080

D3B5F5_POLPA/149-528---------------------------------D.......TDPNIQQVFLNTLINSLIFLGVVVLSTVIMVI--LYKFK
G4VJ47_SCHMA/58-484---------------------------------TPFHT...PDADIGTQTWQTIANTLIFMSVVVVMTCVLVL--LFKYQ
T1KI16_TETUR/103-479---------------------------------TPFTD...QKADTTTRVWHSFANAFIFLIVIVVMTFVLIL--LYTYR
K7J3W8_NASVI/92-490---------------------------------TPFHE...ETNDSGTKAWQAVANSLILMAVVVFMTVILIV--LYKYR
A0A068XH02_HYMMI/46-488---------------------------------APFNT...PNADIGTQTWQTLVNVAIILTFVIVITFILVL--LFKFK
W5JK58_ANODA/96-499---------------------------------TPFHE...LADDTGTKIWNALANSLILMTVIVIMTILLIV--LYKHR
E9FSB0_DAPPU/62-438---------------------------------TPFHE...DSPDTGTKVWNAVANAAILLGVIVVMTVFLIM--LYKYR
C5WT76_SORBI/25-446---------------------------------GGV.....SGGGDGDDIPTALITALTFVVAVTAATFLLAL--LFYLR
C3Z2C5_BRAFL/88-496---------------------------------TPFHE...EGASTASKVGDSLANAAIMVGVILVMTVFLVI--LYKYR
H2TY46_TAKRU/29-412---------------------------------TPFTE...NTSSVGRRLLNSVLNTIIMISVIVVMTIFLVV--LYKYR
H3AT04_LATCH/77-455---------------------------------TPFSE...DTDTVGQRALNSILNAAIMISVIIVMTLLLVL--LYKCR
I1HEG8_BRADI/69-507---------------------------------LES.....PSDSPGQKLVGALLDAAVFVALVAVVTFVLVA--LYYYR
W4XU10_STRPU/68-474---------------------------------TPFHE...KSDQAGTKAWNALANALIIIGIVLIMTIFLVV--LYKYR
G7Y344_CLOSI/42-431---------------------------------TPFHT...PDADLGTRTWQTIANTLIFMSVIIVMTCVLVL--LFKYQ
B7Q2V0_IXOSC/41-421---------------------------------TPFTD...QTVDTGTKVWQSFANAFILMGVIVVMTILLIL--LYKFR
PSN1_RAT/76-458---------------------------------TPFTE...DTETVGQRALHSILNAAIMISVIVVMTILLVV--LYKYR
T1JMG4_STRMM/67-438---------------------------------TPFHE...NTTDPGTKAWQSLANAFILMGVIVVMTVFLIL--LYKYK
T1G6P3_HELRO/9-376---------------------------------TPFVPE..EKDEVKDTLWKSLANSLIIVGVVIIMTILLFL--LFKYR
D7LLE1_ARALL/15-389---------------------------------AES.....DSDSSWDKFVGALLNSVVFVAAITVATFVLVL--LFYLR
A2G9L8_TRIVA/13-428---------------------------------.......VSQSSGGVSTAVAIYIAIGFIVAIALVTGLLLL--LYWFN
F6RA92_CIOIN/37-422---------------------------------TPFHT...TNAAPAQVVWESIANSLIMIGVIVVMTVFLVL--LYKYR
I3IV36_ORENI/95-480---------------------------------TPFPE...DTDTVGQRALNSILNATIMITVIIVMTLVLVM--LYKYR
H2Z6F8_CIOSA/7-395---------------------------------TPFHT...QNAGTAQVVWESIANSLIMISVIVVMTIFLVL--LYKYR
K1PKB7_CRAGI/84-479---------------------------------TPFHDGDKADADTGTKVWQSVANALILLGVICVMTIVLLL--LYKFR
S2K404_MUCC1/83-504---------------------------------STSSSSTDGSTSSGPSIANSFTNAAIIIGQIIGVTILIVF--LFKKG
H3FRQ2_PRIPA/66-481---------------------------------TPFHTN..AGDDTSTRVLSGLGNALIMICFIVVMTFGLIL--LYKFK
E0VJ41_PEDHC/87-467---------------------------------TPFHE...TDSNPGTKAWNAVANSLILIAVIVVMTIVLII--LYKKR
E2AIY0_CAMFO/93-484---------------------------------TPFHE...DSSDTSTKVWQAFANSLILMSVIVFMTVILII--LYKYR
F4PRZ5_DICFS/219-583---------------------------------DVR.....EDPATQTLVWGTIINSLILVGIIFLSSVIMFA--LYYFK
B0WS38_CULQU/61-516---------------------------------TPFHE...LSDDTGTKIWNALANSLILMTVIVIMTILLIV--LYKRR
A0A068YDE2_ECHMU/45-476---------------------------------TPFHT...PNADIGTQTWQTLANVVIFLSVIVVMTFLLVL--LFKFK
E2BSL4_HARSA/95-504---------------------------------TPFHE...DSSDTSTKVWQAFANSLILMSVIVFMTVILII--LYKYK
H9J5W9_BOMMO/68-456---------------------------------TPFHE...ESPYASTKVWNALANSMILLCVIALMTVLLIV--LYKKK
G3Q8S2_GASAC/77-448---------------------------------TPFTE...NTASVGRRLLNSVLNTIIMISVIVVMTIFLVV--LYKYR
F6GSZ0_VITVI/15-427---------------------------------SED.....SSDSTWDKFKGALLNSLVFVGVVTVVTFLLVL--LFYLR
B4QRZ4_DROSI/98-517---------------------------------TPFHE...QSPEPSVKFWSALANSLILMSVVVVMTFLLIV--LYKKR
SPE4_CAEEL/11-464---------------------------------FLDPS...FEQTTGNLLLDGFINGVGTILVLGCVSFIMLA--FVLFD
C7J054_ORYSJ/30-449---------------------------------G........PGGGGDDITTALITAVTFVVAVTAATFLLAF--LFYLR
T1HN85_RHOPR/7-402---------------------------------TPFHE...RSSDPGTKMWNALANATILLSVIVLMTVLLIL--LYKYR
A9S846_PHYPA/9-467---------------------------------NEQ.....ASDSFSEKLGGALLNAIVFVVIVTLVTFMLVA--LFYYR
E3N426_CAERE/9-463---------------------------------FLDDS...FERTTGNTTLDGLINGFATILVLGCVSFVMLA--FVLYD
D8LTV7_ECTSI/63-572---------------------------------EVYDESTTTLDPSSVRLGKSFVNALIIVLVLAAATFVIVW--MYWMR
H3CB70_TETNG/22-406---------------------------------TPFSE...DTSSVGQRLLHSVLNTVIMISVIVVMTVFLVV--LYKYR
G2J6Q7_CAEBR/9-477---------------------------------FLDDS...FNWTTGNPALDGLINGFCTILVLGCVSFVMLA--FVLYD
I1N8G3_SOYBN/8-407---------------------------------AEN.....PSDTAAQKLEGAVLNAVVFIVFIALATFLLVL--LYYYN
G3W888_SARHA/88-452---------------------------------TPFTE...DTPSIGQRLLNSVLNTLIMISVIVVMTIFLVV--LYKHR
PSN_CAEEL/44-434---------------------------------TPFVR...ETDSIVEKGLMSLGNALVMLCVVVLMTVLLIV--FYKYK
F2CQD9_HORVD/22-450---------------------------------LES.....PSDSPAQKLVGALLDAVVFIALVAVVTFVLVA--LYYYR
W5N759_LEPOC/69-512---------------------------------TPFPE...ETETVGQRALNSILNAAIMISVIVVMTLLLVV--LYKYR
Q7PR98_ANOGA/98-513---------------------------------TPFHE...LTDDTGTKIWNALANSLILMTVIVIMTILLIV--LYKHR
M1CAI2_SOLTU/15-421---------------------------------NES.....SSDSNWDKLKGAILNALVFVVVVTAVTFLLVL--LFYFR
W1NQ31_AMBTC/9-446---------------------------------LEK.....STDSNTQKFEGALLNAGVFVILIALVTFLLVM--LYYYR
K3WL66_PYTUL/82-563---------------------------------GSS.....DQDSGAQQLGMSLVNAVVIIGAIAVLTFGMAL--LYKYN
A2DZ73_TRIVA/13-381---------------------------------.......MSRNDSGISVTASIWSAVGIIFMIIVVTAILLT--LYYFG
G0NCU3_CAEBE/9-464---------------------------------FLDDS...FNWTTGSPTLDGLINGFCTILVLGGVSFIMLA--FVLYD
U9UMQ1_RHIID/178-561---------------------------------.....DTSEDASESAQIFNSFLTAAVIIGNIIVVTIIIVC--LFKYG
T1EFZ6_HELRO/89-576---------------------------------TPFEQSVTPETSTGTRIWQSLANALIMLSVVIVMTVVLLL--LYKYR
B7QGI2_IXOSC/14-384---------------------------------QPYVRYPVEYDAEPVLLMNSFANAFSFLSMIMIVNCTLVL--LYKGG
A8PAF6_BRUMA/94-527---------------------------------TPFTK...ETDNTGEKLIMSFGNAFIILGVVVTMTVLLIF--LYKFR
S2J107_MUCC1/49-424---------------------------------DEL.....PSDSVGTRLGGSVLNAIIVVCGITLMTFMFVL--CFKYR
D3B4U3_POLPA/99-477---------------------------------NES.....SDDSTGQKIWGSLLNGLVFLVVIVLTTVAFVL--LYKYR
H2VWC4_CAEJA/11-477---------------------------------FLDTA...SNSTTGNPVLDGAINGMFTIVVLGIVSFVMLG--FVLYD
A9VBA9_MONBE/203-602---------------------------------TPFESNGGAGESSGERFGGAVLNALIVVGIVIVMTFILVM--LYIYE
F2TYS0_SALR5/109-504---------------------------------TPYESN.NPNASNSEKFGGAILNALIIIGIVVGMTCVLLL--LYKYR
E1G929_LOALO/15-397---------------------------------MLDPG...HNRTTGNEIVDGMVNGIGCVLMLAVISFALLA--MALYD
H3FRQ2_PRIPA/544-933---------------------------------TPFLSD..EEDDTSTRVLSALGNAGIMIGVIVVMTFVLIL--LYKYK

PF01478

FLAK_METJA/5-130---------------------------------------------------------------IVGAIGLLIA..SIYDL
FLAK_METMP/5-130---------------------------------------------------------------IIGVIGLLLA..SVQDF
LEP4_BACSU/100-204---------------------------------------------------------------VVFISLLIIV..AVTDI
Q9HWA5_PSEAE/4-110---------------------------------------------------------------LALALWASVC..GYQDI
Q8FME5_COREF/77-189---------------------------------------------------------------AAAAVGCTLL..MVIDL
Q9CPF6_PASMU/89-199---------------------------------------------------------------ASYVSIAICI..AVIDW
Q9RSQ9_DEIRA/109-347---------------------------------------------------------------MVLFTILLVG..SAIDL
Q97HN8_CLOAB/64-168---------------------------------------------------------------CVIATMLFLA..ALIDF
Q8XQX7_RALSO/14-117---------------------------------------------------------------VVLAVLVITS.....DL
LEP4_HAEIN/90-200---------------------------------------------------------------GLTLIILWTI..SYLDW
Q8TMQ5_METAC/5-101---------------------------------------------------------------ILISLFLVLA..CYTDL
Q8NQ30_CORGL/4-110---------------------------------------------------------------FLVGLWCAVL..AVIDI
Q98BF9_RHILO/11-116---------------------------------------------------------------VVFPFCMLFA..AISDM
Y421_METTH/12-138---------------------------------------------------------------FIALLACFYA..SYSDI
Q8CXM1_OCEIH/104-208---------------------------------------------------------------LLLTSLLVII..CISDF
A9CKJ3_AGRFC/8-113---------------------------------------------------------------LILPLCLCFA..ALNDL
Q8TXH1_METKA/6-112---------------------------------------------------------------LAGLAVATVA..AITDL
Q8DLL0_THEEB/89-199---------------------------------------------------------------WLLSAWLLAL..ALIDL
YC8A_METJA/6-148---------------------------------------------------------------LYGLICSIYG..AVEDW
Q9XAP1_STRCO/112-224---------------------------------------------------------------LLLAPVGVLL..AVVDL
LEP4_MYXXD/113-222---------------------------------------------------------------LVLVSLLVPL..AFIDL
LEP4_XANCP/133-242---------------------------------------------------------------IVLSCFLVAM..SGIDL
Q8TLD4_METAC/26-152---------------------------------------------------------------LFAMAFLLYS..CYSDL
O67535_AQUAE/105-214---------------------------------------------------------------YFFFSALLVM..SIIDW
Q988A4_RHILO/13-122---------------------------------------------------------------IALAVVLGAI..SIADF
Q8XVK3_RALSO/140-249---------------------------------------------------------------AALLWFLIAG..SMIDA
Q87I88_VIBPA/13-110---------------------------------------------------------------LVNVLLIFYG.....DI
Q8F6L1_LEPIN/127-232---------------------------------------------------------------LFLCGHLLIS..CLTDA
Q891G5_CLOTE/115-221---------------------------------------------------------------SIFICFLIIV..SVIDF
Q9K8H1_BACHD/15-120---------------------------------------------------------------LALVSLFSII..FVSDL
LEP4_PSEAE/136-245---------------------------------------------------------------LLLTWGLLAM..SLIDA
Q8XI34_CLOPE/100-206---------------------------------------------------------------IVLITFLIVI..SFIDY
Q8EJP8_SHEON/157-266---------------------------------------------------------------AILTFVLIAL..TGIDL
Q9CMH2_PASMU/11-110---------------------------------------------------------------CITMILLIIL..SWTDI
Q92T43_RHIME/12-117---------------------------------------------------------------VVFPFSLALA..ALSDL
HOPD_SALTY/9-119---------------------------------------------------------------IFYASFSLLL..GIYDA
Q8FT27_COREF/8-114---------------------------------------------------------------AVFVVWVGVL..AAWDL
Q8THK9_METAC/8-134---------------------------------------------------------------AACLPFLLYS..SYLDL
Q8RAF7_CALS4/104-208---------------------------------------------------------------MFLSSVLISA..SFIDL
PPPA_ECOLI/130-240---------------------------------------------------------------MILSAWLIAA..SVIDL
Q92YL6_RHIME/12-116---------------------------------------------------------------LLFAGAMTYA..GIRDV
Q89PI9_BRADU/13-114---------------------------------------------------------------LLQILLLLYV..ATIDV
Q89UH6_BRADU/9-113---------------------------------------------------------------LLFPALMAFA..AASDL
Q87M36_VIBPA/5-111---------------------------------------------------------------LVIWSLLIAI..GVSDA
Q8Y6Y1_LISMO/101-204---------------------------------------------------------------YIIYYFLAFF..FITDI
Q89HG8_BRADU/40-149---------------------------------------------------------------AFLAALMLAI..ATHDA
Q8YXA0_NOSS1/108-226---------------------------------------------------------------WTFCGWLLAL..SLIDL
Q9X222_THEMA/103-204---------------------------------------------------------------CVIASALIAI..SLIDL
LEP4_VIBCH/112-221---------------------------------------------------------------LGLYFILFNL..FVIDF
Q989C3_RHILO/11-122---------------------------------------------------------------ALAIPLLARI..AWLDF
LEP4_ECOLI/81-190---------------------------------------------------------------FLYFCFVLTL..SVIDF
Q9ABP2_CAUCR/121-230---------------------------------------------------------------ALMGWSLLLI..ATIDT
Q8Y1N3_RALSO/10-114---------------------------------------------------------------LSLLVLVVTA..AVHDV
Q88QB9_PSEPK/4-110---------------------------------------------------------------IVLLLWLALC..SEQDV
Y83C_METJA/9-115---------------------------------------------------------------IINFILLLLA..AITDI
Q87VV0_PSESM/5-111---------------------------------------------------------------FFLLVWFAIC..AEQDA
O29326_ARCFU/8-129---------------------------------------------------------------LVVLGFLLYA..CKLDL
Q97FF6_CLOAB/100-211---------------------------------------------------------------IVLFSFLFII..SIIDL
Q8RHE5_FUSNN/7-119---------------------------------------------------------------ILLYILLFLV..MYIDI
Q980Y8_SULSO/10-125---------------------------------------------------------------FLSIIMLIHT..SILDL
Q8R8E5_CALS4/6-111---------------------------------------------------------------LSLPVVVLTAYAAWTDC
LEP4_SYNY3/108-223---------------------------------------------------------------WILISFLISL..TLIDW
A0KPV9_AERHH/142-247---------------------------------------------------------------....WVLVAL..TFIDL
A5EXL5_DICNV/138-247---------------------------------------------------------------LVFTWTLIAL..CFIDA
A9H675_GLUDA/111-216---------------------------------------------------------------CLFGWWLLVL..AAIDL
C9R2X4_AGGAD/10-108---------------------------------------------------------------IIMLLLLITL..SITDI
C9R6J1_AGGAD/90-198---------------------------------------------------------------.LYGALLIAI..SLVDW
E0SLF4_DICD3/139-243---------------------------------------------------------------...FGTLLAL..AAIDA
G1UB88_HAEDU/13-108---------------------------------------------------------------..IVLLLIWL..SYTDI
H7C7G6_CAUCR/11-113---------------------------------------------------------------.IFPALAIVG..ALKDL
H9L4S3_VIBCH/135-244---------------------------------------------------------------.FFSYVLIAA..TFIDF
I6Y9M6_MYCTU/5-108---------------------------------------------------------------.AVLAWMGVL..CVCDV
LEP4_BURPS/162-269---------------------------------------------------------------..LCAALLAM..SAIDM
Q0WIM7_YERPE/129-236---------------------------------------------------------------LVLIWSLTAL..AFIDF
Q5F692_NEIG1/134-242---------------------------------------------------------------LILTAFLISL..TFIDA
Q5ZVB6_LEGPH/138-246---------------------------------------------------------------.LAIWILISL..VFIDL
Q65GL0_BACLD/102-205---------------------------------------------------------------.ALISLLLIV..FVSDV
Q7MJZ8_VIBVY/10-109---------------------------------------------------------------.ALLLLLAMV..VLSDV
Q9PAI1_XYLFA/133-241---------------------------------------------------------------IVFSCFLVAL..AGIDL

PF04258

SIPL5_ARATH/240-524NVTLIT..RR.CSK-----CGQKNLK..................................LPLL...-------......
SPP2A_MOUSE/214-499LSALIH..RMPCGQ-----CTILCCG.........................................-------......
SIP_ARATH/47-323LLPAIR..RFLPNP-----WNDNLIV..................................WRFPY..-------......
SPP2B_HUMAN/213-505LAPCVR..RLPFGK-----CRIPNNS..................................LPYFH..-------......
Q9VPQ7_DROME/71-359LSPVIN..SLMPAA-----VPKVPFH..................................ILFTK..-------......
Q9VBL1_DROME/96-408LLPMCQ..YIIRPC-----TDGKRFS..................................FGFC...-------......
SIPL4_ARATH/241-527LVSLLSCFRW.FRR-----FGESYVK..................................VPFL...-------......
SIPL2_ARATH/242-525LVALLS..RW.FQR-----AADTYVK..................................VPFL...-------......
YL8H_SCHPO/31-282FNPKTT........-----................................................-------......
YKK0_YEAST/145-510YSYFLN..SLFRNL-----SHLASWNPLVVLPRYRVTIADDNEDLNKIGGFVTNLNYKDGLTNSVVH-------KKTLDE
SPPL3_MOUSE/60-374LLPMCQ..YLTRPC-----SPQNKIS..................................FGCC...-------......
IMP2_CAEEL/55-450LKPFVT...AFLKK-----MPLVPSF..................................LRFNAPY-------LFSLKK
HM13_MOUSE/62-350ISPFMN..KFFPAN-----FPNRQYQ..................................LLFTQ..-------......
Q93346_CAEEL/275-601IRGFLS..NFKFVG-----HRWYNAK..................................MEWFP..-------......

PF06550

Q9HM09_THEAC/1-278KKLRIF--KVIYSI-----VVAYVIF----------------------------------YVFLILL-------SI----
Q9HQ23_HALSA/15-306KQWILR--GVVLVT-----SGL.VAS----------------------------------YVFAVAI-------PA----
Q8TIY9_METAC/27-303MKWIIS--LLIYLA-----IVS.TLY----------------------------------YVFFALF-------TL----

PF01080

D3B5F5_POLPA/149-528FMKALY--GWLMAT-----SILLLGV----------------------------------FGGFLFI.......LILTYV
G4VJ47_SCHMA/58-484CYKFIR--GWIIMT-----TIFLLFL----------------------------------ISFTFFA.......EVLRAM
T1KI16_TETUR/103-479FYKVIY--GWLVLS-----SSLLLFL----------------------------------FMFIYLS.......VVLQKY
K7J3W8_NASVI/92-490FYKTIH--AWLIIS-----SLILLFL----------------------------------FTSLYCE.......EVLKAY
A0A068XH02_HYMMI/46-488CYKFLT--GWLIMA-----TFVVVFL----------------------------------ASFTFFA.......QLLQVS
W5JK58_ANODA/96-499CYKVIH--GWLILS-----SLLLLFL----------------------------------FSGLYLF.......EILRAY
E9FSB0_DAPPU/62-438CYKIIH--GWLIMS-----SLMLLFI----------------------------------FAYLYLG.......EVLRTY
C5WT76_SORBI/25-446CTPCLR--AYLGFS-----ALAVLLV----------------------------------LGGQVAL.......LLLSRL
C3Z2C5_BRAFL/88-496CYKFIH--GWLILS-----SLMLLFL----------------------------------FAYIYLG.......EVLQAY
H2TY46_TAKRU/29-412CYKFIH--GWLILS-----SLMLLFW----------------------------------FSFMYLG.......EVFKTY
H3AT04_LATCH/77-455CYKVIH--GWLIIS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
I1HEG8_BRADI/69-507CTGFLK--NYMRFS-----AFFVLFS----------------------------------MGGAIAI.......TILRRL
W4XU10_STRPU/68-474CYKVIH--GWLVLS-----SLLLLFF----------------------------------FTFFYLQ.......ELLVTY
G7Y344_CLOSI/42-431CYRFIH--GWLILT-----TFMLLFL----------------------------------ISFLFFT.......EIIRAM
B7Q2V0_IXOSC/41-421CYKVIH--AWLIVS-----SLLLVFL----------------------------------FAYIYLG.......EVLRAY
PSN1_RAT/76-458CYKVIH--AWLIVS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
T1JMG4_STRMM/67-438CYKVIH--GWLILS-----SLMLLFL----------------------------------FAYIYLG.......EVLRAY
T1G6P3_HELRO/9-376CYKVCA--FWMFLA-----TLLLLFI----------------------------------FSYIYYS.......EFCRYL
D7LLE1_ARALL/15-389CVKFLK--FYMGFS-----AFIVLGN----------------------------------LGGEILV.......LLIDRF
A2G9L8_TRIVA/13-428CVKCIY--VWMVVA-----VSLLLSY----------------------------------YVYLAVG.......KIPSLY
F6RA92_CIOIN/37-422CYKVIH--GWLILS-----TLLLVFL----------------------------------FAYLYLA.......EVLRAY
I3IV36_ORENI/95-480CYKVIQ--GWLFLS-----SLLLLFF----------------------------------FSYIYLK.......EVFKTY
H2Z6F8_CIOSA/7-395CYKVIH--GWLILS-----SLLLLFL----------------------------------FAYLYLA.......EVLRAY
K1PKB7_CRAGI/84-479CYKVIH--GWLIAS-----SLMLLFL----------------------------------FSYIYLG.......VVLQAY
S2K404_MUCC1/83-504WIKVLI--GFFMVI-----VLLLLGF----------------------------------MTYLLLL.......NLIQVF
H3FRQ2_PRIPA/66-481CYRFIH--GWLMMS-----SLMLLTM----------------------------------FSMVYVS.......ELMKMN
E0VJ41_PEDHC/87-467CYKTIH--GWLIAS-----SLMLLFL----------------------------------FSYLYLE.......EVLRAY
E2AIY0_CAMFO/93-484FYKVIH--GWLIIS-----SLLLLSM----------------------------------FSILYCE.......QVLKAY
F4PRZ5_DICFS/219-583FMKALY--GWLMAT-----SILLLGV----------------------------------FGGFLFI.......LLMTYA
B0WS38_CULQU/61-516CYKIIH--GWLIMS-----SLMLLFL----------------------------------FSYLYME.......EVLRAY
A0A068YDE2_ECHMU/45-476CYKCLT--GWLVAT-----TFLLVFV----------------------------------ISFTFFT.......ELLRAS
E2BSL4_HARSA/95-504FYKVIH--GWLIIS-----SLLLLSL----------------------------------FSILYCE.......QVLKAY
H9J5W9_BOMMO/68-456CYKTIH--GWLILS-----SLILLFL----------------------------------FSYLYIE.......EALIAY
G3Q8S2_GASAC/77-448CYKFIH--GWLILS-----SLMLLFW----------------------------------LSFMYLS.......EVFKTY
F6GSZ0_VITVI/15-427CTKFLK--YYMGFS-----SFIVLGF----------------------------------MGGEITL.......FLIQDF
B4QRZ4_DROSI/98-517CYRIIH--GWLILS-----SFMLLFI----------------------------------FTYLYLE.......ELLRAY
SPE4_CAEEL/11-464FRRIVK--AWLTLS-----CLLILFG----------------------------------VSAQTLH.......DMFSQV
C7J054_ORYSJ/30-449CTPCLR--AYLGFS-----SLSVLLL----------------------------------LGGHVAL.......LLLSRL
T1HN85_RHOPR/7-402CYKIIH--GWLIMS-----SLILLSI----------------------------------FSYIYLL.......EVLRAY
A9S846_PHYPA/9-467CTRCLR--VYMGIS-----AFTVLAW----------------------------------MGGIVAV.......QIIKLY
E3N426_CAERE/9-463FQRVVK--AWLTLS-----CMLILFG----------------------------------VSGQTLY.......DLFTQI
D8LTV7_ECTSI/63-572CMRCLV--GYMAMS-----SAVLLGV----------------------------------MGGAVWA.......AALEVY
H3CB70_TETNG/22-406CYKFIH--GWLILS-----SLMLLFW----------------------------------FSFMYLG.......EVFRTY
G2J6Q7_CAEBR/9-477FRRIVK--SWLTFS-----CLLILFG----------------------------------VSGQTIY.......DLFSQI
I1N8G3_SOYBN/8-407CTAFLL--HYTRFS-----TFFVLAA----------------------------------MGGSILL.......SLLERF
G3W888_SARHA/88-452CYKFIH--GWLILS-----SLMLLFL----------------------------------FTYIYLG.......EVLKTY
PSN_CAEEL/44-434FYKLIH--GWLIVS-----SFLLLFL----------------------------------FTTIYVQ.......EVLKSF
F2CQD9_HORVD/22-450CTGFLK--NYMRFS-----AFFVLFS----------------------------------MGGAIAV.......ALLRRL
W5N759_LEPOC/69-512CYKVIH--GWLIIS-----SLLLLFF----------------------------------FSFIYLG.......EVFKTY
Q7PR98_ANOGA/98-513CYKVIH--GWLILS-----SLLLLFL----------------------------------FSGLYLF.......EILRAY
M1CAI2_SOLTU/15-421CTKFLK--YYMGFS-----SFLVLGF----------------------------------MGGEICL.......FLIGKF
W1NQ31_AMBTC/9-446FTGFLK--NYMRFS-----AFFVLGS----------------------------------MGGPIFL.......SIIEQF
K3WL66_PYTUL/82-563CMKFLG--GYIMFA-----STAILSF----------------------------------VGGQLVD.......SIVNDQ
A2DZ73_TRIVA/13-381CMKIIF--GWLILA-----VSLLLSM----------------------------------YFLVGFG.......TYPSIV
G0NCU3_CAEBE/9-464FRRIVK--LWLTFS-----CILILFG----------------------------------VSGQTIY.......DLFVQV
U9UMQ1_RHIID/178-561FIKILI--GFFMVV-----VLLLLGF----------------------------------MGYLLMM.......AILQVF
T1EFZ6_HELRO/89-576CYKFIA--GWLFMS-----SFMLLFF----------------------------------FTFIFYS.......ELCRTM
B7QGI2_IXOSC/14-384YTNVIK--AWLMTG-----SGVLLFV----------------------------------VTYYYMG.......RCVYYF
A8PAF6_BRUMA/94-527FYRVIS--AWLVLS-----SLILLSL----------------------------------FTFMYLQ.......EVFKSY
S2J107_MUCC1/49-424LYKFLF--FWLGLS-----VLSILGV----------------------------------TASALWI.......EMLNVY
D3B4U3_POLPA/99-477CLKAIY--AWLFLS-----VGILLAS----------------------------------MGSYVFM.......AMLEAN
H2VWC4_CAEJA/11-477FQNLVK--TWLIFS-----CLLILFG----------------------------------VSGQTFY.......DLFSQL
A9VBA9_MONBE/203-602YYKIIY--GWLALS-----ALLLLYF----------------------------------FSYQYIECVMCTRRQVLIAH
F2TYS0_SALR5/109-504CYKAIH--GWLLLS-----SLLLLFF----------------------------------FSYQFVD.......QVLRAY
E1G929_LOALO/15-397YKCLVQ--MWLYMS-----CVLIIFG----------------------------------VFASFLV.......DLFKAF
H3FRQ2_PRIPA/544-933CYKCLH--GWMISS-----SFMMLTL----------------------------------ISGTYVM.......HVLENH

PF01478

FLAK_METJA/5-130KSREIE--DYVWVS.....MVIFGLI----------------------------------YN.....-------------
FLAK_METMP/5-130RSREIE--DYIWIV.....LAVFGIL----------------------------------FAIYSA.-------------
LEP4_BACSU/100-204HFMLIP--NRILIF.....FLPFLAA----------------------------------AR.....-------------
Q9HWA5_PSEAE/4-110KRLRVS--NWLILG.....GFLISFV----------------------------------YLY....-------------
Q8FME5_COREF/77-189AVCRLP--DRLVAAT..LLALVLGFL----------------------------------AS.....-------------
Q9CPF6_PASMU/89-199RYQLIS--VQLCYC.....LFWIGVV----------------------------------AA.....-------------
Q9RSQ9_DEIRA/109-347DTMTLP--DELTLP.....GTLLGVL----------------------------------FGLAGAG-------------
Q97HN8_CLOAB/64-168KTKNVY--FFITII.....SFLFSTV----------------------------------FV.....-------------
Q8XQX7_RALSO/14-117RSRRVP--NWLVAV.....GLVLSIV----------------------------------LVK....-------------
LEP4_HAEIN/90-200HYQLIS--TTPCLW.....LLTLGLF----------------------------------GA.....-------------
Q8TMQ5_METAC/5-101RYRRVS--NRSCFL.....MFVISVP----------------------------------FI.....-------------
Q8NQ30_CORGL/4-110KYRRLP--DVLTLP.....GALLI..----------------------------------.......-------------
Q98BF9_RHILO/11-116LSMTIA--NRVSVL.....LVVVFAL----------------------------------VA.....-------------
Y421_METTH/12-138KRGIIP--NRLTFP.....VIGLGLL----------------------------------LNGA...-------------
Q8CXM1_OCEIH/104-208IYMVIP--NKLLLF.....FLPIFII----------------------------------LR.....-------------
A9CKJ3_AGRFC/8-113FSMTIP--NVITVV.....LLLSFAF----------------------------------IA.....-------------
Q8TXH1_METKA/6-112KWGIVP--NRLTYP.....AIVAGAI----------------------------------YA.....-------------
Q8DLL0_THEEB/89-199DTMTLP--HPLTKW.....GLITGLL----------------------------------AR.....-------------
YC8A_METJA/6-148RKREVT--DFLWIS.....MLWVGVF----------------------------------I......-------------
Q9XAP1_STRCO/112-224KVRRLP--DPLTLPLAGAALVLLGLT----------------------------------AL.....-------------
LEP4_MYXXD/113-222DHWILP--LSMTVP.....GMLAGIA----------------------------------LA.....-------------
LEP4_XANCP/133-242RHKLLP--DQLTLP.....LMWLGLV----------------------------------GS.....-------------
Q8TLD4_METAC/26-152KARRVS--NGVWKY.....MLVSGSV----------------------------------FVI....-------------
O67535_AQUAE/105-214YYFILP--PGINIG.....GLVLGIL----------------------------------VS.....-------------
Q988A4_RHILO/13-122RRQIIP--DGLNLA.....LAGIGLS----------------------------------YQ.....-------------
Q8XVK3_RALSO/140-249DTQLLP--DAITQP.....LLWLGLL----------------------------------VN.....-------------
Q87I88_VIBPA/13-110RYRIVK--HRFLLI.....IFITSLL----------------------------------.......-------------
Q8F6L1_LEPIN/127-232FHFSLD--YENLPW.....ILCFGVI----------------------------------SIF....-------------
Q891G5_CLOTE/115-221KTMYVY--FSIILI.....TIFLRIG----------------------------------IFF....-------------
Q9K8H1_BACHD/15-120VYMIIP--DRIILF.....FAILFVL----------------------------------FR.....-------------
LEP4_PSEAE/136-245DHQLLP--DVLVLP.....LLWLGLI----------------------------------AN.....-------------
Q8XI34_CLOPE/100-206DTQDVY--AVTTYP.....AVILGII----------------------------------FALIEK.-------------
Q8EJP8_SHEON/157-266DEMLLP--DQMTLP.....LLWLGLL----------------------------------IN.....-------------
Q9CMH2_PASMU/11-110KSRIIS--NKIVFL.....LLLVMV.----------------------------------.......-------------
Q92T43_RHIME/12-117LTMTIP--NRVSLV.....LLVSFFF----------------------------------VA.....-------------
HOPD_SALTY/9-119RTGLLP--DRFTCP.....LLWGGLL----------------------------------YH.....-------------
Q8FT27_COREF/8-114RTRRLP--DALTLP.....GALMI..----------------------------------.......-------------
Q8THK9_METAC/8-134ETRRVP--NRIWKL.....MLFSLSG----------------------------------FLI....-------------
Q8RAF7_CALS4/104-208EHKIIP--NSIIIA.....GFIGALI----------------------------------FR.....-------------
PPPA_ECOLI/130-240DHQWLP--DVFTQG.....VLWTGLI----------------------------------AA.....-------------
Q92YL6_RHIME/12-116ATMTIS--NRVVVF.....LVIAFAI----------------------------------LA.....-------------
Q89PI9_BRADU/13-114ATRLIR--NEICLV.....LAFLGIV----------------------------------T......-------------
Q89UH6_BRADU/9-113FTMTIS--NRVSLA.....LVAGFFA----------------------------------LA.....-------------
Q87M36_VIBPA/5-111QKHRIP--NKAVLL.....LLVAVTA----------------------------------NV.....-------------
Q8Y6Y1_LISMO/101-204FYLYVP--NSILIV.....FFCVLAT----------------------------------IA.....-------------
Q89HG8_BRADU/40-149RHYLIP--NELTGT.....AFALALL----------------------------------RAGA...-------------
Q8YXA0_NOSS1/108-226DTMTLP--NPLTKS.....GLVLGLV----------------------------------FQMIVG.-------------
Q9X222_THEMA/103-204ETYLIP--DYLNFT.....VLIFSFV----------------------------------VA.....-------------
LEP4_VIBCH/112-221KSMLLP--NLLTYP.....IFMLAFI----------------------------------Y......-------------
Q989C3_RHILO/11-122TTQKIA--NRDALL.....LLCLGAG----------------------------------SLLL...-------------
LEP4_ECOLI/81-190RTQLLP--DKLTLP.....LLWLGLV----------------------------------FN.....-------------
Q9ABP2_CAUCR/121-230EHLWLP--DRLTLP.....FGALGVI----------------------------------AT.....-------------
Q8Y1N3_RALSO/10-114RTRRIP--NRLVAA.....GLAAALI----------------------------------AQ.....-------------
Q88QB9_PSEPK/4-110RQRQIS--NVLTLG.....AAGCALA----------------------------------WLF....-------------
Y83C_METJA/9-115KERIIP--HKYTIA.....MIIINLV----------------------------------VGY....-------------
Q87VV0_PSESM/5-111RRKEIL--NGLTLG.....AAALAAG----------------------------------YLA....-------------
O29326_ARCFU/8-129ESRIVP--NRVWKR.....MLLVSLP----------------------------------ITV....-------------
Q97FF6_CLOAB/100-211DTTNVY--LCTTLP.....GIISGII----------------------------------FIAINI.-------------
Q8RHE5_FUSNN/7-119NKKYIP--NVLNFS.....ILVLSIF----------------------------------ICG....-------------
Q980Y8_SULSO/10-125KYREVD--PKIWIY.....YSPLCLF----------------------------------II.....-------------
Q8R8E5_CALS4/6-111KRKEID--NWVPAA.....ILTYGII----------------------------------LN.....-------------
LEP4_SYNY3/108-223DTMTLP--NSLTKP.....GLVLGLL----------------------------------FHLL...-------------
A0KPV9_AERHH/142-247DKMLLP--DQLTLP.....LLWGGLL----------------------------------FN.....-------------
A5EXL5_DICNV/138-247EHQLLP--DRLTLP.....LLWLGIL----------------------------------AA.....-------------
A9H675_GLUDA/111-216KSFRLP--DTLTVP.....LIAAGLG----------------------------------LA.....-------------
C9R2X4_AGGAD/10-108RSRLIS--NRVVLF.....LLLVIIP----------------------------------FS.....-------------
C9R6J1_AGGAD/90-198HYRLIS--PALCQA.....LFTLGLG----------------------------------AA.....-------------
E0SLF4_DICD3/139-243RTQLLP--DVMTLP.....LLWGGLL----------------------------------FN.....-------------
G1UB88_HAEDU/13-108RSRIIT--NKVVLA.....LFCAILP----------------------------------FS.....-------------
H7C7G6_CAUCR/11-113TSYTIP--NWISLA.....LIAAFVP----------------------------------AA.....-------------
H9L4S3_VIBCH/135-244DTLLLP--DQLTLP.....LLWGGIA----------------------------------LA.....-------------
I6Y9M6_MYCTU/5-108RQRRLP--NWLTLP.....GAGVILL----------------------------------FA.....-------------
LEP4_BURPS/162-269QTGFLP--DSLTLP.....LLWAGLC----------------------------------VN.....-------------
Q0WIM7_YERPE/129-236DTYLLP--DCMTIP.....LLWLGLL----------------------------------IN.....-------------
Q5F692_NEIG1/134-242DTQYLP--DSMTLP.....LIWLGLI----------------------------------FN.....-------------
Q5ZVB6_LEGPH/138-246DHQLLP--DSLTLG.....LLWIGLI----------------------------------AN.....-------------
Q65GL0_BACLD/102-205THMIIP--DAVLCF.....FLPVFAV----------------------------------GR.....-------------
Q7MJZ8_VIBVY/10-109LKRKIY--NANLAV.....LVFVSTY----------------------------------YR.....-------------
Q9PAI1_XYLFA/133-241RTRLLP--DQLTLM.....LMWLGLI----------------------------------GS.....-------------

PF04258

SIPL5_ARATH/240-524.............................GNTSILSLVVLLFCFV-----VAILWFMNRKTS.HAWAGQDIFGICMMINV
SPP2A_MOUSE/214-499.............................KNIKVSLIFLSGLCIS-----VAVVWAVFRNEDRWAWILQDILGIAFCLNL
SIP_ARATH/47-323..................FKSLE......VEFTKSQVVAGIPGTF-----FCAWYAWKKH.....WLANNILGLSFCIQG
SPP2B_HUMAN/213-505.............................KRPQARMLLLALFCVA-----VSVVWGVFRNEDQWAWVLQDALGIAFCLYM
Q9VPQ7_DROME/71-359............GEGKHKEDIVN......YKFSTHDIVCLVISSA-----IGVWYLLKKH.....WIANNLFGLAFAING
Q9VBL1_DROME/96-408.............................GRFTAAELFSFTLSVS-----IVCIWVLTGH.....WLLMDAMGMGLCVAF
SIPL4_ARATH/241-527.............................GAVSYLTLAICPFCIA-----FAVFWAVKRQYS.YAWIGQDILGISLIITV
SIPL2_ARATH/242-525.............................GPISYLTLAVSPFCIV-----FAVLWAVYRVHS.FAWIGQDVLGIALIITV
YL8H_SCHPO/31-282.................................FGKITATMSSIA-----IALFYFKTKH.....WMASNILAWALAANS
YKK0_YEAST/145-510IEKDHWMKHFYRRELVEPKDIKSKRQISNMYLNSALIVSFVLSIV-----STVYFYLSPND....WLISNAVSMNMAIWS
SPPL3_MOUSE/60-374.............................GRFTAAELLSFSLSVM-----LVLIWVLTGH.....WLLMDALAMGLCVAM
IMP2_CAEEL/55-450GNKEMEEGDIEDAKKKETEYLFK......IDFDRYDIIALLMCSP-----ILISHLLKRH.....WITNNIIGVSFSILG
HM13_MOUSE/62-350............GSGENKEEIIN......YEFDTKDLVCLGLSSV-----VGVWYLLRKH.....WIANNLFGLAFSLNG
Q93346_CAEEL/275-601.......................TCGGRIHQYKYSEAFIGIICLS-----FCVTWFIIRRQP.YAFILLDVINMALCMHV

PF06550

Q9HM09_THEAC/1-278-----------------------------FLYNVYAIFTVSIVVA-----IVFFYMILFRNE---WYVTDLAGFFLSVGI
Q9HQ23_HALSA/15-306-----------------------------V.VVAG.VNLAVWGPA-----LALVGALYAYPE---WWVIDAAGAIMGMGA
Q8TIY9_METAC/27-303-----------------------------IPALAGLENIASLLLS-----IGLTVLLYKYPE---WYVIDLLGVCIAGGV

PF01080

D3B5F5_POLPA/149-528.......N---------------------IALDYLTFVFVVWNFS.AGGIVCIFW..FCP-----KYLNQAYLICLSAFL
G4VJ47_SCHMA/58-484.......G---------------------VFVDYITVAFALWNFG.VVGMIVIHW..RGP-----LVLQQAYLIFISAQI
T1KI16_TETUR/103-479.......N---------------------LPVDYISVSIFIWNFG.ILGMICIHW..KGP-----LIVQQAYLLVVSALM
K7J3W8_NASVI/92-490.......N---------------------IPMDIITLAIGLWNFG.VVGMVCIHW..QGP-----LSLQQAYLIFIAALM
A0A068XH02_HYMMI/46-488.......R---------------------IFFDNITFAILLWNFG.VLGLISIHW..RGP-----LVLQQAYLIFNSVVV
W5JK58_ANODA/96-499.......N---------------------VPMDWFTAGLLVWNFG.VVGMISIHW..QGP-----LRLQQGYLIFVAALM
E9FSB0_DAPPU/62-438.......N---------------------IPLDYISLLFIMWNFG.VVGMIAIHW..KAP-----LHLQQAYLIFVAALM
C5WT76_SORBI/25-446.......R---------------------FPLDAVSFALLLPNAAGALALAALAP.ASVP-----IALHQAALVAVAVLT
C3Z2C5_BRAFL/88-496.......N---------------------IPCDYITLAIVMWNFG.AVGMVCIHW..KGP-----LLLQQAYLIVISALM
H2TY46_TAKRU/29-412.......N---------------------VAMDYPTVGLLIWNFG.AVGMICIHW..KGP-----LQLQQIYLILISALM
H3AT04_LATCH/77-455.......N---------------------VAMDYITVALIIWNFG.VVGMICIHW..KGP-----LRLQQAYLIMISALM
I1HEG8_BRADI/69-507.......D---------------------VPLDAPTALLLLFNAS.AVGVLSVFA.SAVP-----ILVRQGYMVTLAVIV
W4XU10_STRPU/68-474.......N---------------------IPMDYFTIAVIMWNFG.MVGMVSIHW..KGP-----LRLQQLYLIVISALM
G7Y344_CLOSI/42-431.......G---------------------IFVDYITMAFILWNFG.VVGMVVIHW..RGP-----LILQQAYLIFISAQI
B7Q2V0_IXOSC/41-421.......N---------------------VPMDYLTVALVMWNFG.VVGMISIHW..KGP-----LLLQQAYLILVSALM
PSN1_RAT/76-458.......N---------------------VAVDYITVALLIWNFG.VVGMIAIHW..KGP-----LRLQQAYLIMISALM
T1JMG4_STRMM/67-438.......N---------------------VPMDYITLVFIMWNFG.VVGMICIHW..KGP-----LLLQQAYLIVVAALM
T1G6P3_HELRO/9-376.......N---------------------TATDFISTGFNLWNFG.LMGILAIHW..KSP-----LIVQQFYLIVVSALM
D7LLE1_ARALL/15-389.......R---------------------FPIDSITFLILLFNFS.VVGVFAVFM.SKFS-----ILITQGYLVWIGVLV
A2G9L8_TRIVA/13-428.......N---------------------IPIDYIAVVIFLLNGV.VVGGMSIFW..RAP-----PIVTQAFMIWISVMT
F6RA92_CIOIN/37-422.......N---------------------TAVDYITVVIVLWNFG.VVGMICIHW..KGP-----LLLQQAYLIIVSSLM
I3IV36_ORENI/95-480.......N---------------------LAMDYITLAIIIWNFG.VVGMMCIHW..KGP-----LRLQQAYLIMISALM
H2Z6F8_CIOSA/7-395.......N---------------------TPMDYITVAVVLWNFG.VVGMICIHW..KGP-----LLLQQAYLIVVSSLM
K1PKB7_CRAGI/84-479.......N---------------------VAMDYITVALLMWNFG.VVGMICIHW..KGP-----LFLQQAYLIVISALM
S2K404_MUCC1/83-504.......S---------------------IALDYITLVFALWNFA.VVGLVSIFW..KGP-----LWLQQSYLTIMSSLM
H3FRQ2_PRIPA/66-481.......N---------------------CCVSWPTVLIGLFNFA.AMGMICIHW..KGP-----LLMQQAYLISVSALM
E0VJ41_PEDHC/87-467.......N---------------------IPMDYFTLTIIMWNFG.VVGMICIHW..KGP-----LLLQQAYLIFIAALM
E2AIY0_CAMFO/93-484.......N---------------------IPMDLFTLGIGLWNFG.VVGMICIHW..QGP-----LQLQQAYLIFISALM
F4PRZ5_DICFS/219-583.......N---------------------VGLDYFTFSFIVWNFS.AGGMVCLFW..FCP-----QYLTRAYLVSISSLM
B0WS38_CULQU/61-516.......N---------------------IPFDYPTALLLMWNFG.VVGMISIHW..QGP-----LRLQQGYLIFIAALM
A0A068YDE2_ECHMU/45-476.......M---------------------IFFDNITFAILLWNFG.VLGLISIHW..RSP-----LILQQAYLIFNSVQM
E2BSL4_HARSA/95-504.......N---------------------IPMDFFTLSIGLWNFG.AVGMICIHW..QGP-----LQLQQAYLIFISALM
H9J5W9_BOMMO/68-456.......N---------------------IPMDYITLGFVLWNFG.VMGMIVIHW..KGP-----LRLQQAYLIFIAALM
G3Q8S2_GASAC/77-448.......N---------------------LAVDYPTVGVIIWNFG.TVGMICIHW..KGP-----LQLQQAYLILISALM
F6GSZ0_VITVI/15-427.......S---------------------FPIDCITFLVVLFNFT.VVGVLAVFM.SKMA-----ILVTQGYLVVIGMLV
B4QRZ4_DROSI/98-517.......N---------------------IPMDYPTALLIMWNFG.VVGMMSIHW..QGP-----LRLQQGYLIFVAALM
SPE4_CAEEL/11-464FDQDDNNQ---------------------YYMTIVLIVVPTVVYG.FGGIYAFFS..NSS-----LILHQIFVVTNCSLI
C7J054_ORYSJ/30-449.......R---------------------LPLDAASFALLLPNAAAALALAALSP.ASVP-----IALHQAALVAIAVLT
T1HN85_RHOPR/7-402.......N---------------------IPFDFITLCLFMWNFG.TMGMICIHW..KGP-----LHMQQAYLIFLAALM
A9S846_PHYPA/9-467.......S---------------------IPIDVITFLICTINFA.SVGVAAVFF.CRMP-----IMVTQGYLIVIGMLV
E3N426_CAERE/9-463LDQNDENQ---------------------YILTVALTVIPTTIYG.VLGIYAFFA..NGS-----LALHQFFVISNCSLI
D8LTV7_ECTSI/63-572.......Q---------------------LPCDAFTYYGVLWNFA.VVGVVAIFYQKGIP-----TVVTQAYLVATSIIM
H3CB70_TETNG/22-406.......N---------------------VAVDYPTVALLLWNFG.AVGMVCIHW..KGP-----LQLQQLYLILVSALM
G2J6Q7_CAEBR/9-477FDQNDENQ---------------------FILTVALTVIPTVVYG.CLGIYAFLA..NGS-----LLLHQFFVVSNCSLI
I1N8G3_SOYBN/8-407.......S---------------------VPLDAVTSFLLLFNFA.VVGVLSVFAGGGLP-----ILLRQCYTVCLGIIV
G3W888_SARHA/88-452.......N---------------------VAMDYPTLFLVIWNFG.AVGMICIHW..KGP-----LVLQQAYLIMISALM
PSN_CAEEL/44-434.......D---------------------VSPSALLVLFGLGNYG.VLGMMCIHW..KGP-----LRLQQFYLITMSALM
F2CQD9_HORVD/22-450.......D---------------------APLDAPTALLLLFNAS.AVGVLSVFA.SAVP-----ILVRQGYMVALAVIV
W5N759_LEPOC/69-512.......N---------------------VGMDYITLAVIIWNFG.VVGMICIHW..KGP-----LRLQQAYLIMISALM
Q7PR98_ANOGA/98-513.......N---------------------VPMDWFTAGLLVWNFG.VVGMISIHW..QGP-----LRLQQGYLIFVAALM
M1CAI2_SOLTU/15-421.......R---------------------IPIDCVTFALSLFNFT.VVGVLAVFM.SKTA-----IIITQVYLVVIGVLV
W1NQ31_AMBTC/9-446.......S---------------------IPIDSITCFILLFNFC.VIGVLSVFS.GGVP-----IIVRQVYMVLLGIIV
K3WL66_PYTUL/82-563L......G---------------------WPVDWITFLFVMINFG.FVGVISIFYQKGTP-----KFVQNGYLVLVSVIL
A2DZ73_TRIVA/13-381.......N---------------------IPVDYLSLAVFLLNLV.VVGNMSIFW..RAP-----QRITQAFLVLISILT
G0NCU3_CAEBE/9-464FDQNDENG---------------------FLMTVFCTVIPTVVYG.CLGIYAFLA..NGS-----LLLHQFFVVSNCSLI
U9UMQ1_RHIID/178-561.......Q---------------------IPMDYVTLSFALWNFA.AVGLISVFW..KGP-----LLLQQTYLTIMSSLM
T1EFZ6_HELRO/89-576.......N---------------------IPMDYITTAVFLWNFG.VLGIMCIHW..KGP-----LLLQQFFLIVVSALM
B7QGI2_IXOSC/14-384.......N---------------------FPMDHLSCSFIVWNIG.MTGMGTLYY..KGP-----FVMHQGFVIYVSILM
A8PAF6_BRUMA/94-527.......N---------------------VPVDYILICIFIWNYG.VMGMICIHW..KGP-----LRMQQGYLIMMSALM
S2J107_MUCC1/49-424.......N---------------------MPMDYLTMLFCTWNVA.VVGVVAIFW..KSP-----LWVQQVYLVLVSAAT
D3B4U3_POLPA/99-477.......N---------------------LALDYITFAFIMFNFS.VGGIIAVFW..YAP-----VLMNQGYLVLISTLM
H2VWC4_CAEJA/11-477VDQETENG---------------------RNLTLVLTILPTLVYG.LAGIVAFLA..NGS-----LLLHQCFVVSNCSLI
A9VBA9_MONBE/203-602.......N---------------------ASIDWITMAFIIWNFG.TVGFIAIFW..RSP-----LAVQQVYLVIVSALM
F2TYS0_SALR5/109-504.......N---------------------STLDWITMVVSIWNFG.VVGLICIHW..KGP-----LLLQQVYLVAVSALM
E1G929_LOALO/15-397GLQTAPP.---------------------.....IFTALIVITYG.TVGILVFFT.KKTP-----LYMHQFYVICNCSLV
H3FRQ2_PRIPA/544-933.......N---------------------WCMSNATALFGLFNYA.AMGMICIHW..KGP-----LLMQQAYLISVSALM

PF01478

FLAK_METJA/5-130-----------------------------......G.YLS.FISH--------------------DMLYVIQS...IVGF
FLAK_METMP/5-130-----------------------------..ITLSN.YSI.LINS--------------------ISGFVICF...ILGY
LEP4_BACSU/100-204-----------------------------........LIS.PLDS--------------------WYAGLLGA...AAGF
Q9HWA5_PSEAE/4-110-----------------------------.....VKESSL.TGAT--------------------VNMAMTAL...FIGV
Q8FME5_COREF/77-189-----------------------------.......AAVGGTWND--------------------WVRALLAG...LVLL
Q9CPF6_PASMU/89-199-----------------------------.......YVEV.SPLH--------------------LEQSLQSA...LTGF
Q9RSQ9_DEIRA/109-347-----------------------------LYAQEGQL....GLPN--------------------VAQAVEGA...LMGA
Q97HN8_CLOAB/64-168-----------------------------......MITYF.SGNC--------------------IEDYVVGA...VAMG
Q8XQX7_RALSO/14-117-----------------------------.....FGSVVA.LAYD--------------------WRDVWLGG...AIAL
LEP4_HAEIN/90-200-----------------------------.......DNNF.SLLT--------------------LSESIKSA...ASFF
Q8TMQ5_METAC/5-101-----------------------------............VQLI--------------------SVRYVITV...GLIF
Q8NQ30_CORGL/4-110-----------------------------........NLW.ALTI--------------------YPQWMLGG...LVWA
Q98BF9_RHILO/11-116-----------------------------......PLTGM.EWAA--------------------YGWHFAAG...ALVL
Y421_METTH/12-138-----------------------------.....RALMES.DPWI--------------------FIYTAIFT...AGIF
Q8CXM1_OCEIH/104-208-----------------------------........LLL.PLDP--------------------WWSMFTGA...AIGF
A9CKJ3_AGRFC/8-113-----------------------------......PFAGM.DFQT--------------------FGLSLAGG...LIVF
Q8TXH1_METKA/6-112-----------------------------........AVI.DPSH--------------------LGYALLDA...GVAF
Q8DLL0_THEEB/89-199-----------------------------.......GLTT.GLGG--------------------ITEGIIAA...VIGI
YC8A_METJA/6-148-----------------------------........HLL.YNKS--------------------LLLFFIEI...FAVL
Q9XAP1_STRCO/112-224-----------------------------........VPE.HAGE--------------------CTTALLGALALGAGY
LEP4_MYXXD/113-222-----------------------------........FPL.GMDA--------------------FRDALMGA...AVGF
LEP4_XANCP/133-242-----------------------------........MDN.LYMP--------------------AKPALLGA...AVGY
Q8TLD4_METAC/26-152-----------------------------.....YELFTG.GTPY--------------------LKALFLSG...VVVF
O67535_AQUAE/105-214-----------------------------........PFR.QDIT--------------------PKESIIGA...VVGV
Q988A4_RHILO/13-122-----------------------------........LAA.DADA--------------------MPQRLLFA...AATF
Q8XVK3_RALSO/140-249-----------------------------........LFS.MFAR--------------------LPDAVIGA...TAGY
Q87I88_VIBPA/13-110-----------------------------........SLF.FTPE--------------------PLTQLAVS...TSVF
Q8F6L1_LEPIN/127-232-----------------------------.....LLDGKL.PGLN--------------------DLFVLGGF...FFTF
Q891G5_CLOTE/115-221-----------------------------.....LEGDKI.NFIF--------------------YNYFLAGF...IPAM
Q9K8H1_BACHD/15-120-----------------------------........ATLAPLNP--------------------WWDAWAGA...VVGY
LEP4_PSEAE/136-245-----------------------------........HFG.LFAS--------------------LDDALFGA...VFGY
Q8XI34_CLOPE/100-206-----------------------------...FYFGEN......L--------------------LNYFMGLV...ISAL
Q8EJP8_SHEON/157-266-----------------------------........LNH.TFTS--------------------PADAMIGA...AAGY
Q9CMH2_PASMU/11-110-----------------------------........PLA.WIQH--------------------KQIFFLPA...LLTL
Q92T43_RHIME/12-117-----------------------------......PLAGL.DLAQ--------------------LGLHTVAA...GLIF
HOPD_SALTY/9-119-----------------------------........QIC.LPER--------------------LPDALWGA...IAGY
Q8FT27_COREF/8-114-----------------------------........TGW.AVVV--------------------DPWLLLGG...AGWF
Q8THK9_METAC/8-134-----------------------------.....YEIVEG.GILF--------------------MLQLVFSF...FSSF
Q8RAF7_CALS4/104-208-----------------------------........LLM.YSYG--------------------FLDYILGF...LLGG
PPPA_ECOLI/130-240-----------------------------.......WAQQ.SPLT--------------------LQDAVTGV...LVGF
Q92YL6_RHIME/12-116-----------------------------......PAAGL.NLAT--------------------VMSSVVVA...SAVL
Q89PI9_BRADU/13-114-----------------------------........QLP.NAIQ--------------------IAESLIAA...AILF
Q89UH6_BRADU/9-113-----------------------------......LSGGM.APYE--------------------MLGHVGAG...ALVL
Q87M36_VIBPA/5-111-----------------------------........LYS.PSVS--------------------LLDHAYGG...LVAF
Q8Y6Y1_LISMO/101-204-----------------------------.......ILYN.QSLM--------------------DLIYSGGI...SCLF
Q89HG8_BRADU/40-149-----------------------------....FVPDVGLEALIW--------------------PLARAAAV...ALPL
Q8YXA0_NOSS1/108-226-----------------------------..YAADPTLSG.LIRH--------------------LMMGIVGA...VLGL
Q9X222_THEMA/103-204-----------------------------............LRTS--------------------FLEHLISF...LIVT
LEP4_VIBCH/112-221-----------------------------........VQQNPALT--------------------VESSIIGG...FAAF
Q989C3_RHILO/11-122-----------------------------.....LSLQSG.SWWD--------------------MGLSAIAA...LVLF
LEP4_ECOLI/81-190-----------------------------........AQY.GLID--------------------LHDAVYGA...VAGY
Q9ABP2_CAUCR/121-230-----------------------------........LAI.GEVP--------------------VWTPLVGA...AVGF
Q8Y1N3_RALSO/10-114-----------------------------......CAMLG.PVAG--------------------ALAWLGGA...AAGM
Q88QB9_PSEPK/4-110-----------------------------.....STGHSW.IGAE--------------------ASEAGWAL...AIVM
Y83C_METJA/9-115-----------------------------......YY....FGFN--------------------AIIAFFST...LILC
Q87VV0_PSESM/5-111-----------------------------.....VTGLTW.LGSP--------------------PLEGALAL...VLAL
O29326_ARCFU/8-129-----------------------------.....YQLFLG.KHLI--------------------FEYMIAGI...FVVM
Q97FF6_CLOAB/100-211-----------------------------...FYKNHIYG.YLFA--------------------AFLYSGVI...VLIN
Q8RHE5_FUSNN/7-119-----------------------------.....IDKVDI.FFIG--------------------ASCYTLPI...LIFY
Q980Y8_SULSO/10-125-----------------------------........FSF.HNLF--------------------LPIYLYSF...IITN
Q8R8E5_CALS4/6-111-----------------------------........AFL.NPVG--------------------FIESIVYM...LTAF
LEP4_SYNY3/108-223-----------------------------....LGWQRGH.WIVP--------------------LVEAIASA...VLGL
A0KPV9_AERHH/142-247-----------------------------........LAG.GFIP--------------------LADAVIGA...MAGY
A5EXL5_DICNV/138-247-----------------------------........LFN.VFIN--------------------LESSVIGA...MIGY
A9H675_GLUDA/111-216-----------------------------........ALG.GAAP--------------------VLWHALAA...AAGY
C9R2X4_AGGAD/10-108-----------------------------.......L.....LKY--------------------QTIFVIPA...LCTL
C9R6J1_AGGAD/90-198-----------------------------.......YWQI.GTLT--------------------LEQSLQSA...VVFF
E0SLF4_DICD3/139-243-----------------------------........LAD.TFVP--------------------LEQAVVGA...MAGY
G1UB88_HAEDU/13-108-----------------------------.......WFTQ.GMVY--------------------PMPALICL...VIGF
H7C7G6_CAUCR/11-113-----------------------------.......LVSG.APLS--------------------QIGLCLAV...GLGA
H9L4S3_VIBCH/135-244-----------------------------.......LLGF.SPVS--------------------LSDAVIGA...MAGY
I6Y9M6_MYCTU/5-108-----------------------------.......G....LAGR--------------------GVPALAGA...AALA
LEP4_BURPS/162-269-----------------------------........LWG.TFAS--------------------LRAAVIGA...IAGY
Q0WIM7_YERPE/129-236-----------------------------........IDT.VFAP--------------------LTSAVLGA...VSGY
Q5F692_NEIG1/134-242-----------------------------........LDG.GFVP--------------------LQSAVLGA...VAGY
Q5ZVB6_LEGPH/138-246-----------------------------........TQN.VFVS--------------------LDVAVLSC...AGAY
Q65GL0_BACLD/102-205-----------------------------........FLV.PLEQ--------------------WHSSLSGA...MAGG
Q7MJZ8_VIBVY/10-109-----------------------------........HQL.PDAM--------------------WLDATLYA...LLAL
Q9PAI1_XYLFA/133-241-----------------------------........TDN.LFMA--------------------AKPALLGA...VVGY

PF04258

SIPL5_ARATH/240-524LQVARLP-NIRVATILLCCAFFY--DIFWVFISPLIFK..QSVMIAVARGSKDT...............-----------
SPP2A_MOUSE/214-499IKTMKLP-NFMSCVILLGLLLIY--DVFFVFITPFITKNGESIMVELAAGPFEN...............-----------
SIP_ARATH/47-323IEMLSLG-SFKTGAILLAGLFFY--DIFWVFF........TPVMVSVAK....................-----------
SPP2B_HUMAN/213-505LKTIRLP-TFKACTLLLLVLFLY--DIFFVFITPFLTKSGSSIMVEVATGPSDSAT.............-----------
Q9VPQ7_DROME/71-359VEMLHLN-NFVTGVILLSGLFFY--DIFWVFG........TNVMVTVAK....................-----------
Q9VBL1_DROME/96-408IAFVRLP-SLKVSTLLLTGLLIY--DVFWVFLSSYIFS..TNVMVKVATRPADNPVGIVARKLHLG.GI-----------
SIPL4_ARATH/241-527LQIVRVP-NLKVGFVLLSCAFMY--DIFWVFVSKWWFR..ESVMIVVARGDRSG...............-----------
SIPL2_ARATH/242-525LQIVHVP-NLKVGTVLLSCAFLY--DIFWVFVSKKLFH..ESVMIVVARGDKSG...............-----------
YL8H_SCHPO/31-282ISIMRID-SYNTGALLLGALFFY--DIYFVFG........TEVMVTVAT....................-----------
YKK0_YEAST/145-510IAQLKLK-NLKSGALILIALFFY--DICFVFG........TDVMVTVAT....................-----------
SPPL3_MOUSE/60-374IAFVRLP-SLKVSCLLLSGLLIY--DVFWVFFSAYIFN..SNVMVKVATQPADNPLDVLSRKLHLGPNV-----------
IMP2_CAEEL/55-450IERLHLA-SFKAGSLLLVGLFFY--DIFWVFG........TDVMTSVAK....................-----------
HM13_MOUSE/62-350VELLHLN-NVSTGCILLGGLFIY--DIFWVFG........TNVMVTVAK....................-----------
Q93346_CAEEL/275-601LKCLRLP-SLKWISILMLCMFVY--DAFMVFGTPYMTTNGCSVMLEVATGLSCAAKGKNKGYPVP..PI-----------

PF06550

Q9HM09_THEAC/1-278SSIWGITFGVWAAVAFLIAFEIY--DYIAVYK--------TRHMISLARYAV----------------------------
Q9HQ23_HALSA/15-306AALFGISFGVLPAIVLLTALAVY--DAISVYG--------TEHMLTLASGVM----------------------------
Q8TIY9_METAC/27-303SALIGISLSIIPVVVLLILLAVY--DAISVYK--------TKHMIAMAEGVM----------------------------

PF01080

D3B5F5_POLPA/149-528ALFLAR.FPSWTTWAILVLVSIY..DIFAVLCPGGP----LQQLIETARKRGESI.PALIYNASVFIG............
G4VJ47_SCHMA/58-484SLMFLKYLPKWTCWLVLAALSVW..DIVAVLCPNGP----LRLLVEMAHERQQPLFPALLYSTTTVYLVKKHQPVEKVEN
T1KI16_TETUR/103-479ALVLIKYIPEWTVWVILAVISVW..DLVAVLCPKGP----LRILVETAQSRNESIFPSLIYSSAVTYF............
K7J3W8_NASVI/92-490ALVFIKYLPEWTAWAVLAVISIW..DLIAVLTPKGP----LRILVETAQERNESIFPALIYSSTVMYAFTMNFTGYVAA.
A0A068XH02_HYMMI/46-488ALTLLRFLPKWTCWVLLGAISIW..DLIAVLCPRGP----LRMLVEMAQERNLPLFPAIIYSTAAAYIADT.........
W5JK58_ANODA/96-499ALVFIKYLPEWTTWVVLAVISIW..DLIAVLTPKGP----LRILVETAQERNEQIFPALIYSSTIMYSYL..........
E9FSB0_DAPPU/62-438ALVFIKYLPEWTTWVVLGVISIW..DLVAVLSPRGP----LRILVETAQSRNEPLFPALIYSSTVAYM............
C5WT76_SORBI/25-446AFWFTM.LPEWTTWALLVAMAIY..DLAAVLLPGGP----LRVLLELAIQRNEEI.PALVYEARPVDPRHGRNWRLWRE.
C3Z2C5_BRAFL/88-496ALVFIKYLPDWTTWFILGAISLY..DLVAVLCPKGP----LKVLVETAQERNEPIFPALIYSSTMMWF............
H2TY46_TAKRU/29-412ALVFIKYLPEWSAWVILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWA............
H3AT04_LATCH/77-455ALVFIKYLPEWTGWLILVVISVY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSTMVWL............
I1HEG8_BRADI/69-507AAWLSR.LPEWTTWIMLVALAVY..DLVAVLAPRGP----LRMLVELASSRDDEL.PALIYESRPTVGPAERSSSYAPA.
W4XU10_STRPU/68-474ALIFIKYLPEWTLWTILAAIAVY..DLFAVLCPKGP----LRMLVETAQERDEQIFPALIYSSTMVWL............
G7Y344_CLOSI/42-431ALMFLKYLPKWTCWVLLGALAVW..DLVAVLCPRGP----LRMLVEMAHEREQPLFPALLYSTTAVY.............
B7Q2V0_IXOSC/41-421ALVFIKYLPDWTAWVVLGVISVW..DLIAVLCPKGP----LRILVETAQERNEPIFPALIYSSAMVWNV...........
PSN1_RAT/76-458ALVFIKYLPEWTAWLILAVISVY..DLVAVLCPKGP----LRMLVETAQERNETLFPALIYSSTMVWL............
T1JMG4_STRMM/67-438ALVFIKYLPDWTTWVVLGVISVW..DLIAVLCPKGP----LRILVETAQERNEPIFPALIYSSTVVY.............
T1G6P3_HELRO/9-376ALTFIKHLPGWTAWALLIVISVW..DLIAVLTPKGP----LKGLVNISSERRENLFPALVYSSTPFS.............
D7LLE1_ARALL/15-389AYFFTL.LPEWTTWVLLVALALY..DIAAVLLPVGP----LRLLVEMAISRDEDI.PALVYEARPVIRNDSR....LVQ.
A2G9L8_TRIVA/13-428ACVFLT.LPDWTVWILLVLLIIW..DCCVVLCPNGL----LHLLIKKSQERGDAI.PALVYSSAAFFWKEADDG......
F6RA92_CIOIN/37-422ALVFIKYLPEWTAWVILGFISIY..DLLAVLCPKGP----LRMLVETAQSRNESLFPALIYSSGMMWT............
I3IV36_ORENI/95-480ALVFIKYLPEWTAWLILAVISVY..DLLAVLCPKGP----LRILVETAQERNEPIFPALIYSSTMVWL............
H2Z6F8_CIOSA/7-395ALVFIKYLPEWTAWLILGLISIY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSGMMWT............
K1PKB7_CRAGI/84-479ALVFIKYLPDWTTWVVLGVMVIW..DLVAVLCPKGP----LRILVETAQERNEPIFPALIYSSTMIWSV...........
S2K404_MUCC1/83-504AFSLTG.LEQWTTWILLGLLAIWAIDLIAVLCPFGP----LRLLIESSRNQQREV.PALLYSVNAVWFMMASN..DHFR.
H3FRQ2_PRIPA/66-481ALMFIKMLPDWTVWALLFLISVW..DLIAVLCPKGP----LNMLVKMSQERNEPIFPALIYSSGILLPY...........
E0VJ41_PEDHC/87-467ALVFIKYLPEWTAWVVLAVISIW..DLIAVLTPRGP----LRILVETAQERNEQIFPALIYSSTFMYNY...........
E2AIY0_CAMFO/93-484ALVFIKYLPEWTAWVVLGVISIW..DLIAVLTPKGP----LRILVETAQERNESIFPALIYSSTILYSFTVTYAGYVQA.
F4PRZ5_DICFS/219-583AIFISR.MPEWSTWSILTIVSLY..DIFTVLSPGGP----LKKLIDLAKERGDEI.PALVYNGSVSIG............
B0WS38_CULQU/61-516ALVFIKYLPEWTTWVVLAVISIW..DLIAVLTPKGP----LRILVETAHERNEQIFPALIYSSTIMYSYM..........
A0A068YDE2_ECHMU/45-476ALIFLKFLPKWTCWVLLGALAIW..DLIAVLCPRGP----LRMLVEMAQERNQPLFPAMVYSTTTAYIATTQP.......
E2BSL4_HARSA/95-504ALVFIKYLPEWTAWAVLGVISIW..DLIAVLTPNGP----LRILVETAQERNESIFPALIYSSTILYSFTVSYAGYVQA.
H9J5W9_BOMMO/68-456ALVFIKYLPEWTTWAVLAVISIW..DLVAVLTPKGP----LRILVETAQERNEPIFPALIYSSTVMYCM...........
G3Q8S2_GASAC/77-448ALVFIKFLPEWSAWLILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWT............
F6GSZ0_VITVI/15-427AYWFTL.LPEWTTWVLLVAMALY..DLAAVLLPGGP----LRLLVELAISRDEDI.PALVYEARPVTYQDSCPGGGVAQ.
B4QRZ4_DROSI/98-517ALVFIKYLPEWTAWAVLAAISIW..DLIAVLSPRGP----LRILVETAQERNEQIFPALIYSSTVVYALVNT........
SPE4_CAEEL/11-464SVFYLRVFPSKTTWFVLWIVLFW..DLFAVLAPMGP----LKKVQEKASDYSKCVLNLIMFSANEKRLTAGSNQEETNE.
C7J054_ORYSJ/30-449AFWFTL.LPEWTTWALLVAMAVY..DLAAVLLPGGP----LRLLLELAIERNEEI.PALVYEARPVDPRHGHNWRLWRE.
T1HN85_RHOPR/7-402ALIFIKYLPEWTTWVVLAVISVW..DLFAVLTPKGP----LRILVETAQERNEQIFPALIYSSTVIYSL...........
A9S846_PHYPA/9-467AFWFTK.LPEWTTWVLLLAMAAY..DVVAVLTPRGP----LNLLVELAIERDEDI.PALIYEARPTVSGRMQMPPSPAQ.
E3N426_CAERE/9-463SVFYLRAFPRYTTWFVLWMVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKFLMFAAEDKRETAGIDATEDSS.
D8LTV7_ECTSI/63-572AWQLSR.FEEWTGWCLLVVLALY..DLCAVLTPCGP----LKALVNLMQEYEEPM.PGLLYEAELPAGPPRRRRPENDR.
H3CB70_TETNG/22-406AL.FIKYLPEWSAWVILGAISVY..DLVAVLSPKGP----LRMLVETAQERNEPIFPALIYSSAMMWT............
G2J6Q7_CAEBR/9-477AVFYLRAFPKHTTWFVLWTVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKILMFAAEDKRESAGMDMAQDSQ.
I1N8G3_SOYBN/8-407AAWFTK.LPEWTTWTVLVALALY..DLVAVLAPGGP----LKLLVELESSRNEEL.PALVYEARPTVNTRNHAAAVGFI.
G3W888_SARHA/88-452ALVFIKYLPEWSAWVILGAISVY..DLVAVLCPKGP----LRMLVETAQERNEPIFPALIYSSAMVWT............
PSN_CAEEL/44-434ALVFIKYLPEWTVWFVLFVISVW..DLVAVLTPKGP----LRYLVETAQERNEPIFPALIYSSGVIYPYVL.........
F2CQD9_HORVD/22-450AAWLSR.LPEWTTWIMLLALAVY..DLVAVLAPRGP----LRMLVELASSRDDEL.PALIYESRPTVGPAETSSSYAPA.
W5N759_LEPOC/69-512ALVFIKYLPEWTAWLILAVISVY..DLIAVLCPKGP----LRMLVETAQERNEPIFPALIYSSTMVWL............
Q7PR98_ANOGA/98-513ALVFIKYLPEWTTWAVLAVISIW..DLIAVLTPKGP----LRILVETAQERNEQIFPALIYSSTIMYSYL..........
M1CAI2_SOLTU/15-421AYWFTL.LPEWTTWVLLVAMSLY..DLAAVLLPGGP----LRLLVELAISRDEDI.PALVYEARPIINPDSVQRGAVVQ.
W1NQ31_AMBTC/9-446AVWFTK.LPEWTTWVILVALALY..DLVAVLAPGGP----LKMLVDLASSREEEL.PALIYEARPTISTGSGPRESAMNL
K3WL66_PYTUL/82-563AWEFSM.WPMWTTITFCFMFAIY..DLCAVLTPCGP----LKCLINLIQEKQAPL.PGLLYEADVRDGVTNQPHQQPAA.
A2DZ73_TRIVA/13-381SIVFRY.LPDWTVWILLVLLIIY..DACVVLCPNGL----LILLLKKSEERGDAI.PALLYSAAAWEEADPEKGNQNNE.
G0NCU3_CAEBE/9-464SVFYLRAFPRYTTWFVLWTVLFW..DLFAVLAPMGP----LKKVQEKASDYSNNILKFLMFAAENKRASAGMDMLEGSE.
U9UMQ1_RHIID/178-561AFSLTN.LSSWTTWILLALLAIW..DLIAVLCPFGP----LRILVESSRNDKREI.PALLYSVNAVWLMASPGLSNKFR.
T1EFZ6_HELRO/89-576ALTFIKHLPDWTTWVLLAVISIW..DLVAVLAPKGP----LRSLVKLAQERNDPIFPALIYSTTMAWL............
B7QGI2_IXOSC/14-384AVVLEESFPEWTAWILMILVSLW..DMFAVLCVIGP----LRMLIETAHERNEPLFPALLFSTSSAWCY...........
A8PAF6_BRUMA/94-527ALIFIKYLPEWTVWTVLAVISIW..DLVAVLCPKGP----LRILVETAQERNEPIFPALIYSSGLLYAYTL.........
S2J107_MUCC1/49-424SISMLR.MPPWTTWTVLIAVAIY..DLFAVLCPAGP----LRLLITMAEERQENI.PALVYSAGMASFDTEDDFIGGYR.
D3B4U3_POLPA/99-477AISISR.LPDWTTWVILSVISIY..DLFAVLCPRGP----LKVLVETAQERNETI.PALIYNANFEPPSRPESIPKPPQ.
H2VWC4_CAEJA/11-477AVFYLRAFPRHTTWFVLFIVLFW..DLFAVLTPMGP----LKRVQEKASDYSNNILKFLMFAADDNRQSAGADRAEEVN.
A9VBA9_MONBE/203-602ALVLIKNLPDWTTWVLLAAIAIY..DLFAVLSPCGP----LKCLVEVAQERNQPLFPSLIYSSTMMWT............
F2TYS0_SALR5/109-504ALVLIKNLPDWTTWVVLAAIAIY..DLVAVLSPCGP----LKALVETAQERDEPLFPALIYSSTMAWI............
E1G929_LOALO/15-397SVFYLRMFPTHTAWFVLVCIIIW..DTFAVLAPVGP----LRRINEKAHEYSDQVLRFLMFTAEDKNDEPYEEITVNKS.
H3FRQ2_PRIPA/544-933ALMFIKMLPDWTAFALLVLISIW..DLVAVLCPKGP----LNMLVKMSQERNEPIFPALIYSSGILLPY...........

PF01478

FLAK_METJA/5-130IVCFFLG................--.......................................................
FLAK_METMP/5-130MMFLS..................--.......................................................
LEP4_BACSU/100-204LFLAVI.................--.......................................................
Q9HWA5_PSEAE/4-110CLSLP..................--.......................................................
Q8FME5_COREF/77-189LGYFA..................--.......................................................
Q9CPF6_PASMU/89-199FAFYCLYH...............--.......................................................
Q9RSQ9_DEIRA/109-347GVIVLISVYGSWVLRRFRERQWP--EAPIGYQQISLGLLAGAWLGPWWGLGVALLSAAVNVAAKKAVRIPELLTLGGFLV
Q97HN8_CLOAB/64-168IISYI..................--.......................................................
Q8XQX7_RALSO/14-117AGFLP..................--.......................................................
LEP4_HAEIN/90-200IVFYVIYW...............--.......................................................
Q8TMQ5_METAC/5-101LIIFF..................--.......................................................
Q8NQ30_CORGL/4-110GIYFL..................--.......................................................
Q98BF9_RHILO/11-116AVTFG..................--.......................................................
Y421_METTH/12-138ALGYI..................--.......................................................
Q8CXM1_OCEIH/104-208GIIFLI.................--.......................................................
A9CKJ3_AGRFC/8-113LGCFA..................--.......................................................
Q8TXH1_METKA/6-112GVTLV..................--.......................................................
Q8DLL0_THEEB/89-199WLFDLIRW...............--.......................................................
YC8A_METJA/6-148FITLSVRYEKFNKLVYIGVFLFL--LS.....................................................
Q9XAP1_STRCO/112-224LVLFL..................--.......................................................
LEP4_MYXXD/113-222LSFRMMEY...............--.......................................................
LEP4_XANCP/133-242VSLWTVWW...............--.......................................................
Q8TLD4_METAC/26-152ISVYI..................--.......................................................
O67535_AQUAE/105-214LIPFVIYL...............--.......................................................
Q988A4_RHILO/13-122AAAWLLRR...............--.......................................................
Q8XVK3_RALSO/140-249LFLWAIYW...............--.......................................................
Q87I88_VIBPA/13-110ICFFI..................--.......................................................
Q8F6L1_LEPIN/127-232LVLF...................--.......................................................
Q891G5_CLOTE/115-221IICII..................--.......................................................
Q9K8H1_BACHD/15-120ILLFI..................--.......................................................
LEP4_PSEAE/136-245LSLWSVFW...............--.......................................................
Q8XI34_CLOPE/100-206VIFLI..................--.......................................................
Q8EJP8_SHEON/157-266LSLWSIFW...............--.......................................................
Q9CMH2_PASMU/11-110VIGFL..................--.......................................................
Q92T43_RHIME/12-117AVSFA..................--.......................................................
HOPD_SALTY/9-119GGFALIYW...............--.......................................................
Q8FT27_COREF/8-114LLYLV..................--.......................................................
Q8THK9_METAC/8-134FLAYL..................--.......................................................
Q8RAF7_CALS4/104-208GILLL..................--.......................................................
PPPA_ECOLI/130-240ITFYSLRW...............--.......................................................
Q92YL6_RHIME/12-116ACTFV..................--.......................................................
Q89PI9_BRADU/13-114LLLFV..................--.......................................................
Q89UH6_BRADU/9-113VVAFT..................--.......................................................
Q87M36_VIBPA/5-111AVCFA..................--.......................................................
Q8Y6Y1_LISMO/101-204YLLFF..................--.......................................................
Q89HG8_BRADU/40-149LLLMV..................--.......................................................
Q8YXA0_NOSS1/108-226WLFEAIAL...............--.......................................................
Q9X222_THEMA/103-204IMFLI..................--.......................................................
LEP4_VIBCH/112-221IISYVSNF...............--.......................................................
Q989C3_RHILO/11-122VGLFP..................--.......................................................
LEP4_ECOLI/81-190GVLWCVYW...............--.......................................................
Q9ABP2_CAUCR/121-230GGLALIAW...............--.......................................................
Q8Y1N3_RALSO/10-114GLCIG..................--.......................................................
Q88QB9_PSEPK/4-110LLTLP..................--.......................................................
Y83C_METJA/9-115LILSI..................--.......................................................
Q87VV0_PSESM/5-111ALTLP..................--.......................................................
O29326_ARCFU/8-129VIALSY.................--.......................................................
Q97FF6_CLOAB/100-211IITKK..................--.......................................................
Q8RHE5_FUSNN/7-119GYISD..................--.......................................................
Q980Y8_SULSO/10-125LLFLI..................--.......................................................
Q8R8E5_CALS4/6-111AILFTI.................--.......................................................
LEP4_SYNY3/108-223WLFDLIRM...............--.......................................................
A0KPV9_AERHH/142-247LVLWSLYW...............--.......................................................
A5EXL5_DICNV/138-247LSLWSVYW...............--.......................................................
A9H675_GLUDA/111-216GVFRGI.................--.......................................................
C9R2X4_AGGAD/10-108IIGFL..................--.......................................................
C9R6J1_AGGAD/90-198GVFYAIYH...............--.......................................................
E0SLF4_DICD3/139-243LSLWLIYW...............--.......................................................
G1UB88_HAEDU/13-108VLFML..................--.......................................................
H7C7G6_CAUCR/11-113LVLGM..................--.......................................................
H9L4S3_VIBCH/135-244LSLWSIYW...............--.......................................................
I6Y9M6_MYCTU/5-108GVYLLV.................--.......................................................
LEP4_BURPS/162-269LFLWCILW...............--.......................................................
Q0WIM7_YERPE/129-236LFLWL..................--.......................................................
Q5F692_NEIG1/134-242SSLWLLCA...............--.......................................................
Q5ZVB6_LEGPH/138-246LALWLFIN...............--.......................................................
Q65GL0_BACLD/102-205MLPLLT.................--.......................................................
Q7MJZ8_VIBVY/10-109LIGML..................--.......................................................
Q9PAI1_XYLFA/133-241LSLWIVAA...............--.......................................................

PF04258

SIPL5_ARATH/240-524------------.....GESIPMLLRI....PR......L----------------------------------------
SPP2A_MOUSE/214-499------------.....AEKLPVVIRV....PKLMGYSVM----------------------------------------
SIP_ARATH/47-323------------.....SFDAPIKLLF....PT.......----------------------------------------
SPP2B_HUMAN/213-505------------.....REKLPMVLKV....PR.LNSSPL----------------------------------------
Q9VPQ7_DROME/71-359------------.....SFEAPIKLVF....PQ..DLIEN----------------------------------------
Q9VBL1_DROME/96-408------------VRDTPKLNLPGKLVF....PS.......----------------------------------------
SIPL4_ARATH/241-527------------.....EDGIPMLLKI....PR......M----------------------------------------
SIPL2_ARATH/242-525------------.....EDGIPMLLKI....PR......M----------------------------------------
YL8H_SCHPO/31-282------------.....GIDIPAKYVL....PQ.......----------------------------------------
YKK0_YEAST/145-510------------.....NLDIPVKLSL....PV...KFNT----------------------------------------
SPPL3_MOUSE/60-374------------GRDVPRLSLPGKLVF....PS.......----------------------------------------
IMP2_CAEEL/55-450------------.....GIDAPILLQF....PQ.DIYRNG----------------------------------------
HM13_MOUSE/62-350------------.....SFEAPIKLVF....PQ..DLLEK----------------------------------------
Q93346_CAEEL/275-601------------EQESVPEKFPMLMQVAHFNPMNECLDME----------------------------------------

PF06550

Q9HM09_THEAC/1-278-----------------DSDLPMLFVL----PENSGFTMR----------------------------------------
Q9HQ23_HALSA/15-306-----------------ELRLPIVLVV----PTTLAYSFV----------------------------------------
Q8TIY9_METAC/27-303-----------------DLKLPILFII----PKHLNYSFI----------------------------------------

PF01080

D3B5F5_POLPA/149-528............MAESESIEMNTTTTATQQQLLQNNTNNS......................QKPSPFPTPTSIPINLPS
G4VJ47_SCHMA/58-484DQQFVGSTITCSVDARNEALNINCTTQPCPTTSELVASDN........................................
T1KI16_TETUR/103-479............TGMADGGEKSALTNQEVDQNRPTQQDQ.........................................
K7J3W8_NASVI/92-490............ATMANGDTAAGDS......ISSPARVQP......................QTQRSSVSSDT.......
A0A068XH02_HYMMI/46-488............VRPSSATTTMNTKEEEIPLKTADERAEAQTLVNLNEMPPVSLRRRHPESFSMTPPHDSGYETRSQTHP
W5JK58_ANODA/96-499............GTHTDPDRPAPLSGERAIGTAGGSASAG.........................ATNYGAVE.......
E9FSB0_DAPPU/62-438............AVMATDQSSTSNSTSNNETAANGPRSPT........................................
C5WT76_SORBI/25-446............GRQPGADLDESSTVEVIGEVLGRNL.........................QANPGNSSSSQVHEAATL
C3Z2C5_BRAFL/88-496............VGMADSDPEAKKKKKKKKKRRGDGDAQG......................AAPAGAVGGEE.......
H2TY46_TAKRU/29-412............VGMAKPVDAPHSG...........RETE......................QLSPHSPAETE.......
H3AT04_LATCH/77-455............VGMADPDPEARRKEPEDS......RREA......................EASTNHTASAT.......
I1HEG8_BRADI/69-507............MWSEEMQLPADSARSGVNQYERAGQQDNLGSAMVEMRDLGGSRSRVHQTTSSSGSMLQMGNLEAGQIS
W4XU10_STRPU/68-474............VGMADIDSPPPKSKAKQEPPVEEHTAEE......................NATATGTTVSG.......
G7Y344_CLOSI/42-431............LITASTSANANGSEAEGSDSNAEVPLMS........................................
B7Q2V0_IXOSC/41-421............VTMADRDPFYSSQNQHASQSDASSGTSR......................RPCSTFPRMRG.......
PSN1_RAT/76-458............VNMAEGDPEAQRRVPKNPKYSTQGTERE......................ETQDTGTGSDD.......
T1JMG4_STRMM/67-438............SMMADRETGVEERSNTANNTGQAGNASP........................................
T1G6P3_HELRO/9-376............AVVATSSTSQDDIHTEVYHVSTATAASG......................DHVYNGNNYDD.......
D7LLE1_ARALL/15-389............RRVWRERRSNDAENHANRNEVRAVRSEEVEE.....................................
A2G9L8_TRIVA/13-428............EEQNEEGEDHENLDNYDEEYDSASEDES......................TDPDSSASSDDALPINPD
F6RA92_CIOIN/37-422............VGMAQNAPAPNQQPRGNGSFSTLGVWVH......................SDNTSSTSQGS.......
I3IV36_ORENI/95-480............VNMADTDRPNRNSTEAASPQQEPQEAPV......................ASPVPSSPSQD.......
H2Z6F8_CIOSA/7-395............VGMAQETSRPNAQVSDVPMVGTKSVGST......................DTSSTSGGS.........
K1PKB7_CRAGI/84-479............VGMADDGSDKKKKKKKKSKKKPEAATAE........................................
S2K404_MUCC1/83-504............LSNSMLGTATSTVHETISSPNNNDMRLSVQLHSPSSFIQQNFRKSHDGFMRLPDDSHLTLDSS.....
H3FRQ2_PRIPA/66-481............TIMMSMVEEQERKHVEEGEDGGGGGGEG......................GETTGERRESA.......
E0VJ41_PEDHC/87-467............VNMTSEETKNPTS...........SLKE......................SNSTRNFEEDP.......
E2AIY0_CAMFO/93-484............ATMASEDTVASPT...........RSQV......................DNQNNRASNDT.......
F4PRZ5_DICFS/219-583............MASSKNNTTPTTKTTTNDDTMSDTSSNS......................SSSSSSSSSS........
B0WS38_CULQU/61-516............GTHSDPSEEALTRGERAIGTGSTGTVTT......................SYGSTGTPVHS.......
A0A068YDE2_ECHMU/45-476............VAMMGDEETHSTHLGPAVKPTEEHACLS......................QPSPQQPSSLAPLLEMGN
E2BSL4_HARSA/95-504............ATMAGSDATSGDTTTSGNNTTSPTRDRT......................DNQCSYASGDT.......
H9J5W9_BOMMO/68-456............AAASPAPGAAGERELRPLQPHGTVEGEG......................RDGTEAGGG.........
G3Q8S2_GASAC/77-448............VGMASPPEAQRSGQETGRASQAPTYERE........................................
F6GSZ0_VITVI/15-427............RRAWRERRGVGSNLSENSNNLATSDVNV......................NPDVASNSTLGTCLSVGS
B4QRZ4_DROSI/98-517............VTPQQSQATASSSPSSSNSTTTTRATQN......................SLASPEAAAAS.......
SPE4_CAEEL/11-464...............GEESTIRRTVKQTIEYYTKREAQDD......................EFYQKIRQRRAAINPDSV
C7J054_ORYSJ/30-449............RTQSGAELDANSTVEVLGEVLGTNLGAS......................SAGNLGVSAIRSDERVGL
T1HN85_RHOPR/7-402............INKISDEDNAQRG...........KTSS......................SVSTPQVNYSA.......
A9S846_PHYPA/9-467............MGSDAERPRVRRWNRRASRSSNPSPDTELG....................ESPMSSGNASQRDSTLTA
E3N426_CAERE/9-463............ENLNDERKLRKDVKQLIELYSKKEAQDD......................EFLRKIRQRRTAINPDSA
D8LTV7_ECTSI/63-572............RAPSQQQARREQPGATGGPQEGDVSSSP......................RAPVGTATMGGGGLADLA
H3CB70_TETNG/22-406............VGMAKPTEAPPPGAETGEEGTPTEGTLR......................EEGPRPLPEAE.......
G2J6Q7_CAEBR/9-477............ENLNDERKLRKDVKELIQLYSKQDEKDD......................EFLQKIRQRRNAINPDSG
I1N8G3_SOYBN/8-407............VAGVSDSETSRIELQVVSRVNSNNNNNL......................SSNNDNGENGINDEWERS
G3W888_SARHA/88-452............VGMAKVDTPTKGALPKDQEQVWEQDEDS......................SDTSGDHSYSE.......
PSN_CAEEL/44-434............VTAVENTTDPREPTSSDSNTSTAFPGEA......................SCSSETPKRPK.......
F2CQD9_HORVD/22-450............MWSEESQHHDSAARSGPNLYDRVGQHDDSAPAMVEMRDLG..........STSRDMATSNQAVTGQTS
W5N759_LEPOC/69-512............VGMADGESQAKKKEEPNSSELDDQGSRW......................ESSRTHGQSAS.......
Q7PR98_ANOGA/98-513............GTHTDPDRAAPLSGERTIGTGPGSAGGG......................SRQAGGYGAVN.......
M1CAI2_SOLTU/15-421............RRVWRERRDNDIGSDENLDSRSNLNSTV......................YSSLESSSGLESLPSIGE
W1NQ31_AMBTC/9-446LVGGVSESSETMYSQSQSALSVELQPSRSFVQSSDGIDSH......................RASETCGYSTVTVDGNSS
K3WL66_PYTUL/82-563............AAPRARKSPRPAAATASSSSLGEASQSS......................SSVHASGNSSS.......
A2DZ73_TRIVA/13-381............EGDGNEGNQEDPAEQADNQDNNEEEEEE......................EEAE..............
G0NCU3_CAEBE/9-464............EP.NEERKIRQNVSQLIQMYSKKEEKDD......................EFLQKIRQRRTAINPDSG
U9UMQ1_RHIID/178-561............KSLSSVSSFQATSGEEIPLSENIRYNRG........................................
T1EFZ6_HELRO/89-576............VEPSSGAYEADNDGGADAEADVDGEGDN......................VIEIHDDQVPEGQIPEGH
B7QGI2_IXOSC/14-384............DLSAQTPTNAEKLPRRLLNFRGSTNTED......................SFVVSRMKAIQEIRRQED
A8PAF6_BRUMA/94-527............IGTAMMEQDTSCVTGNTQSESGNPGSST......................GSTNGSLPSTAELLPAND
S2J107_MUCC1/49-424............TQESNRASKNHKKWLPFTNANKGYRPIH........................................
D3B4U3_POLPA/99-477............QQQQQQSASSSSSQQARSRRNNNNGGED......................QQEDEFGQQ.........
H2VWC4_CAEJA/11-477...............EGDGTIRRGVKQLIAMYSKQEAQDE......................EFAQKIRQRRSAWNPDSG
A9VBA9_MONBE/203-602............VTMADVGDSSSNSATIESQPRVADGGAS......................TRGTEMTSMS........
F2TYS0_SALR5/109-504............VNMADTGERTQTQSTSLTNGAQTQPQQQ......................QQQQQRGGTATS......
E1G929_LOALO/15-397............FIKRKQQKMRE.........................................................
H3FRQ2_PRIPA/544-933............TIMLRKLAGKSNEEVEGGAKGEEEAASG......................VS................

PF01478

FLAK_METJA/5-130..........................F.FM..........----------------------------------------
FLAK_METMP/5-130........................................----------------------------------------
LEP4_BACSU/100-204...........................AAI..........----------------------------------------
Q9HWA5_PSEAE/4-110............................GY..........----------------------------------------
Q8FME5_COREF/77-189........................................----------------------------------------
Q9CPF6_PASMU/89-199........................LSKGIY..........----------------------------------------
Q9RSQ9_DEIRA/109-347SLALSSAGTGPGLLDMLRGGLMAAGAVSLVCGVYWWIYWR----------------------------------------
Q97HN8_CLOAB/64-168............................FA..........----------------------------------------
Q8XQX7_RALSO/14-117............................LY..........----------------------------------------
LEP4_HAEIN/90-200........................LAKFYY..........----------------------------------------
Q8TMQ5_METAC/5-101............................AF..........----------------------------------------
Q8NQ30_CORGL/4-110...........................TAV..........----------------------------------------
Q98BF9_RHILO/11-116............................LF..........----------------------------------------
Y421_METTH/12-138............................LW..........----------------------------------------
Q8CXM1_OCEIH/104-208...........................ILI..........----------------------------------------
A9CKJ3_AGRFC/8-113............................LF..........----------------------------------------
Q8TXH1_METKA/6-112............................LN..........----------------------------------------
Q8DLL0_THEEB/89-199........................GGAIAF..........----------------------------------------
YC8A_METJA/6-148.......FILFKSYFALSFLVFYLIGIFLY..........----------------------------------------
Q9XAP1_STRCO/112-224........................................----------------------------------------
LEP4_MYXXD/113-222........................VGWKVF..........----------------------------------------
LEP4_XANCP/133-242........................LFKQLT..........----------------------------------------
Q8TLD4_METAC/26-152............................LF..........----------------------------------------
O67535_AQUAE/105-214........................YYVKFR..........----------------------------------------
Q988A4_RHILO/13-122........................GHFLMT..........----------------------------------------
Q8XVK3_RALSO/140-249........................AYKLLR..........----------------------------------------
Q87I88_VIBPA/13-110............................LW..........----------------------------------------
Q8F6L1_LEPIN/127-232............................FF..........----------------------------------------
Q891G5_CLOTE/115-221............................IL..........----------------------------------------
Q9K8H1_BACHD/15-120........................................----------------------------------------
LEP4_PSEAE/136-245........................LFKLVT..........----------------------------------------
Q8XI34_CLOPE/100-206............................SK..........----------------------------------------
Q8EJP8_SHEON/157-266........................LFKLLT..........----------------------------------------
Q9CMH2_PASMU/11-110............................LF..........----------------------------------------
Q92T43_RHIME/12-117............................LF..........----------------------------------------
HOPD_SALTY/9-119........................GYRLRY..........----------------------------------------
Q8FT27_COREF/8-114...........................TAG..........----------------------------------------
Q8THK9_METAC/8-134............................LF..........----------------------------------------
Q8RAF7_CALS4/104-208........................................----------------------------------------
PPPA_ECOLI/130-240........................IAGIVL..........----------------------------------------
Q92YL6_RHIME/12-116............................LF..........----------------------------------------
Q89PI9_BRADU/13-114............................LY..........----------------------------------------
Q89UH6_BRADU/9-113............................CF..........----------------------------------------
Q87M36_VIBPA/5-111............................LY..........----------------------------------------
Q8Y6Y1_LISMO/101-204............................II..........----------------------------------------
Q89HG8_BRADU/40-149............................LY..........----------------------------------------
Q8YXA0_NOSS1/108-226.........................LGVVF..........----------------------------------------
Q9X222_THEMA/103-204........................................----------------------------------------
LEP4_VIBCH/112-221........................IVRLFK..........----------------------------------------
Q989C3_RHILO/11-122............................FW..........----------------------------------------
LEP4_ECOLI/81-190........................GVWLVC..........----------------------------------------
Q9ABP2_CAUCR/121-230........................LYKTVR..........----------------------------------------
Q8Y1N3_RALSO/10-114............................LY..........----------------------------------------
Q88QB9_PSEPK/4-110............................GY..........----------------------------------------
Y83C_METJA/9-115........................................----------------------------------------
Q87VV0_PSESM/5-111............................GY..........----------------------------------------
O29326_ARCFU/8-129...........................ALY..........----------------------------------------
Q97FF6_CLOAB/100-211............................II..........----------------------------------------
Q8RHE5_FUSNN/7-119............................IL..........----------------------------------------
Q980Y8_SULSO/10-125............................LY..........----------------------------------------
Q8R8E5_CALS4/6-111...........................YII..........----------------------------------------
LEP4_SYNY3/108-223........................GGSLLL..........----------------------------------------
A0KPV9_AERHH/142-247........................AFKLLT..........----------------------------------------
A5EXL5_DICNV/138-247........................LFKLIT..........----------------------------------------
A9H675_GLUDA/111-216...........................SLL..........----------------------------------------
C9R2X4_AGGAD/10-108............................LF..........----------------------------------------
C9R6J1_AGGAD/90-198........................AAKWYY..........----------------------------------------
E0SLF4_DICD3/139-243........................AFRLLS..........----------------------------------------
G1UB88_HAEDU/13-108........................................----------------------------------------
H7C7G6_CAUCR/11-113...........................GMF..........----------------------------------------
H9L4S3_VIBCH/135-244........................LFKLLT..........----------------------------------------
I6Y9M6_MYCTU/5-108...........................HLA..........----------------------------------------
LEP4_BURPS/162-269........................LFKLLR..........----------------------------------------
Q0WIM7_YERPE/129-236...........................SYW..........----------------------------------------
Q5F692_NEIG1/134-242........................VYKLLT..........----------------------------------------
Q5ZVB6_LEGPH/138-246........................LFYLMT..........----------------------------------------
Q65GL0_BACLD/102-205...........................LLL..........----------------------------------------
Q7MJZ8_VIBVY/10-109............................LW..........----------------------------------------
Q9PAI1_XYLFA/133-241........................LFKLIF..........----------------------------------------

PF04258

SIPL5_ARATH/240-524--------------------------------------------------------------------------------
SPP2A_MOUSE/214-499--------------------------------------------------------------------------------
SIP_ARATH/47-323--------------------------------------------------------------------------------
SPP2B_HUMAN/213-505--------------------------------------------------------------------------------
Q9VPQ7_DROME/71-359--------------------------------------------------------------------------------
Q9VBL1_DROME/96-408--------------------------------------------------------------------------------
SIPL4_ARATH/241-527--------------------------------------------------------------------------------
SIPL2_ARATH/242-525--------------------------------------------------------------------------------
YL8H_SCHPO/31-282--------------------------------------------------------------------------------
YKK0_YEAST/145-510--------------------------------------------------------------------------------
SPPL3_MOUSE/60-374--------------------------------------------------------------------------------
IMP2_CAEEL/55-450--------------------------------------------------------------------------------
HM13_MOUSE/62-350--------------------------------------------------------------------------------
Q93346_CAEEL/275-601--------------------------------------------------------------------------------

PF06550

Q9HM09_THEAC/1-278--------------------------------------------------------------------------------
Q9HQ23_HALSA/15-306--------------------------------------------------------------------------------
Q8TIY9_METAC/27-303--------------------------------------------------------------------------------

PF01080

D3B5F5_POLPA/149-528................................................................................
G4VJ47_SCHMA/58-484................................................................................
T1KI16_TETUR/103-479................................................................................
K7J3W8_NASVI/92-490................................................................................
A0A068XH02_HYMMI/46-488NGAMND..........................................................................
W5JK58_ANODA/96-499................................................................................
E9FSB0_DAPPU/62-438................................................................................
C5WT76_SORBI/25-446AGDVSNSRPRVTLGAAFS..............................................................
C3Z2C5_BRAFL/88-496................................................................................
H2TY46_TAKRU/29-412.........................................................................PETDREF
H3AT04_LATCH/77-455................................................................................
I1HEG8_BRADI/69-507NQGGSAQHAVIQ....................................................................
W4XU10_STRPU/68-474........................................................................QEDQTVSS
G7Y344_CLOSI/42-431................................................................................
B7Q2V0_IXOSC/41-421................................................................................
PSN1_RAT/76-458................................................................................
T1JMG4_STRMM/67-438................................................................................
T1G6P3_HELRO/9-376................................................................................
D7LLE1_ARALL/15-389................................................................................
A2G9L8_TRIVA/13-428EFVGLSNNPEDQPPP.................................................................
F6RA92_CIOIN/37-422................................................................................
I3IV36_ORENI/95-480................................................................................
H2Z6F8_CIOSA/7-395................................................................................
K1PKB7_CRAGI/84-479............................................................................PDQV
S2K404_MUCC1/83-504................................................................................
H3FRQ2_PRIPA/66-481................................................................................
E0VJ41_PEDHC/87-467................................................................................
E2AIY0_CAMFO/93-484................................................................................
F4PRZ5_DICFS/219-583................................................................................
B0WS38_CULQU/61-516.............................MSQSSTPAHQPANQQQRQQQQPPPPRPDNAEGTPLVSYRENAAVRTAVGQG
A0A068YDE2_ECHMU/45-476LSGNSTQPSGMAN...................................................................
E2BSL4_HARSA/95-504................................................................................
H9J5W9_BOMMO/68-456................................................................................
G3Q8S2_GASAC/77-448................................................................................
F6GSZ0_VITVI/15-427GEQETSLVNAE.....................................................................
B4QRZ4_DROSI/98-517...........................................................GQRTGNSHPRQNQRDDGSVLA
SPE4_CAEEL/11-464PTEHSPLVEAEPSP...IEL............................................................
C7J054_ORYSJ/30-449AGDARNLRLGTSMPNL................................................................
T1HN85_RHOPR/7-402.........................................................................LRMIQLS
A9S846_PHYPA/9-467AVDDSQNLITGPPTEPEVGIIGSRLISSTGEGGALHAVSIILHENSHMDDDTVPLV........................
E3N426_CAERE/9-463LTETSP.VHTEPSDAL.IQL............................................................
D8LTV7_ECTSI/63-572GGGDEEGG........................................................................
H3CB70_TETNG/22-406..................................................................LEEDPGPASRGSES
G2J6Q7_CAEBR/9-477STAHSPMVTTEPSPIVL...............................................................
I1N8G3_SOYBN/8-407PLVGGMRF........................................................................
G3W888_SARHA/88-452................................................................................
PSN_CAEEL/44-434................................................................................
F2CQD9_HORVD/22-450NQGGSAQHAVIQIE..................................................................
W5N759_LEPOC/69-512......................................................................PADSHSLCVH
Q7PR98_ANOGA/98-513......................................................................NHGPTQTGAT
M1CAI2_SOLTU/15-421RTAVDVE.........................................................................
W1NQ31_AMBTC/9-446SFGGYGAQRADHG...................................................................
K3WL66_PYTUL/82-563................................................................................
A2DZ73_TRIVA/13-381................................................................................
G0NCU3_CAEBE/9-464LTGHSPLVHTQPSPTTPLRL............................................................
U9UMQ1_RHIID/178-561................................................................................
T1EFZ6_HELRO/89-576VPEGHVHEGHVPESHVPESHVPEGHVPEGHVPEGHILSSDKAGTSANVDYVNLEHFTTEITIAAEK..............
B7QGI2_IXOSC/14-384VLCSHHHHHTHQPRH.................................................................
A8PAF6_BRUMA/94-527ANEKRGFPQGK........................................................IIRRFAPTRTAND
S2J107_MUCC1/49-424................................................................................
D3B4U3_POLPA/99-477................................................................................
H2VWC4_CAEJA/11-477LTEQSPLVETEPSPSVPTEH............................................................
A9VBA9_MONBE/203-602................................................................................
F2TYS0_SALR5/109-504................................................................................
E1G929_LOALO/15-397................................................................................
H3FRQ2_PRIPA/544-933................................................................................

PF01478

FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRFC/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_CALS4/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_CALS4/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
C9R6J1_AGGAD/90-198--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524----------------------------------SDPW-----------------------------GG-----------
SPP2A_MOUSE/214-499----------------------------------SVCS-----------------------------VP-----------
SIP_ARATH/47-323----------------------------------GDAL-----------------------------RP-----------
SPP2B_HUMAN/213-505----------------------------------ALCD-----------------------------RP-----------
Q9VPQ7_DROME/71-359----------------------------------GLNA-----------------------------SN-----------
Q9VBL1_DROME/96-408----------------------------------LHNT-----------------------------GH-----------
SIPL4_ARATH/241-527----------------------------------FDPW-----------------------------GG-----------
SIPL2_ARATH/242-525----------------------------------FDPW-----------------------------GG-----------
YL8H_SCHPO/31-282----------------------------------FKNP-----------------------------TR-----------
YKK0_YEAST/145-510----------------------------------AQNN-----------------------------FN-----------
SPPL3_MOUSE/60-374----------------------------------.STG-----------------------------SH-----------
IMP2_CAEEL/55-450----------------------------------IMEA-----------------------------SK-----------
HM13_MOUSE/62-350----------------------------------GLEA-----------------------------DN-----------
Q93346_CAEEL/275-601----------------------------------IELG-----------------------------FQ-----------

PF06550

Q9HM09_THEAC/1-278----------------------------------GLSFDN-----------RGD.............GN-----------
Q9HQ23_HALSA/15-306----------------------------------EDAAET-----------ADEAEAGEREAAAPADRP-----------
Q8TIY9_METAC/27-303----------------------------------TEGFKE-----------GEKREA............-----------

PF01080

D3B5F5_POLPA/149-528..................................QSEMIE...........PKSSPNSESMSTGVSTSE......LSEST
G4VJ47_SCHMA/58-484..................................SNQPMT...........GNSRNMLNIPNNTSRTDAIVVDTPDDNTI
T1KI16_TETUR/103-479..................................NIREGQ...........ASSSSQSPSSTQPAQPEA......DIPPI
K7J3W8_NASVI/92-490...EEGGFTREWVETHADR...............SARRAQ...........EVRENAQTNSRGSAEVNG......ASQQA
A0A068XH02_HYMMI/46-488..................................ERRVKS...........NQSHQPMDSSNSHQEWHN......PSPSL
W5JK58_ANODA/96-499..DQTAGFTQDWAATTNQR...............VTRRQI...........EVQANIASNPSRPEYRTV......TAESN
E9FSB0_DAPPU/62-438....DGGFTPAWNQEAEQR...............TEARRH...........RVQAAAAEAPRAAPQPQP......VTEEI
C5WT76_SORBI/25-446..................................SSDSTV...........AQAGEVSALPEHRVAVAEMSVPLIQPRPQ
C3Z2C5_BRAFL/88-496....EGGFGQDWNESRGFQ...............PTRRPN...........RGGNASDASVNSEDARQA......AQNLS
H2TY46_TAKRU/29-412CHGDDGGVHAKWCTSKQYR...............ISGSPI...........NPPRAAIIHQSGPVPVHK......GGD..
H3AT04_LATCH/77-455.PADDGGFTQDWVQQQNET..........LGDMHSTMETR...........AAVQALPNNNPIPEDP.............
I1HEG8_BRADI/69-507..................................IEQPEE...........EERAPLVSAASANSAVAN......EEHRQ
W4XU10_STRPU/68-474DQEVNGGFDTVF......................TERRER...........DLERSANSSVTSEDRRAA......VRALR
G7Y344_CLOSI/42-431..................................EYRHST...........GDQRNSSDLPSANVTTSE......QLPER
B7Q2V0_IXOSC/41-421..................................SGRSRR...........RSQRGSMANSGTLAALGS......SQGSA
PSN1_RAT/76-458.....GGFSEEWEAQRDSH..........LGPHRSTPESR...........AAVQELSGSILTSEDP.............
T1JMG4_STRMM/67-438.EDQEAGFSREW......................LVRRGT...........GNNVTRIDENGRRSQRRS......MPNPV
T1G6P3_HELRO/9-376..................................DSTNLA...........YMNRFIHSKPDRKDEPKI......SSTIY
D7LLE1_ARALL/15-389..................................EHVGSS...........ERAEISVPLIDRRPEQAE......NSETF
A2G9L8_TRIVA/13-428..................................QPKPEQ...........QPESELAQPAGEPTKPKK......KRPNQ
F6RA92_CIOIN/37-422....DTGFDVAWQRRHNRNSGEVIIT........SNETRN...........QARQQLGPPPEGSEEA.............
I3IV36_ORENI/95-480....DGGFTQSWVSQQEHR..........LGPLQSTEETR...........REIQQMPSARPPVEEDD............
H2Z6F8_CIOSA/7-395....EAGFGVSWQRHHDSEVTCCFYLNKYCVVITSNETRE...........HARQQLGDPPEEP................
K1PKB7_CRAGI/84-479EAELDGGF..........................LEERPT...........RQLSQSTEETARAVRAARVLGDTENGQRT
S2K404_MUCC1/83-504..................................SNPFAT...........QTTLQAPDDTDRPSTPRQ......EEATR
H3FRQ2_PRIPA/66-481..................................NNQPST...........SSSVPSSSSASTSVLIPA......GESKQ
E0VJ41_PEDHC/87-467....ESGFVRGWMNPQR.................AKRRNE...........EIQQSEVRFHPQQSEGHS......NPGPV
E2AIY0_CAMFO/93-484...EEGGFTPEWVETHGER...............SARRAQ...........EVRENSSREGTTRQQENR......VRFSQ
F4PRZ5_DICFS/219-583..................................SSSNIQ...........KSTSSSSISTGLSTEPSD......TPMEV
B0WS38_CULQU/61-516HPDQSGGFTQEWADASGQR...............VTRRQI...........EVQANIASNPNRPEYRTV......TAGAR
A0A068YDE2_ECHMU/45-476..................................DLSHSE...........GQQSNQGEGNTNQQEQCD......FTPPL
E2BSL4_HARSA/95-504...EEEGFTNEWVETHGER...............SARRAQ...........EVRENDETRGTNRRQQEN......RSVEI
H9J5W9_BOMMO/68-456....EAGFDAAWRERRDEG...............AAPRRL...........RVDSAPPRYVTRLDPPHA......PHAPP
G3Q8S2_GASAC/77-448CRDPQGCWFEPWLFHEEAEQ..............SSRRAE...........PENRQSQLFPEDDLE..............
F6GSZ0_VITVI/15-427..................................EGRVSE...........GNSELVVPLIDHRINVGE......HGQED
B4QRZ4_DROSI/98-517TEAEAAGFTQEWSANLSER...............VARRQI...........EVQSTQSGNAQRSNEYRT......VTAPD
SPE4_CAEEL/11-464..................................KEKNST...........EELSDDESDTSETSSGSS......NLSSS
C7J054_ORYSJ/30-449..................................SSDSAS...........AQVEVLPASPEISVSVPEMRVPLIQPRPE
T1HN85_RHOPR/7-402VELREDGFSADWADGLEAR...............VEGRQR...........AVAAHEASSGFQPRQPTR......ISTQN
A9S846_PHYPA/9-467..................................QQQTNS...........PSSPATLGRSEAEFDHRS......RPMNG
E3N426_CAERE/9-463..................................KSKNSD...........EEHTDDESDTTESSTTTS.........SS
D8LTV7_ECTSI/63-572..................................RGADDE...........TPAAPVSAEAAAVVEPQS......SSPGG
H3CB70_TETNG/22-406CRLRPLGPGRSWKFL...................ELQTPE...........QVWTRLTDH....................
G2J6Q7_CAEBR/9-477..................................KEKNSD...........EELFDNESDTTESSSESS........TSS
I1N8G3_SOYBN/8-407..................................GEVVVD...........EGMSPLVEMSGVGENEEE......GEGVR
G3W888_SARHA/88-452..................................TYDSPR...........CTPLHVPSYAVEELEEE............
PSN_CAEEL/44-434..................................VKRIPQ...........KVQIESNTTASTTQNSGV......RVERE
F2CQD9_HORVD/22-450..................................RRQEEE...........LETAPLVSAASANPTVAN......EEHTQ
W5N759_LEPOC/69-512THIPRYGELINFLSSSGQNRILTISLKFRSSQLHGDGDLNVVRKASYFLLGKEVVHFSSSNPEHISTPQKLGCESSPSAG
Q7PR98_ANOGA/98-513VEDQTAGFTQDWAATANQR...............VTRRQI...........EVQANIANNPSRPEYRTV......TAEAT
M1CAI2_SOLTU/15-421..................................DGLVSR...........SDSELAAPLIQHRINVRM......NLQ..
W1NQ31_AMBTC/9-446..................................EIEHVN...........EEMSPLVIRGGESHDLSH......ATERV
K3WL66_PYTUL/82-563..................................SSSNHQ...........RAARPTPAPIQPRPAPVA......PAASS
A2DZ73_TRIVA/13-381..................................NNQPQE...........NANGEAQNGNQNNNKKKK......NMSKR
G0NCU3_CAEBE/9-464..................................KEHNSD...........VEHTDDESDTTESSSSSS........SSG
U9UMQ1_RHIID/178-561..................................EGGVSD...........EGGINCDGTDENSQIPRRQSSSLQPQSQP
T1EFZ6_HELRO/89-576..................................KSDEPD...........QQERPAEEQGEPQAKQKR......SKHRQ
B7QGI2_IXOSC/14-384..................................HRQRRQ...........DAAAPEDT.....................
A8PAF6_BRUMA/94-527QGVENAGLNTEQSDNNSKN...............IGKGRT...........AASFNKGGESGGTQRVTV......QNTEV
S2J107_MUCC1/49-424..................................NNELDE...........NATLSIALSTLEQSRDVE......RRNSN
D3B4U3_POLPA/99-477..................................QQQQED...........DAQVDVNNNDEEVPPIEE......LEPEQ
H2VWC4_CAEJA/11-477..................................QQEEKE...........DKQMDSESSSESCSESAS.......IASG
A9VBA9_MONBE/203-602..................................SQPRAR...........QGSRADSEADDGARDIST......FAAPR
F2TYS0_SALR5/109-504..................................SSSHGH...........HRRRSRQSSSSPNADDVE......LLADI
E1G929_LOALO/15-397..................................RHERRS...........KTKLDSEAENEHLRQRKM......LCSKS
H3FRQ2_PRIPA/544-933..................................CGESRQ...........NRSRVGPSSDEEKGTREK......AGCDE

PF01478

FLAK_METJA/5-130---------------------------------------------------...........FLL....-----------
FLAK_METMP/5-130---------------------------------------------------..................-----------
LEP4_BACSU/100-204---------------------------------------------------...........THG....-----------
Q9HWA5_PSEAE/4-110---------------------------------------------------...........LLG....-----------
Q8FME5_COREF/77-189---------------------------------------------------...........LAFIA..-----------
Q9CPF6_PASMU/89-199---------------------------------------------------...........RKE....-----------
Q9RSQ9_DEIRA/109-347---------------------------------------------------RNKQAEDDGTDDEQSD..-----------
Q97HN8_CLOAB/64-168---------------------------------------------------...........LFK....-----------
Q8XQX7_RALSO/14-117---------------------------------------------------...........ALG....-----------
LEP4_HAEIN/90-200---------------------------------------------------...........GKE....-----------
Q8TMQ5_METAC/5-101---------------------------------------------------...........KKG....-----------
Q8NQ30_CORGL/4-110---------------------------------------------------...........LVG....-----------
Q98BF9_RHILO/11-116---------------------------------------------------...........AMG....-----------
Y421_METTH/12-138---------------------------------------------------...........RMV....-----------
Q8CXM1_OCEIH/104-208---------------------------------------------------...........SRG....-----------
A9CKJ3_AGRFC/8-113---------------------------------------------------...........AAN....-----------
Q8TXH1_METKA/6-112---------------------------------------------------...........VLG....-----------
Q8DLL0_THEEB/89-199---------------------------------------------------...........NQE....-----------
YC8A_METJA/6-148---------------------------------------------------...........YLN....-----------
Q9XAP1_STRCO/112-224---------------------------------------------------..............IN..-----------
LEP4_MYXXD/113-222---------------------------------------------------...........QRE....-----------
LEP4_XANCP/133-242---------------------------------------------------...........GKE....-----------
Q8TLD4_METAC/26-152---------------------------------------------------...........HLG....-----------
O67535_AQUAE/105-214---------------------------------------------------...........KIE....-----------
Q988A4_RHILO/13-122---------------------------------------------------...........GRI....-----------
Q8XVK3_RALSO/140-249---------------------------------------------------...........GRE....-----------
Q87I88_VIBPA/13-110---------------------------------------------------...........LIN....-----------
Q8F6L1_LEPIN/127-232---------------------------------------------------...........FPG....-----------
Q891G5_CLOTE/115-221---------------------------------------------------...........LTN....-----------
Q9K8H1_BACHD/15-120---------------------------------------------------...........VYLIY..-----------
LEP4_PSEAE/136-245---------------------------------------------------...........GKE....-----------
Q8XI34_CLOPE/100-206---------------------------------------------------...........LTG....-----------
Q8EJP8_SHEON/157-266---------------------------------------------------...........GKE....-----------
Q9CMH2_PASMU/11-110---------------------------------------------------...........TFG....-----------
Q92T43_RHIME/12-117---------------------------------------------------...........AAN....-----------
HOPD_SALTY/9-119---------------------------------------------------...........QKE....-----------
Q8FT27_COREF/8-114---------------------------------------------------...........VVG....-----------
Q8THK9_METAC/8-134---------------------------------------------------...........RLR....-----------
Q8RAF7_CALS4/104-208---------------------------------------------------...........ISLLS..-----------
PPPA_ECOLI/130-240---------------------------------------------------...........RKE....-----------
Q92YL6_RHIME/12-116---------------------------------------------------...........AAG....-----------
Q89PI9_BRADU/13-114---------------------------------------------------...........TRG....-----------
Q89UH6_BRADU/9-113---------------------------------------------------...........AMG....-----------
Q87M36_VIBPA/5-111---------------------------------------------------...........LVK....-----------
Q8Y6Y1_LISMO/101-204---------------------------------------------------...........FRK....-----------
Q89HG8_BRADU/40-149---------------------------------------------------...........RRWRG..-----------
Q8YXA0_NOSS1/108-226---------------------------------------------------...........QKE....-----------
Q9X222_THEMA/103-204---------------------------------------------------...........LKAMY..-----------
LEP4_VIBCH/112-221---------------------------------------------------...........RID....-----------
Q989C3_RHILO/11-122---------------------------------------------------...........VLR....-----------
LEP4_ECOLI/81-190---------------------------------------------------...........HKE....-----------
Q9ABP2_CAUCR/121-230---------------------------------------------------...........GFD....-----------
Q8Y1N3_RALSO/10-114---------------------------------------------------...........LLR....-----------
Q88QB9_PSEPK/4-110---------------------------------------------------...........MLG....-----------
Y83C_METJA/9-115---------------------------------------------------..................-----------
Q87VV0_PSESM/5-111---------------------------------------------------...........TLG....-----------
O29326_ARCFU/8-129---------------------------------------------------...........LIG....-----------
Q97FF6_CLOAB/100-211---------------------------------------------------...........DMP....-----------
Q8RHE5_FUSNN/7-119---------------------------------------------------...........KKE....-----------
Q980Y8_SULSO/10-125---------------------------------------------------...........KLS....-----------
Q8R8E5_CALS4/6-111---------------------------------------------------...........TNG....-----------
LEP4_SYNY3/108-223---------------------------------------------------...........GRE....-----------
A0KPV9_AERHH/142-247---------------------------------------------------...........GKE....-----------
A5EXL5_DICNV/138-247---------------------------------------------------...........GRE....-----------
A9H675_GLUDA/111-216---------------------------------------------------...........YRRAR.G-----------
C9R2X4_AGGAD/10-108---------------------------------------------------...........SLR....-----------
C9R6J1_AGGAD/90-198---------------------------------------------------...........RQE....-----------
E0SLF4_DICD3/139-243---------------------------------------------------...........GRE....-----------
G1UB88_HAEDU/13-108---------------------------------------------------.............G....-----------
H7C7G6_CAUCR/11-113---------------------------------------------------...........AAG....-----------
H9L4S3_VIBCH/135-244---------------------------------------------------...........GKE....-----------
I6Y9M6_MYCTU/5-108---------------------------------------------------...........LPA....-----------
LEP4_BURPS/162-269---------------------------------------------------...........GIE....-----------
Q0WIM7_YERPE/129-236---------------------------------------------------...........LFKIVRG-----------
Q5F692_NEIG1/134-242---------------------------------------------------...........GKT....-----------
Q5ZVB6_LEGPH/138-246---------------------------------------------------...........GKV....-----------
Q65GL0_BACLD/102-205---------------------------------------------------...........TKG....-----------
Q7MJZ8_VIBVY/10-109---------------------------------------------------...........QRR....-----------
Q9PAI1_XYLFA/133-241---------------------------------------------------...........NKE....-----------

PF04258

SIPL5_ARATH/240-524--------------------------------------------------------------------------------
SPP2A_MOUSE/214-499--------------------------------------------------------------------------------
SIP_ARATH/47-323--------------------------------------------------------------------------------
SPP2B_HUMAN/213-505--------------------------------------------------------------------------------
Q9VPQ7_DROME/71-359--------------------------------------------------------------------------------
Q9VBL1_DROME/96-408--------------------------------------------------------------------------------
SIPL4_ARATH/241-527--------------------------------------------------------------------------------
SIPL2_ARATH/242-525--------------------------------------------------------------------------------
YL8H_SCHPO/31-282--------------------------------------------------------------------------------
YKK0_YEAST/145-510--------------------------------------------------------------------------------
SPPL3_MOUSE/60-374--------------------------------------------------------------------------------
IMP2_CAEEL/55-450--------------------------------------------------------------------------------
HM13_MOUSE/62-350--------------------------------------------------------------------------------
Q93346_CAEEL/275-601--------------------------------------------------------------------------------

PF06550

Q9HM09_THEAC/1-278--------------------------------------------------------------------------------
Q9HQ23_HALSA/15-306--------------------------------------------------------------------------------
Q8TIY9_METAC/27-303--------------------------------------------------------------------------------

PF01080

D3B5F5_POLPA/149-528DSVTLEKGR.......................................................................
G4VJ47_SCHMA/58-484NNDARNNNETISQAPHET..............................................................
T1KI16_TETUR/103-479SFRGQDNLRPDLAGVDEF.........EE...................................................
K7J3W8_NASVI/92-490NQQQMMMMQ.......................................................................
A0A068XH02_HYMMI/46-488TTGANEFSSHEMVTSGEQ..............................................................
W5JK58_ANODA/96-499RTGTNDPSQPALPMYAVQE.............................................................
E9FSB0_DAPPU/62-438DDDE............................................................................
C5WT76_SORBI/25-446RSGEEVEGEDGIGLSSSG..............................................................
C3Z2C5_BRAFL/88-496NGRLSPSGNQQQQQQQQQMEEDEDE.......................................................
H2TY46_TAKRU/29-412................................................................................
H3AT04_LATCH/77-455................................................................................
I1HEG8_BRADI/69-507ISSSDPPDEDFEMFESSK..............................................................
W4XU10_STRPU/68-474QNNGPSNRQPPVDEEEE...............................................................
G7Y344_CLOSI/42-431HLRRMTESIADHSGNSTD..............................................................
B7Q2V0_IXOSC/41-421PEVDDLPRQEE.....................................................................
PSN1_RAT/76-458................................................................................
T1JMG4_STRMM/67-438TNQDEE..........................................................................
T1G6P3_HELRO/9-376NA..............................................................................
D7LLE1_ARALL/15-389........LEGIGLGSSG..............................................................
A2G9L8_TRIVA/13-428DNQHGDPENPDKRKKKSGSAKSTPTSE.....................................................
F6RA92_CIOIN/37-422................................................................................
I3IV36_ORENI/95-480................................................................................
H2Z6F8_CIOSA/7-395................................................................................
K1PKB7_CRAGI/84-479NSPRNPTREEEEEEEE................................................................
S2K404_MUCC1/83-504KATEPENDEEDAERS.................................................................
H3FRQ2_PRIPA/66-481KRPQVRRVPPPAREERRE.........EEGV.................................................
E0VJ41_PEDHC/87-467GTNAVTVEE.......................................................................
E2AIY0_CAMFO/93-484EQGTVTE.........................................................................
F4PRZ5_DICFS/219-583NYST............................................................................
B0WS38_CULQU/61-516GGTGDSQQVPLYEQP.................................................................
A0A068YDE2_ECHMU/45-476TVDSVEPRLHEMQSGHGG..............................................................
E2BSL4_HARSA/95-504QSQVAPPPPPPPPM..................................................................
H9J5W9_BOMMO/68-456HAPDLD..........................................................................
G3Q8S2_GASAC/77-448................................................................................
F6GSZ0_VITVI/15-427SVSTENLPFEGIGLGSSG..............................................................
B4QRZ4_DROSI/98-517QNHPDGQ.........................................................................
SPE4_CAEEL/11-464DSSTT..........VST.........SDIS.................................................
C7J054_ORYSJ/30-449RTRDEEDDEDGIGLSSSG..............................................................
T1HN85_RHOPR/7-402PQGVPHAQDEE.....................................................................
A9S846_PHYPA/9-467ATQHSEDGDEETGIGLSG..............................................................
E3N426_CAERE/9-463D..............VTT.........SEVS.................................................
D8LTV7_ECTSI/63-572DHSSARRPGADSAGASESVAAPLLELVESGTAAVAVGDASADGSGTRSGREQGKRRLATVRRGIRGGGCLDPEPPGWRTV
H3CB70_TETNG/22-406................................................................................
G2J6Q7_CAEBR/9-477ESV............FSS.........SDVS.................................................
I1N8G3_SOYBN/8-407RKIGER..........................................................................
G3W888_SARHA/88-452................................................................................
PSN_CAEEL/44-434LAAERPTVQDANFHRHEE..............................................................
F2CQD9_HORVD/22-450ISSSEPPEEEFEMFESSR..............................................................
W5N759_LEPOC/69-512................................................................................
Q7PR98_ANOGA/98-513RAGQDPQLGGALYDQA................................................................
M1CAI2_SOLTU/15-421EGPSDDFALEGIGLGSSG..............................................................
W1NQ31_AMBTC/9-446EENHERDRAGVHERGRRGEGRILEFEASR...................................................
K3WL66_PYTUL/82-563DLATVTENFNRPRNVMES.........DFSTYDCETMDALIELLANFYRTFSPEDVWKAPQVAEKFFATQDRLWLLIFHK
A2DZ73_TRIVA/13-381DNE.............................................................................
G0NCU3_CAEBE/9-464EVSTE..........VSS.........SEVS.................................................
U9UMQ1_RHIID/178-561PNNVSYDDEEDERS..................................................................
T1EFZ6_HELRO/89-576HSKQQNRPKGPSQQQNEQ.........QQIG.................................................
B7QGI2_IXOSC/14-384................................................................................
A8PAF6_BRUMA/94-527NPAG............LQ.........NERF.................................................
S2J107_MUCC1/49-424EAGQDEDEEEDELN..................................................................
D3B4U3_POLPA/99-477EKR.............................................................................
H2VWC4_CAEJA/11-477DSNADDKEKEEEDDEYQS.........SNIE.................................................
A9VBA9_MONBE/203-602GETRSTNQAAPASQPSFQ.........PDDE.................................................
F2TYS0_SALR5/109-504GGSPAPNRARTAASRPPA.........NQGD.................................................
E1G929_LOALO/15-397DTQVEICSKFRAASD.................................................................
H3FRQ2_PRIPA/544-933KVVVIRSGASQSPEDYEE.........EEEE.................................................

PF01478

FLAK_METJA/5-130--------------------------------------------------------------------------------
FLAK_METMP/5-130--------------------------------------------------------------------------------
LEP4_BACSU/100-204--------------------------------------------------------------------------------
Q9HWA5_PSEAE/4-110--------------------------------------------------------------------------------
Q8FME5_COREF/77-189--------------------------------------------------------------------------------
Q9CPF6_PASMU/89-199--------------------------------------------------------------------------------
Q9RSQ9_DEIRA/109-347--------------------------------------------------------------------------------
Q97HN8_CLOAB/64-168--------------------------------------------------------------------------------
Q8XQX7_RALSO/14-117--------------------------------------------------------------------------------
LEP4_HAEIN/90-200--------------------------------------------------------------------------------
Q8TMQ5_METAC/5-101--------------------------------------------------------------------------------
Q8NQ30_CORGL/4-110--------------------------------------------------------------------------------
Q98BF9_RHILO/11-116--------------------------------------------------------------------------------
Y421_METTH/12-138--------------------------------------------------------------------------------
Q8CXM1_OCEIH/104-208--------------------------------------------------------------------------------
A9CKJ3_AGRFC/8-113--------------------------------------------------------------------------------
Q8TXH1_METKA/6-112--------------------------------------------------------------------------------
Q8DLL0_THEEB/89-199--------------------------------------------------------------------------------
YC8A_METJA/6-148--------------------------------------------------------------------------------
Q9XAP1_STRCO/112-224--------------------------------------------------------------------------------
LEP4_MYXXD/113-222--------------------------------------------------------------------------------
LEP4_XANCP/133-242--------------------------------------------------------------------------------
Q8TLD4_METAC/26-152--------------------------------------------------------------------------------
O67535_AQUAE/105-214--------------------------------------------------------------------------------
Q988A4_RHILO/13-122--------------------------------------------------------------------------------
Q8XVK3_RALSO/140-249--------------------------------------------------------------------------------
Q87I88_VIBPA/13-110--------------------------------------------------------------------------------
Q8F6L1_LEPIN/127-232--------------------------------------------------------------------------------
Q891G5_CLOTE/115-221--------------------------------------------------------------------------------
Q9K8H1_BACHD/15-120--------------------------------------------------------------------------------
LEP4_PSEAE/136-245--------------------------------------------------------------------------------
Q8XI34_CLOPE/100-206--------------------------------------------------------------------------------
Q8EJP8_SHEON/157-266--------------------------------------------------------------------------------
Q9CMH2_PASMU/11-110--------------------------------------------------------------------------------
Q92T43_RHIME/12-117--------------------------------------------------------------------------------
HOPD_SALTY/9-119--------------------------------------------------------------------------------
Q8FT27_COREF/8-114--------------------------------------------------------------------------------
Q8THK9_METAC/8-134--------------------------------------------------------------------------------
Q8RAF7_CALS4/104-208--------------------------------------------------------------------------------
PPPA_ECOLI/130-240--------------------------------------------------------------------------------
Q92YL6_RHIME/12-116--------------------------------------------------------------------------------
Q89PI9_BRADU/13-114--------------------------------------------------------------------------------
Q89UH6_BRADU/9-113--------------------------------------------------------------------------------
Q87M36_VIBPA/5-111--------------------------------------------------------------------------------
Q8Y6Y1_LISMO/101-204--------------------------------------------------------------------------------
Q89HG8_BRADU/40-149--------------------------------------------------------------------------------
Q8YXA0_NOSS1/108-226--------------------------------------------------------------------------------
Q9X222_THEMA/103-204--------------------------------------------------------------------------------
LEP4_VIBCH/112-221--------------------------------------------------------------------------------
Q989C3_RHILO/11-122--------------------------------------------------------------------------------
LEP4_ECOLI/81-190--------------------------------------------------------------------------------
Q9ABP2_CAUCR/121-230--------------------------------------------------------------------------------
Q8Y1N3_RALSO/10-114--------------------------------------------------------------------------------
Q88QB9_PSEPK/4-110--------------------------------------------------------------------------------
Y83C_METJA/9-115--------------------------------------------------------------------------------
Q87VV0_PSESM/5-111--------------------------------------------------------------------------------
O29326_ARCFU/8-129--------------------------------------------------------------------------------
Q97FF6_CLOAB/100-211--------------------------------------------------------------------------------
Q8RHE5_FUSNN/7-119--------------------------------------------------------------------------------
Q980Y8_SULSO/10-125--------------------------------------------------------------------------------
Q8R8E5_CALS4/6-111--------------------------------------------------------------------------------
LEP4_SYNY3/108-223--------------------------------------------------------------------------------
A0KPV9_AERHH/142-247--------------------------------------------------------------------------------
A5EXL5_DICNV/138-247--------------------------------------------------------------------------------
A9H675_GLUDA/111-216--------------------------------------------------------------------------------
C9R2X4_AGGAD/10-108--------------------------------------------------------------------------------
C9R6J1_AGGAD/90-198--------------------------------------------------------------------------------
E0SLF4_DICD3/139-243--------------------------------------------------------------------------------
G1UB88_HAEDU/13-108--------------------------------------------------------------------------------
H7C7G6_CAUCR/11-113--------------------------------------------------------------------------------
H9L4S3_VIBCH/135-244--------------------------------------------------------------------------------
I6Y9M6_MYCTU/5-108--------------------------------------------------------------------------------
LEP4_BURPS/162-269--------------------------------------------------------------------------------
Q0WIM7_YERPE/129-236--------------------------------------------------------------------------------
Q5F692_NEIG1/134-242--------------------------------------------------------------------------------
Q5ZVB6_LEGPH/138-246--------------------------------------------------------------------------------
Q65GL0_BACLD/102-205--------------------------------------------------------------------------------
Q7MJZ8_VIBVY/10-109--------------------------------------------------------------------------------
Q9PAI1_XYLFA/133-241--------------------------------------------------------------------------------

PF04258

SIPL5_ARATH/240-524---------------------------------------------------------------YNMIGFGDILFPGLLIC
SPP2A_MOUSE/214-499---------------------------------------------------------------VSVLGFGDIIVPGLLIA
SIP_ARATH/47-323---------------------------------------------------------------YSMLGLGDIVIPGIFVA
SPP2B_HUMAN/213-505---------------------------------------------------------------FSLLGFGDILVPGLLVA
Q9VPQ7_DROME/71-359---------------------------------------------------------------FAMLGLGDIVIPGIFIA
Q9VBL1_DROME/96-408---------------------------------------------------------------FSMLGLGDVVMPGLLLC
SIPL4_ARATH/241-527---------------------------------------------------------------YSIIGFGDIILPGLLVT
SIPL2_ARATH/242-525---------------------------------------------------------------YSIIGFGDILLPGLLIA
YL8H_SCHPO/31-282---------------------------------------------------------------LSMLGLGDIVMPGLMLA
YKK0_YEAST/145-510---------------------------------------------------------------FSILGLGDIALPGMFIA
SPPL3_MOUSE/60-374---------------------------------------------------------------FSMLGIGDIVMPGLLLC
IMP2_CAEEL/55-450---------------------------------------------------------------HSMLGLGDIVIPGIFIA
HM13_MOUSE/62-350---------------------------------------------------------------FAMLGLGDIVIPGIFIA
Q93346_CAEEL/275-601---------------------------------------------------------------FTILGLGDIVMPGYLVA

PF06550

Q9HM09_THEAC/1-278---------------------------------------------------------------VLMIGFGDIALPSIMVV
Q9HQ23_HALSA/15-306---------------------------------------------------------------AYFIGLGDAVMPSIMVA
Q8TIY9_METAC/27-303---------------------------------------------------------------.FFMGLGDAVMPTLLVV

PF01080

D3B5F5_POLPA/149-528...............................................................GIKLGLGDFVFYSVLVG
G4VJ47_SCHMA/58-484......DTLVAGRPNRWQELQADLIDRDS..............................K...GVKLGLGDFVFYSLLIG
T1KI16_TETUR/103-479...........................EE..............................R...GVKLGLGDFIFYSVLVG
K7J3W8_NASVI/92-490...........................EE..............................R...GVKLGLGDFIFYGVLVG
A0A068XH02_HYMMI/46-488.........LETPNEWLRDVQEDVIDRED..............................R...GVKLGLGDFVFYSVLIG
W5JK58_ANODA/96-499...........................EE..............................R...GIKLGLGDFIFYSVLVG
E9FSB0_DAPPU/62-438...........................EE..............................R...GIKLGLGDFIFYSVLVG
C5WT76_SORBI/25-446...............................................................AIKLGLGDFIFYSVLVG
C3Z2C5_BRAFL/88-496...........................EE..............................R...GVKLGLGDFIFYSVLVG
H2TY46_TAKRU/29-412...........................QA..............................G...GVKLGLGDFIFYSVLVG
H3AT04_LATCH/77-455...........................EE..............................S...TYSFALG...LLSYLMG
I1HEG8_BRADI/69-507...............................................................GIKLGLGDFVFYSVLVG
W4XU10_STRPU/68-474...........................EE..............................R...GVKLGLGDFIFYSVLVG
G7Y344_CLOSI/42-431............AASRWRQIHLDLRDREE..............................R...GVKLGLGDFVFYSLLIG
B7Q2V0_IXOSC/41-421...........................EE..............................R...GVKLGLGDFIFYSVLVG
PSN1_RAT/76-458...........................EE..............................R...GVKLGLGDFIFYSVLVG
T1JMG4_STRMM/67-438...........................EE..............................R...GVKLGLGDFIFYSVLVG
T1G6P3_HELRO/9-376...............................................................GIKLGLGDFIFYSLLVG
D7LLE1_ARALL/15-389...............................................................AIKLGLGDFIFYSVLVG
A2G9L8_TRIVA/13-428...............................................................GVKLGLGDFIFYGILVT
F6RA92_CIOIN/37-422...........................ED..............................K...GVKLGLGDFIFYSVLVG
I3IV36_ORENI/95-480...........................EE..............................R...GVKLGLGDFIFYSMLVG
H2Z6F8_CIOSA/7-395...........................ED..............................K...GVKLGLGDFIFYSVLVG
K1PKB7_CRAGI/84-479...........................EE..............................R...GVKLGLGDFIFYGVLVG
S2K404_MUCC1/83-504...............................................................GLKLGLGDFVFYSVLIA
H3FRQ2_PRIPA/66-481......SRARTAGDRRVVSESRSTEEVEE..............................R...GIKLGLGDFIFYSVLVG
E0VJ41_PEDHC/87-467...........................EE..............................R...GVKLGLGDFIFYSVLVG
E2AIY0_CAMFO/93-484...........................EE..............................R...GVKLGLGDFIFYSVLVG
F4PRZ5_DICFS/219-583...............................................................KIQLGLGDLVFYSVLLG
B0WS38_CULQU/61-516...........................EE..............................R...GIKLGLGDFIFYSVLVG
A0A068YDE2_ECHMU/45-476.......EQPESANDHLRDLQENVIEREE..............................R...GVKLGLGDFIFYSLLIG
E2BSL4_HARSA/95-504...........................EE..............................R...GVKLGLGDFIFYSVLVG
H9J5W9_BOMMO/68-456...........................EE..............................K...GVKLGLGDFIFYSVLVG
G3Q8S2_GASAC/77-448...........................ED..............................R...GVKLGLGDFIFYSVLVG
F6GSZ0_VITVI/15-427...............................................................AIKLGLGDFIFYSVLVG
B4QRZ4_DROSI/98-517...........................EE..............................R...GIKLGLGDFIFYSVLVG
SPE4_CAEEL/11-464......TAEECDQKEWDDLVSNS....LPNNDKRPATAADALNDG.................EVLRLGFGDFVFYSLLIG
C7J054_ORYSJ/30-449...............................................................AIKLGLGDFIFYSVLVG
T1HN85_RHOPR/7-402...........................EE..............................R...GVKLGLGDFIFYSVLVG
A9S846_PHYPA/9-467...............................................................AIKLGLGDFVFYSVLVG
E3N426_CAERE/9-463......TAEEVAPEEWNELMEQQEKQAEFDQRYVPVTAADALNDG.................ETVRLGFGDFVFYSLLIG
D8LTV7_ECTSI/63-572QAEKKLELFSPVPTSSRAAAAAENDEDEE..............................EMGVSIKLGLGDFVFYSVLVS
H3CB70_TETNG/22-406...........................QQ..............................G...GVKLGLGDFIFYSVLVG
G2J6Q7_CAEBR/9-477......TAAECAPEEWNELIHQQN...EFDQNDATVTAADALNDGVKSKNSGRLFSEICRFPETVRLGFGDFVFYSLLIG
I1N8G3_SOYBN/8-407...............................................................GIKFGLGDFVFYSVLVG
G3W888_SARHA/88-452...........................EE..............................R...GVKLGLGDFIFYSVLVG
PSN_CAEEL/44-434...........................EE..............................R...GVKLGLGDFIFYSVLLG
F2CQD9_HORVD/22-450...............................................................GIKLGLGDFVFYSVLVG
W5N759_LEPOC/69-512...........................KE.................LGVGDADALCLPG....GVKLGLGDFIFYSVLVG
Q7PR98_ANOGA/98-513...........................EE..............................R...GIKLGLGDFIFYSVLVG
M1CAI2_SOLTU/15-421...............................................................AIKLGLGDFIFYSVLVA
W1NQ31_AMBTC/9-446...............................................................GIKLGLGDFIFYSVLVG
K3WL66_PYTUL/82-563YRVCSCSIEIPCAVQARQDAKRRAAEEED..............................DDDKTIKLGLGDFIFYSVLVG
A2DZ73_TRIVA/13-381...............................................................GIKLGLGDFVFYGILVS
G0NCU3_CAEBE/9-464......TADECAPEEWNQLVQE.....VVPEAKAQVTAADALNDG.................ETVRLGFGDFVFYSLLIG
U9UMQ1_RHIID/178-561...............................................................GLKLGLGDFVFYSVLVA
T1EFZ6_HELRO/89-576......RLGHPESFEQFKQQVARLDKMED..............................S...GVKLGLGDFIFYSVLVG
B7QGI2_IXOSC/14-384...............................................................GMKMGLGDFIFYSILVG
A8PAF6_BRUMA/94-527......P....................DE..............................K...GIKLGLGDFIFYSVLVG
S2J107_MUCC1/49-424...............................................................AIKLGLGDFIFYSVLVG
D3B4U3_POLPA/99-477...............................................................SLKLGLGDFVFYSVLMG
H2VWC4_CAEJA/11-477......TAEECDMETWQQLVNEANA..KQGDNKSNLTAADALNDG.................ETVRLGFGDFVFYSLLIG
A9VBA9_MONBE/203-602......D....................DS..................................GVKLGLGDFIFYSVLVG
F2TYS0_SALR5/109-504......D....................EE.................H............T...GVKLGLGDFIFYSVLVG
E1G929_LOALO/15-397...........................EQRNDGTKFTVYDALNDGS.................SVRLGMGDFVFYSLMVG
H3FRQ2_PRIPA/544-933......E....................EE..............................S...GVKLGLGDFIFYSVLVG

PF01478

FLAK_METJA/5-130---------------------------------------------------------------..GVGGGDGKLIMGL--
FLAK_METMP/5-130---------------------------------------------------------------..GIGGGDGKILIGL--
LEP4_BACSU/100-204---------------------------------------------------------------..GVGGGDIKLFAVI--
Q9HWA5_PSEAE/4-110---------------------------------------------------------------..RLGAADVKYLAAL--
Q8FME5_COREF/77-189---------------------------------------------------------------PAGLGLGDVKFAAVV--
Q9CPF6_PASMU/89-199---------------------------------------------------------------..LLGKGDYWLMLGL--
Q9RSQ9_DEIRA/109-347---------------------------------------------------------------PVAMGFGDVKLAAVI--
Q97HN8_CLOAB/64-168---------------------------------------------------------------..VIGLGDVEIFIIC--
Q8XQX7_RALSO/14-117---------------------------------------------------------------..WMGAGDVKFFAVA--
LEP4_HAEIN/90-200---------------------------------------------------------------..AFGRGDYWLAMAL--
Q8TMQ5_METAC/5-101---------------------------------------------------------------..CFGGGDAKSLILI--
Q8NQ30_CORGL/4-110---------------------------------------------------------------..GIGGGDIKLALGL--
Q98BF9_RHILO/11-116---------------------------------------------------------------..GMGGGDAKLLAAT--
Y421_METTH/12-138---------------------------------------------------------------..AWAGGDVKLFTAV--
Q8CXM1_OCEIH/104-208---------------------------------------------------------------..GMGAGDMKLLGLA--
A9CKJ3_AGRFC/8-113---------------------------------------------------------------..VMGGGDAKLLTGA--
Q8TXH1_METKA/6-112---------------------------------------------------------------..VLGGGDVKLLPSL--
Q8DLL0_THEEB/89-199---------------------------------------------------------------..VMGGGDGKLAAMI--
YC8A_METJA/6-148---------------------------------------------------------------..FMGGGDCKFLMGL--
Q9XAP1_STRCO/112-224---------------------------------------------------------------PAGMGFGDVKLALTA--
LEP4_MYXXD/113-222---------------------------------------------------------------..ALGAGDKYLVAML--
LEP4_XANCP/133-242---------------------------------------------------------------..GMGHGDFKLLAAL--
Q8TLD4_METAC/26-152---------------------------------------------------------------..AFGGGDAKGLLVL--
O67535_AQUAE/105-214---------------------------------------------------------------..GLGFGDVILLGFI--
Q988A4_RHILO/13-122---------------------------------------------------------------..GLGLGDVKMLAAA--
Q8XVK3_RALSO/140-249---------------------------------------------------------------..GMGYGDFKLMGAL--
Q87I88_VIBPA/13-110---------------------------------------------------------------..IVGGGDVKLIGVL--
Q8F6L1_LEPIN/127-232---------------------------------------------------------------..GIGFGDVLFAPIY--
Q891G5_CLOTE/115-221---------------------------------------------------------------..GMGWGDVEVIFIA--
Q9K8H1_BACHD/15-120---------------------------------------------------------------PNGIGGGDVKLFTVL--
LEP4_PSEAE/136-245---------------------------------------------------------------..GMGYGDFKLLAML--
Q8XI34_CLOPE/100-206---------------------------------------------------------------..AMGSGDIEIHAIA--
Q8EJP8_SHEON/157-266---------------------------------------------------------------..GMGYGDFKLLAVF--
Q9CMH2_PASMU/11-110---------------------------------------------------------------..VMGAGDIKLMSVL--
Q92T43_RHIME/12-117---------------------------------------------------------------..VMGGGDAKLLTAS--
HOPD_SALTY/9-119---------------------------------------------------------------..GLGYGDVKYLAAL--
Q8FT27_COREF/8-114---------------------------------------------------------------..GIGGGDIKFALGL--
Q8THK9_METAC/8-134---------------------------------------------------------------..VFGGADAKALIVI--
Q8RAF7_CALS4/104-208---------------------------------------------------------------GGEMGGGDVKLMALI--
PPPA_ECOLI/130-240---------------------------------------------------------------..ALGMGDVLLFAAL--
Q92YL6_RHIME/12-116---------------------------------------------------------------..WIGGGDAKLLPVA--
Q89PI9_BRADU/13-114---------------------------------------------------------------..GIGGGDVKLLTAL--
Q89UH6_BRADU/9-113---------------------------------------------------------------..WVGGGDAKVAASV--
Q87M36_VIBPA/5-111---------------------------------------------------------------..AMAGGDVKLLAVI--
Q8Y6Y1_LISMO/101-204---------------------------------------------------------------..GIGLGDIKILIIL--
Q89HG8_BRADU/40-149---------------------------------------------------------------RDGLGLGDVKLAAVC--
Q8YXA0_NOSS1/108-226---------------------------------------------------------------..AMGAGDAKLAAMM--
Q9X222_THEMA/103-204---------------------------------------------------------------RDGLGAGDVILAMGI--
LEP4_VIBCH/112-221---------------------------------------------------------------..VMGGGDIKLYTAI--
Q989C3_RHILO/11-122---------------------------------------------------------------..KVGAGDVKLMAVV--
LEP4_ECOLI/81-190---------------------------------------------------------------..GLGYGDFKLLAAA--
Q9ABP2_CAUCR/121-230---------------------------------------------------------------..GMGGGDPRLLGAI--
Q8Y1N3_RALSO/10-114---------------------------------------------------------------..GMGAGDVKLMGAI--
Q88QB9_PSEPK/4-110---------------------------------------------------------------..RFGADDVKLMGAL--
Y83C_METJA/9-115---------------------------------------------------------------..GMGGGDVKLFTAL--
Q87VV0_PSESM/5-111---------------------------------------------------------------..RLGAADVKLMTAL--
O29326_ARCFU/8-129---------------------------------------------------------------..AYGGADAKAIMAL--
Q97FF6_CLOAB/100-211---------------------------------------------------------------..AFGSGDAEVLLMC--
Q8RHE5_FUSNN/7-119---------------------------------------------------------------..VFGFDDIKLIIPL--
Q980Y8_SULSO/10-125---------------------------------------------------------------..LLGGADLFLNVIL--
Q8R8E5_CALS4/6-111---------------------------------------------------------------..QLGGGDVKLLTAL--
LEP4_SYNY3/108-223---------------------------------------------------------------..GMGDGDPKLASMV--
A0KPV9_AERHH/142-247---------------------------------------------------------------..GMGYGDFKLLAAL--
A5EXL5_DICNV/138-247---------------------------------------------------------------..GMGYGDFKLLACL--
A9H675_GLUDA/111-216---------------------------------------------------------------HDGLGGGDAKLLAAG--
C9R2X4_AGGAD/10-108---------------------------------------------------------------..FIGAGDIKLASVL--
C9R6J1_AGGAD/90-198---------------------------------------------------------------..ALGRGDYWLALGL--
E0SLF4_DICD3/139-243---------------------------------------------------------------..ALGQGDFKLLAAL--
G1UB88_HAEDU/13-108---------------------------------------------------------------..VIGAGDAKLMAVL--
H7C7G6_CAUCR/11-113---------------------------------------------------------------..WIGGGDGKLFAVC--
H9L4S3_VIBCH/135-244---------------------------------------------------------------..GMGYGDFKLLAAL--
I6Y9M6_MYCTU/5-108---------------------------------------------------------------..AMGAGDVKLAIGL--
LEP4_BURPS/162-269---------------------------------------------------------------..GIGYGDLKLLAAL--
Q0WIM7_YERPE/129-236---------------------------------------------------------------VDGMGYGDFKLMAAL--
Q5F692_NEIG1/134-242---------------------------------------------------------------..GMGNGDFKLIAAL--
Q5ZVB6_LEGPH/138-246---------------------------------------------------------------..GMGHGDFKLFAAF--
Q65GL0_BACLD/102-205---------------------------------------------------------------..GIGWGDVKLFAVI--
Q7MJZ8_VIBVY/10-109---------------------------------------------------------------..LLGAGDVKL.AVI--
Q9PAI1_XYLFA/133-241---------------------------------------------------------------..GMGHGDFKMLAAL--

PF04258

SIPL5_ARATH/240-524FIFR---FDKENNKGVSN.................GYFPWLMF-GYGLG-------LFLTYLGLYVMNGHGQPALLYLVP
SPP2A_MOUSE/214-499YCRR---FDVQTGSS....................IYYISSTI-AYAVG-------MIITFVVLMVMK.TGQPALLYLVP
SIP_ARATH/47-323LALR---FDVSRRRQP...................QYFTSAFI-GYAVG-------VILTIVVMNWFQ.AAQPALLYIVP
SPP2B_HUMAN/213-505YCHR---FDIQVQSSR...................VYFVACTI-AYGVG-------LLVTFVALALMQ.RGQPALLYLVP
Q9VPQ7_DROME/71-359LLLR---FDDSKKRKTR..................IYFYSTLI-AYFLG-------LLATIFVMHVFK.HAQPALLYLVP
Q9VBL1_DROME/96-408FVLR---YDAYKKAQGVTSDPTLSP..PRGVGSRLTYFHCSLL-GYFLG-------LLTATVSSEVFK.AAQPALLYLVP
SIPL4_ARATH/241-527FALR---YDWLANKRLKS.................GYFLGTMS-AYGLG-------LLITYIALNLMDGHGQPALLYIVP
SIPL2_ARATH/242-525FALR---YDWLANKTLRT.................GYFIWAMV-AYGLG-------LLITYVALNLMDGHGQPALLYIVP
YL8H_SCHPO/31-282LMYR---FDLHYYINSTSQPKKHS...........TYFRNTFI-AYGLG-------LGVTNFALYYFK.AAQPALLYLSP
YKK0_YEAST/145-510MCYK---YDIWKWHLDHDDTEFHFL.NWSYVG...KYFITAMV-SYVAS-------LVSAMVSLSIFN.TAQPALLYIVP
SPPL3_MOUSE/60-374FVLR---YDNYKKQASGDSCGAPGPANISGRMQKVSYFHCTLI-GYFVG-------LLTATVASRIHR.AAQPALLYLVP
IMP2_CAEEL/55-450LLRR---FDYRVVQTTAESKAPQGSLKGR......YYFVVTVV-AYMAG-------LFITMAVMHHFK.AAQPALLYLVP
HM13_MOUSE/62-350LLLR---FDISLKKNTH..................TYFYTSFA-AYIFG-------LGLTIFIMHIFK.HAQPALLYLVP
Q93346_CAEEL/275-601HCFT---MNGFSERVRL..................IYGFISVV-GYGIG-------LIVTFLALALMK.TAQPALIYLVP

PF06550

Q9HM09_THEAC/1-278SSAI---YGISHIL.....----------------FFTVLPLA-GGLIG-------MAVLYF.--WNRDRPAPGLPYINT
Q9HQ23_HALSA/15-306SAAF---FLDTPPVVAGIE----------------LAPLTAMA-GTLVG-------LLVLMRM--VFAGRAHAGLPLLNG
Q8TIY9_METAC/27-303SANV---FLEN....GGLS----------------YPVLGAML-GTLVG-------HIFLSIL--VMRGKPQAGLPFLNS

PF01080

D3B5F5_POLPA/149-528RAAY...KEI-------------------------ILVFICFV.AILTG-------LFITLLLLAVYK-RALPALPIKMK
G4VJ47_SCHMA/58-484RATL..DGDA-------------------------VTVVTCYV.AILVG-------MCITVIVLGITR-QALPALPISIT
T1KI16_TETUR/103-479KASS..YGDW-------------------------NTTLACFV.SILIG-------LCLTLLLLAFFK-KALPALPISIF
K7J3W8_NASVI/92-490KASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIA
A0A068XH02_HYMMI/46-488RASL..DGDI-------------------------LTAISCYV.AILVG-------MCLTIVALAVAR-RALPALPISII
W5JK58_ANODA/96-499KASS..YGDW-------------------------NTTIACFV.AILVG-------LCLTLLLLAIFR-KALPALPISIF
E9FSB0_DAPPU/62-438KASS..YGDW-------------------------NTTIACFV.AILIG-------LCLTLLLLAIFR-KALPALPISIT
C5WT76_SORBI/25-446RAAM...YDY-------------------------MTVYACYL.AIIAG-------LGITLLLLAFFR-KALPALPVSIA
C3Z2C5_BRAFL/88-496KASS..NGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
H2TY46_TAKRU/29-412KAAAT.GGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
H3AT04_LATCH/77-455ASSQKSNGGR-------------------------NVLVQIFLHAVSLG-------LCLTLLLLAIFK-KALPALPISIT
I1HEG8_BRADI/69-507RAAM...YDL-------------------------MTVYACYL.AIIAG-------LGCTLILLSICR-HALPALPISIM
W4XU10_STRPU/68-474KASA..SGDW-------------------------TTTIACFV.AILIG-------LCLTLILLAIFK-KALPALPISIA
G7Y344_CLOSI/42-431RAAL..DGDV-------------------------ITVATCYV.AILVG-------MCVTIIVLGITR-RALPALPVSVA
B7Q2V0_IXOSC/41-421KASS..YGDW-------------------------NTTIACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
PSN1_RAT/76-458KASATASGDW-------------------------NTTIACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
T1JMG4_STRMM/67-438KASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFQ-KALPALPISIT
T1G6P3_HELRO/9-376KVSQ..LEEW-------------------------NTTTACFI.SVLIG-------LSLTILLLVLYE-QALPALPISVF
D7LLE1_ARALL/15-389RAAM...YDL-------------------------MTVYACYL.AIIAG-------LGITLMLLSVYQ-KALPALPVSIM
A2G9L8_TRIVA/13-428RAAR...VGW-------------------------DIAILDIL.AVMDG-------LALTLICLAYFE-RPLPALPFSLA
F6RA92_CIOIN/37-422KASA..TGDW-------------------------NTTIACFV.AILIG-------LCLTLILLAIYR-KALPALPISIT
I3IV36_ORENI/95-480KASATASGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIF
H2Z6F8_CIOSA/7-395KASA..NGDW-------------------------NTTIACFV.AILIG-------LCLTLILLAIYR-KALPALPISIT
K1PKB7_CRAGI/84-479KASS..NGDW-------------------------NTTLACFV.AILIG-------LCFTLLLLAIFR-KALPALPISIT
S2K404_MUCC1/83-504RAAM...YDW-------------------------ITTVCCTI.AVLTG-------LTATIFLLAIYK-KALPALPISIA
H3FRQ2_PRIPA/66-481KASE..SADW-------------------------NTIVACYV.AILVG-------LCATLLLLAVFK-KALPALPISIT
E0VJ41_PEDHC/87-467KASS..YGDW-------------------------NTTVACFV.AILIG-------LCLTLLLLAVFR-KALPALPISIT
E2AIY0_CAMFO/93-484KASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
F4PRZ5_DICFS/219-583RAAL...YDL-------------------------GTIFACFV.AILTG-------LFITLILLIVYK-KAIPALPISIF
B0WS38_CULQU/61-516KASS..YGDW-------------------------NTTIACFV.AILVG-------LCLTLLLLAIFR-KALPALPISIF
A0A068YDE2_ECHMU/45-476RASL..DGDV-------------------------LTAVACYI.AILVG-------MCLTIVALGVAR-KALPALPISIA
E2BSL4_HARSA/95-504KASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLVLLAICK-KALPALPISIT
H9J5W9_BOMMO/68-456KASS..YGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAILK-KALPALPISIT
G3Q8S2_GASAC/77-448KAAAT.GGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
F6GSZ0_VITVI/15-427RAAM...YDF-------------------------MTVYACYL.AIIAG-------LGVTLMLLAIYQ-KALPALPVSIL
B4QRZ4_DROSI/98-517KASS..YGDW-------------------------TTTIACFV.AILIG-------LCLTLLLLAIWR-KALPALPISIT
SPE4_CAEEL/11-464QAAA..SGCP-------------------------FAVISAAL.GILFG-------LVVTLTVFSTEE-STTPALPLPVI
C7J054_ORYSJ/30-449RAAM...YDY-------------------------MTVYACYL.AIIAG-------LGITLLLLAFYR-KALPALPVSIA
T1HN85_RHOPR/7-402KASS..NGDW-------------------------NTTLACFV.AILIG-------LSLTLLLLAIFK-KALPALPISIT
A9S846_PHYPA/9-467RAAM...YDL-------------------------MTVYACYL.AIVAG-------LGATLILLAVWQ-RALPALPISIS
E3N426_CAERE/9-463QTAT..GGSA-------------------------LAVACSAL.GILFG-------LVATLTVFSSGE-STTPALPLPVI
D8LTV7_ECTSI/63-572KAAL...YGF-------------------------TAWAACVV.VIVFG-------LGATLVLLAVYR-MALPALPISIG
H3CB70_TETNG/22-406KAAAT.GGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
G2J6Q7_CAEBR/9-477QAAT..GGCP-------------------------ISVGFAAF.GILFG-------LIATLTVLSSEE-STTPALPLPVI
I1N8G3_SOYBN/8-407RAAM...YDL-------------------------MTVYACYL.AIISG-------LGCTLILLSMCR-KALPALPISIA
G3W888_SARHA/88-452KAAATASGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAVFK-KALPALPISIT
PSN_CAEEL/44-434KASS..YFDW-------------------------NTTIACYV.AILIG-------LCFTLVLLAVFK-RALPALPISIF
F2CQD9_HORVD/22-450RAAM...YDL-------------------------MTVYACYL.AIIAG-------LGCTLILLSICR-HALPALPISIM
W5N759_LEPOC/69-512KASATASGDW-------------------------NTTLACFV.AILIG-------LCLTLLLLAIFK-KALPALPISIT
Q7PR98_ANOGA/98-513KASS..YGDW-------------------------NTTIACFV.AILVG-------LCLTLLLLAIFR-KALPALPISIF
M1CAI2_SOLTU/15-421RAAM...YDF-------------------------MTVYACYL.AIIAG-------LGITLMLLAFYQ-KALPALPVSVL
W1NQ31_AMBTC/9-446RAAM...YDL-------------------------LTVYACYI.AIISG-------LGCTLILLSLCN-HALPALPVSIT
K3WL66_PYTUL/82-563RAAI...YDF-------------------------STFAATFI.CIVMG-------LGGTLFLLAVLH-KALPALPISIF
A2DZ73_TRIVA/13-381RAAR...IGW-------------------------DITILCIF.AVILG-------LSLTLVCLAVWE-RPLPALPFSLA
G0NCU3_CAEBE/9-464QAAT..GGCP-------------------------VAVALAAF.GILFG-------LIVTLTVLSNDE-STTPALPVPVI
U9UMQ1_RHIID/178-561QAAL...FDW-------------------------ITTVACIV.AVLTG-------LNTTIFLLAIYK-KALPALPISIA
T1EFZ6_HELRO/89-576KASL..LGDW-------------------------NTTVACFI.AILMG-------LCFTLLLLASFR-KALPALPVSIA
B7QGI2_IXOSC/14-384KASR..HGTV-------------------------SAVVICYI.YVVIG-------IILTLALLVIAQ-KPVPALPLSIS
A8PAF6_BRUMA/94-527KASS..YGDW-------------------------NTTVACYV.AILIG-------LCFTLILLAVFR-KALPALPISIF
S2J107_MUCC1/49-424KAAK...TDS-------------------------VTLCLCII.AILTG-------LSLTILILTLNR-KALPALPISIL
D3B4U3_POLPA/99-477RAAM...FDI-------------------------STVFTCFV.AIITG-------LFATLFLLAIFR-KALPALPISIA
H2VWC4_CAEJA/11-477QAAA..SGCP-------------------------IAVVFAAA.GILFG-------LLVTLTVLSTEE-STTPALPVPVL
A9VBA9_MONBE/203-602KAAT..AHEW-------------------------TTILACYV.AILIG-------LACTLLLLSIFK-KALPALPISIF
F2TYS0_SALR5/109-504KAAT..ADKW-------------------------TTIAACYV.GILIG-------LACTLLLLSIFR-KALPALPISIA
E1G929_LOALO/15-397KAAA..THNA-------------------------MCVIGSMV.GILVG-------LIVTLTILSNDD-ETTPALPVSIT
H3FRQ2_PRIPA/544-933MAVKH.SADW-------------------------NTLVACYV.AILMG-------LCATLLLLAVFK-KALPALPISIT

PF01478

FLAK_METJA/5-130--------------------------------------------GALIP.......KYNMPIHTPLGAILNYLYLPSFPI
FLAK_METMP/5-130--------------------------------------------GALVP.......KFQMPIYTSLGTLLNLNYIPNFPI
LEP4_BACSU/100-204--------------------------------------------GFVLG.......VKML...................A
Q9HWA5_PSEAE/4-110--------------------------------------------GLASD.......PLTV...................L
Q8FME5_COREF/77-189--------------------------------------------GVFLGW....FSWQHV...................A
Q9CPF6_PASMU/89-199--------------------------------------------GSMSH.......FAWL...................P
Q9RSQ9_DEIRA/109-347--------------------------------------------GAFLG.......WERL...................L
Q97HN8_CLOAB/64-168--------------------------------------------GISIG.......FYKS...................I
Q8XQX7_RALSO/14-117--------------------------------------------GLLAG.......WHGL...................V
LEP4_HAEIN/90-200--------------------------------------------GSFIH.......LETL...................P
Q8TMQ5_METAC/5-101--------------------------------------------SLLFP..............................D
Q8NQ30_CORGL/4-110--------------------------------------------GTAVAALGMQALMVAI...................V
Q98BF9_RHILO/11-116--------------------------------------------AVWMG.......LNIH..................LV
Y421_METTH/12-138--------------------------------------------TSLLP.......FQPSLVSYSFLGTAFPVTASYPFP
Q8CXM1_OCEIH/104-208--------------------------------------------GIVLG.......VEKI...................I
A9CKJ3_AGRFC/8-113--------------------------------------------AVWYG.......FNIS..................LV
Q8TXH1_METKA/6-112--------------------------------------------TLFLH.......RGDRIT...............TGI
Q8DLL0_THEEB/89-199--------------------------------------------GAWLG.......WQGL...................L
YC8A_METJA/6-148--------------------------------------------SYLKG.......MFFT...................F
Q9XAP1_STRCO/112-224--------------------------------------------GAVLGW....YGWPTL...................M
LEP4_MYXXD/113-222--------------------------------------------GAFLT.......WRAL...................L
LEP4_XANCP/133-242--------------------------------------------GAWCG.......LKGI...................L
Q8TLD4_METAC/26-152--------------------------------------------SILFP.......LYPIFQFSGEAYPLLGRPLIGLFT
O67535_AQUAE/105-214--------------------------------------------GSVSG.......VYGV...................F
Q988A4_RHILO/13-122--------------------------------------------SCWIS.......PLLL...................P
Q8XVK3_RALSO/140-249--------------------------------------------GAWFG.......WQAL...................P
Q87I88_VIBPA/13-110--------------------------------------------FLGVN.......DEYM...................L
Q8F6L1_LEPIN/127-232--------------------------------------------AFIAG.......HPWW...................M
Q891G5_CLOTE/115-221--------------------------------------------GLFLG.......IKLC...................F
Q9K8H1_BACHD/15-120--------------------------------------------GFVLG.......WKLT...................L
LEP4_PSEAE/136-245--------------------------------------------GAWGG.......WQIL...................P
Q8XI34_CLOPE/100-206--------------------------------------------GIFLG.......WKLA...................I
Q8EJP8_SHEON/157-266--------------------------------------------GAWLG.......WQML...................P
Q9CMH2_PASMU/11-110--------------------------------------------MLTIP.......HSQI...................I
Q92T43_RHIME/12-117--------------------------------------------AAWFG.......FNES..................LV
HOPD_SALTY/9-119--------------------------------------------GAWHC.......WETL...................P
Q8FT27_COREF/8-114--------------------------------------------GTVAATGSVEGWLLAV...................V
Q8THK9_METAC/8-134--------------------------------------------GTLVP.......VYPVLDFYGYTFPLLGFPPVGLFS
Q8RAF7_CALS4/104-208--------------------------------------------GFFIG.......WKLV...................L
PPPA_ECOLI/130-240--------------------------------------------GGWVG.......ALSL...................P
Q92YL6_RHIME/12-116--------------------------------------------VLWLG.......ADLA...................L
Q89PI9_BRADU/13-114--------------------------------------------AIGFP.......LTGV...................I
Q89UH6_BRADU/9-113--------------------------------------------ALWFG.......FAQL...................M
Q87M36_VIBPA/5-111--------------------------------------------GAWLG.......LSNLWE...............ASI
Q8Y6Y1_LISMO/101-204--------------------------------------------STFLG.......FKIG...................Y
Q89HG8_BRADU/40-149--------------------------------------------GAWLD..............................L
Q8YXA0_NOSS1/108-226--------------------------------------------GAWLG.......WRYL...................L
Q9X222_THEMA/103-204--------------------------------------------GFLLS.......PVPS...................I
LEP4_VIBCH/112-221--------------------------------------------GTLIG.......VEFV...................P
Q989C3_RHILO/11-122--------------------------------------------PFLVG.......GNDLVG...............FSI
LEP4_ECOLI/81-190--------------------------------------------GAWCG.......WQTL...................P
Q9ABP2_CAUCR/121-230--------------------------------------------GAWVG.......WQGL...................P
Q8Y1N3_RALSO/10-114--------------------------------------------GAFTG.......PLAA...................L
Q88QB9_PSEPK/4-110--------------------------------------------ALATS.......PQYV...................L
Y83C_METJA/9-115--------------------------------------------APIFA.......YPNSFVFY..........IPKYIL
Q87VV0_PSESM/5-111--------------------------------------------ALASN.......TAYL...................L
O29326_ARCFU/8-129--------------------------------------------AVIFP.......FYPTFNGFPL......LGPSFSFA
Q97FF6_CLOAB/100-211--------------------------------------------GLFLG.......MKLG...................M
Q8RHE5_FUSNN/7-119--------------------------------------------GGLLY.......LGEINFF.............LQIY
Q980Y8_SULSO/10-125--------------------------------------------SLANA.......SVISLVPSRF......LVIGLEPL
Q8R8E5_CALS4/6-111--------------------------------------------AFFFG.......SDI....................M
LEP4_SYNY3/108-223--------------------------------------------GAWLG.......WPSL...................L
A0KPV9_AERHH/142-247--------------------------------------------GAWLG.......WQAL...................P
A5EXL5_DICNV/138-247--------------------------------------------CAWQG.......AWML...................P
A9H675_GLUDA/111-216--------------------------------------------GAWLG.......PESL...................P
C9R2X4_AGGAD/10-108--------------------------------------------MLAVP.......SDEV...................F
C9R6J1_AGGAD/90-198--------------------------------------------GVFLP.......AHQF...................P
E0SLF4_DICD3/139-243--------------------------------------------GAWLG.......WQAL...................P
G1UB88_HAEDU/13-108--------------------------------------------MLAVP.......PEYT...................I
H7C7G6_CAUCR/11-113--------------------------------------------ALWLG.......WPAA...................L
H9L4S3_VIBCH/135-244--------------------------------------------GAWLG.......WQQL...................P
I6Y9M6_MYCTU/5-108--------------------------------------------GGLTG.......CFGVE................VWF
LEP4_BURPS/162-269--------------------------------------------GAWLG.......WEAL...................P
Q0WIM7_YERPE/129-236--------------------------------------------GAWFG.......VSAV...................P
Q5F692_NEIG1/134-242--------------------------------------------GAWLG.......ISAL...................P
Q5ZVB6_LEGPH/138-246--------------------------------------------GAWLG.......WMYL...................P
Q65GL0_BACLD/102-205--------------------------------------------GMALG.......SRLL...................V
Q7MJZ8_VIBVY/10-109--------------------------------------------CVWMV.......FPNW...................G
Q9PAI1_XYLFA/133-241--------------------------------------------GAWCG.......LKGI...................L

PF04258

SIPL5_ARATH/240-524CTLGITV-ILGLVRKELRDLWNYGTQQ
SPP2A_MOUSE/214-499CTLITVS-VVAWSRKEMKKFWKGSSYQ
SIP_ARATH/47-323AVIGFLA-SHCIWNGDIKPLLAFDESK
SPP2B_HUMAN/213-505CTLVTSC-AVALWRRELGVFWTGSGFA
Q9VPQ7_DROME/71-359ACMGTPL-LVALIRGELKVLFAYEDHP
Q9VBL1_DROME/96-408FTLLPLL-LMAYLKGDLRRMWSEPFIA
SIPL4_ARATH/241-527FILGTLF-VLGHKRGDLKTLWTTGEPD
SIPL2_ARATH/242-525FTLGTML-TLARKRDDLWILWTKGEPE
YL8H_SCHPO/31-282ACIVAPL-LTAWYRDELKTLFSFRSET
YKK0_YEAST/145-510SLLISTI-LVACWNKDFKQFWNFQYDT
SPPL3_MOUSE/60-374FTLLPLL-TMAYLKGDLRRMWSEPFHS
IMP2_CAEEL/55-450CCLFVPL-LLAVIRGELSALWNYDESR
HM13_MOUSE/62-350ACIGFPV-LVALAKGEVAEMFSYEESN
Q93346_CAEEL/275-601STLFPII-MLALCRGEFLKIWNGVPVE

PF06550

Q9HM09_THEAC/1-278GTIAGFL-IAFLAFRV-----------
Q9HQ23_HALSA/15-306GAIAGYL-VGAVAAGI-----------
Q8TIY9_METAC/27-303GAIIGFF-IGVLFSGA-----------

PF01080

D3B5F5_POLPA/149-528FNKLLLV-SILLIVH...---------
G4VJ47_SCHMA/58-484CGILFYF-VSSATISPFL---------
T1KI16_TETUR/103-479FGLTFYF-TTSQLVAPFC---------
K7J3W8_NASVI/92-490FGLIFYF-ATRVIVAPFA---------
A0A068XH02_HYMMI/46-488CGIIFYF-STAAVITPFI---------
W5JK58_ANODA/96-499FGLIFCF-VTSVIVKPYT---------
E9FSB0_DAPPU/62-438FGLVFYF-ATSKLVAPFA---------
C5WT76_SORBI/25-446LGVVFYV-LTRTLLEEFV---------
C3Z2C5_BRAFL/88-496FGLIFNF-ATANLVTPFT---------
H2TY46_TAKRU/29-412FGLIFYF-STDFLVQPFM---------
H3AT04_LATCH/77-455FGIIFYF-ATDNLVRPFM---------
I1HEG8_BRADI/69-507LGVVFYF-LTRLLMEPFV---------
W4XU10_STRPU/68-474FGLVFYF-CTSNLVFPFT---------
G7Y344_CLOSI/42-431CGILFYF-VTSTVISPFL---------
B7Q2V0_IXOSC/41-421FGLIFYF-ATSSLVQPFA---------
PSN1_RAT/76-458FGLIFYF-ATDYLVQPFM---------
T1JMG4_STRMM/67-438FGLIFYF-LTKEIVQPFA---------
T1G6P3_HELRO/9-376FGVAFYF-GGYYTIDPFV---------
D7LLE1_ARALL/15-389LGVVFYF-LARLLLEVFV---------
A2G9L8_TRIVA/13-428LGIIFYL-IGAYTFRGF.---------
F6RA92_CIOIN/37-422FGLVFYF-STDYVVRPYM---------
I3IV36_ORENI/95-480FGLVFYF-ATDNLVRPFM---------
H2Z6F8_CIOSA/7-395FGLVFYF-STDYVVRPFM---------
K1PKB7_CRAGI/84-479FGLIFNF-TTSLLVQPFA---------
S2K404_MUCC1/83-504FGMLFYF-VAKTVLVPYV---------
H3FRQ2_PRIPA/66-481AGLIFYF-STTFLITPFT---------
E0VJ41_PEDHC/87-467FGLIFYF-TTKKIVKPFA---------
E2AIY0_CAMFO/93-484FGLTFYF-ATRVIVAPFA---------
F4PRZ5_DICFS/219-583IGILFFF-STSKLICPFL---------
B0WS38_CULQU/61-516FGLIFCF-ATSVIVKPFT---------
A0A068YDE2_ECHMU/45-476CGIVFYF-STAVVITPFI---------
E2BSL4_HARSA/95-504FGLTFYF-ATRVIVAPFA---------
H9J5W9_BOMMO/68-456FGLIFYF-ATRSVVKPFA---------
G3Q8S2_GASAC/77-448FGLVFYF-STGFLVQPFM---------
F6GSZ0_VITVI/15-427LGVLFYF-FTRFLLEAFI---------
B4QRZ4_DROSI/98-517FGLIFCF-ATSAVVKPFM---------
SPE4_CAEEL/11-464CGTFCYF-SSMFFWEQLY---------
C7J054_ORYSJ/30-449LGVVFYV-LTRTLLETFV---------
T1HN85_RHOPR/7-402FGLIFYF-TTTEIVQPFS---------
A9S846_PHYPA/9-467LGVIFYF-LARLVMDPFV---------
E3N426_CAERE/9-463CGTFCYF-ISKFVVDQVY---------
D8LTV7_ECTSI/63-572FGTVFYL-LTRFSIQPYV---------
H3CB70_TETNG/22-406FGLVFYF-STDFLVQPFM---------
G2J6Q7_CAEBR/9-477CGTFCYF-VSRFLVDS..---------
I1N8G3_SOYBN/8-407LGVLFYF-LTRLLMEPFI---------
G3W888_SARHA/88-452FGLIFYF-STDNLVRPFM---------
PSN_CAEEL/44-434SGLIFYF-CTRWIITPFV---------
F2CQD9_HORVD/22-450LGVVFYF-LTRLLMEPFV---------
W5N759_LEPOC/69-512FGLVFYF-ATDNLVRPFM---------
Q7PR98_ANOGA/98-513FGLIFCF-VTSVIVKPFT---------
M1CAI2_SOLTU/15-421LGVLFYL-LTRLLLETFV---------
W1NQ31_AMBTC/9-446LGVMFYF-LTRLLMEPFV---------
K3WL66_PYTUL/82-563LATFFYF-WTYYLFVDFC---------
A2DZ73_TRIVA/13-381LGIVFFI-IGAMTFRQFC---------
G0NCU3_CAEBE/9-464CGTFCYF-ISKLVMDQFY---------
U9UMQ1_RHIID/178-561FGMLFYF-VARNTLVPY.---------
T1EFZ6_HELRO/89-576FGLIFYF-ATSQVVLPFM---------
B7QGI2_IXOSC/14-384LGMFAYF-STISFVEPFM---------
A8PAF6_BRUMA/94-527CGLIFYF-CTRGIITPFC---------
S2J107_MUCC1/49-424LGCITYA-TAYYMTSPM.---------
D3B4U3_POLPA/99-477FGILFYF-LTRIFLYPFI---------
H2VWC4_CAEJA/11-477CGTFCYF-TSKFVWENL.---------
A9VBA9_MONBE/203-602FGLCFFF-LTSEVLDPLI---------
F2TYS0_SALR5/109-504FGLVFYF-ATSEVLDPLI---------
E1G929_LOALO/15-397IALLLHF-GIYLFVEPFY---------
H3FRQ2_PRIPA/544-933AGLIFYF-ATSFIITPFT---------

PF01478

FLAK_METJA/5-130MVVINAM.FFSITLPI-----------
FLAK_METMP/5-130MVFINGI.FFMVFLPF-----------
LEP4_BACSU/100-204AAFFFSV.LIGALYGA-----------
Q9HWA5_PSEAE/4-110YSLAFGC.LLCIALFI-----------
Q8FME5_COREF/77-189IGTLLAF.VLNVVVAV-----------
Q9CPF6_PASMU/89-199LWLFLAC.VMGLGYVC-----------
Q9RSQ9_DEIRA/109-347LAVVVAI.FAGAVLGL-----------
Q97HN8_CLOAB/64-168EVLILSI.FLCGIYGI-----------
Q8XQX7_RALSO/14-117AIWLVSS.VLAGVHAL-----------
LEP4_HAEIN/90-200HFLLLAS.VLGICFSL-----------
Q8TMQ5_METAC/5-101PVLIIWIMFISSVIVI-----------
Q8NQ30_CORGL/4-110GSSLISV.LLGGIFAA-----------
Q98BF9_RHILO/11-116EYLVVST.LIGGLLTI-----------
Y421_METTH/12-138LTVIINS.ILALLPFL-----------
Q8CXM1_OCEIH/104-208LAFFLAC.IIGSVISI-----------
A9CKJ3_AGRFC/8-113EFLLAVT.LVGGALTV-----------
Q8TXH1_METKA/6-112DVLFNSI.LLYAPFAL-----------
Q8DLL0_THEEB/89-199VTFFLAC.ALGGLMGG-----------
YC8A_METJA/6-148IIFLNAI.LFVIPYCI-----------
Q9XAP1_STRCO/112-224LGTFAGF.LLGALYGG-----------
LEP4_MYXXD/113-222GVLLFAS.MQGAVVGI-----------
LEP4_XANCP/133-242PIILISS.LVGAVLGS-----------
Q8TLD4_METAC/26-152LTVLGNALLLTALIPL-----------
O67535_AQUAE/105-214SALFIGS.FLGLLYAL-----------
Q988A4_RHILO/13-122VLLFIAS.ASALLFVG-----------
Q8XVK3_RALSO/140-249LLVLLSS.VVGLVFGV-----------
Q87I88_VIBPA/13-110AAIVAIG.LLGGIQIL-----------
Q8F6L1_LEPIN/127-232FFLNASY.IPAVLFTI-----------
Q891G5_CLOTE/115-221LLTFLSF.FIGAIISV-----------
Q9K8H1_BACHD/15-120VAIMLSS.LCGAIGGG-----------
LEP4_PSEAE/136-245LTILLSS.LVGAILGV-----------
Q8XI34_CLOPE/100-206INIFLSF.IIGGIIAV-----------
Q8EJP8_SHEON/157-266LVILLSS.LVGAFVGI-----------
Q9CMH2_PASMU/11-110YFFLFTA.FSGLFLII-----------
Q92T43_RHIME/12-117TFLVYVS.FFGGFLTL-----------
HOPD_SALTY/9-119LLVFLAAMLACGGFGV-----------
Q8FT27_COREF/8-114GSSLLTL.LLAGVTLS-----------
Q8THK9_METAC/8-134LTVLENSVLLTAIIPL-----------
Q8RAF7_CALS4/104-208LNLLLGV.VLGALAGV-----------
PPPA_ECOLI/130-240NVALIAS.CCGLIYAV-----------
Q92YL6_RHIME/12-116PFILYTS.VIGAALTV-----------
Q89PI9_BRADU/13-114QLLTVTA.LAGGILAL-----------
Q89UH6_BRADU/9-113NFLLYAS.LFGGALTL-----------
Q87M36_VIBPA/5-111GIILAGG.IVGIFYLM-----------
Q8Y6Y1_LISMO/101-204YIFFLAI.IMGTIILL-----------
Q89HG8_BRADU/40-149ATVAAVI.ELAALLAI-----------
Q8YXA0_NOSS1/108-226LAGLIAC.TLGALVGV-----------
Q9X222_THEMA/103-204FAILIAS.ISGILYAL-----------
LEP4_VIBCH/112-221YLFLLSS.IIAFIHWF-----------
Q989C3_RHILO/11-122LLLLFAL.ATAVVVKN-----------
LEP4_ECOLI/81-190MILLIAS.LGGIGYAI-----------
Q9ABP2_CAUCR/121-230SVLVWAC.VAGLSVAI-----------
Q8Y1N3_RALSO/10-114HVGLASC.VAGGVLAV-----------
Q88QB9_PSEPK/4-110GTFIGAG.VTVLVWLL-----------
Y83C_METJA/9-115YLIAISM.FIAAVFPM-----------
Q87VV0_PSESM/5-111CTFIGAG.VAMLAWAL-----------
O29326_ARCFU/8-129FSTLANS.VIAAPFLL-----------
Q97FF6_CLOAB/100-211FMLFISF.VLAGFVSI-----------
Q8RHE5_FUSNN/7-119IFYLLVF.SLATLYII-----------
Q980Y8_SULSO/10-125VIVLYSS.IIILIFSL-----------
Q8R8E5_CALS4/6-111VLLLIAG.ITATAYGV-----------
LEP4_SYNY3/108-223LTTFIAC.FIGSIYGG-----------
A0KPV9_AERHH/142-247IVLLLSS.LVGAFIGI-----------
A5EXL5_DICNV/138-247IILFSAA.ILGMIYAL-----------
A9H675_GLUDA/111-216HVVFLGA.VLTL....-----------
C9R2X4_AGGAD/10-108SFFFFTT.FAGLGLI.-----------
C9R6J1_AGGAD/90-198VFLFLAC.FFGLLYA.-----------
E0SLF4_DICD3/139-243NLVLIAS.LTGLAA..-----------
G1UB88_HAEDU/13-108FFLFFTT.CAGLGL..-----------
H7C7G6_CAUCR/11-113TFMLYTG.LAGGVLT.-----------
H9L4S3_VIBCH/135-244VIVLLSS.VVGVIFGL-----------
I6Y9M6_MYCTU/5-108LAALAAP.LLTAVCG.-----------
LEP4_BURPS/162-269QVVLIAA.VAGAAVGL-----------
Q0WIM7_YERPE/129-236FLILFSS.FFGLVA..-----------
Q5F692_NEIG1/134-242VLIFVSS.LIGLVAA.-----------
Q5ZVB6_LEGPH/138-246LILLISS.ITGAIIGL-----------
Q65GL0_BACLD/102-205LAFFLSA.AAGTVLGL-----------
Q7MJZ8_VIBVY/10-109ELILLSA.LGAGVLA.-----------
Q9PAI1_XYLFA/133-241PIILISS.LAGVVLG.-----------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window