Sequence alignment for CL0131

PF04173

Q97X72_SULSO/12-173----------------------FLPMLRVTLGLMF-----------------------------F-S-AFIRRA-I----
Q97XJ3_SULSO/18-183----------------------YLFPIRFAVGWMF-----------------------------F-D-GGIRKA-I----
Q973M6_SULTO/9-177----------------------WPNFMRLALATIW-----------------------------I-Y-AGVFEK-L----
Q97UC4_SULSO/10-178----------------------FTLILRISMASIW-----------------------------L-Y-AGILGK-L----
Q8AAF0_BACTN/18-181----------------------FTLSLRLIVGWTY-----------------------------F-S-AFWRRL-V----
F4B442_ACIHW/20-184----------------------YLFPVRFAVGWMF-----------------------------L-D-GGLRKA-V----

PF07681

Q83CN9_COXBU/12-94----------------------AALIGRILISLIF-----------------------------I.I-SGIHKI-T----
Q87K55_VIBPA/16-104----------------------SALALRIPIGIIF-----------------------------M.A-HGAQKL-F----
Q8KEE1_CHLTE/7-88----------------------GKLLIRLCVGGLM-----------------------------L.F-HGVYKL-I----
Q9RTC4_DEIRA/8-92----------------------GLALLRLVLGVVF-----------------------------V.A-HGLQAM-A----
Q7TUM8_PROMM/37-127----------------------GILILRLGVSILM-----------------------------V.H-NGLEKL-Q----
Q7VHA8_HELHP/8-89----------------------GKLIVRLCVGGLM-----------------------------L.F-HGVNKI-T----
Q89FZ6_BRADU/10-92----------------------AALVLRVTLGALF-----------------------------L.A-HAGLKL-F----
Q8EDN3_SHEON/21-107----------------------APLALRLYLAPVL-----------------------------M.Q-AGYNKL-T----
Q8A9J9_BACTN/19-101----------------------FLLAVRIIFGILL-----------------------------M.N-HGIQKW-S----
Q83BV7_COXBU/131-217----------------------HLTFIRMYIGYDL-----------------------------I.A-HFAEKL-F----
Q92W39_RHIME/11-107----------------------AQLALRLALAVPF-----------------------------W.R-SGLGKW-D----
Q8U4Y0_AGRT5/25-105----------------------TVAL..LALCSAY-----------------------------I.Q-GPLTKI-F----
Q7V0B0_PROMP/15-102----------------------ALLILRVITGTVL-----------------------------I.H-HGFEKL-A----
Q984Q4_RHILO/6-88----------------------VQALGALLIGGVF-----------------------------V.W-AGVEHF-V----
Q9A3E7_CAUCR/28-117----------------------LTLVARLGVAAIF-----------------------------F.Q-SGRTKV-D----
Q983U6_RHILO/19-101----------------------TILLGRILLAVIF-----------------------------L.L-SGFGKL-T----
Q82HN4_STRAW/24-126----------------------ALLPLRVFLGVTF-----------------------------I.Y-AGLDKL-T----
Q7VUY8_BORPE/24-126----------------------IALLGRCSIAATF-----------------------------W.L-SGQTKV-E----
Q831Y6_ENTFA/7-87----------------------GIQVIRIWLGVTM-----------------------------L.I-HGVMKV-T----
Q983U8_RHILO/8-90----------------------LLLVSRLLFALMF-----------------------------V.P-SGFQAL-A----
Q7V328_PROMP/44-134----------------------SIFILRIGFSVLM-----------------------------I.H-HGLEKL-Q----
Q7MRA2_WOLSU/17-98----------------------SALLLRLALGGLM-----------------------------L.M-HGIHKL-K----
Q8F8N5_LEPIN/13-98----------------------GSLILRLVAGIVI-----------------------------F.P-HGAQKL-L----
Q9HYW2_PSEAE/22-108----------------------APLALRLYLAPVF-----------------------------W.M-AGSQKL-A----
Q88P63_PSEPK/6-95----------------------LCLVARFGIASIF-----------------------------F.L-SGRTKV-E----
Q9HWH6_PSEAE/14-96----------------------LWLTARICLALMF-----------------------------V.A-SGLAKL-F----
Q8FR06_COREF/10-94----------------------ALLLFRVVLGIIF-----------------------------V.A-HGWEKL-F----
Q9KYL5_STRCO/4-96----------------------LRLAGRPMLASMF-----------------------------V.A-GGLQSL-R----
Q8NR01_CORGL/191-281----------------------GLLIIRAVIGVYL-----------------------------I.V-RGVFTF-F----
Q8XR31_RALSO/30-119----------------------ILLIARAYLFYVF-----------------------------F.R-SGLTKL-H----
Q92SD1_RHIME/6-88----------------------IVLIGRILLSIIF-----------------------------I.T-SGFGKL-T----
Q7NPD1_GLOVI/22-104----------------------GLLVLRVFAGLTM-----------------------------A.V-HGLGKV-P----
Q7NZE1_CHRVO/10-92----------------------AALVLRVALGLMY-----------------------------L.S-HGALKL-F----
Q7VDS1_PROMA/43-133----------------------SIFVLRVVFSLFM-----------------------------I.H-HGLEKL-Q----
Q7N096_PHOLL/8-89----------------------ALLLARILMPILF-----------------------------I.V-AGYGKL-G----
Q8XWH4_RALSO/12-94----------------------LILLGRVLMMLLF-----------------------------L.I-SGWGKL-T----
Q7VYL1_BORPE/8-89----------------------GKLILRLALGILV-----------------------------I.M-HGLAKL-S----
Q7US51_RHOBA/24-106----------------------GLLALRVAFGCFM-----------------------------L.V-HGLQKV-I----
Q88G88_PSEPK/13-95----------------------IILIARVLLMVLF-----------------------------V.L-SGWAKL-T----
Q812S4_BACCR/6-87----------------------GNLIIRIVLGVTF-----------------------------F.M-HGLTKF-Q----
Q88KH7_PSEPK/17-105----------------------GLSVIRILVGIIF-----------------------------M.A-HGAQKL-F----
Q98JU3_RHILO/13-95----------------------ALLIARLIFAAVF-----------------------------L.M-AVTFKF-M----
Q89MP6_BRADU/4-104----------------------FVTFGRILFAVLF-----------------------------I.Y-TGATKL-F----
CATD_BACSU/8-88----------------------GTLLLRVITGIIF-----------------------------F.V-HGLSKF-Q----
Q7VTR5_BORPE/10-91----------------------AVLLLRLALGVMY-----------------------------L.A-HGLTKL-L----
Q7UE97_RHOBA/16-98----------------------GMLGLRIAFGCFM-----------------------------L.V-HGIQKL-M----
Q7NA66_PHOLL/20-124----------------------LPLLARISLAATF-----------------------------W.L-SGQSKV-V----
Q7VBT6_PROMA/9-93----------------------LDFLGRVFLASTF-----------------------------V.V-AIPSKF-L----
Q8FSC2_COREF/11-95----------------------ALLLSRVLLGVIL-----------------------------I.A-HGWDKF-Q----
Q98K48_RHILO/27-109----------------------LLFLGRLLLGGAF-----------------------------V.V-AGLRNI-Q----
Q7NSB1_CHRVO/12-100----------------------VLLLLRLWLLDVF-----------------------------F.R-SGLTKI-D----
Q9HZY2_PSEAE/16-104----------------------GLAILRIVTGLTL-----------------------------M.S-HGSQKL-F----
Q88K91_PSEPK/19-105----------------------ADVPLRVFLAWEF-----------------------------F.E-SGLEKF-N----
Q8EZJ9_LEPIN/12-95----------------------LVDFLRIYLGGVL-----------------------------I.Y-KGLEFL-Y----
Q8Y2U2_RALSO/28-111----------------------GLLFLRVAGSALL-----------------------------LYV-HGLPKV-L----
Q9CP47_PASMU/16-102----------------------GLLGLRLFLAWEF-----------------------------F.E-SGKEKW-K----
Q9HWS4_PSEAE/24-110----------------------ADLSLRLFLAWEF-----------------------------F.E-SGWEKW-N----
Q82PS9_STRAW/30-117----------------------GILLLRLAVGLLL-----------------------------A.G-HGAQKL-F----
MHQP_BACSU/5-93----------------------GLLLIRIMIGVVF-----------------------------L.F-YGTQKL-F----
Q883U2_PSESM/16-104----------------------GLTLLRVIVGIAF-----------------------------I.A-HGSQKL-F----
Q92TK3_RHIME/11-93----------------------LALIGRLLLAAMF-----------------------------I.L-SGFGKL-G----
Q7V7V3_PROMM/10-94----------------------VDFIGRLCLSAVF-----------------------------V.V-AVPSKI-T----
A9CK19_AGRT5/23-105----------------------LVLIARILLSFIF-----------------------------I.Y-SGFGKL-T----
Q7U687_SYNPX/15-102----------------------GLLLLRVFTGSLL-----------------------------I.H-HGYEKL-A----
Q89EW4_BRADU/19-101----------------------LWHAARLALVSAY-----------------------------L.L-GGFIKL-L----
Y1602_HAEIN/14-100----------------------SLLILRFFLAWEF-----------------------------F.E-SGLEKW-N----
Q98JF9_RHILO/23-103----------------------TLLAGRLLMSFIF-----------------------------L.H-EGVTLA-T----
Q8YSN3_NOSS1/6-88----------------------IPLVARSFLAVIF-----------------------------I.Y-AGVNKV-F----
Q92Y87_RHIME/25-105----------------------FLAL..LALCSAY-----------------------------I.Q-GPLMKI-Y----
YQJF_ECOLI/8-88----------------------GVLVARILMPILF-----------------------------I.T-AGWGKI-T----
Q812I5_BACCR/5-93----------------------GLLIIRLIIGITF-----------------------------M.G-HGAQKL-F----
Q8NT59_CORGL/10-94----------------------AFLIARILLGVIL-----------------------------I.A-HGWDKF-A----
Q87KG0_VIBPA/27-115----------------------LLLFCRLWVAWVF-----------------------------F.N-SGLIKI-A----
Q8P8R3_XANCP/15-111----------------------ALLMLRLAGGGFL-----------------------------L.P-HGLGKL-L----
Q89SK7_BRADU/66-148----------------------LILIGRVLLAWVF-----------------------------V.G-SAYGAI-S----
Q82AZ6_STRAW/10-97----------------------GLLLLRLGTGGVL-----------------------------A.A-HGAQKL-F----
Q82V34_NITEU/11-94----------------------GKLTLRLTVGVLI-----------------------------L.L-HGVHKI-F----
Q82UE4_NITEU/22-102----------------------SQFVARLFLGQIF-----------------------------L.L-AGISKI-S----
I0IQM6_LEPFC/14-98----------------------..MVLRLGLAGVI-----------------------------L.P-HGFGKL-L----
I6XG31_MYCTU/17-94----------------------.LSLFRLVYGLLF-----------------------------A.G-YGSMIL-F----
I6YAV3_MYCTU/114-195----------------------GLLILRVGLGAVL-----------------------------I.A-HGLQKL-F----
YPHA_ECOLI/16-98----------------------LLLIARIAVVLIF-----------------------------I.I-FGFPKM-M----
Q2FZM5_STAA8/5-82----------------------.MLLIRWMLATSF-----------------------------L.V-HGTLKF-V----
Q2YIJ7_BRUA2/13-93----------------------.TLIIRVFLSVLF-----------------------------I.I-AGYNKL-T----
Q7AJS4_BACHD/8-89----------------------GILLLRLFLGVTF-----------------------------F.I-HGLVKF-Q----
Q7MGN3_VIBVY/23-104----------------------VLLFCRLWVAWVF-----------------------------F.N-AGLSKI-A----
Q8F8V4_LEPIN/14-97----------------------.PLLLRLGLSICI-----------------------------F.P-HGAQKL-L----
Q9CCC8_MYCLE/7-92----------------------GLLILRLVLGLTL-----------------------------A.A-HGYNKF-F----

PF13564

D1AAS7_THECD/7-112-------------------------ILQALLAVMF-----------------------------A-M.AGVMKS.T----
D2SF07_GEOOG/7-113-------------------------IVAGLLAVAF-----------------------------L-A.AGLMKL.T----
C5BX04_BEUC1/7-113-------------------------ITAGLLALAF-----------------------------L-G.SGAVKL.V----
D3Q9W4_STANL/7-109-------------------------VVTVVTIAVN-----------------------------L-A.VAVADF.A----
D1BDS4_SANKS/7-113-------------------------ILAGLLAVAF-----------------------------F-A.SGLSKI.V----
D1BYA3_XYLCX/7-112-------------------------VIAGLLAAVY-----------------------------F-T.VGCVKL.L----
B5HYY5_9ACTO/7-112-------------------------IVAGLLALFY-----------------------------F-Y.AGTMKV.I----
D1BVK9_XYLCX/7-113-------------------------IGAGLLALFY-----------------------------L-Y.SGGIKV.A----
A9B5S7_HERA2/7-113-------------------------IIQGLLALVF-----------------------------G-G.AGAFKL.I----
D3Q6B3_STANL/7-112-------------------------IVQIVLAVAF-----------------------------A-A.IGALKT.T----
C5C629_BEUC1/7-115-------------------------IVAGLMAAVF-----------------------------L-V.AGSTKL.F----
D3PWB3_STANL/7-114-------------------------IVTGILAAAF-----------------------------A-F.AGSTKL.F----
D3EH52_GEOS4/7-112-------------------------IIQGLAALGF-----------------------------V-Y.SGWLKA.F----
A4F848_SACEN/7-108-------------------------TVTIMTALCN-----------------------------L-A.AAAVDF.A----
A1SIQ7_NOCSJ/7-109-------------------------IATVLLAFLA-----------------------------V-N.SAAMKL.R----
C6WJU0_ACTMD/7-113-------------------------VLQGLLAVAF-----------------------------V-A.AGGMKL.A----
B5I6V7_9ACTO/19-120-------------------------VVTLLAAAMA-----------------------------G-Y.SGTVVL.T----
C6VZE8_DYAFD/11-112-------------------------IFTAWLALGM-----------------------------T-S.TGVVQL.M----
Q0SGE8_RHOSR/7-112-------------------------VCGVLLAVSA-----------------------------V-A.VSIPKL.R----
D5UX83_TSUPD/7-115-------------------------IITGVLAAGF-----------------------------A-A.GGAALL.A----
D3PZS4_STANL/7-112-------------------------ILQVALALFF-----------------------------A-N.AGFAKV.S----
D3PUC2_STANL/7-110-------------------------TLTLITAAAN-----------------------------L-F.SGGLAL.A----
C9Z9S2_STRSW/7-108-------------------------TLAVALSLIF-----------------------------F-S.FGTAKI.A----
A1TE84_MYCVP/11-113-------------------------AVTLTCAVAN-----------------------------A-A.VAAADL.A----
D2AS43_STRRD/5-106-------------------------IVTVLAAAWV-----------------------------A-F.SAYAIL.T----
D2PZ45_KRIFD/7-114-------------------------IVSALLAVLF-----------------------------A-A.SGVAKS.T----
B1MM14_MYCA9/10-112-------------------------ITTVLCIATN-----------------------------G-F.EVVAKA.V----
Q65HS4_BACLD/5-107-------------------------FLKAGLAAFM-----------------------------L-T.GGVIKV.L----
Q5YWI3_NOCFA/31-132-------------------------VLTALAAAAA-----------------------------A-F.AAGVDL.V----
D3F1P3_CONWI/7-108-------------------------VLSTLLAVLL-----------------------------T-A.SAASKL.A----
C7PZU5_CATAD/19-125-------------------------ILQAVLAAFF-----------------------------A-L.SGLGKA.F----
B5H4W5_STRPR/7-108-------------------------VFTLLAAATS-----------------------------G-Y.SAANHL.I----
Q11P05_CYTH3/10-110-------------------------VATGIFGAMM-----------------------------L-M.SGFMYF..----
D5UGI3_CELFN/7-114-------------------------TVNALLALAF-----------------------------I-G.TGTFKL.A----
Q89Y33_BRADU/62-168-------------------------AAQGLIFFVF-----------------------------A-S.AGLVKL.L----
C0ZKK1_BREBN/2-104-------------------------ILSLILALMF-----------------------------S-I.SVLMKF.L----
B1MDG2_MYCA9/7-115-------------------------VCAGVLAVVH-----------------------------L-A.AGAFKL.I----
Q7UL85_RHOBA/23-124-------------------------VTLALFCLAM-----------------------------A-G.GGFADL.T----
C7PUE7_CHIPD/10-111-------------------------VTTAIIALMM-----------------------------T-Y.SAYAYL.T----
D3Q6A9_STANL/7-109-------------------------ILSIALIAFF-----------------------------G-S.LGGAKL.V----
Q82R50_STRAW/28-129-------------------------TLACLIALIF-----------------------------G-A.SGVLNT.L----
D2QST6_SPILD/17-122-------------------------TAQVVLAVSL-----------------------------I-W.AATMKL.F----
Q5YXM8_NOCFA/33-141-------------------------IAAGLLAFVA-----------------------------L-G.GGVGKT.F----
C7PKH0_CHIPD/17-121-------------------------VAQGLLSATL-----------------------------L-W.ASATKL.F----
B2JL65_BURP8/47-153-------------------------AAQILVSGFF-----------------------------A-L.AASMKIGM----
D2ASD1_STRRD/34-143-------------------------SLQVLFGFFF-----------------------------A-G.SGFGKV.L----
B0UIU5_METS4/14-111-------------------------VLRGLITAVF-----------------------------V-L.AAGMKF.A----
D2PS28_KRIFD/35-136-------------------------ASTVVVVFEL-----------------------------I-A.GSVWNL.A----
C7PYY8_CATAD/7-121-------------------------VVQALLAALF-----------------------------L-L.SGSLKS.T----
A9GJR9_SORC5/11-117-------------------------VTTGWVALGM-----------------------------V-S.GGVAHV.L----
B8IER0_METNO/21-116-------------------------SLQVLLALVF-----------------------------L-A.AGGTKL.A----
Q1IKM4_KORVE/10-111-------------------------ASTVLAALLF-----------------------------M-V.PGLGLL.G----
A9FEJ3_SORC5/27-126-------------------------ILSGLSVAFL-----------------------------L-F.DSIGKL.M----
Q2S0Z3_SALRD/8-118-------------------------GSTVLFALMM-----------------------------A-G.SGTMYF..----
Q11S70_CYTH3/11-112-------------------------LSYTYYLYVF-----------------------------G-Y.ASLFKV.F----
Q5Z2J9_NOCFA/19-120-------------------------VPVTAVLAET-----------------------------A-V.GAYWDL.A----
C6X539_FLAB3/10-112-------------------------ITTGIFGLSM-----------------------------L-F.SAYMYL.T----
B5HQQ2_9ACTO/55-152-------------------------TLQVVLALFY-----------------------------V-IASALPKL.I----
A7H7U7_ANADF/31-130-------------------------ILTALPVLFL-----------------------------L-F.DGTIKL.L----
A5FBV8_FLAJ1/7-111-------------------------IFWITTTIIF-----------------------------L-F.EGVMPA.L----
D2QN87_SPILD/19-118-------------------------TATLLIV.LF-----------------------------D-S.VGALGF..----
A9B014_HERA2/18-116-------------------------ILRGLAAAFL-----------------------------L-F.DGSFKL.F----
Q1D110_MYXXD/7-102-------------------------IFTGLVVATL-----------------------------A-F.SASMKL.G----
C7PKI9_CHIPD/12-107-------------------------VLSGIAGLML-----------------------------G-A.SAIDKI.V----
A9F3Z6_SORC5/44-143-------------------------VLSGLGVLFL-----------------------------T-F.DAAVKV.L----
D9QMH9_BRESC/33-140-------------------------TLQGWVAMFF-----------------------------V-A.AGYAKL.T----
Q0SJ69_RHOSR/31-130-------------------------VVSALVVLFL-----------------------------L-F.DSLIHI.A----
Q1IPI6_KORVE/25-123-------------------------VLSSVAILFL-----------------------------L-F.DGLMKV.I----
A9UV76_MONBE/637-749-------------------------ILCLLLTVMF-----------------------------L-M.AGTAKL.T----
B4RA61_PHEZH/23-122-------------------------TLTGLFTAFM-----------------------------L-F.DVGIKL.A----
C5C5Y3_BEUC1/41-144-------------------------VLLVWMVVSF-----------------------------T-V.GAITKF.Y----
C0Z8W5_BREBN/15-114-------------------------IMSGLVILFM-----------------------------L-F.DGVFKL.I----
B9JK89_AGRRK/29-136-------------------------FLEASIAVVF-----------------------------G-L.SGFLKI.S----
B1MHX9_MYCA9/33-130-------------------------ALTAIIVLFL-----------------------------L-A.DAIPKI.F----
A5V4G4_SPHWW/11-106-------------------------VLGYAVAFVM-----------------------------A-T.GVVVNL.A----
A4YMD8_BRASO/6-106-------------------------ILSALVILFL-----------------------------L-F.DGAIKL.I----
B7VRG5_VIBSL/12-116-------------------------VVSVLLVVFF-----------------------------L-L.ASSIKT.I----
C3AVH4_BACMY/21-123-------------------------.VTLLLAAAI-----------------------------M-L.SGIGQL.M----
Q73Z31_MYCPA/32-131-------------------------...LFTAAIT-----------------------------A-A.IAVADF.V----
Q81NN7_BACAN/4-103-------------------------VLQVVLAIFI-----------------------------V-V.GGFIKI.F----
Q81U50_BACAN/7-106-------------------------VLQCLLIFAF-----------------------------F-F.SSVSKI.A----
Q8F0G1_LEPIN/13-113-------------------------IVTAVIAANY-----------------------------A-F.ASYAYF.N----

PF07291

MAUE_METEA/3-186--------------MALLAEPVVTTFVRAFLILLL-----------------------------A-S-AAIPKL------
MAUE_METFK/2-184--------------SWLINDPTAAVLASLFIGIVL-----------------------------A-A-AAIPKF------
A1BB98_PARDP/3-185--------------.DFLIQPMVLWALRIFLALLF-----------------------------V-A-AALSKL------

PF04224

Q9CJR3_PASMU/1-137---------MKKWLQHFQQSHLDITLLRLSVILLF-----------------------------F-I-FANTKW-F----
O25289_HELPY/5-190---------KSLLEVITKLQNLGGYLMHIAIFIIF-----------------------------I-W-IGGLKF-V----
RCLC_ECOLI/2-182---------EKYLHLLSRGDKIGLTLIRLSIAIVF-----------------------------M-W-IGLLKF-V----
Q9KRP9_VIBCH/1-146---------MHDSKTHNLTTQYGYLIGVLGVSLIL-----------------------------I-W-LGIYKF-T----
Y219_HAEIN/13-209---------EFVARIVAPMQRQFINFIRIAIFIVM-----------------------------A-W-IGGLKV-C----

PF05514

O23298_ARATH/1-138-------------------MELASFLGRALFVSVF-----------------------------L-L-SAWQEFND----
Q9LTD0_ARATH/18-201-------------------FPHVETIGRALFASSF-----------------------------F-L-SSWHDYME----
Q0IXE1_ORYSJ/1-138-------------------MGFLSFAGRVLFAAAF-----------------------------L-L-SAYQEFSE----
O22690_ARATH/1-138-------------------MGFFSFLGRVLFASLF-----------------------------I-L-SAWQMFND----
I1PJ49_ORYGL/1-138-------------------MGFISFVGRVLFASIF-----------------------------L-L-SAYQEFSE----
Q8GYI3_ARATH/20-151-------------------MPAIAFFGRMAFSFVF-----------------------------F-I-TAIQDYAD----
Q8H080_ORYSJ/1-138-------------------MGFVSFAGRVLFASVF-----------------------------L-L-SAYQEFSE----

PF02077

SURF4_CAEEL/11-277NEMLAKAEDAAE.DFFRKTRTYLPHIARLCLVSTF-----------------------------L-E-DGIRMY-F----
YFC7_CAEEL/4-269NVVITRCEDYTE.TLARNTRKVLPTIGRLLLISTF-----------------------------V-E-DGLRLL-F----
ERV29_YEAST/48-310EKFASRIEGLTDNAVVYKLKPYIPSLSRFFIVATF-----------------------------Y-E-DSFRIL-S----
SURF4_SCHPO/33-302SERACQFMEQAE.TFMAPFTPYMPLLGRFLIVATY-----------------------------F-E-DAIRIV-T----
SURF4_DROME/5-270NEYIAKTEDVAE.QVIKRGKNVLPTVARLCLIATF-----------------------------F-E-DGLRMY-I----
SURF4_HUMAN/4-269NDLMGTAEDFAD.QFLRVTKQYLPHVARLCLISTF-----------------------------L-E-DGIRMW-F----

PF13781

C3AK78_BACMY/185-286---------------------SFVWMYQGLMPKVL-----------------------------F-N-HPE.EV------
D3E5H6_GEOS4/180-281---------------------VVLWCYEGLVPKLL-----------------------------F-P-EAG.EL------
Q65IN6_BACLD/178-279---------------------SFVWIYQGLVPKLI-----------------------------M-A-HPG.EI------
C6CYU2_PAESJ/180-281---------------------CLLWLYEGLVPKWM-----------------------------H-P-EAG.EL------
Q8ESB3_OCEIH/179-280---------------------SFIWIYQGLVPKIL-----------------------------F-Q-HTG.EL------
A1BFB6_CHLPD/25-125---------------------SFSWIYQGAVPKIV-----------------------------C-Q-STG.EI------
B4SAW4_PELPB/19-119---------------------AFSWVYQGAVPKIA-----------------------------C-Q-SKG.EI------
B3EQZ0_CHLPB/20-120---------------------AFSWIYQGAVPKVI-----------------------------C-R-SPG.EI------
B4S7F5_PROA2/21-121---------------------AFSWIYQGAVPKIA-----------------------------C-Q-SPG.EI------
Q3ARZ2_CHLCH/17-117---------------------AISWIYQGAVPKLM-----------------------------C-Q-SSG.EL------
B3QTS0_CHLT3/26-127---------------------AFVWIYHGLVPKLL-----------------------------F-G-HVD.EI------
Q1H1D1_METFK/335-436---------------------AVVWIVTGLVSLGL-----------------------------Y-P-VEE.SY------
C7R8T5_KANKD/19-119---------------------AFLWIFTGLTSV.Y-----------------------------F-D-YQT.GH------
Q2SM61_HAHCH/17-117---------------------AGVFLYHGLVPKIL-----------------------------W-L-SPT.EL------
Q3SHK0_THIDA/314-415---------------------AVMWVVTGFVSLWV-----------------------------Y-P-VAD.SL------
Q2Y734_NITMU/330-431---------------------AAVWFVAGAVSMGI-----------------------------Y-P-VEE.SY------
Q5NY22_AROAE/320-421---------------------AFVWILTGIVSLGV-----------------------------F-P-VAE.SH------
A1K6I8_AZOSB/336-437---------------------GVMWIATALVSFGL-----------------------------Y-P-VAA.SL------
Q1LGK6_RALME/315-415---------------------ALVWLATALVTLFA-----------------------------Y-P-LAD.SL------
C1F939_ACIC5/18-120---------------------AAVWAYEGLWCKLL-----------------------------G-R-MPS.QF------
Q7NW81_CHRVO/13-112---------------------AALWLWSGLQPP.L-----------------------------T-V-WSE.SI------
Q11TY1_CYTH3/19-119---------------------TLVWLANGLLCKVL-----------------------------N-L-VPR.HQ------
C7PI03_CHIPD/14-115---------------------ALVWLVNGLLCKVL-----------------------------H-L-VPR.HE------
A1VMB6_POLNA/12-112---------------------IAVWLGTAAVSL.L-----------------------------E-L-EGQ.SA------
Q0ANG5_MARMM/322-422---------------------GLYWLLTGVLAL.T-----------------------------V-A-RDH.AY------
A9C3F1_DELAS/21-121---------------------IAVWLGTALVSA.I-----------------------------E-H-RGL.SV------
Q4K472_PSEF5/309-409---------------------VLIWLGTALVCI.G-----------------------------P-G-YAW.GL------
Q89WY4_BRADU/329-429---------------------AAFWVVSGFIALF.-----------------------------V-S-YRA.AA------
Q2K6I2_RHIEC/316-414---------------------SVFWLLSGLIPLLA-----------------------------L-E-KT..ST------
A1TNI5_ACIAC/22-122---------------------VAVWLGTAVASV.A-----------------------------E-F-HGQ.SR------
B9JGJ5_AGRRK/322-420---------------------ALFWMLSGIVPL.L-----------------------------A-P-IAA.SR------
A5V930_SPHWW/323-422---------------------FLLWMGSAVATFLH-----------------------------F-D-EA...A------
Q2JZG1_RHIEC/327-426---------------------PLFWISTGIISLTS-----------------------------G-F-.EQ.GV------
Q11CJ7_CHESB/321-420---------------------PLFWIGTGIVSLTI-----------------------------G-Y-RE..GI------
A7IKV9_XANP2/322-421---------------------SLFWIVTGLISLGP-----------------------------A-A-SAG.EA------
Q2S702_HAHCH/327-427---------------------VVVWLLSGVAGFAA-----------------------------R-P-EAF.EP------
C2WZH4_BACCE/180-281---------------------AFVWIYQGIVPKLL-----------------------------F-T-HSE.EV------
G8PNG3_PSEUV/327-425---------------------.LFWLASGIIGAIQ-----------------------------L-N-EAQ.SV------
Q5ZVY7_LEGPH/322-422---------------------SFVWIWTALCCLFF-----------------------------Y-P-KSD.SL------
Q9A4D7_CAUCR/322-420---------------------.AFWLVSGLIGLTV-----------------------------G-F-EPA.VA------
Q9I6F8_PSEAE/307-408---------------------ALVLIWLGTLVACL-----------------------------G-P-GYGWGL------

PF06762

K1QJR5_CRAGI/165-541----------------YGFGWESQILETGFLATFL.CPVWNVRPVPEDT...............P-T-SKIVIWGF....
LMF2_XENTR/122-588----------------LYFQWDSLLLETGFLAVLV.APVHALRWKTSVWS..............S-H-DGVTFWLT....
E4N190_KITSK/121-477----------------YAFGWESLLLEAGALAVFL.GNDRT.......................A-P-PLLGTWLL....
F2UH93_SALR5/134-601----------------LYFQWDILLLEVGFLAAAT.APLVCVRNQYH.................P-G-GDLMLSLV....
I3KCS2_ORENI/122-585----------------LYFQWDNLLLETGFLCILV.APLTLIRGSRGVR...............E-H-DRVTFWLI....
F1P0J3_CHICK/7-472----------------LYFQWDSLLLEAGFLAVLV.APLRLFKWRSTAWR..............P-H-DSVTFWLV....
E1GDX1_LOALO/74-452----------------.RFQWDSLLVESGAICIII.APLPFVGPS...................P-A-DNISLYLM....
E2B8W4_HARSA/122-575----------------MWFQWDVLLLEVGFLCIFI.APFWYSRWKSNT................P-S-DAMVFWMV....
F0Y0J4_AURAN/130-628----------------.GFQWDIFLLETGFWTVLY.APWCSLSARGEEA...............A-G-HPMAVPL.....
Q08T93_STIAD/249-609----------------LSFQWDALLLEMGLLGALM.APAGLRPGWGRR................D-A-SAVEVALF....
K7J1M5_NASVI/123-578----------------MWFQWDILLLEAGFLCIIV.APFWYSNHTRKST...............P-S-DSLTFWTV....
E5SED2_TRISP/131-543----------------MWFQWDMLLLEVGFLSILL.APFRMVRKSPNQWL..............P-H-DNVTLFLF....
A1TEH0_MYCVP/123-475----------------YGFGWESLLLEAGFLAMLL.GNDDT.......................A-P-PLLALWLA....
F8L1K9_PARAV/119-467----------------LAFGWEGFLLEITIHAYFM.............................S-L-TIVPCYLIWASA
F5YS29_MYCSD/125-477----------------YSFGWESILLEAGFLAVFL.GNDRV.......................A-P-PVLVMWLA....
G3UCY5_LOXAF/167-547----------------YSFGWESQLLETGFLGIFL.CPLWTLSRLPRYT...............P-T-SWVVVWGF....
Q4N0L2_THEPA/112-755----------------.....DLLLLEVGFLAIFIFSPFKFFDKHLSL................D-L-PSLVKWSF....
H9GJK7_ANOCA/78-542----------------LYFQWDSLLLEVGFLGVLV.APLHLLKWRSTAWR..............P-H-DGVTFWLL....
G3VQT8_SARHA/6-467----------------LYFQWDSLLLETGFLAVLV.APWCPTWGKEAGAP..............P-H-ADVPFWLV....
A0QT94_MYCS2/77-429----------------YSFGWESLLLEAGTLAVFL.GNDDV.......................A-P-PLLVLWLV....
B3DXT0_METI4/128-489----------------FNFQWDGLLLECGLLSSLF.LPWKLSCRFTTLT...............S-S-SAWTTFLF....
H9GAZ9_ANOCA/164-545----------------YSFGWESQLLETGFLGIFL.CPLWTLSRLPKNT...............P-P-SRIIIWAY....
T1KS50_TETUR/132-583----------------.WFQWDILLLEAGFLCIII.APFSNSFNHSP.................S-R-DPITLWLV....
M3ZPC1_XIPMA/122-585----------------LYFQWDNLLLETGFLCILV.APLTLIRGSRTVR...............D-H-DPVTFWLI....
Q234A3_TETTS/140-610----------------FSFQWDIMLLEAGFLTIFI.TPTVRNGQLIVD................E-I-SSVTRDLL....
W5KQN4_ASTMX/197-654----------------...EWDSLLLEAGFLAVLV.APLGLLRRSSSAA...............H-H-DSVTFWLT....
G1QIY9_NOMLE/23-406----------------LYFQWDSLLLETGFLAVLV.APLRPASHRKQAPQGGQAGAL.......P-H-EDLPFWLV....
F4WBZ8_ACREC/123-579----------------MLFQWDVLLLEVGFLCIFV.APLWYAYRGN..................P-S-DDVTLWAV....
F1Q4Q4_DANRE/125-588----------------...EWDVLLLEAGFLAVLV.APLGLLRSHSRHA...............F-H-DSLTFWMI....
W5KBQ4_ASTMX/194-574----------------YSFGWESQLLETGFLGIFL.CPLWSLDQMPRRC...............P-P-SLISIWTL....
G0MSI2_CAEBE/122-480----------------MHYQWDAFLLESTVAVALL.AWFCDG......................P-P-DSIALYGI....
U6IKR5_HYMMI/134-572----------------..WKWTSLLIESGFLCFLY.LFTLRRNSK...................S-A-TVVSLWLF....
Q1IR35_KORVE/151-523----------------.SYQSDGMLLEAGFICLFF.APPGWRPGLAASH...............P-P-SRASLFLL....
Z4YJR1_MOUSE/170-551----------------.SLGWESQLLETGFLGIFL.SPLWTLSRLPKNT...............P-T-SQIVLWGF....
M4AS74_XIPMA/175-556----------------YSFGWESQLLETGFLAVFL.CPVWTLSQVPSSC...............P-P-SLVCIWTF....
A8XC70_CAEBR/122-552----------------MYYQWDAFLLESTVYVAIL.AFFRDG......................P-A-DIVAIFGI....
C5BX37_BEUC1/125-479----------------YAFGWETLLLEAGFIVAFL.GSDDV.......................A-P-PVLVLLAA....
V4Z567_TOXGO/197-765----------------YAFGWESELLEIGFLSIWL.CPFWSFSRLPASW...............P-T-PKICVWGN....
G2NZI2_STRVO/121-473----------------YGFGWESLLLESGFLAVFL.GNEHT.......................A-P-PVLILWLL....
H6RBI8_NOCCG/121-470----------------YGFVWEMLLLEVGFLAIFL.GNAQT.......................A-P-PILVIFLL....
H8MNZ0_CORCM/241-604----------------LSFQWDVLLLEMGLLGALT.APVGVRPGLGKR................D-V-SALEVFLF....
E9GA51_DAPPU/120-571----------------MYFQWDIMLLESGFITIIV.APIIYSKKTSTT................P-K-DQISFWLV....
J9JZT7_ACYPI/128-582----------------.....DELLLEVGLLCILI.APLHSQKFRPNLRLETLL..........P-H-YSIPFWLV....
N0BDW0_9RHIZ/243-594----------------MSYQWDLLLLESGFLAIFL.T...........................A-G-SRIVVWLY....
D7EJW8_TRICA/90-537----------------.AFTGDEFLLEAGFLVLLV.APLLPGRRKGSKVL..............P-S-DSISFWLV....
LMF2_BOVIN/122-590----------------LYFQWDSLLLETGFLAMLV.APLGLPPNHKQAPQGRPGGVS.......P-H-EGLPFWLV....
R4VWD1_9EURY/128-492----------------YGYGWESMLLETGFLAVFL.GAGPA.......................G-P-PVVVVWLV....
G8TN66_NIAKG/129-490----------------YGYGWEIQLCETGFLAIFL.CPLLEMRPFPRR................A-P-PFPIIILF....
E9JDB8_SOLIN/123-577----------------MFFQWDVLLLEVGFLCILV.APFWWSPYHGR.................P-S-DGVTVWAV....
W5QF34_SHEEP/126-543----------------LYFQWDSLLLETGFLAVLV.APLGLPPNHKQAPQGRPGGAS.......P-P-EGLAFWLV....
E9T639_COREQ/121-473----------------YGFGWESLLLEVGLLAVFV.GNWDT.......................A-P-PLLTLLLL....
Q1CX59_MYXXD/289-654----------------LSFQWDVLLLEMGLLAALT.APGGLRPGLGRD................E-P-SALDVFLF....
W5TQD8_9NOCA/121-473----------------YGFGWESLLLETGFLAVFL.GNDRV.......................A-P-PILVLWLA....
B9M9C6_GEODF/118-468----------------YAFGWESLLLECGFLAIFL.GPVGV.......................E-P-PIVIIWLY....
Q6MNI0_BDEBA/151-506----------------LSYQWDSLLLELGFLGLFF.APWQWEWIPLAAH...............N-L-HPIMLGLV....
J9KB65_ACYPI/128-591----------------.....DELLLEVGLLCILI.APIPFQKLRVPSKKRNLRLQTSLASL..P-H-DSIPFWLV....
A8Q0Q7_BRUMA/122-570----------------.QFQWDSLLIESGAICILI.APLPFVGPS...................P-A-DNISLYLM....
Q16NM9_AEDAE/95-538----------------...QSDELLLEAGFLCILL.APSKLSDPRS..................P-I-EDLALLLM....
H3FMM6_PRIPA/124-598----------------LYFQWDSLVLESGWLMIVV.AASGNS......................P-A-DLMSTYLV....
G4VFY8_SCHMA/126-567----------------.WFQWDILLLESGFIAILL.SSFGTVISLPRVV...............A-S-DKIGMWLL....
B3DK37_DANRE/122-584----------------LYFQWDNLLLETGFLAILI.APMKMPWSSK.VR...............L-Y-DNVTFWLL....
B2HN18_MYCMM/121-472----------------YGFGWESLLLETGFLMVFL.GNDRV.......................A-P-PLVMLWLV....
D0NCT8_PHYIT/130-640----------------MQFQWDSFLLEVGVLAILL.APWCVDTTKYTF................E-T-PAAAVWTL....
H3B2B1_LATCH/185-566----------------YSFGWESQLLETGFLGIFL.CPLWTLRAVPHYT...............P-P-SSIIIWAL....
F6FUF5_ISOV2/129-486----------------YGFGWEMLLCEMAFLVAWL.GSDAV.......................P-V-PFLVVLAA....
B8C9U9_THAPS/126-526----------------YGYGWEPQLAELTFHALFL.VPLVSMNPFFGWSPTMKLGTY.......P-V-PILVIWAI....
H2ULX4_TAKRU/122-510----------------LYFQWDNLLLETGFLCILI.APLTLIRGSRGVR...............D-H-DRVTFWLI....
B0WW43_CULQU/88-531----------------...QSDEMLLEAGFLCILL.APAKLSDPRG..................P-I-EGLAMLLM....
U6I483_ECHMU/120-559----------------...KWTSLLIEAGFLCFLL.SIKLRKYSR...................S-A-SMIVAWLI....
W5K8X7_ASTMX/123-584----------------LYFQWDNLLLEVGFLAILV.APMNMPWGWRLH................A-H-DNMTFWLV....
T1G9T0_HELRO/127-575----------------.WFQWDTLLLELGFLTIFV.APLKLLFIDLHAFSK.............Q-I-GTISFWLV....
Q45WA6_TOXGO/205-775----------------FSVGWEAQLLELGFLAIWM.APFWSFSRLPPSW...............P-T-PKICVWGN....
B7FQF3_PHATC/171-536----------------YAFGWEPLLAEVLFHTLFL.VPFWSLNPIAKV................P-V-PVLVQWTV....
A1R4Z7_ARTAT/124-478----------------YGFGWEILLLEAGFTVAFL.GSNQC.......................P-P-PTTILVLI....
H2ULX3_TAKRU/164-554----------------LYFQWDNLLLETGFLCILI.APLTLIRGSRGVR...............D-H-DRVTFWLI....
E0W2V6_PEDHC/123-573----------------MWFQWDILLLEVGFLSIFV.APFLHNSHNKKWIYT.............P-A-DNVTFFLV....
LMF2_RAT/122-589----------------LYFQWDSLLLETGFLAILV.APLRRPSKHK.IPQGGLAGAL.......P-H-EDLPFWLV....
G7Q042_MACFA/113-483----------------.........LERQVAGILI..PTHGQQQLPEGR...............P-I-PRGDSWGL....
A0C620_PARTE/119-569----------------.QFQWDIMLLETGFICIIF.C...........................I-T-PIVGRELL....
Q73TN3_MYCPA/121-476----------------YSFGWESLLLETGFLMIFL.GNAEV.......................A-P-PLLTLWMA....
G3PHM6_GASAC/9-458----------------LYFQWDNLLLEVGFLCILV.APLTLIRGSRGVR...............E-H-DRVTFWLL....
L0J1F6_MYCSM/123-475----------------YGFGWESLLLEAGFIAIFL.GNDET.......................A-P-PLPAILLA....
W5NJI5_LEPOC/122-585----------------LYFQWDNLLLEAGFLTILI.APLNLFRSRATLK...............Y-H-DSITFWLT....
T1HC95_RHOPR/92-555----------------....GDILLLETGFLCLLL.SPWRQKGSSASSSSGGSKKQAAISNASSP-A-DYINFWLV....
W5JUK3_ANODA/140-616----------------...QADHLLLEAGFLCILL.APTRLTDGRN..................P-M-EDIALLLL....
T1G1C1_HELRO/128-506----------------YSFGWESQLLETGFLAVFL.CPFFSLKKFPKTV...............P-C-SFLIIMLY....
D2RQ81_HALTV/123-476----------------YGYGWESMLLETGFLAIFL.GAGAV.......................A-P-PVIILVLL....
E3LDC7_CAERE/122-552----------------MYYQWDAFLLESTVYVAVL.AWFDDG......................P-A-DSVALFSI....
E2AAK1_CAMFO/89-546----------------FSFAGDILLLEVGFLCILV.APFWYSHRGKSST...............P-S-DAVTFWTV....
D7FTX6_ECTSI/148-515----------------YGFGWENQLLETAFLTAFA.VPLLSLQPFPATC...............P-P-PAVIPWLY....
Q7PZH8_ANOGA/94-545----------------...QADHLLLEAGFLCILL.APTRLTDRRH..................P-M-EAIALLLL....
F0VNS7_NEOCL/190-761----------------FSFSWESQLLELGFLAIWT.SPFWSLSRLPPSW...............P-T-PKVCVWGN....
F4Q4V3_DICFS/211-592----------------YSYQWDQLLLETSFLAIFL.SPFTFKYDD...................K-P-STPIRYLL....
U1NTR0_ASCSU/122-570----------------.WFQWDTLLLEAGALCCLL.APFPFLGSS...................P-A-DNISIFLI....
C3Z738_BRAFL/141-522----------------YSFGWESQLLETGFLAIFF.CPLLTLHPLPRST...............P-S-PWVIIWGY....
A7RJW9_NEMVE/81-462----------------YSFGWESQLLESGFLAIFL.CPVFKLQQVPAQT...............P-I-PLVVIYGY....
A0JUS2_ARTS2/124-486----------------YGFGWEMLLLEAGFTVAFL.GSDQT.......................P-P-PRTILILL....
G1NWH4_MYOLU/169-550----------------YSFGWESQLLETGFLGIFL.CPLWTLSRLPRKT...............P-T-SRIVLWGF....
F8JRN7_STREN/121-473----------------YGFGWESLLLEAGLLGLFL.GNART.......................A-P-PVLVLWLV....
D8J6J5_HALJB/125-476----------------YGYGWESMLLETGFLAVFL.GAGGV.......................A-P-PFVVFVLL....
Q21435_CAEEL/1-432----------------MYYQWDALLLESTVYVAIL.AWFDNG......................P-A-DSIALFGI....
A7AW74_BABBO/157-697----------------...NIDLLLLEVGFLAALLYSPFAFFGYEHKEW...............G-V-PSTSRWSY....

PF04173

Q97X72_SULSO/12-173----------------------------NVPAKL-----D-----P----------NSSAYVGGKLIT---F---LPH--
Q97XJ3_SULSO/18-183----------------------------LKPAKL-----D-----P----------NSSSFVGGKLVN---F---LPH--
Q973M6_SULTO/9-177----------------------------LNPGYL-----N-----P----------SSTSYVGIT.IE---V---LMQ--
Q97UC4_SULSO/10-178----------------------------LNSGFL-----N-----P----------SSEQYVGFT.IQ---Y---LAQ--
Q8AAF0_BACTN/18-181----------------------------LEN.KL-----I-----P----------DATGYIGEKFNH---F---LPN--
F4B442_ACIHW/20-184----------------------------LKPAKL-----D-----P----------NSASFVGGKLVN---F---LPH--

PF07681

Q83CN9_COXBU/12-94..........--------------........GF-----D-----A..........TVSTLA....QT---G---LPS--
Q87K55_VIBPA/16-104GWF.......--------------.....GGYGL-----E-----G..........TGQWMA....SI---G---LGP--
Q8KEE1_CHLTE/7-88H.........--------------........GY-----G-----F..........IAGKLK....AA---H---L..--
Q9RTC4_DEIRA/8-92W.........--------------.......GDL-----G-----P..........LVEQFR....AW---H---IPH--
Q7TUM8_PROMM/37-127..........--------------........NP-----E-----G..........FSEFVISQHLNF---L---PGD--
Q7VHA8_HELHP/8-89N.........--------------........GV-----S-----G..........IEGFME....SH---G---L..--
Q89FZ6_BRADU/10-92V.........--------------.......FTP-----A-----G..........TAKFFG....SL---G---F..--
Q8EDN3_SHEON/21-107..........--------------........HF-----D-----D..........TVAWFANPDWGL---G---LPM--
Q8A9J9_BACTN/19-101..........--------------........NF-----Q-----E..........LSTAFP....DP---I---GLG--
Q83BV7_COXBU/131-217AG........--------------......PVSF-----Q-----G..........DVKAFL....GL---G---ITN--
Q92W39_RHIME/11-107G.........--------------......FLEL-----N-----D..........VAVLLFTSEFQL---H---LPG--
Q8U4Y0_AGRT5/25-105..........--------------........DF-----P-----G..........AIAEMN....HF---G---LQP--
Q7V0B0_PROMP/15-102N.........--------------..........-----.-----...........IDNFADAFVRPL---H---LPF--
Q984Q4_RHILO/6-88..........--------------........KF-----K-----P..........MTEYLA....AR---Q---FPA--
Q9A3E7_CAUCR/28-117G.........--------------......LLHI-----T-----D..........GTYALFETEYAL---P---LIP--
Q983U6_RHILO/19-101..........--------------........AI-----S-----G..........TAAYFG....GL---G---LPV--
Q82HN4_STRAW/24-126NS........--------------......AFMS-----E-----S..........GAGSIG....DM---M---RTV--
Q7VUY8_BORPE/24-126GFAVNALA..--------------GEFDLGWPRL-----S-----E..........SAISLFRDEYQV---P---LLP--
Q831Y6_ENTFA/7-87..........--------------........SL-----E-----D..........TLAFFA......---S---IGL--
Q983U8_RHILO/8-90..........--------------........NI-----A-----G..........TSDYFA....GL---G---LPL--
Q7V328_PROMP/44-134..........--------------........DP-----Q-----G..........FGEFVVGKYFPF---L---PGD--
Q7MRA2_WOLSU/17-98N.........--------------........GI-----G-----G..........IEKMLV....NN---G---L..--
Q8F8N5_LEPIN/13-98GWF.......--------------.....GGYGF-----S-----G..........TMGYFI....GQ---G---I..--
Q9HYW2_PSEAE/22-108..........--------------........DM-----P-----A..........TIEWFGNPDWGL---G---LPF--
Q88P63_PSEPK/6-95G.........--------------......FLTL-----T-----P..........GTYELFRTEYAL---P---LLS--
Q9HWH6_PSEAE/14-96..........--------------........DY-----Q-----A..........SLEEMR....AA---G---LEP--
Q8FR06_COREF/10-94I.........--------------.......SGT-----T-----A..........TTGQFS....AW---G---VPQ--
Q9KYL5_STRCO/4-96..........--------------........RP-----Q-----DVAPAAEPVVRPVADRV....PV---L---PDS--
Q8NR01_CORGL/191-281TLG.......--------------.....GSAGL-----A-----G..........LEAEFA......---.---...--
Q8XR31_RALSO/30-119D.........--------------.......W..-----.-----P..........TTVLLFSEEYKV---P---LLP--
Q92SD1_RHIME/6-88..........--------------........DP-----S-----A..........TAGMIT....GA---G---WPA--
Q7NPD1_GLOVI/22-104..........--------------........PN-----E-----G..........LVETVA....SL---G---FPA--
Q7NZE1_CHRVO/10-92V.........--------------.......FTP-----A-----G..........TAGYFA....SL---G---L..--
Q7VDS1_PROMA/43-133..........--------------........DP-----Q-----G..........FAEFVVGKYFTF---L---PGD--
Q7N096_PHOLL/8-89D.........--------------........SY-----A-----G..........TQQYMN....AM---G---V..--
Q8XWH4_RALSO/12-94..........--------------........GF-----S-----A..........TVGYMG....TV---G---APM--
Q7VYL1_BORPE/8-89S.........--------------........GV-----G-----G..........IAGMLS....SH---G---L..--
Q7US51_RHOBA/24-106..........--------------........GF-----S-----T..........ISEGFP....DP---L---GMG--
Q88G88_PSEPK/13-95..........--------------........GF-----D-----G..........TVGYMT....SL---G---APA--
Q812S4_BACCR/6-87S.........--------------........GI-----D-----N..........IAGWFT....SI---G---L..--
Q88KH7_PSEPK/17-105GLF.......--------------.....GGYGL-----E-----G..........TGQWME....SI---G---LAP--
Q98JU3_RHILO/13-95..........--------------........GM-----G-----A..........TAGFIA....AA---G---FPF--
Q89MP6_BRADU/4-104AIQATADFIA--------------TKVVVPDIIA-----P-----Y..........AKQIET....AT---A---MTT--
CATD_BACSU/8-88..........--------------........GM-----E-----G..........TIQFFG....SI---G---L..--
Q7VTR5_BORPE/10-91V.........--------------.......FTL-----P-----G..........TAQFFA....KV---G---F..--
Q7UE97_RHOBA/16-98..........--------------........GF-----T-----A..........MAESFP....DP---L---GMG--
Q7NA66_PHOLL/20-124GLNIDILETR--------------TPWQLGIPRV-----T-----D..........SSVSLFTNEYKL---P---LLP--
Q7VBT6_PROMA/9-93..........--------------........NY-----P-----V..........VLNTII....QK---G---IPE--
Q8FSC2_COREF/11-95I.........--------------.......TGL-----E-----G..........VSGFFA....SL---G---IPA--
Q98K48_RHILO/27-109..........--------------..........-----.-----...........NAAFLTGLMAAR---G---VPQ--
Q7NSB1_CHRVO/12-100D.........--------------.......W..-----.-----D..........ITLALFTDEYHV---P---LLP--
Q9HZY2_PSEAE/16-104GMF.......--------------.....GGAGL-----N-----G..........MAQWFE....SI---G---LTP--
Q88K91_PSEPK/19-105G.........--------------......SNWF-----A-----D..........LQSSFP...FPF---N---LLP--
Q8EZJ9_LEPIN/12-95..........--------------........DT-----D-----A..........LIRLME....MN---N---APM--
Q8Y2U2_RALSO/28-111H.........--------------..........-----.-----...........YSQELARIEDPF---R---LG.--
Q9CP47_PASMU/16-102G.........--------------......ENWF-----M-----E..........IQESFP...FPF---N---VIP--
Q9HWS4_PSEAE/24-110G.........--------------......ENWF-----G-----D..........IQSAFP...FPF---D---RLP--
Q82PS9_STRAW/30-117GIF.......--------------.....GGPGL-----S-----A..........TGKGFA....DM---G---YRP--
MHQP_BACSU/5-93GWF.......--------------.....GGYGI-----K-----G..........TGQWFE....SI---G---VKP--
Q883U2_PSESM/16-104GAF.......--------------.....GGYGL-----E-----G..........TAQYME....SL---G---LTP--
Q92TK3_RHIME/11-93..........--------------........DP-----S-----G..........TIGYIA....SA---G---LPL--
Q7V7V3_PROMM/10-94..........--------------........KF-----S-----S..........VVEAIS....GQ---G---IPE--
A9CK19_AGRT5/23-105..........--------------........DP-----A-----G..........TAGMIA....GA---G---MPA--
Q7U687_SYNPX/15-102N.........--------------..........-----.-----...........IENFADAFVRPL---H---LPF--
Q89EW4_BRADU/19-101..........--------------........DF-----A-----G..........AVAEQE....HF---G---LYP--
Y1602_HAEIN/14-100G.........--------------......QNWF-----A-----E..........IQDRFP...FPF---N---LIP--
Q98JF9_RHILO/23-103..........--------------........HF-----D-----G..........AARAMA....AL---G---V..--
Q8YSN3_NOSS1/6-88..........--------------........NF-----A-----Q..........TSESMA....KA---G---LPI--
Q92Y87_RHIME/25-105..........--------------........DF-----E-----G..........AIAEMN....HF---G---LTP--
YQJF_ECOLI/8-88..........--------------........GY-----A-----G..........TQQYME....AM---G---V..--
Q812I5_BACCR/5-93GWF.......--------------.....GGYGL-----K-----G..........TGGWME....SI---G---LRP--
Q8NT59_CORGL/10-94I.........--------------.......TGL-----E-----G..........VTGFFD....SL---G---IPA--
Q87KG0_VIBPA/27-115S.........--------------.......W..-----.-----D..........STLYLFEFEYQV---P---LLP--
Q8P8R3_XANCP/15-111GWF.......--------------.....NGPGL-----A-----G..........FAAELQ....QF---G---LPA--
Q89SK7_BRADU/66-148..........--------------........DF-----S-----G..........SVGYFR....SL---H---LPA--
Q82AZ6_STRAW/10-97GWF.......--------------.....GGAGL-----E-----G..........TGQFME....SV---G---YAP--
Q82V34_NITEU/11-94N.........--------------......PGSL-----D-----Y..........ISTLLA....NV---N---L..--
Q82UE4_NITEU/22-102..........--------------........SY-----A-----G..........TQGYMD....AM---G---V..--
I0IQM6_LEPFC/14-98GWF.......--------------.....GGFGF-----S-----G..........TMGFFT...HKM---H---I..--
I6XG31_MYCTU/17-94G.........--------------.......W..-----.-----...........PVTSAQ....PV---E---F..--
I6YAV3_MYCTU/114-195GWW.......--------------.....DGQGL-----A-----G..........FQNSLS....DI---G---YQH--
YPHA_ECOLI/16-98..........--------------........GF-----D-----G..........TVQYMA....SL---G---APM--
Q2FZM5_STAA8/5-82..........--------------........DL-----D-----G..........TIHFLG....SL---G---L..--
Q2YIJ7_BRUA2/13-93..........--------------........AL-----D-----G..........TADYFA....SI---G---LPM--
Q7AJS4_BACHD/8-89D.........--------------........GI-----G-----Q..........TVGFFD....SI---G---I..--
Q7MGN3_VIBVY/23-104..........--------------........TW-----D-----S..........TLYLFEL.EYQV---P---ILP--
Q8F8V4_LEPIN/14-97GWF.......--------------.....GGAGY-----E-----A..........SMDYLV....NT---A---Q.F--
Q9CCC8_MYCLE/7-92C.........--------------......GGRI-----P-----G..........TARWFE....SI---G---MKP--

PF13564

D1AAS7_THECD/7-112..RP......--------------K.DR.....L.....A....PK----------LP.........W.VED...F..--
D2SF07_GEOOG/7-113..QP......--------------K.KK.....L.....AD...SG----------MG.........W.TED...F..--
C5BX04_BEUC1/7-113..KS.....R--------------D.DV.....V.....A.....A----------YA.........W.AED...F..--
D3Q9W4_STANL/7-109..KA......--------------P.FV.....V.....A.....N----------ST.........T.V.G...V..--
D1BDS4_SANKS/7-113..GTR....D--------------Q.MI.....T.....K.....T----------PY.........V.E.D...F..--
D1BYA3_XYLCX/7-112..RG......--------------K.AL.....E.....Q.....R----------MP.........W.V.E..AF..--
B5HYY5_9ACTO/7-112..RS......--------------PDQL.....R.....P.....M----------MA.........W.VDR...M..--
D1BVK9_XYLCX/7-113..QS......--------------K.EQ.....L.....R....PM----------MA.........W.VDD...V..--
A9B5S7_HERA2/7-113..QP......--------------KDKI.....A.....A.....Q----------LA.........W.AKD...F..--
D3Q6B3_STANL/7-112..RP......--------------K.NK.....L.....A....PM----------MP.........W.VAD...F..--
C5C629_BEUC1/7-115..IP......--------------R.ST.....L.....A.....E----------APG......GGW.VGG...F..--
D3PWB3_STANL/7-114IPRE......--------------K.LM.....K.....A....PG----------AG.........W.VED...F..--
D3EH52_GEOS4/7-112..QF......--------------E.KA.....N.....A.....S----------WG.........W.VKD...V..--
A4F848_SACEN/7-108..RS......--------------K.WV.....L.....G.....N----------MS.........K.Y.G...L..--
A1SIQ7_NOCSJ/7-109..QN......--------------E.QV.....V.....T.....S----------IH........KT.V.G...V..--
C6WJU0_ACTMD/7-113..TP......--------------R.QQL...LE.....K.....G----------MG.........W.V.E...H..--
B5I6V7_9ACTO/19-120..RA......--------------D.WI.....V.....K.....A----------LT.........D.Y.G...V..--
C6VZE8_DYAFD/11-112..KM......--------------E.EE.....V.....K.....M----------FA.........H.L.G...Y..--
Q0SGE8_RHOSR/7-112..LK......--------------G.TA.....W.....T.....G----------LQ.........S.R.G...L..--
D5UX83_TSUPD/7-115..LP......--------------R.ER.....Y.....R.....A----------LGPN.....QHW.VDD...F..--
D3PZS4_STANL/7-112..QP.....I--------------G.TL.....A.....D.....T----------MT.........W.I.E..YF..--
D3PUC2_STANL/7-110..GF......--------------A.PI.....Y.....P.....A----------MA.........K.A.G...V..--
C9Z9S2_STRSW/7-108..AV......--------------P.FM.....R.....Q.....A----------AA.........H.L.G...L..--
A1TE84_MYCVP/11-113..RA......--------------P.FV.....L.....A.....N----------SA.........E.V.G...V..--
D2AS43_STRRD/5-106..RA......--------------A.WV.....V.....Q.....P----------LA.........A.Y.G...V..--
D2PZ45_KRIFD/7-114MSRD......--------------R.LI.....A.....T.....G----------QT.........G.V.A..VF..--
B1MM14_MYCA9/10-112..KA......--------------Q.FV.....V.....Q.....N----------SG.........E.V.G...L..--
Q65HS4_BACLD/5-107..HV......--------------P.FQ.....V.....E.....H----------WR.........H.Y.E...Y..--
Q5YWI3_NOCFA/31-132..RP......--------------E.WV.....R.....A.....N----------MR.........T.Y.G...I..--
D3F1P3_CONWI/7-108..RR......--------------P.QI.....V.....A.....S----------AT.........R.V.G...F..--
C7PZU5_CATAD/19-125..QS......--------------K.EK.....V....LV.....K----------AP.........V.LEN...Y..--
B5H4W5_STRPR/7-108..RP......--------------R.WI.....I.....D.....N----------LT.........S.Y.G...V..--
Q11P05_CYTH3/10-110..TD......--------------P.KI.....V.....E.....G----------FK.........F.M.G...F..--
D5UGI3_CELFN/7-114..RS......--------------K.EQ.....L.....RA...AG----------MA.........W.TDD...F..--
Q89Y33_BRADU/62-168.TPI......--------------P.QL.....A.....A.....M----------MP.........W.A.G..QY..--
C0ZKK1_BREBN/2-104..RA......--------------N.SM.....L.....Q.....H----------WK.........E.Y.G...Y..--
B1MDG2_MYCA9/7-115..TP.....H--------------E.KI.....A.....AN...AN----------LA.........W.AND...F..--
Q7UL85_RHOBA/23-124..QN......--------------A.AI.....M.....E.....S----------MT.........R.L.G...F..--
C7PUE7_CHIPD/10-111...K......--------------P.EM.....D.....Q.....A----------FQ.........H.I.G...Y..--
D3Q6A9_STANL/7-109..LA......--------------P.SV.....V.....E.....H----------VT.........A.L.G...F..--
Q82R50_STRAW/28-129..AL......--------------P.KA.....R.....E.....L----------AA.........E.T.G...F..--
D2QST6_SPILD/17-122..RP......--------------A.DQ.....L.....A.....T----------MW........PW.T.A...E..--
Q5YXM8_NOCFA/33-141..FP......--------------V.EK.....L.....A.....A----------APG......GGWTA.A...V..--
C7PKH0_CHIPD/17-121..KP......--------------AAEL.....A.....A.....M----------WP.........W.T.A...E..--
B2JL65_BURP8/47-153..SI......--------------E.PL.....A.....K.....I----------FP.........W.M.G..QV..--
D2ASD1_STRRD/34-143..LY......--------------D.GA.....LYAAAPR.....A----------VA.........W.YAA...V..--
B0UIU5_METS4/14-111..AV......--------------P.FE.....V.....S.....G----------FL.........R.F.G...Y..--
D2PS28_KRIFD/35-136..AI......--------------E.WV.....Q.....V.....Q----------TS.........H.L.G...Y..--
C7PYY8_CATAD/7-121..WP......--------------K.DR.....L.....I.....A----------SG.........Q.T.GVTPF..--
A9GJR9_SORC5/11-117..HV......--------------P.AS.....V.....D.....G----------FV.........R.L.G...Y..--
B8IER0_METNO/21-116..GV......--------------P.MM.....V.....Q.....V----------YD.........L.I.G...V..--
Q1IKM4_KORVE/10-111..RV......--------------S.HF.....T.....D.....D----------MA.........H.L.G...Y..--
A9FEJ3_SORC5/27-126..RV......--------------P.QV.....L.....E.....G----------SE.........Q.L.G...Y..--
Q2S0Z3_SALRD/8-118..VS......--------------E.NM.....A.....A.....K----------FA.........Q.L.G...F..--
Q11S70_CYTH3/11-112..QK......--------------T.TM.....M.....Q.....S----------MQ.........S.F.G...F..--
Q5Z2J9_NOCFA/19-120..RI......--------------S.YV.....R.....E.....S----------FD.........H.L.G...Y..--
C6X539_FLAB3/10-112..DA......--------------E.VK.....A.....G.....F----------SS.........H.L.G...I..--
B5HQQ2_9ACTO/55-152..AH......--------------P.SA.....A.....E.....G----------FD.........K.M.G...W..--
A7H7U7_ANADF/31-130..KL......--------------D.PV.....V.....E.....S----------FA.........R.L.G...Y..--
A5FBV8_FLAJ1/7-111TSQT......--------------E.LA.....K.....E.....G----------IR.........H.L.G...Y..--
D2QN87_SPILD/19-118..NT......--------------P.LA.....I.....E.....G----------TR.........H.L.G...F..--
A9B014_HERA2/18-116..NP......--------------A.PV.....A.....K.....S----------FA.........A.L.G...Y..--
Q1D110_MYXXD/7-102..QS......--------------P.EA.....I.....Q.....G----------IE.........K.S.G...Y..--
C7PKI9_CHIPD/12-107..QS......--------------G.HA.....L.....Q.....M----------SA.........S.F.G...L..--
A9F3Z6_SORC5/44-143..QL......--------------F.PA.....D.....A.....A----------TA.........Q.L.G...F..--
D9QMH9_BRESC/33-140..ES.....I--------------S.NL.....T.....A.....L----------MS.........W.PAL...V..--
Q0SJ69_RHOSR/31-130..NT......--------------Q.MV.....R.....E.....A----------MA.........E.L.G...F..--
Q1IPI6_KORVE/25-123..LE......--------------P.HV.....V.....A.....A----------SG.........P.L.G...F..--
A9UV76_MONBE/637-749..DAFVPDLH--------------N.EL.....V.....G.....K----------FETYAKVLQTVQ.Y.G...V..--
B4RA61_PHEZH/23-122..RL......--------------P.IV.....E.....V.....T----------GA.........Q.L.G...L..--
C5C5Y3_BEUC1/41-144..PG......--------------E.TFFGAPYS.....V.....K----------FV.........E.W.G...Y..--
C0Z8W5_BREBN/15-114..QP......--------------A.PV.....V.....E.....G----------TL.........V.L.G...Y..--
B9JK89_AGRRK/29-136..KP......--------------I.EY.....L.....GS...LG----------MD.........S.V.T..VL..--
B1MHX9_MYCA9/33-130..GA......--------------Q.FS.....R.....S.....A----------TE.........A.L.G...F..--
A5V4G4_SPHWW/11-106..GP......--------------A.GI.....R.....A.....A----------YA.........R.W.G...Y..--
A4YMD8_BRASO/6-106..PL......--------------P.VV.....T.....Q.....T----------MD.........Q.I.G...YGS--
B7VRG5_VIBSL/12-116..AW......--------------Q.KK.....V.....FEIQLGF----------FK.........S.Y.G...L..--
C3AVH4_BACMY/21-123..QY......--------------G.GN.....V.....E.....L----------VT.........N.L.G...Y..--
Q73Z31_MYCPA/32-131..PA......--------------R.FV.....L.....A.....N----------SA.........E.V.G...V..--
Q81NN7_BACAN/4-103..RI......--------------S.FQ.....V.....E.....H----------WR.........Q.Y.Q...Y..--
Q81U50_BACAN/7-106..GA......--------------K.MQ.....V.....E.....A----------FA.........H.L.G...L..--
Q8F0G1_LEPIN/13-113..RG......--------------P.EV.....V.....A.....G----------IT.........K.L.G...Y..--

PF07291

MAUE_METEA/3-186---------------------------------------R----------------HGEEFFGVVRNFRL-----M----
MAUE_METFK/2-184---------------------------------------R----------------HPDEFQGVVANYKL-----L----
A1BB98_PARDP/3-185---------------------------------------R----------------HVEEFYGVVRNFRL-----L----

PF04224

Q9CJR3_PASMU/1-137EFEV-----------------------------------E-----A----------LKPIISAS.WLSFLYD---LF...
O25289_HELPY/5-190PYEA-----------------------------------E-----G----------IAPFVANSPFFSFMYK---FEK.P
RCLC_ECOLI/2-182PYEA-----------------------------------D-----S----------ITPFVANSPLMSFFYE---HPEDY
Q9KRP9_VIBCH/1-146PTEA-----------------------------------K-----L----------IEPLVLNHPLMGWIYQ---FLS..
Y219_HAEIN/13-209QYEA-----------------------------------D-----G----------IAHFVSNSPFFSYMYE---..KGP

PF05514

O23298_ARATH/1-138F..GEDGGRS--------------AKSLKPKFNA----------------------FVNHVTTHT....GQQ---L----
Q9LTD0_ARATH/18-201L..KANWNGT--------------EDYWSPKFGY----------------------SGD.............---.----
Q0IXE1_ORYSJ/1-138F..GVDGGPA--------------AKALQPKFNT----------------------IVANISTRT....GLV---V----
O22690_ARATH/1-138F..GTDGGPA--------------AKELAPKLDL----------------------TKAHLSSIL....GVS---L----
I1PJ49_ORYGL/1-138F..GTDGGPA--------------AKALKPKFNL----------------------FMQQVSKSL....GMA---V----
Q8GYI3_ARATH/20-151HYGGGAGGPL--------------EKTMGPAVNM----------------------LSKYGSKALTFYFGMQ---V----
Q8H080_ORYSJ/1-138F..GADGGPA--------------AKALRPKYNV----------------------FTKNISAHL....GVA---V----

PF02077

SURF4_CAEEL/11-277QWDDQKQFMQ--------------ESWSCGWFIATLFVIYNFFGQFIPVLMIMLRKKVLVACGILASIVILQTIAY----
YFC7_CAEEL/4-269NTHDHVNHFS--------------YNWGLNYHFSLFLTIVMIINLLFGSLFVMMRYKVTESSAVLGFTIFAQVILY----
ERV29_YEAST/48-310QWSDQIFYLN--------------KWKHYPYFFVVVFLVVVTVSMLIGASLLVLRKQTNYATGVLCACVISQALVY----
SURF4_SCHPO/33-302QWPEQVSYMR--------------DYRRFRFGTAPLLLFVCVVLMLVGSTLVVFKKRQAYAIGSLLFVTLLQAFAY----
SURF4_DROME/5-270QWNEQREYMD--------------MSWGCGKFLATVFVLVNLLGQLGGCGMVMARFKVDIAVGLLFFIVVLQTVAY----
SURF4_HUMAN/4-269QWSEQRDYID--------------TTWNCGYLLASSFVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAY----

PF13781

C3AK78_BACMY/185-286---------------------------------------Q----------------MLSVL.IGSNEN------------
D3E5H6_GEOS4/180-281---------------------------------------D----------------LLRQS.GLAAGR------------
Q65IN6_BACLD/178-279---------------------------------------S----------------MLSAF.TGGRFH------------
C6CYU2_PAESJ/180-281---------------------------------------G----------------IMQSM.HMFPGI------------
Q8ESB3_OCEIH/179-280---------------------------------------D----------------LVQSI.GWFQGY------------
A1BFB6_CHLPD/25-125---------------------------------------D----------------LLGHV.IPVYQW------------
B4SAW4_PELPB/19-119---------------------------------------D----------------LLGHL.IPVYQW------------
B3EQZ0_CHLPB/20-120---------------------------------------Q----------------LLEYV.IRNNEL------------
B4S7F5_PROA2/21-121---------------------------------------E----------------LIGHV.IKVYEI------------
Q3ARZ2_CHLCH/17-117---------------------------------------E----------------LLGHI.IPIYKW------------
B3QTS0_CHLT3/26-127---------------------------------------R----------------LLQAG.GIDFAT------------
Q1H1D1_METFK/335-436---------------------------------------A----------------LLAEV.GLEGTA------------
C7R8T5_KANKD/19-119---------------------------------------E----------------LLINF.GFNDSI------------
Q2SM61_HAHCH/17-117---------------------------------------A----------------MIEAQ.GLG.QY------------
Q3SHK0_THIDA/314-415---------------------------------------E----------------LLRRV.GVPAAL------------
Q2Y734_NITMU/330-431---------------------------------------V----------------LLARV.GITGGL------------
Q5NY22_AROAE/320-421---------------------------------------A----------------LLARA.GVPEAL------------
A1K6I8_AZOSB/336-437---------------------------------------E----------------LLARA.GVPEGL------------
Q1LGK6_RALME/315-415---------------------------------------A----------------LLGAV.GLHGTP------------
C1F939_ACIC5/18-120---------------------------------------A----------------MMIELPGCTAER------------
Q7NW81_CHRVO/13-112---------------------------------------A----------------MLARL.GLPQAA------------
Q11TY1_CYTH3/19-119---------------------------------------Q----------------IVAR..ILGNEH------------
C7PI03_CHIPD/14-115---------------------------------------A----------------IVAR..ILGAQY------------
A1VMB6_POLNA/12-112---------------------------------------Q----------------LLHAA.GLSQPL------------
Q0ANG5_MARMM/322-422---------------------------------------S----------------VLAAG.GFSEAA------------
A9C3F1_DELAS/21-121---------------------------------------Q----------------VLADA.GIHDAR------------
Q4K472_PSEF5/309-409---------------------------------------R----------------IMAEA.GVQGIW------------
Q89WY4_BRADU/329-429---------------------------------------G----------------ILSAH.NFAPAL------------
Q2K6I2_RHIEC/316-414---------------------------------------H----------------FLP...FMPEAA------------
A1TNI5_ACIAC/22-122---------------------------------------D----------------LLVAA.GMQNTL------------
B9JGJ5_AGRRK/322-420---------------------------------------H----------------FLP...FMSSGM------------
A5V930_SPHWW/323-422---------------------------------------G----------------LLRAG.GLDDRL------------
Q2JZG1_RHIEC/327-426---------------------------------------E----------------LMMG..GGASSL------------
Q11CJ7_CHESB/321-420---------------------------------------E----------------LMLRT.GAGPL.------------
A7IKV9_XANP2/322-421---------------------------------------F----------------LQEA..G.TGPL------------
Q2S702_HAHCH/327-427---------------------------------------.----------------VLKAI.SLPETL------------
C2WZH4_BACCE/180-281---------------------------------------K----------------MLSLL.IGSNES------------
G8PNG3_PSEUV/327-425---------------------------------------.----------------LLER..GFLPTF------------
Q5ZVY7_LEGPH/322-422---------------------------------------T----------------LFAQI.GFSSLW------------
Q9A4D7_CAUCR/322-420---------------------------------------T----------------LTTA..GVGREL------------
Q9I6F8_PSEAE/307-408---------------------------------------R----------------ILGEA.GIHGWP------------

PF06762

K1QJR5_CRAGI/165-541RWLIFRIMIG.....AGLIKIR..GDQCWR..DLTCMNYH----------------YETQPVPNPISYFMHQ---S----
LMF2_XENTR/122-588RWLLFRLMFA.....SGIVKLTS.RCPTWW..GLTALTYH----------------YETQCIPNPAAWFAHQ---L----
E4N190_KITSK/121-477RWLLFRVEFG.....AGLIKWR..GDTCWR..ALTCLYHH----------------HETQPMPGPLSWFFHH---L----
F2UH93_SALR5/134-601RWLFFRLMFL.....SGIVKLTS.QCPTWW..GLTAMDVH----------------YESQCIPTPLAWFAHQ---L----
I3KCS2_ORENI/122-585RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPLAWFAHQ---L----
F1P0J3_CHICK/7-472RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPAAWYAHQ---L----
E1GDX1_LOALO/74-452RWLLFRLIYA.....SGVVKLTS.HCPLWW..DLAALDVH----------------FESQCVPTWISYYVHM---V----
E2B8W4_HARSA/122-575RWLLFRLMFS.....SGVVKLTS.GCPMWW..KLDALNVH----------------FESQCIPTPLAWYAHH---L----
F0Y0J4_AURAN/130-628RALWVKFMVM.....SGVVKVTA.NCPTWK..RLTALEFH----------------FASTCLPTAEAWYFHS---L----
Q08T93_STIAD/249-609RLLLFRLYLG.....SGLSKLQS.GDRTWR..ELTACQHY----------------YETAPLPTRGGWYAHH---L----
K7J1M5_NASVI/123-578RWLLFRLMFS.....SGVVKLTS.GCPLWW..NLDALNVH----------------FESQCIPTPLAWYAHH---L----
E5SED2_TRISP/131-543RWLAFRLMFQ.....SGISKLLN.QDKTWW..SLTALHYH----------------FASQCLPTYLAWYAHQ---A----
A1TEH0_MYCVP/123-475RWLLFRVEFG.....AGLIKMR..GDPCWR..DLSCLDYH----------------HETQPMPGPLSWFFHH---L----
F8L1K9_PARAV/119-467NCLLFRFHFQ.....AGAVKLLS.KDPAWT..NLTAIAHH----------------YQSQPLPNTIAWYAHK---L----
F5YS29_MYCSD/125-477RWLLFRLEFG.....AGLIKLR..GDSCWR..DLTCLYYH----------------HETQPMPGPLSWFFHQ---L----
G3UCY5_LOXAF/167-547RWLIFRIMLG.....AGLIKIR..GDQCWW..DLTCMDYH----------------YETQPVPNPAAYYLHR---T----
Q4N0L2_THEPA/112-755RLLSYRVVLL.....SGLYKIFL.........KLN.FQHI----------------LTSIPLPTFFAHFLTR---A----
H9GJK7_ANOCA/78-542RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPAAWFFHQ---L----
G3VQT8_SARHA/6-467RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCLPTPAAWFAHH---L----
A0QT94_MYCS2/77-429RWLLFRVEFG.....AGMIKMR..GDRCWR..DLTCLYYH----------------HETQPMPGPLSWFFHH---L----
B3DXT0_METI4/128-489HWLLFKLMFL.....SGLVKLES.HDPTWR..ALTALKYH----------------YETEPLPTPPAWYFYH---L----
H9GAZ9_ANOCA/164-545RWLIFRIMLG.....AGLIKIR..GDRCWR..ALTCMNYH----------------YETQPVPNPIAYYMHR---S----
T1KS50_TETUR/132-583KWLLFRLMFS.....SGIVKLTS.KCPTWW..GLTALNYH----------------FESQCLPTPFSWYAHH---L----
M3ZPC1_XIPMA/122-585RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPLAWFAHQ---L----
Q234A3_TETTS/140-610KWLCFRLNYA.....SGVVKLTS.QCPTWW..QLTALHYH----------------FESQPLPNPISYYFHQ---L----
W5KQN4_ASTMX/197-654RWLLFRLVFS.....TGVSKLAS.GDPSWW..DLTALSRH----------------FETQASPTPLAWYAHQ---L----
G1QIY9_NOMLE/23-406RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCLPTPAAWFAHH---L----
F4WBZ8_ACREC/123-579RWLLFRLLFS.....SGVVKLTA.GCPVWW..KLDALNIH----------------FESQCIPTALAWYAHH---L----
F1Q4Q4_DANRE/125-588RWLFFRLTFS.....TGVSKLAT.GDPAWY..DLSALSHH----------------LEDQMSPTLLAWYVHQ---L----
W5KBQ4_ASTMX/194-574RWLIVRIMLG.....AGLIKIR..GDRCWR..DLTCMDYH----------------YETQPVPNPISYYLHH---S----
G0MSI2_CAEBE/122-480VLVFLRAIFM.....NGVTKLQS.KCPAYW..SLTALDYY----------------FESQPLPTVFAWHAHQ---L----
U6IKR5_HYMMI/134-572KWLLFREAIS.....SGFAALSD.SNLPWH..DLSAMNNF----------------FLPRISPTPASWFLTN---Q----
Q1IR35_KORVE/151-523QWEWLRIYFE.....SGIVKLAS.GDVQWR..NFTAMDEY----------------YQNGPLPTWIGWYIQH---L----
Z4YJR1_MOUSE/170-551RWLIFRIMLG.....AGLIKVR..GDKCWL..DLTCMDFH----------------YETQPVPNPIAYYLHR---S----
M4AS74_XIPMA/175-556RWLIVRIMLG.....AGLIKIR..GDQCWR..DLTCMDYH----------------YETQPVPNPVSYYLHR---S----
A8XC70_CAEBR/122-552VVLIVRVTFM.....TGATKLLS.KCPEWW..SLNALDYH----------------FESQPMPTPLSFYAHH---F----
C5BX37_BEUC1/125-479RWLVFRVEFG.....AGLIKMR..GDPAWR..DLTALYYH----------------HETQPMPGPLSWHAHH---A----
V4Z567_TOXGO/197-765RWLLFRLMLG.....AGLIKLR..NDNLWT..DLTALDYH----------------YETMPIPNPFSWYMHN---Q----
G2NZI2_STRVO/121-473RWLLFRVEFG.....AGLIKIR..GDRCWR..DLTCLYYH----------------HETQPMPGPLSWFFHH---L----
H6RBI8_NOCCG/121-470RWVLVRLEVG.....AGLIKIR..NDPAWR..NLTALYYH----------------HQTQPLPSRFSWYFHH---L----
H8MNZ0_CORCM/241-604RMLVFRLYFG.....SGISKFHS.GDRTWR..ELSACDVY----------------FETAPLPTRGGWTAHQ---L----
E9GA51_DAPPU/120-571KWLLFRLMFA.....SGVVKLTS.KCPTWW..GLSALPLH----------------FESQCIPTPFAWYLYE---L----
J9JZT7_ACYPI/128-582RWLLFRVAFS.....AGVAKMSS.KSSIWY..DLTAFSKY----------------FESMPLPNAISWYAHY---S----
N0BDW0_9RHIZ/243-594RWLIFRYLFM.....SGIVKAVS.AQPTWH..DLTALKYY----------------FMSQPLPTPLAWYAAQ---L----
D7EJW8_TRICA/90-537RWLLFRFLLT.....CGLLKFIS.GCPKWW..TLSAFNYY----------------FETLPLPTPLSWYFHQ---I----
LMF2_BOVIN/122-590RWLLFRLMFA.....SGVVKLTS.RCPAWW..GLTALTYH----------------YETQCLPTPAAWFAHH---L----
R4VWD1_9EURY/128-492KWVCFRNMFG.....AGLIKLR..GDECWR..DLTAMDYH----------------YETQPIPNPVSWFAHH---L----
G8TN66_NIAKG/129-490RWLICRLMLG.....AGLIKLR..GDVVWR..NSTALYYH----------------FETQPIPGPLSRWFHF---L----
E9JDB8_SOLIN/123-577RWLLFRLMFA.....SGVVKLTS.NCPIWW..KLDALNIH----------------FESQCIPTPLAWYAHH---L----
W5QF34_SHEEP/126-543RWLLFRLMFA.....SGVVKLTS.RCPAWW..GLTALTYH----------------YETQCLPTPAAWFAHR---L----
E9T639_COREQ/121-473RWLLFRLEFG.....AGLIKIR..GDPCWR..DLTCLNYH----------------HETQPMPGPLSWYFHH---L----
Q1CX59_MYXXD/289-654RLLVFRLYFG.....SGLSKLQS.GDRTWR..ELSACEHY----------------YETAPLPTRGGWYAHH---L----
W5TQD8_9NOCA/121-473RWLLFRVEFG.....AGLVKMR..GDPCWR..DLTCLYYH----------------HETQPMPGPLSRTFHR---L----
B9M9C6_GEODF/118-468RWVLFRVMFG.....AGLIKMR..GDPCWR..DLSCLDYH----------------FETQPMPNPVSRFFHL---L----
Q6MNI0_BDEBA/151-506IFLLFKLMFL.....SGVVKLTH.KDGSWK..DLTALTYH----------------YWTQPLPTPLAYFAHK---M----
J9KB65_ACYPI/128-591RWLLFRVAFS.....AGVAKMSS.KSSIWY..DLTALSKY----------------FESMPLPNAISWYAHY---F----
A8Q0Q7_BRUMA/122-570RWLLFRLMYA.....SGVVKLTS.RCPLWW..NLAALDVH----------------FECQCVPTWISYYVHM---A----
Q16NM9_AEDAE/95-538KWLLFRFVFA.....SGSVKLAS.GCPLWW..DLTALKRH----------------FETMPLPTSYSWYTYQ---Q----
H3FMM6_PRIPA/124-598RFLAARLMFS.....SGIVKLQS.MCPTWW..GLTALDIH----------------YETQCLPTPLAWFAHN---Q----
G4VFY8_SCHMA/126-567RWLLFRLMFS.....SGVVKLTS.DCPTWW..GLKALHWH----------------YQSQCIPTPVAWYAHH---L----
B3DK37_DANRE/122-584RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPLAWFAHQ---L----
B2HN18_MYCMM/121-472RWLLFRVEFG.....AGLIKMR..GDACWR..NLTCLYYH----------------HETQPMPGPLSWFFHR---M----
D0NCT8_PHYIT/130-640RFLFFKFMLM.....SGAVKIQS.RCPTWL..ELTALDFH----------------FATQPLPLPLSWYALQ---A----
H3B2B1_LATCH/185-566RWLIFRIMLG.....AGLIKIR..GDHCWR..DLTCMDYH----------------YETQPIPNPLAYYMHR---S----
F6FUF5_ISOV2/129-486RWLLFRLELG.....AGLIKWR..GGREWR..DLTALDYH----------------HETQPMPGPFSWHAHH---L----
B8C9U9_THAPS/126-526RWYLFKIMMG.....AGLIKVKS.SDPKWKPGNMSAMCFF----------------YETQPVPNPFTRYFHF---M----
H2ULX4_TAKRU/122-510RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPLAWFAHQ---L----
B0WW43_CULQU/88-531KWLLFRYVFA.....SGSVKLAS.GCPMWW..DLTGLKKH----------------FETMPLPTSYSWYTFQ---Q----
U6I483_ECHMU/120-559KWLLFREAVS.....TGFARLAN.DNYFWW..DLSAMEHY----------------FSTQISPTPAAYYLSL---A----
W5K8X7_ASTMX/123-584RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTAVTYH----------------YETQCIPTPLAWFAHQ---L----
T1G9T0_HELRO/127-575RWLTFRLMFS.....SGVVKLNS.QCPTWW..GLTAMTYH----------------YESQCIPTPLAWYAHQ---F----
Q45WA6_TOXGO/205-775RWLVFRVMLG.....SGLIKLR..TDRAWK..DLTALDYH----------------YETQPLPNPLSWYFQN---Q----
B7FQF3_PHATC/171-536RWMLFRIMLG.....AGLIKLRS.GDAKWK..DLTAMNYF----------------YETQPVPNPLSRHFHR---M----
A1R4Z7_ARTAT/124-478VWLVFRLEFG.....AGMIKIR..GGREWR..DMTAMFYH----------------HETQPMPGPLSRQAHL---L----
H2ULX3_TAKRU/164-554RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPLAWFAHQ---L----
E0W2V6_PEDHC/123-573KWLLFRFMFS.....SGIVKLQS.NCPTWW..GLTALNVH----------------FESQPLPHFVSWYMHH---T----
LMF2_RAT/122-589RWLLFRLMFA.....SGVVKLTS.RCPAWW..GLTALTYH----------------YETQCLPTPAAWFAHH---L----
G7Q042_MACFA/113-483RGVWKSVPLP.....AGLIKIR..GDRCWR..DLTCMDFH----------------YETQPVPNPVAYYLHH---S----
A0C620_PARTE/119-569RWLAFRLYFS.....SGLVKLLS.QCDTWW..NLTALHHH----------------FASQCIPHFLSWWAHQ---L----
Q73TN3_MYCPA/121-476RLLLFRVEFG.....AGLIKMR..GDPCWR..DLTCLYYH----------------HETQPMPGPLSWFFHH---L----
G3PHM6_GASAC/9-458RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTQLAWYAHQ---L----
L0J1F6_MYCSM/123-475IWLVFRVEFG.....AGLIKLR..GDPCWR..DLTCLYYH----------------HETQPMPGPLSWFFHH---L----
W5NJI5_LEPOC/122-585RWLLFRLMFA.....SGVVKLTS.RCPTWW..GLTALTYH----------------YETQCIPTPLAWYAHQ---F----
T1HC95_RHOPR/92-555RWLLFRLMFS.....NAVVKLTS.GCPTWW..SLTALNVH----------------FESMVIPTPIAWYFHH---L----
W5JUK3_ANODA/140-616KWLVFRFMFA.....SGSVKLAS.GCPLWW..SLDGLRRH----------------YETMPLPTSYSWYTYQ---L----
T1G1C1_HELRO/128-506RWLIFRIMLG.....AGLIKLR..GDRCWW..DLTCMNYH----------------YETQPVPNPISYYMHQ---E----
D2RQ81_HALTV/123-476QWVLFRNMFG.....AGLIKLR..GDDCWR..DLSCMDYH----------------YETQPIPNPLSWFAHH---L----
E3LDC7_CAERE/122-552VALLVRVIFM.....NGASKLLS.KCPAWW..NLTALDYH----------------FESQPLPTPFSWYAHH---F----
E2AAK1_CAMFO/89-546RWLLFRLMFA.....SGVVKLTS.DCPLWW..KLDALNVH----------------FESQCIPTPLAWYVHH---L----
D7FTX6_ECTSI/148-515KWLAFRIMFGAFERRAGLIKIR..GDKVWK..DLTAMDYH----------------YETQPLPNPISYFLHQ---A----
Q7PZH8_ANOGA/94-545KWLVFRFMFA.....SGSVKLAS.GCPLWW..SLDGLKRH----------------YETMPLPTSYSWYTYQ---L----
F0VNS7_NEOCL/190-761RWLLFRVILG.....SGLIKLR..NDAAWK..NLTALDYH----------------FETQPLPNPLSWYFQN---Q----
F4Q4V3_DICFS/211-592KWLVFRLIFG.....SGIIKLT....PIWS..SFKAMSFH----------------YETQCIPNIISYYVHQ---F----
U1NTR0_ASCSU/122-570RWLVFRLMYA.....SGVVKLTS.QCPAWW..SLTALNIH----------------FESQCLPTWVAYYAHH---S----
C3Z738_BRAFL/141-522RWLIFRIMLG.....AGLIKIR..GDQCWR..DLTCMNYH----------------YQTQPVPNPISYYLHQ---T----
A7RJW9_NEMVE/81-462RWLIFRIMLG.....AGLIKIR..GDQCWR..DLTCMNYH----------------YETQPVPNPISYYMHH---S----
A0JUS2_ARTS2/124-486VWLLFRLEFG.....AGMIKIR..GGSEWR..DLTALYYH----------------HETQPMPGPLSRQAHL---L----
G1NWH4_MYOLU/169-550RWLIFRIMLG.....AGLIKIR..GDQCWR..DLTCMDFH----------------YETQPVPNPMAYFLHR---S----
F8JRN7_STREN/121-473RWLLFRVEFG.....AGLIKMR..GDRCWR..DLTCLYYH----------------HETQPMPGPLSWFFHH---L----
D8J6J5_HALJB/125-476QWVLFRNMFG.....AGLIKLR..GDECWR..DLTCMEYH----------------YETQPIPNPVSWFAHH---R----
Q21435_CAEEL/1-432VSLLLRVVFM.....NGATKLLS.KCPTWW..NLTALNYH----------------FESQPLPTPFAWYAHY---F----
A7AW74_BABBO/157-697YFLLYRGMFC.....AGVDRIRQGEDPTEA..GSDDLKNL----------------MEAIPLSSTITQMVYD---F----

PF04173

Q97X72_SULSO/12-173--------------------AWSPIKGMLESILLNPS-LLY-DFI-IL-F---TAIEAIFGLF-MI-----IG-------
Q97XJ3_SULSO/18-183--------------------A.GPFKDFLLMTLENRT-FDV-TFL-TI-F---SYVEILVGLF-LI-----IG-------
Q973M6_SULTO/9-177--------------------G.PIMRPFLEYVVLPHV-LLV-GEL-VM-I---G..EISFGIL-NL-----LG-------
Q97UC4_SULSO/10-178--------------------G.SIIRQFLYIVAMPHP-VLV-GTL-VM-I---G..EISFGIL-TL-----IG-------
Q8AAF0_BACTN/18-181--------------------S.IGIKPIIEYLVSTPD-LLW-WAM-VI-F---TLVEGIVGLL-YM-----LG-------
F4B442_ACIHW/20-184--------------------A.GPFKGLLLMTLENRS-LDV-TFL-TV-F---SYIEIIAGLF-II-----IG-------

PF07681

Q83CN9_COXBU/12-94--------------------................P-QWL-SIL-SI-I---F--ELGGGIL-VF-----FG-------
Q87K55_VIBPA/16-104--------------------................G-VLM-AFL-AG-S---A--EFFGGLF-IL-----LG-------
Q8KEE1_CHLTE/7-88--------------------................P-VWL-VAG-VP-V---G--EVFAPLL-IV-----LG-------
Q9RTC4_DEIRA/8-92--------------------................P-LLA-APL-VA-T---I--ETVGGVL-LF-----LG-------
Q7TUM8_PROMM/37-127--------------------................P-MLW-TYA-AA-L---T--EIICPIG-IA-----FG-------
Q7VHA8_HELHP/8-89--------------------................P-TLF-AYG-AY-I---G--EVLAPLM-II-----VG-------
Q89FZ6_BRADU/10-92--------------------................P-PEL-AYL-IM-T---V--EVLSGVA-LI-----LG-------
Q8EDN3_SHEON/21-107--------------------................P-TLM-AAL-AA-G---T--EFFGAIL-LL-----LG-------
Q8A9J9_BACTN/19-101--------------------................S-SIS-LGL-AI-F---G--ELVCSMG-FI-----FG-------
Q83BV7_COXBU/131-217--------------------................P-DFL-VRL-AG-L---C--ELGGAIA-IG-----LG-------
Q92W39_RHIME/11-107--------------------GPY.........PFPAP-AAT-AFV-VA-F---A--EVMLPIF-LA-----LG-------
Q8U4Y0_AGRT5/25-105--------------------................A-AAF-AVF-VI-I---F--ELTASAM-VV-----TG-------
Q7V0B0_PROMP/15-102--------------------................P-IFL-SYV-AA-F---S--EIGGSWL-LI-----LG-------
Q984Q4_RHILO/6-88--------------------................P-AFL-LAA-GS-A---L--EIVAGLL-VA-----VG-------
Q9A3E7_CAUCR/28-117--------------------................P-DLA-AHA-AT-Y---S--EHLFSIL-LV-----LG-------
Q983U6_RHILO/19-101--------------------................P-TVT-AVV-VG-L---I--ELLGGLA-IL-----VG-------
Q82HN4_STRAW/24-126--------------------RDSSAIPALVDLALKNP-VGF-GYA-IA-L---G--ELAVGIG-TL-----IG-------
Q7VUY8_BORPE/24-126--------------------................P-ELA-ALL-AA-S---V--EHILPVL-LI-----LG-------
Q831Y6_ENTFA/7-87--------------------................P-SLF-VYG-VA-A---I--ELIGGLF-MI-----IG-------
Q983U8_RHILO/8-90--------------------................P-TLA-AWG-TG-L---F--ELIAGLL-IL-----IG-------
Q7V328_PROMP/44-134--------------------................P-VLW-TYG-AA-I---T--QLVCPLG-LA-----LG-------
Q7MRA2_WOLSU/17-98--------------------................P-EFM-AYG-TY-I---G--EIFSPAL-LI-----LG-------
Q8F8N5_LEPIN/13-98--------------------................P-API-AFL-VI-I---G--ESLGALG-LI-----FG-------
Q9HYW2_PSEAE/22-108--------------------................P-ELL-AWL-AA-L---S--EAGGAVL-LL-----CG-------
Q88P63_PSEPK/6-95--------------------................P-WLA-AHL-AA-Y---A--EHLFPLL-LV-----LG-------
Q9HWH6_PSEAE/14-96--------------------................A-WLF-NIA-TA-V---T--LLAGSAL-VL-----LD-------
Q8FR06_COREF/10-94--------------------................P-TLS-VWI-AA-V---A--ELLGGAF-LV-----VG-------
Q9KYL5_STRCO/4-96--------------------................T-EQL-VRL-NG-A---V--HVVGGIM-LG-----LG-------
Q8NR01_CORGL/191-281--------------------GY............QWP-EIL-AIL-LP-S---I--ELAAGVF-LL-----LG-------
Q8XR31_RALSO/30-119--------------------................P-ALA-AAL-GT-F---G--ELVFPSL-ML-----IG-------
Q92SD1_RHIME/6-88--------------------................A-TAL-AYL-AG-L---F--ELVAGLA-IL-----VG-------
Q7NPD1_GLOVI/22-104--------------------................P-VFF-AWS-AG-L---A--ELVGGIL-LA-----VG-------
Q7NZE1_CHRVO/10-92--------------------................P-GFV-GYF-AI-L---I--EIGGGLL-LL-----AG-------
Q7VDS1_PROMA/43-133--------------------................P-IIW-TFA-AG-L---T--QIICPIG-LA-----LG-------
Q7N096_PHOLL/8-89--------------------................P-SFL-LPL-TI-L---L--ELGGGLA-VL-----FG-------
Q8XWH4_RALSO/12-94--------------------................P-MLA-AIV-AV-I---M--EFGVGIA-LL-----IG-------
Q7VYL1_BORPE/8-89--------------------................P-GFL-AYF-AY-V---G--EIVGPLL-II-----LG-------
Q7US51_RHOBA/24-106--------------------................H-QLS-LVC-AI-A---T--EVGCSIL-LI-----LG-------
Q88G88_PSEPK/13-95--------------------................P-MLA-AGI-AV-I---M--EFLVAIL-LI-----LG-------
Q812S4_BACCR/6-87--------------------................P-GGL-AYG-VA-T---F--ELVGGLL-LI-----LG-------
Q88KH7_PSEPK/17-105--------------------................G-YLM-ALL-SG-S---A--EFFGGLA-LV-----VG-------
Q98JU3_RHILO/13-95--------------------................P-LFL-AWC-AA-I---L--EVALVLC-FL-----SG-------
Q89MP6_BRADU/4-104--------------------................P-QLL-AIA-VG-A---L--EIIAGLM-IA-----LN-------
CATD_BACSU/8-88--------------------................P-SFM-AYV-IA-A---I--ELIGGVL-VF-----FG-------
Q7VTR5_BORPE/10-91--------------------................A-GWL-AYP-VT-Y---F--EIVGGVL-LI-----LG-------
Q7UE97_RHOBA/16-98--------------------................H-QLS-LLC-AI-G---A--EVGCSVL-LI-----LG-------
Q7NA66_PHOLL/20-124--------------------................P-DVA-AVM-AA-T---A--EHLFPLL-LI-----VG-------
Q7VBT6_PROMA/9-93--------------------T..............QA-NIL-LVA-AI-F---L--LISGSLA-LV-----FG-------
Q8FSC2_COREF/11-95--------------------................A-GVV-APL-VG-A---I--ELIGGIM-IL-----LG-------
Q98K48_RHILO/27-109--------------------................A-RLA-LWA-GI-V---L--QMIAGVL-VM-----AG-------
Q7NSB1_CHRVO/12-100--------------------................P-AVA-AVM-AT-C---G--ELGLSAL-LA-----LG-------
Q9HZY2_PSEAE/16-104--------------------................G-YLL-ATL-AG-S---A--EFFGGLA-LV-----IG-------
Q88K91_PSEPK/19-105--------------------................A-ELN-WQL-SM-W---A--ELVLPLL-LL-----LG-------
Q8EZJ9_LEPIN/12-95--------------------...............AS-TLL-AHY-IV-I---A--HICGGVL-LL-----SG-------
Q8Y2U2_RALSO/28-111--------------------................A-APT-LLL-AI-L---S--ETVCPLL-IA-----LG-------
Q9CP47_PASMU/16-102--------------------................S-DLN-WTL-AM-G---A--ELLLPFF-LI-----LG-------
Q9HWS4_PSEAE/24-110--------------------................A-AFN-WEL-SL-W---A--ELLGALF-LL-----LG-------
Q82PS9_STRAW/30-117--------------------................G-DFF-AGL-AG-A---S--EFLGGLG-LA-----VG-------
MHQP_BACSU/5-93--------------------................G-NVA-AAL-SG-L---G--ELVSGIL-FI-----LG-------
Q883U2_PSESM/16-104--------------------................G-YLM-ALM-SG-S---A--EFFGGVG-LL-----LG-------
Q92TK3_RHIME/11-93--------------------................P-PVA-YAV-AL-A---V--EIGAGIL-LV-----LG-------
Q7V7V3_PROMM/10-94--------------------S..............LA-PFL-LLA-AI-A---C--LIVGSVL-LL-----FG-------
A9CK19_AGRT5/23-105--------------------................A-TAL-AYL-AG-L---F--ELVAGLA-IL-----AG-------
Q7U687_SYNPX/15-102--------------------................P-ILL-SYV-AA-F---S--EVIGSWL-LI-----TG-------
Q89EW4_BRADU/19-101--------------------................G-WLW-ATA-AI-V---V--ELGGSLL-VV-----VN-------
Y1602_HAEIN/14-100--------------------................A-DIN-WHV-AM-G---S--ELIFPFL-LI-----FG-------
Q98JF9_RHILO/23-103--------------------................G-LPL-FVA-TI-A---L--QLGAGLS-VA-----SG-------
Q8YSN3_NOSS1/6-88--------------------................V-GVL-LIF-TI-A---F--QILGGLS-II-----LG-------
Q92Y87_RHIME/25-105--------------------................A-PLF-AVG-VI-V---F--ELAMSAL-IL-----LG-------
YQJF_ECOLI/8-88--------------------................P-GFM-LPL-VI-L---L--EFGGGLA-IL-----FG-------
Q812I5_BACCR/5-93--------------------................G-VFM-AFM-AG-A---T--ELLGGFL-FA-----SG-------
Q8NT59_CORGL/10-94--------------------................A-GIA-AIA-AA-V---V--ELLGGIL-II-----LG-------
Q87KG0_VIBPA/27-115--------------------................W-EFA-AYS-GT-F---A--ELVLPVF-LA-----LG-------
Q8P8R3_XANCP/15-111--------------------................T-APL-PLL-LA-L---V--QSLSGVA-VL-----IG-------
Q89SK7_BRADU/66-148--------------------................P-ELF-TMT-NI-A---L--EVLISVG-LI-----LG-------
Q82AZ6_STRAW/10-97--------------------................G-KAS-ATA-AG-L---A--EAGGGTL-LA-----LG-------
Q82V34_NITEU/11-94--------------------................P-QIL-AYG-VY-L---G--EVIAPLM-II-----LG-------
Q82UE4_NITEU/22-102--------------------................P-GTL-LPL-VI-A---L--EIGGGLA-II-----AG-------
I0IQM6_LEPFC/14-98--------------------................P-APL-AFL-VI-I---G--ESLGSVA-LL-----LG-------
I6XG31_MYCTU/17-94--------------------................G-SWP-GWY-AG-V---I--ELVAGLL-IA-----TG-------
I6YAV3_MYCTU/114-195--------------------................A-EIL-AYV-SA-G---G--EIVAGVL-LV-----LG-------
YPHA_ECOLI/16-98--------------------................P-MLA-AII-AV-V---M--EVPAAIL-IV-----LG-------
Q2FZM5_STAA8/5-82--------------------................P-PTI-AVL-MS-I---G--EVVGGLA-LI-----IG-------
Q2YIJ7_BRUA2/13-93--------------------................P-IVT-AVV-VG-L---I--EFVGGLA-IL-----FG-------
Q7AJS4_BACHD/8-89--------------------................P-GFL-AYV-VA-I---V--ELVGGLA-VL-----LG-------
Q7MGN3_VIBVY/23-104--------------------................W-ELA-AYL-AT-A---A--ELSLPIL-LA-----LG-------
Q8F8V4_LEPIN/14-97--------------------................P-ATL-SIL-AI-M---S--EFFGSIA-IL-----LG-------
Q9CCC8_MYCLE/7-92--------------------................G-TFH-ATV-AA-T---T--EISAGLG-LA-----AG-------

PF13564

D1AAS7_THECD/7-112------------------------------------P.SGM.VKF.IG-V---A--ELAAALG-LI.....LP..--AAT
D2SF07_GEOOG/7-113------------------------------------S.DGA.VKG.IG-A---L--EVLGAAG-LI.....LPAA--LDI
C5BX04_BEUC1/7-113------------------------------------S.KGQ.IRL.IG-A---A--EVLGAVG-LV.....LPPA--LGT
D3Q9W4_STANL/7-109------------------------------------P.ASW.VVP.LG-V---L--KAAGALG-LL.....LG..--LLG
D1BDS4_SANKS/7-113------------------------------------P.QGA.VRL.IG-L---V--EVLGALG-LV.....LPAL--LDV
D1BYA3_XYLCX/7-112------------------------------------P.GVV.VRF.IG-L---C--EIAGALG-LI.....LP..--QAT
B5HYY5_9ACTO/7-112------------------------------------P.LPV.VRA.LG-T---V--EILGATG-LI.....LP.P--LTG
D1BVK9_XYLCX/7-113------------------------------------P.MRL.VRT.IG-T---L--ELLGAIG-LV.....LPPL--IGI
A9B5S7_HERA2/7-113------------------------------------T.PNT.IKL.IG-G---V--EVLGALG-LI.....LP..--WLT
D3Q6B3_STANL/7-112------------------------------------S.PAT.VRF.IG-A---V--ELLAAVG-LI.....GP..--AVT
C5C629_BEUC1/7-115------------------------------------S.ASF.VKV.LG-A---L--EIAGGVG-LV.....LPAA--LGV
D3PWB3_STANL/7-114------------------------------------S.AGF.IKL.LA-V---V--EILGALG-LI.....LP..--AVT
D3EH52_GEOS4/7-112------------------------------------P.KAF.VVF.IG-V---A--ELVGAFG-LI.....LP..--LAM
A4F848_SACEN/7-108------------------------------------P.HSW.IYP.LG-A---V--KTAGALG-LM.....AG..--I.A
A1SIQ7_NOCSJ/7-109------------------------------------P.MRY.IPV.LA-A---L--EVAGAIG-IV.....AG..--L.W
C6WJU0_ACTMD/7-113------------------------------------R.KDAEVKA.VG-A---V--EVLGGLG-LV.....LP..--WAT
B5I6V7_9ACTO/19-120------------------------------------P.RTW.WNL.LG-A---A--KIAGAVG-LL.....AG..--LF.
C6VZE8_DYAFD/11-112------------------------------------P.EYL.LTI.IG-V---W--KILGVVA-VL.....IP..--..G
Q0SGE8_RHOSR/7-112------------------------------------S.GQQ.VRL.IG-V---A--ELAGGVG-VL.....VG..--LYW
D5UX83_TSUPD/7-115------------------------------------G.DGH.LTA.IG-T---I--KVTGALG-LI.....LP.P--LVG
D3PZS4_STANL/7-112------------------------------------P.SGT.VPI.LG-A---L--EMLAAIG-LI.....LPAA--FGI
D3PUC2_STANL/7-110------------------------------------P.ASW.VRFPIG-T---L--KTAGALG-LL.....AG..--L.W
C9Z9S2_STRSW/7-108------------------------------------S.LTL.YRV.IG-A---L--EIAGAAG-LL.....LG..--LAS
A1TE84_MYCVP/11-113------------------------------------A.PRW.IPY.LA-G---L--KLAGAAG-LL.....LG..--FVT
D2AS43_STRRD/5-106------------------------------------P.SSW.WPW.LG-A---A--KAAGAAG-LL.....VG..--LF.
D2PZ45_KRIFD/7-114------------------------------------P.MPL.VRV.VA-G---C--EILGAVG-LV.....VP..--WLT
B1MM14_MYCA9/10-112------------------------------------A.PRW.LPY.LA-V---V--EGAGVVG-LV.....IG..--LAG
Q65HS4_BACLD/5-107------------------------------------P.LWF.LSV.TG-C---L--EIAGALG-MI.....GG..--I.W
Q5YWI3_NOCFA/31-132------------------------------------P.DRA.LYP.LA-A---V--KAIGALG-LL.....AG..--LVV
D3F1P3_CONWI/7-108------------------------------------P.ADR.LDR.LA-V---I--LLAGAAG-LL.....LG..--LAW
C7PZU5_CATAD/19-125------------------------------------A.PGT.IRF.IG-A---A--ELAGAIG-LV.....LPRA--LGV
B5H4W5_STRPR/7-108------------------------------------P.LTW.LPA.LG-A---L--KGAGVLG-LL.....IG..--IGW
Q11P05_CYTH3/10-110------------------------------------P.DYF.RVE.LG-T---A--KLLGALV-LL.....IP..--Q.I
D5UGI3_CELFN/7-114------------------------------------D.AAR.IKL.AG-I---A--EVLGALG-LV.....LP..--LAT
Q89Y33_BRADU/62-168------------------------------------S.ETF.VRI.IG-L---I--DLAGGIG-IL.....LP.A--LTR
C0ZKK1_BREBN/2-104------------------------------------P.LWF.MDV.IA-S---L--ELVGVIG-VI.....SS..--F.W
B1MDG2_MYCA9/7-115------------------------------------S.PHV.VKA.IA-G---S--EVLGAIG-VV.....IP..--YAT
Q7UL85_RHOBA/23-124------------------------------------P.SYV.ATI.LG-F---W--KIAGVVA-LL.....LP..--..G
C7PUE7_CHIPD/10-111------------------------------------P.AYF.RIE.LA-I---A--KLIGVVL-LV.....LP..--LVK
D3Q6A9_STANL/7-109------------------------------------S.MRA.CRI.IG-G---L--EIAACLG-LI.....VG..--FFW
Q82R50_STRAW/28-129------------------------------------S.VAA.YRR.IG-V---L--QLAGVAG-VV.....LG..--L.A
D2QST6_SPILD/17-122------------------------------------H.TNL.VKL.TG-V---L--DLLSGIG-LV.....LP.T--LLH
Q5YXM8_NOCFA/33-141------------------------------------R.PGF.VRT.LG-G---V--ELLAAAG-LI.....LPPL--LGI
C7PKH0_CHIPD/17-121------------------------------------H.RGL.VVF.TG-I---L--DFLGALG-LV.....LP.G--ILR
B2JL65_BURP8/47-153------------------------------------P.SWV.VRG.TG-I---F--DLAGALG-LV.....LP..--AVT
D2ASD1_STRRD/34-143------------------------------------P.QSL.IVF.IG-V---C--EVLGGVG-LI.....LP..--AMT
B0UIU5_METS4/14-111------------------------------------P.LWF.MYA.VG-A---A--QLAGAAL-LW.....I...--...
D2PS28_KRIFD/35-136------------------------------------P.DYF.IYI.LG-V---C--HVAAAAA-II.....VP..--..G
C7PYY8_CATAD/7-121------------------------------------P.LPL.LRF.AA-V---C--ELFAAAG-LI.....LPRA--AGI
A9GJR9_SORC5/11-117------------------------------------P.LHF.VTL.LG-I---W--KILGALA-LM.....AP..--..R
B8IER0_METNO/21-116------------------------------------G.QWF.RIV.TG-L---V--EVAGAVA-LL.....VP..--G..
Q1IKM4_KORVE/10-111------------------------------------P.LYF.LTF.LG-A---W--KVLGALA-IL.....AP..--..G
A9FEJ3_SORC5/27-126------------------------------------P.VSS.VRG.IG-V---V--LLASVVT-YM.....IP..--...
Q2S0Z3_SALRD/8-118------------------------------------P.DYF.RIE.LG-I---A--KLLGAVA-LLTPLPRLG..--LSR
Q11S70_CYTH3/11-112------------------------------------N.KTW.TIS.IG-I---L--ELTGVLL-IV.....AG..--I.V
Q5Z2J9_NOCFA/19-120------------------------------------P.LYF.ATI.LG-V---A--KTAALAA-IL.....TP..--..G
C6X539_FLAB3/10-112------------------------------------P.DYL.RVE.LA-V---A--KILGSLA-LM.....LP..--F.V
B5HQQ2_9ACTO/55-152------------------------------------G.SAG.MYT.IG-V---L--ELAGGIA-LL.....IP..--V..
A7H7U7_ANADF/31-130------------------------------------P.ATI.ARG.IG-G---L--ELA....-LI.....AV..--T.L
A5FBV8_FLAJ1/7-111------------------------------------P.EYF.GNA.LV-I---F--KILGVLV-LV.....IP..--S.V
D2QN87_SPILD/19-118------------------------------------P.DYF.RVE.LS-L---G--KILGGIL-LV.....LP..--M.I
A9B014_HERA2/18-116------------------------------------P.AGI.ALS.LG-I---L--LLVCTVL-AI.........--...
Q1D110_MYXXD/7-102------------------------------------P.GSV.LLA.IG-I---T--ELICMV.-...........--LYA
C7PKI9_CHIPD/12-107------------------------------------S.GGV.YSL.LG-I---I--EILSVAL-FL.....Y...--...
A9F3Z6_SORC5/44-143------------------------------------P.ASL.VPT.LG-Y---L--QIACLVT-YL.....IP..--...
D9QMH9_BRESC/33-140------------------------------------S.ESL.VRG.VG-I---V--EIVLALG-MV.....AP..--LVS
Q0SJ69_RHOSR/31-130------------------------------------A.ENL.NRV.IG-V---V--LLVCLI.-.......LY..--I..
Q1IPI6_KORVE/25-123------------------------------------D.PPT.IVR.IG-A---I--LLVCTT.-...........--LYA
A9UV76_MONBE/637-749------------------------------------SGSTF.RQF.LG-V---V--ETAAALL-LW.....VA..--...
B4RA61_PHEZH/23-122------------------------------------P.PGS.GFA.IG-V---M--EA.....-IL.....LG..--LYL
C5C5Y3_BEUC1/41-144------------------------------------P.SWF.RFV.VG-G---G--ELVAAAM-LI.....SP..--R..
C0Z8W5_BREBN/15-114------------------------------------A.QHH.IGV.IG-I---L--ALVSTV.-...........--LYA
B9JK89_AGRRK/29-136------------------------------------P.EWA.VRI.VG-T---V--ELLSASA-LL.....VP.A--MLG
B1MHX9_MYCA9/33-130------------------------------------P.SYQ.TAL.IG-W---V--LLACTI.-.V.....FA..--...
A5V4G4_SPHWW/11-106------------------------------------P.AGF.RFV.TA-L---L--EALSAI.-.L.....IP..--I..
A4YMD8_BRASO/6-106------------------------------------S.DAL.ARA.LG-L---I--TLLCTLL-YA.....LP..--...
B7VRG5_VIBSL/12-116------------------------------------N.RVI.MFL.VG-M---V--EFTGAVL-LL.....CA..--LVG
C3AVH4_BACMY/21-123------------------------------------P.LYI.LTI.LG-I---W--KVLGVIA-LV.....VP..--..G
Q73Z31_MYCPA/32-131------------------------------------P.RSW.LPA.LG-A---A--KLAGAAG-LV.....VG..--LLG
Q81NN7_BACAN/4-103------------------------------------S.LWF.MSI.IG-F---I--EIIGAIG-II.....GG..--I.W
Q81U50_BACAN/7-106------------------------------------P.QWF.RIA.TG-W---I--ALAGVVG-LI.....FG..--F.W
Q8F0G1_LEPIN/13-113------------------------------------P.MYF.ITI.LG-V---W--KLLGAIA-IT.....AP..--..R

PF07291

MAUE_METEA/3-186------------------------------------P-EWLARPFALV-L---PWLELGIAVG-LV-----LP-------
MAUE_METFK/2-184------------------------------------P-SFLVAPVAKL-L---PLVELLCAVA-LM-----IP-------
A1BB98_PARDP/3-185------------------------------------P-DLASRVVALV-L---PVVEAAVAVG-LV-----VT-------

PF04224

Q9CJR3_PASMU/1-137....................................G-VYKTSYL-LG-I---I--ETLAYLG-LI-----IG-------
O25289_HELPY/5-190AYKQHKMSESQSMQEEMQDNPK...IVENKEWHKENR-TYLVAEA-LG-I---T--IMILGIL-VL-----LG-------
RCLC_ECOLI/2-182KQYLTHEGEYK...............PEARAWQTANN-TYGFSNG-LG-V---V--EVIIALL-VL-----AN-------
Q9KRP9_VIBCH/1-146.....................................-IQAVSNL-IG-A---T--EIIVGIG-LL-----IG-------
Y219_HAEIN/13-209NLVPNDKGE.LVMEYTLHKNPEGKMVAKNIEWHKENG-TYTASYI-IG-A---I--IVTVGIL-TL-----AG-------

PF05514

O23298_ARATH/1-138------------------------------------PPVDMKILV-AA-A---IALKGIGGLL-FV--------------
Q9LTD0_ARATH/18-201------------------------------------...QIKHLM-TV-S---IIVRTLGGLI-FI--------------
Q0IXE1_ORYSJ/1-138------------------------------------PHIELKHIV-AA-M---ISLKGLGGLL-FI--------------
O22690_ARATH/1-138------------------------------------PNLEVKQVV-WA-I---VALKGLGGLL-FV--------------
I1PJ49_ORYGL/1-138------------------------------------PHIDIKTVI-AA-T---MFLKGFGGLL-FI--------------
Q8GYI3_ARATH/20-151------------------------------------VAFDVRLIE-FA-L---ISAKATAALW-FI--------------
Q8H080_ORYSJ/1-138------------------------------------PHVELKHIV-AA-T---IGLKGLGGLL-FI--------------

PF02077

SURF4_CAEEL/11-277------------------------------------H-ILWDLKFLAR-N---I--AVGGGLL-LL-----LAET--QEE
YFC7_CAEEL/4-269------------------------------------Q-LYTTYHLLTR-N---I--SIVAAIM-LL-----VAEN--MLR
ERV29_YEAST/48-310------------------------------------G-LFTGSSFVLR-N---F--SVIGGLL-IA-----FSDS--IVQ
SURF4_SCHPO/33-302------------------------------------G-LITSGEMFFR-N---M--SVIGGLC-LV-----ASDT--FIH
SURF4_DROME/5-270------------------------------------S-ILWDFQFLLR-N---F--ALIGALL-LV-----LAEA--RIE
SURF4_HUMAN/4-269------------------------------------S-ILWDLKFLMR-N---L--ALGGGLL-LL-----LAES--RSE

PF13781

C3AK78_BACMY/185-286------------------------------------S-ILA-LKI-IG.F---.L.EIGFGIM-WL-----LP-------
D3E5H6_GEOS4/180-281------------------------------------E-GVV-LTL-LG.I---.T.EIGVGLL-TL-----LF-------
Q65IN6_BACLD/178-279------------------------------------P-ETL-LRL-IG.L---.A.EVMVGVL-WL-----YP-------
C6CYU2_PAESJ/180-281------------------------------------E-LQA-LKW-LG.A---.S.EILLGLL-LL-----LY-------
Q8ESB3_OCEIH/179-280------------------------------------E-SVL-LYL-LG.L---.F.QILFGLT-FL-----LF-------
A1BFB6_CHLPD/25-125------------------------------------A-CMA-VTW-MG.V---.V.EILFGIY-LL-----VA-------
B4SAW4_PELPB/19-119------------------------------------A-CEA-VFW-IG.A---.A.EILFGLF-LL-----VA-------
B3EQZ0_CHLPB/20-120------------------------------------A-CAM-VVW-MG.Y---.G.EIVFGAF-LL-----VT-------
B4S7F5_PROA2/21-121------------------------------------A-CQL-VTS-MG.Y---.G.EIVFGIF-LL-----FT-------
Q3ARZ2_CHLCH/17-117------------------------------------A-CIA-MQW-MG.Y---.G.EILFGVF-LL-----IA-------
B3QTS0_CHLT3/26-127------------------------------------A-KSV-LPI-IG.V---.A.EILIGVL-LL-----LT-------
Q1H1D1_METFK/335-436------------------------------------A-SVA-LYG-AA.L---.L.DIGFGIA-TL-----WL-------
C7R8T5_KANKD/19-119------------------------------------T-LTL-IYS-GA.I---.L.DIGLGLW-IL-----NN-------
Q2SM61_HAHCH/17-117------------------------------------A-PQI-AMA-GG.V---.A.EILLGLL-IA-----LP-------
Q3SHK0_THIDA/314-415------------------------------------G-PLM-LYG-AA.G---.L.DFALGAG-TL-----VL-------
Q2Y734_NITMU/330-431------------------------------------A-PIA-LYG-AA.A---.M.DIAFGFG-TL-----FL-------
Q5NY22_AROAE/320-421------------------------------------R-SAA-LYG-AA.L---.L.DLALGVL-ML-----AG-------
A1K6I8_AZOSB/336-437------------------------------------R-LLA-LYG-AA.A---.L.DLVLGVL-CF-----TS-------
Q1LGK6_RALME/315-415------------------------------------A-IVT-LYA-AV.F---.V.DAAMAVG-CL-----RY-------
C1F939_ACIC5/18-120------------------------------------A-VLL-LRL-LG.L---.V.EMSLALW-VL-----SG-------
Q7NW81_CHRVO/13-112------------------------------------L-APL-FLL-SC.A---.L.DVAYAVW-IV-----.W-------
Q11TY1_CYTH3/19-119------------------------------------A-RVL-TTA-IG.V---.S.EIIMAVW-II-----SG-------
C7PI03_CHIPD/14-115------------------------------------A-GPL-TML-IG.L---.S.EIAMAIW-VV-----RG-------
A1VMB6_POLNA/12-112------------------------------------L-VQA-LIV-SGAA---.A.DLALGLA-LW-----LR-------
Q0ANG5_MARMM/322-422------------------------------------Q-PPV-LWF-GS.L---.F.DIALGLG-ML-----AK-------
A9C3F1_DELAS/21-121------------------------------------W-QTF-LIW-SG.L---LA.DLAVGLA-LW-----LR-------
Q4K472_PSEF5/309-409------------------------------------A-ALA-VIG-GS.L---.C.DALLGVG-LL-----LR-------
Q89WY4_BRADU/329-429------------------------------------V-DPI-TIG-TS.L---.M.DMSIGVL-IA-----FR-------
Q2K6I2_RHIEC/316-414------------------------------------A-TAL-TLV-TC.L---.I.DIALGAA-VL-----VR-------
A1TNI5_ACIAC/22-122------------------------------------L-MQA-IIA-AG.I---.AADLAVG.A-WL-----WW-------
B9JGJ5_AGRRK/322-420------------------------------------A-TTL-TIA-TC.F---.L.DIALGAL-AL-----VR-------
A5V930_SPHWW/323-422------------------------------------A-RFL-GGG-GA.V---.V.DGLLALL-ML-----HR-------
Q2JZG1_RHIEC/327-426------------------------------------A-APT-VIA-GA.L---.T.DIAIGCA-IA-----IR-------
Q11CJ7_CHESB/321-420------------------------------------S-ASG-VVA-GA.I---.A.DILVGLA-IA-----YR-------
A7IKV9_XANP2/322-421------------------------------------A-LPL-ALA-GA.L---.A.DLSIGLG-IA-----WR-------
Q2S702_HAHCH/327-427------------------------------------W-RPM-VWF-TS.I---.L.DIVLGAL-LL-----SR-------
C2WZH4_BACCE/180-281------------------------------------S-VCI-LKI-IG.V---.L.EIIFGVV-WL-----LP-------
G8PNG3_PSEUV/327-425------------------------------------T-LLL-VLG-GS.L---.A.DITLGTL-IL-----FR-------
Q5ZVY7_LEGPH/322-422------------------------------------Q-LFL-FYA-SA.L---.W.DGLLGIA-ML-----FN-------
Q9A4D7_CAUCR/322-420------------------------------------A-VAA-VVG-GS.V---.A.DIALALL-LA-----HR-------
Q9I6F8_PSEAE/307-408------------------------------------A-SLA-VIA-GA.L---.L.DGALGVG-LL-----LR-------

PF06762

K1QJR5_CRAGI/165-541------------------------------------P-EIFHMFETLT-N...HFVELVVPWF.LI-----GP.R..RLC
LMF2_XENTR/122-588------------------------------------P-VWFQKFSVVA-T...YFIEIGVPLL.FF-----LPFR..RLR
E4N190_KITSK/121-477------------------------------------P-RPLHKVEAAA-N...HVVQLVVPFG.LF-----LP.Q..PIA
F2UH93_SALR5/134-601------------------------------------P-HWFQAFSVVQ-V...YVIEAVLPFG.FF-----LPFS..SVR
I3KCS2_ORENI/122-585------------------------------------P-VWWQKLSVVG-A...FVIEIAVPFL.FF-----SPLR..RLR
F1P0J3_CHICK/7-472------------------------------------P-VWFQKFSVVA-T...YVIEIAVPLL.FF-----MPIR..RLR
E1GDX1_LOALO/74-452------------------------------------P-KWFKHFSTAL-T...LYIKIILPPL.FL-----LPFK..YAR
E2B8W4_HARSA/122-575------------------------------------P-AWYLRLATVF-A...NVIELAVPFL.FF-----FPDI..KVR
F0Y0J4_AURAN/130-628------------------------------------P-PLLLRLGTAV-M...FLTELVAPWL.LL-----APAT..AAR
Q08T93_STIAD/249-609------------------------------------P-VRAQKLSTAA-V...LVSETALPLL.IF-----TP.R..RLR
K7J1M5_NASVI/123-578------------------------------------P-RWYLRLNTVG-A...NIFELVIPFL.FF-----FPIR..KVR
E5SED2_TRISP/131-543------------------------------------S-DSLKQFSVAA-T...FTILIFLPLF.GL-----SPSK..HLR
A1TEH0_MYCVP/123-475------------------------------------P-KPLHRVEVAG-N...HVAQLVVPFA.LF-----AP.Q..PVA
F8L1K9_PARAV/119-467------------------------------------P-MWFQKGSVLG-M...FFAEMIAPFG.IF-----WG.D..FAR
F5YS29_MYCSD/125-477------------------------------------P-KPLHRIEAAG-N...HFAQLVVPFG.LF-----AP.Q..PIA
G3UCY5_LOXAF/167-547------------------------------------P-WWVHRTETLG-N...HVIELLVPFF.LL-----LG.R..RMC
Q4N0L2_THEPA/112-755------------------------------------V-AKYSFLNTLL-TVGLLFYEVVLSVF.IV-----TPHR..SCR
H9GJK7_ANOCA/78-542------------------------------------P-VWFQKFSVVA-T...YVIEIAIPPL.FF-----VPLR..RLR
G3VQT8_SARHA/6-467------------------------------------P-VWLHKLSVVA-T...FLIEIAVPAL.FF-----APVR..RLR
A0QT94_MYCS2/77-429------------------------------------P-KPLHRVEVAG-N...HVAQLVIPFL.LF-----AP.Q..PVA
B3DXT0_METI4/128-489------------------------------------P-MKFHEITTFL-V...LFIELVVPFA.IF-----LG.K..TAR
H9GAZ9_ANOCA/164-545------------------------------------P-EGFHQFETLF-N...HVIELPVPFL.LF-----LG.R..RLC
T1KS50_TETUR/132-583------------------------------------P-SWLLRLGVVG-T...YVVEIIIPFF.FF-----GP.A..VLR
M3ZPC1_XIPMA/122-585------------------------------------P-VCWQKLSVVG-T...FIIEIPVPFL.FF-----SPLR..RLR
Q234A3_TETTS/140-610------------------------------------P-SWLKKLFVAQ-N...FITLIGGSLL.IY-----SPFR..RFR
W5KQN4_ASTMX/197-654------------------------------------P-DWLSRLGAVC-I...MAEEIAVPLLMFF-----APIR..GLR
G1QIY9_NOMLE/23-406------------------------------------P-VWLHKLSVVA-T...FLIEIAVPPL.FF-----APIR..RLR
F4WBZ8_ACREC/123-579------------------------------------P-TWLLRLSTVA-I...NVIELAIPFL.FF-----FPNR..KVR
F1Q4Q4_DANRE/125-588------------------------------------P-EWLLKLGAVV-M...LHSGICIPLLTFF-----APIR..RLR
W5KBQ4_ASTMX/194-574------------------------------------P-WWFHRFETLS-N...HFIELIVPFF.TF-----MG.R..RMC
G0MSI2_CAEBE/122-480------------------------------------P-PYIKQVASLV-M...HYCEIILPAF.FL-----IPLK..HVR
U6IKR5_HYMMI/134-572------------------------------------P-KWILRALTML-T...ISMKIFVPFL.YF-----IPIC..EIK
Q1IR35_KORVE/151-523------------------------------------P-HTLHAFATGA-T...LVMELGLIWM.IL-----LP.R..RFR
Z4YJR1_MOUSE/170-551------------------------------------P-WWFHRFETLS-N...HFVELLVPFF.LF-----LG.R..RMR
M4AS74_XIPMA/175-556------------------------------------P-WWFHRFETLS-N...HFVELIAPFF.TF-----LG.R..RLC
A8XC70_CAEBR/122-552------------------------------------P-SFLKQAATLA-T...FCFEIALPCM.YM-----IPVI..HVR
C5BX37_BEUC1/125-479------------------------------------P-RWWHRVEVAG-N...HVTQLGIVWL.LF-----AP.Q..PVA
V4Z567_TOXGO/197-765------------------------------------S-HTAHAFQVIV-N...HVVECVFPFL.LL-----IPFR..QCR
G2NZI2_STRVO/121-473------------------------------------P-RPLHRAEVAA-N...HVAQLIVPVL.LF-----TP.Q..PVA
H6RBI8_NOCCG/121-470------------------------------------P-KPVHRLEVLG-N...HVAQLIVPFG.LL-----CP.Q..PIA
H8MNZ0_CORCM/241-604------------------------------------P-RPVRHAGTAA-V...LAAETAVPFL.AF-----GP.R..RVR
E9GA51_DAPPU/120-571------------------------------------P-IWFHKLSVVA-T...YVIEIMLPFL.FF-----MPAR..KLR
J9JZT7_ACYPI/128-582------------------------------------P-LWFLKSITVF-A...EINDLFVPLM.FL-----VPIR..SVK
N0BDW0_9RHIZ/243-594------------------------------------P-PWMLAAGTAA-T...LVIELILVFL.IF-----LP.R..RLR
D7EJW8_TRICA/90-537------------------------------------P-SWYLKLFGVI-A...NVCEIGIPFL.FF-----VPIR..AVR
LMF2_BOVIN/122-590------------------------------------P-VWLHKLSVVA-T...FLIEIAVPPL.FF-----APVR..RLR
R4VWD1_9EURY/128-492------------------------------------P-DRFHRVEVLG-N...HVVELAVPFL.LF-----AP.Q..PYA
G8TN66_NIAKG/129-490------------------------------------P-RAVLRAGVWF-N...WLAELAAPLF.AF-----GP.R..LAR
E9JDB8_SOLIN/123-577------------------------------------P-TCFLRLANVA-T...NVIELAVPFL.FF-----FPNR..KVR
W5QF34_SHEEP/126-543------------------------------------P-VWLHKLSVVA-T...FLIEIAVPPL.FF-----APVR..RLR
E9T639_COREQ/121-473------------------------------------P-RPLHKIEVAG-N...HFTQLIVPFF.LF-----AP.Q..PVA
Q1CX59_MYXXD/289-654------------------------------------P-RRLQRASTGA-V...LWLETVVPFL.AF-----GP.R..RLR
W5TQD8_9NOCA/121-473------------------------------------P-RPLHRAEVAA-N...HIAQLVLPFA.LF-----TP.Q..PIA
B9M9C6_GEODF/118-468------------------------------------P-AVLRRCGVAF-N...HLAELVMPCL.YF-----AP.Q..PLA
Q6MNI0_BDEBA/151-506------------------------------------P-RWFQKVSTVI-M...FFIELVCPFL.ML-----VPGK...TQ
J9KB65_ACYPI/128-591------------------------------------P-LWFLKTITVF-A...EINDLFVPLM.FL-----VPIR..SVK
A8Q0Q7_BRUMA/122-570------------------------------------P-KWFKHLSTAL-T...LYIEIILPPL.FL-----LPFK..YAR
Q16NM9_AEDAE/95-538------------------------------------P-DALHRLSTIW-V...YLSELVCSWL.FF-----APNQ..KVR
H3FMM6_PRIPA/124-598------------------------------------P-EWARRLSVAL-T...FFIEIYLPPM.FL-----LPIP..MLR
G4VFY8_SCHMA/126-567------------------------------------P-GWIHNLCVAG-A...FIIEIPLPLL.FF-----VPFR..TAR
B3DK37_DANRE/122-584------------------------------------P-VWFQKLSVVG-T...YVIEIAVPFL.FF-----SPIR..RHR
B2HN18_MYCMM/121-472------------------------------------P-RPLHRIEVAG-N...HFAQLVVPFG.LF-----AP.Q..PIA
D0NCT8_PHYIT/130-640------------------------------------P-PLINRLAVAV-T...LLIEGPWTFF.LI-----APHP..TLR
H3B2B1_LATCH/185-566------------------------------------P-WWFHQFETLV-N...HFIELIVPFF.VF-----MG.R..RMC
F6FUF5_ISOV2/129-486------------------------------------P-RWWHRVEVVG-N...HVTQLGLPWL.LW-----LP.Q..PLP
B8C9U9_THAPS/126-526------------------------------------P-SAWHRVEVWV-N...HFVELVAPFL.LL-----VPFR..KWR
H2ULX4_TAKRU/122-510------------------------------------P-VWWQKLSVVG-T...FMIEIPVPLL.FF-----SPVR..RLR
B0WW43_CULQU/88-531------------------------------------P-DGIHKLSTIY-V...YVSELVCSWL.FF-----APNQ..RVR
U6I483_ECHMU/120-559------------------------------------P-SLVLRIISLF-F...IVMEIFIPFL.FL-----IPVR..ELQ
W5K8X7_ASTMX/123-584------------------------------------P-VWFQKLSVVG-T...YVIEIGGPFL.FF-----SPIR..RHR
T1G9T0_HELRO/127-575------------------------------------P-VWFQKASTAS-V...FIIQIVTSIL.FF-----SPFR..AHR
Q45WA6_TOXGO/205-775------------------------------------S-HGVHAAQVVI-T...HIVECVISFL.VI-----LPFR..QCR
B7FQF3_PHATC/171-536------------------------------------P-GWWHKQEVLV-N...HFVELIAPWL.LI-----LPGLPVQLR
A1R4Z7_ARTAT/124-478------------------------------------P-RPLHKVEVVG-N...HFAQLVVPFF.LF-----AP.Q..PLA
H2ULX3_TAKRU/164-554------------------------------------P-VWWQKLSVVG-T...FMIEIPVPLL.FF-----SPVR..RLR
E0W2V6_PEDHC/123-573------------------------------------P-NWFLKLGTVF-T...LIVEQLMPFL.FF-----FPLR..SVR
LMF2_RAT/122-589------------------------------------P-VWLHRLSVVA-T...FLIEIAVPPL.FF-----APIR..RLR
G7Q042_MACFA/113-483------------------------------------P-WWFHRFETLS-N...HFIELLVPFF.LF-----LG.R..RAC
A0C620_PARTE/119-569------------------------------------P-GELKKLMVAS-N...FYVLIFGAIY.FY-----FPRR..FMR
Q73TN3_MYCPA/121-476------------------------------------P-KPLHRIEVAG-N...HFAQLIVPFG.LF-----AP.Q..PVA
G3PHM6_GASAC/9-458------------------------------------P-VWWQKLSVVG-T...LVIEIAAPLL.FF-----SPLR..RLR
L0J1F6_MYCSM/123-475------------------------------------P-KPLHRVEVAG-N...HFAQLVVPFA.LF-----AP.Q..PIA
W5NJI5_LEPOC/122-585------------------------------------P-MWIQKLSVVG-T...YVIEIAIALL.FF-----APIR..SLR
T1HC95_RHOPR/92-555------------------------------------P-LWILKLGLAY-S...FFAEIFVSPL.FF-----CPIK..GVR
W5JUK3_ANODA/140-616------------------------------------P-EAFHRLSTIY-V...YLSELVVPWL.FF-----APNR..VVR
T1G1C1_HELRO/128-506------------------------------------P-VFFHKFETMV-N...HFVELIAPIC.LL-----MP.R..KFC
D2RQ81_HALTV/123-476------------------------------------P-KRFHRVETFG-N...HVVELLIPFL.YF-----AP.Q..PAS
E3LDC7_CAERE/122-552------------------------------------P-PFFKQLATIA-I...YYFEIILPPL.FL-----IPVI..HVR
E2AAK1_CAMFO/89-546------------------------------------P-TWFLRLSTVA-A...NVIELAVPFL.FF-----FLNR..KVR
D7FTX6_ECTSI/148-515------------------------------------P-KKFHRFETAM-N...HIVELGASWL.LL-----APVR..ALS
Q7PZH8_ANOGA/94-545------------------------------------P-DVFHRLSTIY-V...YLSELVVPWL.FF-----APSR..TVR
F0VNS7_NEOCL/190-761------------------------------------T-HGVHAAQVVV-T...HIVECVLSFL.VL-----LPFR..QCR
F4Q4V3_DICFS/211-592------------------------------------P-NYYHQFETMM-T...LVIEILVTPF.FF-----AP.R..VFK
U1NTR0_ASCSU/122-570------------------------------------P-EWLRRLSVAV-T...FYIETALPPM.FL-----LPFK..SLR
C3Z738_BRAFL/141-522------------------------------------P-ENMHKFETLS-N...HFVELVAPWF.IF-----LT.R..PFR
A7RJW9_NEMVE/81-462------------------------------------P-ELFHKFETLV-N...HFVELVAPFL.LF-----LP.R..PLR
A0JUS2_ARTS2/124-486------------------------------------P-KPLHRMEVLG-N...HFAQLVVPFF.LF-----AP.Q..PLA
G1NWH4_MYOLU/169-550------------------------------------P-WWVHRFETLS-N...HFLELVVPFF.IF-----LG.R..RMC
F8JRN7_STREN/121-473------------------------------------P-KPLHRVETAA-N...HMAQLVVPVL.LF-----TP.Q..PVA
D8J6J5_HALJB/125-476------------------------------------S-KAFHRLETLG-N...HVVELAVPFL.YF-----AP.Q..PAA
Q21435_CAEEL/1-432------------------------------------P-QFFKQLATLQ-M...NFIEILLPPL.FL-----IPLI..HVR
A7AW74_BABBO/157-697------------------------------------L-SGSSVLTTII-SSTPLFVELVASVS.LI-----IPIR..KCR

PF04173

Q97X72_SULSO/12-173----------------------FLTR------LSGL-VL-AGMAWGIG--------------------------------
Q97XJ3_SULSO/18-183----------------------FLTR------LSAF-GA-AVMAIGMA--------------------------------
Q973M6_SULTO/9-177----------------------LMTR------FTNT-VA-FYTNLIYF--------------------------------
Q97UC4_SULSO/10-178----------------------LMSR------LCSV-VA-FYTNLIYF--------------------------------
Q8AAF0_BACTN/18-181----------------------FFTR------LMSI-GV-FSLAFGIL--------------------------------
F4B442_ACIHW/20-184----------------------LLTR------LAAL-GA-LAMSVGFA--------------------------------

PF07681

Q83CN9_COXBU/12-94----------------------LFTR--....FGAF-LL-LVFVLLVT...-----------------------------
Q87K55_VIBPA/16-104----------------------LLTR--....PAAV-AL-SFTMVVAI...-----------------------------
Q8KEE1_CHLTE/7-88----------------------IYTR--....PAAL-VE-AFLMGVAV...-----------------------------
Q9RTC4_DEIRA/8-92----------------------LAAR--....TVAF-LL-SCIMFGAI...-----------------------------
Q7TUM8_PROMM/37-127----------------------LATR--....LCAL-GL-LSTMAFAITYH-----------------------------
Q7VHA8_HELHP/8-89----------------------YQVR--....IAAA-LE-AFTMLVAI...-----------------------------
Q89FZ6_BRADU/10-92----------------------VWTR--....YAAL-AG-IPILLGAI...-----------------------------
Q8EDN3_SHEON/21-107----------------------LATR--....LISI-PL-MITMLVAA...-----------------------------
Q8A9J9_BACTN/19-101----------------------FLYR--....LAMI-PM-IFTMIVAF...-----------------------------
Q83BV7_COXBU/131-217----------------------FLTR--....LGSL-GI-TLYLIITT...-----------------------------
Q92W39_RHIME/11-107----------------------LATR--....LAAL-GL-LAMAIVIQ...-----------------------------
Q8U4Y0_AGRT5/25-105----------------------VLRW--....VGAL-AL-SGFTLLAT...-----------------------------
Q7V0B0_PROMP/15-102----------------------LATR--....FGAL-AI-VGTISVAIYHA-----------------------------
Q984Q4_RHILO/6-88----------------------IAVP--....FAAG-AL-VVFTLAVN...-----------------------------
Q9A3E7_CAUCR/28-117----------------------LFTR--....MSAL-AF-LGMTAVIQ...-----------------------------
Q983U6_RHILO/19-101----------------------FQTR--....IAAW-VL-AIFTVATG...-----------------------------
Q82HN4_STRAW/24-126----------------------LLTR--....LAAL-GG-ALISLSLW...-----------------------------
Q7VUY8_BORPE/24-126----------------------LATR--....WSAL-GL-LLMTLVIQ...-----------------------------
Q831Y6_ENTFA/7-87----------------------FLIP--....LVSV-GF-IAVLVGAI...-----------------------------
Q983U8_RHILO/8-90----------------------FQTR--....IVAL-QL-AAFCVVAG...-----------------------------
Q7V328_PROMP/44-134----------------------VFAR--....LSSL-GL-FSTMAFAVYFH-----------------------------
Q7MRA2_WOLSU/17-98----------------------LYTR--....LNAL-VI-ALTMVVAI...-----------------------------
Q8F8N5_LEPIN/13-98----------------------FLTR--....LSAF-GI-GIIMIGAA...-----------------------------
Q9HYW2_PSEAE/22-108----------------------LAVR--....WISL-PL-MVTMLVAI...-----------------------------
Q88P63_PSEPK/6-95----------------------LMTR--....LSAL-AL-LGMTLVIE...-----------------------------
Q9HWH6_PSEAE/14-96----------------------RKLW--....LGAG-AL-AVFLLLTI...-----------------------------
Q8FR06_COREF/10-94----------------------LLTT--....FVAG-AL-ALLMLAAV...-----------------------------
Q9KYL5_STRCO/4-96----------------------RCPR--....LAAL-AL-AVTLVPTT...-----------------------------
Q8NR01_CORGL/191-281----------------------LMTP--....VAAA-VA-TVATSFTTLHQ-----------------------------
Q8XR31_RALSO/30-119----------------------IVPR--....LAAA-GL-FFVNLVAVGSY-----------------------------
Q92SD1_RHIME/6-88----------------------FQTR--....IASY-LL-AAFCVVTA...-----------------------------
Q7NPD1_GLOVI/22-104----------------------LLTR--....PAAA-AV-LFTMLVAG...-----------------------------
Q7NZE1_CHRVO/10-92----------------------LQAR--....WVAL-LL-IPQLLGAI...-----------------------------
Q7VDS1_PROMA/43-133----------------------VLTR--....LAAL-GL-LNTMLFALYFH-----------------------------
Q7N096_PHOLL/8-89----------------------LLTR--....TTAL-FT-FGFCVLTA...-----------------------------
Q8XWH4_RALSO/12-94----------------------FWTR--....PLAL-LM-ALFVLGTA...-----------------------------
Q7VYL1_BORPE/8-89----------------------IYCR--....LGAL-LV-VLNMVVAI...-----------------------------
Q7US51_RHOBA/24-106----------------------LGTR--....VAVS-GL-AFTMFVAL...-----------------------------
Q88G88_PSEPK/13-95----------------------FYTR--....PLAF-LF-ALFVLGTA...-----------------------------
Q812S4_BACCR/6-87----------------------LGVR--....YIGL-LF-ALVMVGAI...-----------------------------
Q88KH7_PSEPK/17-105----------------------LLAR--....PAAL-AL-TVTLIVAI...-----------------------------
Q98JU3_RHILO/13-95----------------------AFFT--....QAAL-IA-AAYVLFLG...-----------------------------
Q89MP6_BRADU/4-104----------------------FGAR--....FFAM-LL-IVYVAVAT...-----------------------------
CATD_BACSU/8-88----------------------LATR--....IVGV-LF-ALTLIGAI...-----------------------------
Q7VTR5_BORPE/10-91----------------------IYPR--....WVAA-IA-AVQLLAAA...-----------------------------
Q7UE97_RHOBA/16-98----------------------LGTR--....FAVL-NL-AFTMCVAL...-----------------------------
Q7NA66_PHOLL/20-124----------------------LATR--....FSAL-AL-MVMTLVIQ...-----------------------------
Q7VBT6_PROMA/9-93----------------------KDQK--....IGAI-FL-LIFLVPTT...-----------------------------
Q8FSC2_COREF/11-95----------------------VFTR--....YVSA-VV-AVVMLGAA...-----------------------------
Q98K48_RHILO/27-109----------------------LWTA--....LACA-VL-VLFLIVAT...-----------------------------
Q7NSB1_CHRVO/12-100----------------------LGGR--....FAAA-GL-FILNAVAVI.S-----------------------------
Q9HZY2_PSEAE/16-104----------------------LLVR--....PASV-VV-GFTMIVAI...-----------------------------
Q88K91_PSEPK/19-105----------------------LGTR--....LASL-GL-MVVTVVAI...-----------------------------
Q8EZJ9_LEPIN/12-95----------------------LLTR--....FAAI-LQ-VPVLIGAV...-----------------------------
Q8Y2U2_RALSO/28-111----------------------MLAR--....LACL-PI-VFLLLVAL...-----------------------------
Q9CP47_PASMU/16-102----------------------FFTR--....CSAL-SL-TILTAVAW...-----------------------------
Q9HWS4_PSEAE/24-110----------------------LGTR--....LTAL-VL-IVVTLVAT...-----------------------------
Q82PS9_STRAW/30-117----------------------LLTP--....LAAA-AV-VGVMINAM...-----------------------------
MHQP_BACSU/5-93----------------------VFLP--....LGAA-II-TIIMLGAI...-----------------------------
Q883U2_PSESM/16-104----------------------LLAR--....PAAV-VV-IVLLLVAI...-----------------------------
Q92TK3_RHIME/11-93----------------------YRAR--....WVAL-IL-AAFTLASA...-----------------------------
Q7V7V3_PROMM/10-94----------------------KSQK--....LGAS-LL-LIFLVPTT...-----------------------------
A9CK19_AGRT5/23-105----------------------FQTK--....IAAW-AL-AVFCVFTG...-----------------------------
Q7U687_SYNPX/15-102----------------------LLTR--....MGAM-AI-AGTITVAIYHA-----------------------------
Q89EW4_BRADU/19-101----------------------RFVW--....LGAG-GL-GILTFVAM...-----------------------------
Y1602_HAEIN/14-100----------------------VLTR--....FSAL-SL-TILISVAW...-----------------------------
Q98JF9_RHILO/23-103----------------------LLTR--....LGGI-GL-GLFCLATA...-----------------------------
Q8YSN3_NOSS1/6-88----------------------YKAE--....IGAI-LL-IIFLIPAT...-----------------------------
Q92Y87_RHIME/25-105----------------------IFRK--....VAAL-CL-AVFTVAAT...-----------------------------
YQJF_ECOLI/8-88----------------------FLTR--....TTAL-FT-AGFTLLTA...-----------------------------
Q812I5_BACCR/5-93----------------------IFIV--....VGSL-FI-VGTMLMAI...-----------------------------
Q8NT59_CORGL/10-94----------------------VFTR--....IVAA-FV-AIDMLFAA...-----------------------------
Q87KG0_VIBPA/27-115----------------------LFTR--....PMAA-ML-FVFNIIAVL.S-----------------------------
Q8P8R3_XANCP/15-111----------------------LWTR--ASAALAAA-FI-ATTVVIAIPKG-----------------------------
Q89SK7_BRADU/66-148----------------------VGTR--....YCAI-LT-FVFVVAAT...-----------------------------
Q82AZ6_STRAW/10-97----------------------LATP--....AAGA-AA-AGAMVGAA...-----------------------------
Q82V34_NITEU/11-94----------------------IFSR--....IGGL-LV-FGNTVFAI...-----------------------------
Q82UE4_NITEU/22-102----------------------WQTR--....LTSI-AL-AVFTLAAA...-----------------------------
I0IQM6_LEPFC/14-98----------------------FLTR--....FVAV-SF-VMIMLGAI...-----------------------------
I6XG31_MYCTU/17-94----------------------LFTR--....AVAF-VA-SGEMAVAY...-----------------------------
I6YAV3_MYCTU/114-195----------------------LFTP--....LAAA-GA-LAFLIN.....-----------------------------
YPHA_ECOLI/16-98----------------------FFTR--....PLAV-LF-IFYTLGTA...-----------------------------
Q2FZM5_STAA8/5-82----------------------FLTP--....YVNV-FY-ICVMLGSI...-----------------------------
Q2YIJ7_BRUA2/13-93----------------------FKTR--....IAAV-IV-GLFTLGAT...-----------------------------
Q7AJS4_BACHD/8-89----------------------VGTK--....YVSI-LF-AIIMVGAI...-----------------------------
Q7MGN3_VIBVY/23-104----------------------VFTR--....ITSL-VL-FAFNAMAV...-----------------------------
Q8F8V4_LEPIN/14-97----------------------FCTR--....LSAF-GI-TCTLAVAG...-----------------------------
Q9CCC8_MYCLE/7-92----------------------LLTP--....IPAA-GF-VSLMMVAA...-----------------------------

PF13564

D1AAS7_THECD/7-112G.I--------------A.P..VLTP------LAAA-GL-VIVMIGAMITH-----------------------------
D2SF07_GEOOG/7-113...--------------V.P..VLVP------IAAT-GL-ALLMLGAAVTH-----------------------------
C5BX04_BEUC1/7-113...--------------M.T..VLTP------VAAA-GL-ALLMVGAVIVH-----------------------------
D3Q9W4_STANL/7-109...--------------V.P..FIGI------AAAA-GL-TLFFVGAVAVH-----------------------------
D1BDS4_SANKS/7-113...--------------A.P..ALVP------TAAI-GL-ALVMIGAAVVH-----------------------------
D1BYA3_XYLCX/7-112...--------------G.EHVWLTP------TAAA-CL-ALLQLLAILVH-----------------------------
B5HYY5_9ACTO/7-112..I--------------A.P..WLAS------AAAI-GF-LLLQLGAVAVH-----------------------------
D1BVK9_XYLCX/7-113...--------------A.P..WLAL------AAAV-GL-VLLQIGGTALH-----------------------------
A9B5S7_HERA2/7-113G.I--------------A.P..ILTP------LAAL-GL-ALTMFVAGLVH-----------------------------
D3Q6B3_STANL/7-112G.V--------------A.T..MLVP------AAAV-GL-AVTMLLAAVVH-----------------------------
C5C629_BEUC1/7-115...--------------A.P..FLTP------VAAS-GL-AIVMVGAAVVE-----------------------------
D3PWB3_STANL/7-114G.I--------------A.P..ILVP------LAAV-GL-GLIMVGAAVVE-----------------------------
D3EH52_GEOS4/7-112Y.I--------------V.P..KLTP------IAAA-GL-ATIVLLGALYH-----------------------------
A4F848_SACEN/7-108...--------------V.P..WIGI------AAAA-GL-FLYFIGAVTTV-----------------------------
A1SIQ7_NOCSJ/7-109...--------------L.E..PLGI------AAAA-GL-TAYFLGAMGGH-----------------------------
C6WJU0_ACTMD/7-113G.I--------------A.P..VLTP------IAAA-GL-VITMVIAVGVH-----------------------------
B5I6V7_9ACTO/19-120...--------------L.P..YVGL------AAGI-GL-VLYFTGAAVTV-----------------------------
C6VZE8_DYAFD/11-112...--------------F.P..LLKE------WAYA-GF-FFCMSGAIVSH-----------------------------
Q0SGE8_RHOSR/7-112...--------------T.P...LGV------IAAV-AL-LILLLCAIAFH-----------------------------
D5UX83_TSUPD/7-115...--------------VAD..VLSP------IAAC-GL-ALFMAGAATTR-----------------------------
D3PZS4_STANL/7-112...--------------V.E..ILTP------LAAT-GL-VLMMIGAAITH-----------------------------
D3PUC2_STANL/7-110...--------------L.P..MLGT------AAAI-GL-VLFFVCAIHTH-----------------------------
C9Z9S2_STRSW/7-108...--------------A.P...LGV------AAAA-GL-ALLMTAAAVVH-----------------------------
A1TE84_MYCVP/11-113...--------------T.P..WLGL------AAAT-GL-VGFFVGAVAVH-----------------------------
D2AS43_STRRD/5-106...--------------V.P..VIGT------LAGI-GL-VLYFVGAVITV-----------------------------
D2PZ45_KRIFD/7-114D.T--------------A.R..YLTP------VAAV-GL-GVVMIGAAAAH-----------------------------
B1MM14_MYCA9/10-112...--------------V.R..QIGL------AAAI-GL-VAFFIGAVGAH-----------------------------
Q65HS4_BACLD/5-107...--------------N.V..HLAV------GSGL-LF-SLLMTGAIHAH-----------------------------
Q5YWI3_NOCFA/31-132...--------------A.P...VGL------AAAI-GL-VGYFSLAVLTV-----------------------------
D3F1P3_CONWI/7-108...--------------A.P...IGV------AAAI-GV-VLYFLVTVAFH-----------------------------
C7PZU5_CATAD/19-125...--------------A.T..VLTP------LAAV-GI-AVMMLLGALAH-----------------------------
B5H4W5_STRPR/7-108...--------------G.P...IGV------AASV-GL-ILYYAGAMLVI-----------------------------
Q11P05_CYTH3/10-110...--------------P.T..RVKE------WAYA-GF-GINLIAAAITH-----------------------------
D5UGI3_CELFN/7-114G.V--------------A.P..VLTP------VAAV-AL-AGTMVAATAVH-----------------------------
Q89Y33_BRADU/62-168..I--------------L.P..RLTV------LAAL-GC-TVLQVFALVFH-----------------------------
C0ZKK1_BREBN/2-104...--------------I.P..EVLT------FACI-LF-AILMLGAIHAH-----------------------------
B1MDG2_MYCA9/7-115G.I--------------A.P..VLSP------LAAA-GL-AVLQAGAFGVH-----------------------------
Q7UL85_RHOBA/23-124...--------------F.G..RLKE------WAYA-GF-FFDLTGATAAH-----------------------------
C7PUE7_CHIPD/10-111...--------------..G..RLKE------WTYA-GF-TFTFVSAAIAH-----------------------------
D3Q6A9_STANL/7-109...--------------E.P...VSL------VASL-GL-FTLMIGALRAQ-----------------------------
Q82R50_STRAW/28-129...--------------V.P..PLGG------LAGA-GL-LLLLAGAVVVH-----------------------------
D2QST6_SPILD/17-122...--------------IQP..KLTR------YAAY-GT-VALMVAASLFH-----------------------------
Q5YXM8_NOCFA/33-141...--------------A.P..ALVP------VTAA-CW-VVLMIGAIITH-----------------------------
C7PKH0_CHIPD/17-121...--------------IWP..RLTR------YAAY-GI-LLLMIAASVFH-----------------------------
B2JL65_BURP8/47-153R.V--------------A.P..RLTI------WAAW-GC-SGLQFCAILFH-----------------------------
D2ASD1_STRRD/34-143..G--------------VKP..KLTP------LAAV-GL-TLTMILAAGFH-----------------------------
B0UIU5_METS4/14-111...--------------..R..GATA------LGAF-LL-AAIMAGAVGSH-----------------------------
D2PS28_KRIFD/35-136...--------------F.K..LLKE------WAYA-GT-VFMWSGAVASH-----------------------------
C7PYY8_CATAD/7-121...--------------A.P..VLTP------IAAV-GL-CCVMAGAISSH-----------------------------
A9GJR9_SORC5/11-117...--------------F.P..RLKE------WAYA-GI-VFDLTGAAFAW-----------------------------
B8IER0_METNO/21-116...--------------......YAV------FAAV-WL-GCTMVGAVLAH-----------------------------
Q1IKM4_KORVE/10-111...--------------I.P..RVKE------WAYA-GM-IFDLSGAMISR-----------------------------
A9FEJ3_SORC5/27-126...--------------.....RTSV------LGAI-LL-TGFLGGAVATH-----------------------------
Q2S0Z3_SALRD/8-118AVL--------------A.R..TVKE------WTYA-GF-TISIVSAMIAH-----------------------------
Q11S70_CYTH3/11-112...--------------I.H..RLKA------IGIL-LL-LPFAIGAFTAH-----------------------------
Q5Z2J9_NOCFA/19-120...--------------H.P..RTKE------WAYA-GL-VFVYGGAAASH-----------------------------
C6X539_FLAB3/10-112...--------------P.K..GFKY------FAYA-GF-TINLISASVAH-----------------------------
B5HQQ2_9ACTO/55-152...--------------......LQS------VAAV-AL-SGLMVGAFVVQ-----------------------------
A7H7U7_ANADF/31-130...--------------V.P..RTSL------LGAV-LL-TGYLGGAVSTH-----------------------------
A5FBV8_FLAJ1/7-111...--------------P.K..NVKE------WAYA-GF-GFDFIFASISH-----------------------------
D2QN87_SPILD/19-118...--------------P.A..RIKE------WAYV-GF-GISMISAIIAN-----------------------------
A9B014_HERA2/18-116...--------------I.P..RTAV------LGTV-LL-TGYFGGAIASH-----------------------------
Q1D110_MYXXD/7-102...--------------V.P..RTAV------LGAI-LV-TGYLGGATSTH-----------------------------
C7PKI9_CHIPD/12-107...--------------..T..RTGV------LGTL-LL-SSYLGGAIATH-----------------------------
A9F3Z6_SORC5/44-143...--------------.....RTAV------LGAV-LW-TGYLGGAIAIH-----------------------------
D9QMH9_BRESC/33-140WKL--------------G.R..WPLL------VSAV-GL-IAVETAMLAVH-----------------------------
Q0SJ69_RHOSR/31-130...--------------V.P..ATAI------LGAV-LL-TGYLGGAVATN-----------------------------
Q1IPI6_KORVE/25-123...--------------I.P..RTSV------LGAM-LL-TGYLGGAVVTN-----------------------------
A9UV76_MONBE/637-749...--------------..P.....Q------LAAS-VL-AIIMTGAIYTH-----------------------------
B4RA61_PHEZH/23-122...--------------Y.P..RTSV------LGAV-LF-TALFGGTCAVH-----------------------------
C5C5Y3_BEUC1/41-144...--------------......SRF------LGAL-LL-VVITAGAVVTH-----------------------------
C0Z8W5_BREBN/15-114...--------------I.P..RTAV------LGAL-LL-TGFFGGVIATQ-----------------------------
B9JK89_AGRRK/29-136...--------------VLV..SLAP------SAII-VL-LAVEGFAIILE-----------------------------
B1MHX9_MYCA9/33-130...--------------V.A..RTAV------LGAV-AL-TAYLGGAVTID-----------------------------
A5V4G4_SPHWW/11-106...--------------..E..ATRP------WGLM-LA-AAIMLAAIATL-----------------------------
A4YMD8_BRASO/6-106...--------------.....ATSL------LGAI-LL-TGYLGGAIASH-----------------------------
B7VRG5_VIBSL/12-116..L--------------APE..HTQL------MGGL-IL-ASTSLGAIYFH-----------------------------
C3AVH4_BACMY/21-123...--------------F.P..RLKE------WAHA-GI-FFLMTGAALSH-----------------------------
Q73Z31_MYCPA/32-131...--------------L.P..ALGI------AAAA-GL-VVFFVGAVLTH-----------------------------
Q81NN7_BACAN/4-103...--------------N.Q..YLAL------GANT-LL-AVLMVGAIHAH-----------------------------
Q81U50_BACAN/7-106...--------------N.E..VVLV------LAAL-WI-ACIMLGAVLSH-----------------------------
Q8F0G1_LEPIN/13-113...--------------F.P..LLKE------WAYA-GM-FFNLTSASISN-----------------------------

PF07291

MAUE_METEA/3-186-------------------VTAPLAA------GLAG-GL-MVLFGIAIAIN-----------------------------
MAUE_METFK/2-184-------------------PAREIAA------CVAA-GL-FIVFALALAIN-----------------------------
A1BB98_PARDP/3-185-------------------PLAVPAA------VAAA-AL-LLVFAAALAIN-----------------------------

PF04224

Q9CJR3_PASMU/1-137----------------------FRQP--KAGLLGSG-LV-LITALVTVSLL-----------------------------
O25289_HELPY/5-190----------------------LWMP--LMGVIGGL-LV-AGMTITTLSFL-----------------------------
RCLC_ECOLI/2-182----------------------PVNR--WLGLLGGL-MA-FTTPLVTLSFL-----------------------------
Q9KRP9_VIBCH/1-146----------------------LRSS--KVAYYSGI-AS-MVIFISTLSFL-----------------------------
Y219_HAEIN/13-209----------------------IWNA--TAGLAGGL-LT-FGMSIVTLSFL-----------------------------

PF05514

O23298_ARATH/1-138----------------------FGSS------LGAY-LL-LLHQAVATPIL-----------------------------
Q9LTD0_ARATH/18-201----------------------YGSF------FGAF-LL-LMYQGIATMVH-----------------------------
Q0IXE1_ORYSJ/1-138----------------------LSSS------LGAY-LL-LFHLAFITPVV-----------------------------
O22690_ARATH/1-138----------------------IGNI------FGAY-LL-AVYLVVVSPIL-----------------------------
I1PJ49_ORYGL/1-138----------------------ISSS------FGAF-LL-LLYLAFITPVV-----------------------------
Q8GYI3_ARATH/20-151----------------------FGQS------IPAY-FL-LATQIFSTVI.-----------------------------
Q8H080_ORYSJ/1-138----------------------LSSS------FGAY-LL-LIYLAFITPVV-----------------------------

PF02077

SURF4_CAEEL/11-277KAS..LFAGVPTMGDS.NKPKSYMLL------AGRV-LL-IFMFMSLMHFE.----------------------------
YFC7_CAEEL/4-269KPKPANYTQLPRDEHE.IEVTSVLLA------ACRV-CL-NLMLISMVHFD.----------------------------
ERV29_YEAST/48-310NKT..TFGMLPELNSKNDKAKGYLLF------AGRI-LI-VLMFIAFTFSK.----------------------------
SURF4_SCHPO/33-302RRIN.RFAGLPAVSE..HNKRTYFQL------AGRV-LL-IFMFLGLLAKEG----------------------------
SURF4_DROME/5-270GRS..LFAGVPSMGE..NKPKNFMQL------AGRI-LL-AFMFITLIRFE.----------------------------
SURF4_HUMAN/4-269GKS..MFAGVPTMRE..SSPKQYMQL------GGRV-LL-VLMFMTLLHFD.----------------------------

PF13781

C3AK78_BACMY/185-286----------------------FQKQ--KLLLLHII.IL.IGLTIVAGFTN-----------------------------
D3E5H6_GEOS4/180-281----------------------HKNR--LWYRLIMI.LL.AILMIGAWMTD-----------------------------
Q65IN6_BACLD/178-279----------------------VRKR--KWFLLHIV.LL.VLLSASAGMAD-----------------------------
C6CYU2_PAESJ/180-281----------------------HRTK--WIYYLQVV.GL.LALAGGALIYT-----------------------------
Q8ESB3_OCEIH/179-280----------------------GRWK--SLHILNII.AL.LLLGIAATISD-----------------------------
A1BFB6_CHLPD/25-125----------------------RK.S--WAFWLNVL.TL.FSLLIYVALFE-----------------------------
B4SAW4_PELPB/19-119----------------------RS.Q--WVFLLNIA.AL.TGLLLFVALFE-----------------------------
B3EQZ0_CHLPB/20-120----------------------RR.G--SVFLLNVI.AL.SALLVYVAVFE-----------------------------
B4S7F5_PROA2/21-121----------------------RR.S--WLFIANIL.IL.SLLLGYVALFQ-----------------------------
Q3ARZ2_CHLCH/17-117----------------------RW.Q--WAFWLNII.AL.IGLLFFVGIFE-----------------------------
B3QTS0_CHLT3/26-127----------------------WSRS--WPLALSAI.AM.IFALLGVAFTS-----------------------------
Q1H1D1_METFK/335-436----------------------RKRR--LLWQMQIA.VI.LGYTLILSWFI-----------------------------
C7R8T5_KANKD/19-119----------------------TKMK--LCYVVQII.VI.TSYTILLTMIE-----------------------------
Q2SM61_HAHCH/17-117----------------------LRSN--LPLLAAGV.AL.VGLLLDVAWFS-----------------------------
Q3SHK0_THIDA/314-415----------------------RRRR--LLWLAQIA.LI.VFYTAAISLYL-----------------------------
Q2Y734_NITMU/330-431----------------------RDRR--LLWIAQVT.LI.GVYMVAITLFL-----------------------------
Q5NY22_AROAE/320-421----------------------RGRA--AVLVVQAG.LI.LAYTAIISWKL-----------------------------
A1K6I8_AZOSB/336-437----------------------WQRR--RVWAAQAA.LI.AAYTLIISWKL-----------------------------
Q1LGK6_RALME/315-415----------------------PSRR--.LWALQAA.LV.AGYSLIIAVAL-----------------------------
C1F939_ACIC5/18-120----------------------DAPA--ACALTQAG.LL.LALNANGIFWA-----------------------------
Q7NW81_CHRVO/13-112----------------------RPSA--LGWRLQAL.TV.LFYSAAVAVAL-----------------------------
Q11TY1_CYTH3/19-119----------------------FKAR--FNAFTQIAVII.TMNTMEFILVP-----------------------------
C7PI03_CHIPD/14-115----------------------FKSR--LNAILQIA.IVGTMNILEFMLVP-----------------------------
A1VMB6_POLNA/12-112----------------------PK.R--TTYLAALA.LM.LLMTLAATMLL-----------------------------
Q0ANG5_MARMM/322-422----------------------WRVR--WLATIMIL.GT.FAYIFTLSMTL-----------------------------
A9C3F1_DELAS/21-121----------------------PGR.--ESYLAALL.LM.AAMTVLATVLQ-----------------------------
Q4K472_PSEF5/309-409----------------------RWRR--RALQAQLG.LM.LGYTLIISLIL-----------------------------
Q89WY4_BRADU/329-429----------------------RTAA--VGLVAGIV.AS.LGYMLGAAILT-----------------------------
Q2K6I2_RHIEC/316-414----------------------PLAK--RALLGMLA.VS.LAYLAGATMLE-----------------------------
A1TNI5_ACIAC/22-122----------------------RPGR--PAYAAALL.LM.GTMTVIATFLL-----------------------------
B9JGJ5_AGRRK/322-420----------------------PFTR--AALHGMLG.VT.LAYLAGGTLLE-----------------------------
A5V930_SPHWW/323-422----------------------RAVC--FALLGTVA.VT.AAYLLGATIVR-----------------------------
Q2JZG1_RHIEC/327-426----------------------RTAR--WGLYAAVL.LS.LFYAAAATAVL-----------------------------
Q11CJ7_CHESB/321-420----------------------PTTR--HGLYGAIA.LS.VFYIISGTILL-----------------------------
A7IKV9_XANP2/322-421----------------------RTSR--LALLGGAG.LS.VLYALAATALV-----------------------------
Q2S702_HAHCH/327-427----------------------RHMA--LVGQWMLL.CV.LGYTLTLGALA-----------------------------
C2WZH4_BACCE/180-281----------------------IIKR--KLFILHII.VL.LVLTLAAGFTN-----------------------------
G8PNG3_PSEUV/327-425----------------------KNTR--LACLGMIA.VT.LGYLGAGTIWA-----------------------------
Q5ZVY7_LEGPH/322-422----------------------YRFK--LTSILQLI.TI.LVYTVIITIKL-----------------------------
Q9A4D7_CAUCR/322-420----------------------RTAA--PALKGMLL.VT.AGYLVGGALVR-----------------------------
Q9I6F8_PSEAE/307-408----------------------RWRR--RALLAQFW.LM.LGYSLAISLIL-----------------------------

PF06762

K1QJR5_CRAGI/165-541MIGGAIQI--------------LFQV..VLIISGNLSFLNWLTIVPSLACFD........D..........ASLGW.MFS
LMF2_XENTR/122-588LFSFYSQV--------------VLQI..LIIMTGNYNFFNLLTVVLCCSLLD........D..........QHITF....
E4N190_KITSK/121-477SGAALLMI--------------ATQL..WLIASGNFAWLNWLTVALALGVLD........T..........GTLRR.VLP
F2UH93_SALR5/134-601VVCAVAQV--------------VLMA..LIFVTGNYNFFNILTALLAIPVLY........D..........NELKA....
I3KCS2_ORENI/122-585LGAFYLQV--------------LLQV..LIILSGNYNFFNLLTVTLCLSLLD........D..........RHVYF....
F1P0J3_CHICK/7-472LFAFYCQV--------------LLQI..LIILTGNYNFFNALTIVLAFSLLD........E..........EHMGR....
E1GDX1_LOALO/74-452YFSFGPQI--------------LLMC..LIMATGNYNFFNLLISVECVAVLV........D..........SDEFR....
E2B8W4_HARSA/122-575KVAFYAQV--------------FLQI..CIIATGNYNFFNFLTICLCISLLD........D..........QFFYK....
F0Y0J4_AURAN/130-628RAGCLAQI--------------PLQA..LIMYSGNYNWFNLHTVVLLLPAWA.......CD...................
Q08T93_STIAD/249-609QWAFGLFS--------------LLQA..GIAATGNYGFFNLQSFVLGVWLLD........D..........EALTG....
K7J1M5_NASVI/123-578IVAFYLQV--------------FLQV..HIIATGNYNFFNLLTICLCISLLD........D..........HFFYT....
E5SED2_TRISP/131-543TFAFYGLT--------------LQML..LISLTGNYNFFNILSVVICLAMYT........Q...................
A1TEH0_MYCVP/123-475SVAAGIVI--------------VTQL..WLVLSGNFAWLNWLTILLAFSAVD........Q..........SVFAV.VLP
F8L1K9_PARAV/119-467LTTCAILV--------------LLQY..GIWLTGNFSFLNHLTAVFCIILIN........N..........AVLS.....
F5YS29_MYCSD/125-477GVAAVIII--------------VTQL..WLVASGNFAWLNWVTIVLAAAALD........Q..........SWLTG.LFP
G3UCY5_LOXAF/167-547ILHGILQV--------------IFQV..ILIISGNLSFLNWLTIVPSLACFD........D..........AALGF.LFS
Q4N0L2_THEPA/112-755LFGGMALM--------------VYGS..VFTLLGNFGPFYILLLLTSLFCLD........D..........QFLHP....
H9GJK7_ANOCA/78-542LFAFYSQI--------------FLQV..LITLTGNYNFFNFLTVVLCFSLLD........D..........EHLGF....
G3VQT8_SARHA/6-467LAAFYSQA--------------LLQV..LIILTGNYNFFNLLTLVLTTSLLD........D..........QHVAW....
A0QT94_MYCS2/77-429STAAAVVI--------------VTQL..WLVASGNFAWLNWITIVLACGVVS........D..........TALSA.VVG
B3DXT0_METI4/128-489RISFFLFS--------------FFQL..FIILTGNHAFFNWLSLALCWTLLD........DGFIKKIIPYFSSFSP....
H9GAZ9_ANOCA/164-545ILHGLLQI--------------LFQVRRSLVVRGGLSSISGVLGVPSSVCHR........P..........ATLSS.FFP
T1KS50_TETUR/132-583RISFWAQV--------------IFQF..CIILTGNYNFFNLLTIVLCIPLLQ........D..........ADFPR....
M3ZPC1_XIPMA/122-585LAAFYMQL--------------LLQV..LIILSGNYNFFNLLTVTLCLSLLD........D..........RHVNF....
Q234A3_TETTS/140-610QFGGLMLL--------------SEQF..MIILTGNYNFFNFLTVLVTLATFD........D..........KFLKY....
W5KQN4_ASTMX/197-654ISAFYIQV--------------SHQL..CLMLLGGSSLLHLLTIALSFSLLD........D..........EQFNI....
G1QIY9_NOMLE/23-406LAAFYSQV--------------LLQV..LIIITGNYNFFNLMTLVLTTALLD........D..........QHLAA....
F4WBZ8_ACREC/123-579IIAFYLQV--------------FLQI..CTIATGNYNFFNFLMICLCISLLD........D..........QFFYK....
F1Q4Q4_DANRE/125-588LFGFYVQL--------------FLQL..FHILTGNCSLLNLLSIALSFSLLD........D..........DHFNT....
W5KBQ4_ASTMX/194-574MVNGVLQI--------------LFQV..VLIISGNLSFLNWLTIVPSIACFD........D..........SALAF.LFR
G0MSI2_CAEBE/122-480YVAFFGQV--------------LLMS..ANILTGNGGYLYYNILVLLISLLG............................
U6IKR5_HYMMI/134-572YFVFFASF--------------LYHA..NFVLVDNDNIYSILLLVLSLVLLP........Q...................
Q1IR35_KORVE/151-523IVLFAIVC--------------SWEV..MVIATANYAFLNYLVLSLGILLVD........D..........RFVLS....
Z4YJR1_MOUSE/170-551ILHGVLQI--------------LFQV..ILIISGNLSFLNWLTIVPSLACFD........D..........AALGF.LFP
M4AS74_XIPMA/175-556MVNGAIQI--------------LFQV..VLIISGNLSFLNWLTIVPSLACFD........D..........ASLSF.LFR
A8XC70_CAEBR/122-552YVMFFGQF--------------LLTT..LTILTTNNGFMNYNVLVLLVSMLE............................
C5BX37_BEUC1/125-479SIAAGVIV--------------LTQA..WLVVTGNFAWLNALTMVLAASAIS........D..........SSWRW.LLP
V4Z567_TOXGO/197-765LVGGVTQI--------------LFQG..AIIFSGNFSFLNHLSILPALMTLD........D..........NFVSC.LFP
G2NZI2_STRVO/121-473SVAAGIIV--------------VTQL..WLVASGNFSWLNWLTILLALPAVD........G..........RRAAD.VLG
H6RBI8_NOCCG/121-470TVSAVIII--------------VTQL..WLMVSGNFAWLNLLTITLATLALD........G..........RLLNA.ILP
H8MNZ0_CORCM/241-604QATFGILS--------------ALQA..AIIATGNYGFFNVQSLALGLWLLD........D..........AALR.....
E9GA51_DAPPU/120-571LIGCYGQI--------------LLQV..AIIASGNYNFFNLLTITFCLSLMD........D..........RHLSD....
J9JZT7_ACYPI/128-582KLAFYIQV--------------FMQV..CILASGNYSYYNLLYIVLCLSLLD........D..........HTFYR....
N0BDW0_9RHIZ/243-594ALAALCIL--------------TFQV..LILLTGNYGFFNLLTIALCVFLFD........D..........AAIR.....
D7EJW8_TRICA/90-537ITSFMIQI--------------FLQI..SIVLTGNYNFTNLLMVTLLLSLLD........D..........QFFYG....
LMF2_BOVIN/122-590LAAFYSQV--------------LLQV..LIILTGNYNFFNLLTLVLTTALLD........D..........THLAA....
R4VWD1_9EURY/128-492SLGGAAIV--------------GFQA..WLMLTGNFSWLNALTIVQAVAAFT........DSVLAAAFVPVGTITA.ALP
G8TN66_NIAKG/129-490HIAGVIMI--------------LLQV..TLIVSGNLSFLNWLSIIPALACFD........D..........GCWAK.LLP
E9JDB8_SOLIN/123-577ITAFYLQV--------------ILQI..CVMATGNYNFFNFLTICLCISLLD........D..........QFFYK....
W5QF34_SHEEP/126-543LAAFYSQV--------------LLQV..LIVITGNYNFFNLLTLVLATALLD........D..........THLAA....
E9T639_COREQ/121-473GGAAAIMV--------------VTQL..WLVASGNFAWLNWLAIVLGLSVLP........D..........GFWEF.VLP
Q1CX59_MYXXD/289-654QFAFWSLS--------------GLQT..AISATGNYGFFNVQAWVLGVWLLD........D..........AALR.....
W5TQD8_9NOCA/121-473SIAAILLA--------------VTQL..WLILSGNFAWLNWLTILLACTAID........A..........RTVTT.VLP
B9M9C6_GEODF/118-468VTGGVVSA--------------AFLF..FIIVSGNFAWLNWLAFILCFSTVT........T..........GQLPFLALE
Q6MNI0_BDEBA/151-506VIAVALLL--------------SLQF..LIILTGNYGFFNLLTIGLCLAVLP........D...................
J9KB65_ACYPI/128-591KLAFYIQV--------------FMQV..GILASGNYSYYNLLYIVLCLSLLD........D..........HTFYR....
A8Q0Q7_BRUMA/122-570YFSFGPQI--------------LLMS..LIMATGNYNFFNLLISVECVAVLV........D..........SDEFK....
Q16NM9_AEDAE/95-538MFALWWQV--------------FLHL..NIIGSGNYGFLSLIVLTLLLTLVD........D...................
H3FMM6_PRIPA/124-598AIAAIPNI--------------IFMF..AIMATGNYNFFNLHFALLCVSSL......................EGG....
G4VFY8_SCHMA/126-567LVSFYSQV--------------LLQL..SIILTGNYNFFNLLTIALCYSLLK........D..........DDFNP....
B3DK37_DANRE/122-584LAAFYMQV--------------LLQV..LIILSGNYNFFNILTITLCLSLLD........D..........QHVNF....
B2HN18_MYCMM/121-472SIAAVIII--------------VTQL..WLVMSGNFSWLNWLTILLACSAIE........Q..........SAARK.VLP
D0NCT8_PHYIT/130-640RIGAIQQT--------------ALQI..SILLTGNYNFFNLLTIILATVLLDVDNGATGCE..........SDITL....
H3B2B1_LATCH/185-566ITHGILQI--------------LFQV..VLIISGNLSFLNWLTIVPSIACFD........D..........ASLGF.LFS
F6FUF5_ISOV2/129-486SVAGIAVV--------------LTQG..WLVVTGNFAWLNWAAIVLGAAMVS........D..........TTWAF.LLG
B8C9U9_THAPS/126-526LAGGLSQI--------------MFQL..VLISSGNLSFLNWLTIVPAIFCLD........DVFLLSNLPPILQRVA.LGT
H2ULX4_TAKRU/122-510LGSFYLQV--------------LLQV..LIILSGNYNFFNLLTLTLCLSLLD........D..........QHVHF....
B0WW43_CULQU/88-531MFSLWWQV--------------FLHL..NIIGSGNYGFLSLIVMTLLLTLVD........D...................
U6I483_ECHMU/120-559IFSFFAKV--------------MFHA..DLIVIGNHGIYNLLSIVLSFALLP........E...................
W5K8X7_ASTMX/123-584LTAFYMQV--------------LLQV..LIILSGNYNFFNLLTIVLCFSLLD........D..........EHVNF....
T1G9T0_HELRO/127-575NASFYLQS--------------FLMF..VIILTGNYNFFNWVSIVMCLSLVD........D..........RFLAC....
Q45WA6_TOXGO/205-775LFAGIVQI--------------AFQV..GILLSGNLAFLNYLTIVSAIMCLD........D..........HFLTC.LFP
B7FQF3_PHATC/171-536RLGGTIQL--------------IFQS..ILICSGNFSFLNWLTMIPAIMCLD........DALVGRMFSPAMQQAA.VFA
A1R4Z7_ARTAT/124-478SIAAGIII--------------ATQL..WLVGTGNFAWLNWVAIVLAFAAVS........D..........PVAHA.VFP
H2ULX3_TAKRU/164-554LGSFYLQV--------------LLQV..LIILSGNYNFFNLLTLTLCLSLLD........D..........QHVHF....
E0W2V6_PEDHC/123-573QMGFFFQV--------------FLQL..MIIFTGNYNFFNLLTIVLCFSLLD........D..........RFFYP....
LMF2_RAT/122-589LSAFYAQA--------------LLQI..LIIITGNYNFFNLLTLVLTTALLD........D..........RHLSA....
G7Q042_MACFA/113-483IIHGALQI--------------LFQA..ILIVSGNLSFLNWLTMVPSLACFD........D..........ATLGF.LFP
A0C620_PARTE/119-569IFGFILQF--------------LMQI..GIILTGNYNFFNLLSIVLAMVVLD........D..........HFIYK....
Q73TN3_MYCPA/121-476GVAAAIIV--------------VTQL..WLVASGNFAWLNWVTILLACSAID........D..........SSVAL.LLP
G3PHM6_GASAC/9-458LGAFYLQV--------------LLQV..LIILTGNYNFFNLLTLALCLSLLD........D..........QHVNF....
L0J1F6_MYCSM/123-475SVAAAIVI--------------VTQL..WLVLSGNFAWLNWVTIILAFCAID........H..........ASFAA.VLP
W5NJI5_LEPOC/122-585LGAFYFQV--------------LLQV..LIILTGNYNFFNLLTIALCFSLLD........D..........DQVNS....
T1HC95_RHOPR/92-555TTAFFIQV--------------FLQL..MIIISGNYNFFNFLIFALCFSLLD........D..........DFFYG....
W5JUK3_ANODA/140-616RFALVWHV--------------FLHA..NIIGCGNYGFLSPLVLTLMVTLLD........D...................
T1G1C1_HELRO/128-506IFGGLVQI--------------VFQI..VLIISGNLSFLNWLTIAPCLACFD........D..........LSLSY.FFS
D2RQ81_HALTV/123-476SLAGAATI--------------GFMG..WLMLTGNFAWLNALTIVLAIATFS........D..........GALEW.ALP
E3LDC7_CAERE/122-552YVVFFCQI--------------LLMI..LTMLTGNNGFFNYNVIILLVSLLE............................
E2AAK1_CAMFO/89-546IIAFYLQV--------------FLQI..CIIATGNYNFFNFLTICLCISLLD........D..........QFFYK....
D7FTX6_ECTSI/148-515LLAGGIQT--------------GFQL..AIIISGNLSFLNYLTILPFIWCFD........D..........RALAW.LFP
Q7PZH8_ANOGA/94-545RFAVWWHV--------------FLHL..NIIGCGNYGFLSPLVLTLLVALLD........D...................
F0VNS7_NEOCL/190-761LFGGVIQI--------------AFQV..AILVSGNLAFLNYMTVVSAIMCLD........D..........HFLTC.LFP
F4Q4V3_DICFS/211-592ITACLINI--------------LLQI..CIILTGNYNFFNYLTIALLLMLLD........D...................
U1NTR0_ASCSU/122-570VFSFYPQI--------------LLMV..CIMLTGNYNFFNALYALHCMAVLN........D..........SDEYN....
C3Z738_BRAFL/141-522FTCGFLQI--------------LFQV..ILIISGNLSFLNWLTILPSICSFD........D..........AHLAC.LFP
A7RJW9_NEMVE/81-462IWGGLIQI--------------AFQV..ILIISGNLSFLNWLTILPSIACFD........D..........SSLAW.LFS
A0JUS2_ARTS2/124-486GVAAGIVI--------------FTQL..WLVASGNFAWLNWMAILLAFAAVS........D..........PVAHA.VLP
G1NWH4_MYOLU/169-550ILHGALQI--------------LFQV..VLIVSGNLSFLNWLTIVPSIACFD........D..........ATLGF.LFP
F8JRN7_STREN/121-473SVAAGIVI--------------VTQL..WLVASGNFAWLNWLTIVLAFAAVD........G..........ARAAD.VLG
D8J6J5_HALJB/125-476ALAGVATI--------------GFQG..WLMITGNFAWLNALTIVLAIATFS........D..........GVLST.VLP
Q21435_CAEEL/1-432YFVFFCQV--------------LLTT..LTLFTGNNGFFNYNILVLMVSLLQ............................
A7AW74_BABBO/157-697IIGGFVAL--------------FYTL..FLGCVSENGSYYLLLASTSILCFD........D..........YF.......

PF04173

Q97X72_SULSO/12-173--------------------------------------------------------------------------------
Q97XJ3_SULSO/18-183--------------------------------------------------------------------------------
Q973M6_SULTO/9-177--------------------------------------------------------------------------------
Q97UC4_SULSO/10-178--------------------------------------------------------------------------------
Q8AAF0_BACTN/18-181--------------------------------------------------------------------------------
F4B442_ACIHW/20-184--------------------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94--------------------------------------------------------------------------------
Q87K55_VIBPA/16-104--------------------------------------------------------------------------------
Q8KEE1_CHLTE/7-88--------------------------------------------------------------------------------
Q9RTC4_DEIRA/8-92--------------------------------------------------------------------------------
Q7TUM8_PROMM/37-127--------------------------------------------------------------------------------
Q7VHA8_HELHP/8-89--------------------------------------------------------------------------------
Q89FZ6_BRADU/10-92--------------------------------------------------------------------------------
Q8EDN3_SHEON/21-107--------------------------------------------------------------------------------
Q8A9J9_BACTN/19-101--------------------------------------------------------------------------------
Q83BV7_COXBU/131-217--------------------------------------------------------------------------------
Q92W39_RHIME/11-107--------------------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105--------------------------------------------------------------------------------
Q7V0B0_PROMP/15-102--------------------------------------------------------------------------------
Q984Q4_RHILO/6-88--------------------------------------------------------------------------------
Q9A3E7_CAUCR/28-117--------------------------------------------------------------------------------
Q983U6_RHILO/19-101--------------------------------------------------------------------------------
Q82HN4_STRAW/24-126--------------------------------------------------------------------------------
Q7VUY8_BORPE/24-126--------------------------------------------------------------------------------
Q831Y6_ENTFA/7-87--------------------------------------------------------------------------------
Q983U8_RHILO/8-90--------------------------------------------------------------------------------
Q7V328_PROMP/44-134--------------------------------------------------------------------------------
Q7MRA2_WOLSU/17-98--------------------------------------------------------------------------------
Q8F8N5_LEPIN/13-98--------------------------------------------------------------------------------
Q9HYW2_PSEAE/22-108--------------------------------------------------------------------------------
Q88P63_PSEPK/6-95--------------------------------------------------------------------------------
Q9HWH6_PSEAE/14-96--------------------------------------------------------------------------------
Q8FR06_COREF/10-94--------------------------------------------------------------------------------
Q9KYL5_STRCO/4-96--------------------------------------------------------------------------------
Q8NR01_CORGL/191-281--------------------------------------------------------------------------------
Q8XR31_RALSO/30-119--------------------------------------------------------------------------------
Q92SD1_RHIME/6-88--------------------------------------------------------------------------------
Q7NPD1_GLOVI/22-104--------------------------------------------------------------------------------
Q7NZE1_CHRVO/10-92--------------------------------------------------------------------------------
Q7VDS1_PROMA/43-133--------------------------------------------------------------------------------
Q7N096_PHOLL/8-89--------------------------------------------------------------------------------
Q8XWH4_RALSO/12-94--------------------------------------------------------------------------------
Q7VYL1_BORPE/8-89--------------------------------------------------------------------------------
Q7US51_RHOBA/24-106--------------------------------------------------------------------------------
Q88G88_PSEPK/13-95--------------------------------------------------------------------------------
Q812S4_BACCR/6-87--------------------------------------------------------------------------------
Q88KH7_PSEPK/17-105--------------------------------------------------------------------------------
Q98JU3_RHILO/13-95--------------------------------------------------------------------------------
Q89MP6_BRADU/4-104--------------------------------------------------------------------------------
CATD_BACSU/8-88--------------------------------------------------------------------------------
Q7VTR5_BORPE/10-91--------------------------------------------------------------------------------
Q7UE97_RHOBA/16-98--------------------------------------------------------------------------------
Q7NA66_PHOLL/20-124--------------------------------------------------------------------------------
Q7VBT6_PROMA/9-93--------------------------------------------------------------------------------
Q8FSC2_COREF/11-95--------------------------------------------------------------------------------
Q98K48_RHILO/27-109--------------------------------------------------------------------------------
Q7NSB1_CHRVO/12-100--------------------------------------------------------------------------------
Q9HZY2_PSEAE/16-104--------------------------------------------------------------------------------
Q88K91_PSEPK/19-105--------------------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95--------------------------------------------------------------------------------
Q8Y2U2_RALSO/28-111--------------------------------------------------------------------------------
Q9CP47_PASMU/16-102--------------------------------------------------------------------------------
Q9HWS4_PSEAE/24-110--------------------------------------------------------------------------------
Q82PS9_STRAW/30-117--------------------------------------------------------------------------------
MHQP_BACSU/5-93--------------------------------------------------------------------------------
Q883U2_PSESM/16-104--------------------------------------------------------------------------------
Q92TK3_RHIME/11-93--------------------------------------------------------------------------------
Q7V7V3_PROMM/10-94--------------------------------------------------------------------------------
A9CK19_AGRT5/23-105--------------------------------------------------------------------------------
Q7U687_SYNPX/15-102--------------------------------------------------------------------------------
Q89EW4_BRADU/19-101--------------------------------------------------------------------------------
Y1602_HAEIN/14-100--------------------------------------------------------------------------------
Q98JF9_RHILO/23-103--------------------------------------------------------------------------------
Q8YSN3_NOSS1/6-88--------------------------------------------------------------------------------
Q92Y87_RHIME/25-105--------------------------------------------------------------------------------
YQJF_ECOLI/8-88--------------------------------------------------------------------------------
Q812I5_BACCR/5-93--------------------------------------------------------------------------------
Q8NT59_CORGL/10-94--------------------------------------------------------------------------------
Q87KG0_VIBPA/27-115--------------------------------------------------------------------------------
Q8P8R3_XANCP/15-111--------------------------------------------------------------------------------
Q89SK7_BRADU/66-148--------------------------------------------------------------------------------
Q82AZ6_STRAW/10-97--------------------------------------------------------------------------------
Q82V34_NITEU/11-94--------------------------------------------------------------------------------
Q82UE4_NITEU/22-102--------------------------------------------------------------------------------
I0IQM6_LEPFC/14-98--------------------------------------------------------------------------------
I6XG31_MYCTU/17-94--------------------------------------------------------------------------------
I6YAV3_MYCTU/114-195--------------------------------------------------------------------------------
YPHA_ECOLI/16-98--------------------------------------------------------------------------------
Q2FZM5_STAA8/5-82--------------------------------------------------------------------------------
Q2YIJ7_BRUA2/13-93--------------------------------------------------------------------------------
Q7AJS4_BACHD/8-89--------------------------------------------------------------------------------
Q7MGN3_VIBVY/23-104--------------------------------------------------------------------------------
Q8F8V4_LEPIN/14-97--------------------------------------------------------------------------------
Q9CCC8_MYCLE/7-92--------------------------------------------------------------------------------

PF13564

D1AAS7_THECD/7-112--------------------------------------------------------------------------------
D2SF07_GEOOG/7-113--------------------------------------------------------------------------------
C5BX04_BEUC1/7-113--------------------------------------------------------------------------------
D3Q9W4_STANL/7-109--------------------------------------------------------------------------------
D1BDS4_SANKS/7-113--------------------------------------------------------------------------------
D1BYA3_XYLCX/7-112--------------------------------------------------------------------------------
B5HYY5_9ACTO/7-112--------------------------------------------------------------------------------
D1BVK9_XYLCX/7-113--------------------------------------------------------------------------------
A9B5S7_HERA2/7-113--------------------------------------------------------------------------------
D3Q6B3_STANL/7-112--------------------------------------------------------------------------------
C5C629_BEUC1/7-115--------------------------------------------------------------------------------
D3PWB3_STANL/7-114--------------------------------------------------------------------------------
D3EH52_GEOS4/7-112--------------------------------------------------------------------------------
A4F848_SACEN/7-108--------------------------------------------------------------------------------
A1SIQ7_NOCSJ/7-109--------------------------------------------------------------------------------
C6WJU0_ACTMD/7-113--------------------------------------------------------------------------------
B5I6V7_9ACTO/19-120--------------------------------------------------------------------------------
C6VZE8_DYAFD/11-112--------------------------------------------------------------------------------
Q0SGE8_RHOSR/7-112--------------------------------------------------------------------------------
D5UX83_TSUPD/7-115--------------------------------------------------------------------------------
D3PZS4_STANL/7-112--------------------------------------------------------------------------------
D3PUC2_STANL/7-110--------------------------------------------------------------------------------
C9Z9S2_STRSW/7-108--------------------------------------------------------------------------------
A1TE84_MYCVP/11-113--------------------------------------------------------------------------------
D2AS43_STRRD/5-106--------------------------------------------------------------------------------
D2PZ45_KRIFD/7-114--------------------------------------------------------------------------------
B1MM14_MYCA9/10-112--------------------------------------------------------------------------------
Q65HS4_BACLD/5-107--------------------------------------------------------------------------------
Q5YWI3_NOCFA/31-132--------------------------------------------------------------------------------
D3F1P3_CONWI/7-108--------------------------------------------------------------------------------
C7PZU5_CATAD/19-125--------------------------------------------------------------------------------
B5H4W5_STRPR/7-108--------------------------------------------------------------------------------
Q11P05_CYTH3/10-110--------------------------------------------------------------------------------
D5UGI3_CELFN/7-114--------------------------------------------------------------------------------
Q89Y33_BRADU/62-168--------------------------------------------------------------------------------
C0ZKK1_BREBN/2-104--------------------------------------------------------------------------------
B1MDG2_MYCA9/7-115--------------------------------------------------------------------------------
Q7UL85_RHOBA/23-124--------------------------------------------------------------------------------
C7PUE7_CHIPD/10-111--------------------------------------------------------------------------------
D3Q6A9_STANL/7-109--------------------------------------------------------------------------------
Q82R50_STRAW/28-129--------------------------------------------------------------------------------
D2QST6_SPILD/17-122--------------------------------------------------------------------------------
Q5YXM8_NOCFA/33-141--------------------------------------------------------------------------------
C7PKH0_CHIPD/17-121--------------------------------------------------------------------------------
B2JL65_BURP8/47-153--------------------------------------------------------------------------------
D2ASD1_STRRD/34-143--------------------------------------------------------------------------------
B0UIU5_METS4/14-111--------------------------------------------------------------------------------
D2PS28_KRIFD/35-136--------------------------------------------------------------------------------
C7PYY8_CATAD/7-121--------------------------------------------------------------------------------
A9GJR9_SORC5/11-117--------------------------------------------------------------------------------
B8IER0_METNO/21-116--------------------------------------------------------------------------------
Q1IKM4_KORVE/10-111--------------------------------------------------------------------------------
A9FEJ3_SORC5/27-126--------------------------------------------------------------------------------
Q2S0Z3_SALRD/8-118--------------------------------------------------------------------------------
Q11S70_CYTH3/11-112--------------------------------------------------------------------------------
Q5Z2J9_NOCFA/19-120--------------------------------------------------------------------------------
C6X539_FLAB3/10-112--------------------------------------------------------------------------------
B5HQQ2_9ACTO/55-152--------------------------------------------------------------------------------
A7H7U7_ANADF/31-130--------------------------------------------------------------------------------
A5FBV8_FLAJ1/7-111--------------------------------------------------------------------------------
D2QN87_SPILD/19-118--------------------------------------------------------------------------------
A9B014_HERA2/18-116--------------------------------------------------------------------------------
Q1D110_MYXXD/7-102--------------------------------------------------------------------------------
C7PKI9_CHIPD/12-107--------------------------------------------------------------------------------
A9F3Z6_SORC5/44-143--------------------------------------------------------------------------------
D9QMH9_BRESC/33-140--------------------------------------------------------------------------------
Q0SJ69_RHOSR/31-130--------------------------------------------------------------------------------
Q1IPI6_KORVE/25-123--------------------------------------------------------------------------------
A9UV76_MONBE/637-749--------------------------------------------------------------------------------
B4RA61_PHEZH/23-122--------------------------------------------------------------------------------
C5C5Y3_BEUC1/41-144--------------------------------------------------------------------------------
C0Z8W5_BREBN/15-114--------------------------------------------------------------------------------
B9JK89_AGRRK/29-136--------------------------------------------------------------------------------
B1MHX9_MYCA9/33-130--------------------------------------------------------------------------------
A5V4G4_SPHWW/11-106--------------------------------------------------------------------------------
A4YMD8_BRASO/6-106--------------------------------------------------------------------------------
B7VRG5_VIBSL/12-116--------------------------------------------------------------------------------
C3AVH4_BACMY/21-123--------------------------------------------------------------------------------
Q73Z31_MYCPA/32-131--------------------------------------------------------------------------------
Q81NN7_BACAN/4-103--------------------------------------------------------------------------------
Q81U50_BACAN/7-106--------------------------------------------------------------------------------
Q8F0G1_LEPIN/13-113--------------------------------------------------------------------------------

PF07291

MAUE_METEA/3-186--------------------------------------------------------------------------------
MAUE_METFK/2-184--------------------------------------------------------------------------------
A1BB98_PARDP/3-185--------------------------------------------------------------------------------

PF04224

Q9CJR3_PASMU/1-137--------------------------------------------------------------------------------
O25289_HELPY/5-190--------------------------------------------------------------------------------
RCLC_ECOLI/2-182--------------------------------------------------------------------------------
Q9KRP9_VIBCH/1-146--------------------------------------------------------------------------------
Y219_HAEIN/13-209--------------------------------------------------------------------------------

PF05514

O23298_ARATH/1-138--------------------------------------------------------------------------------
Q9LTD0_ARATH/18-201--------------------------------------------------------------------------------
Q0IXE1_ORYSJ/1-138--------------------------------------------------------------------------------
O22690_ARATH/1-138--------------------------------------------------------------------------------
I1PJ49_ORYGL/1-138--------------------------------------------------------------------------------
Q8GYI3_ARATH/20-151--------------------------------------------------------------------------------
Q8H080_ORYSJ/1-138--------------------------------------------------------------------------------

PF02077

SURF4_CAEEL/11-277--------------------------------------------------------------------------------
YFC7_CAEEL/4-269--------------------------------------------------------------------------------
ERV29_YEAST/48-310--------------------------------------------------------------------------------
SURF4_SCHPO/33-302--------------------------------------------------------------------------------
SURF4_DROME/5-270--------------------------------------------------------------------------------
SURF4_HUMAN/4-269--------------------------------------------------------------------------------

PF13781

C3AK78_BACMY/185-286--------------------------------------------------------------------------------
D3E5H6_GEOS4/180-281--------------------------------------------------------------------------------
Q65IN6_BACLD/178-279--------------------------------------------------------------------------------
C6CYU2_PAESJ/180-281--------------------------------------------------------------------------------
Q8ESB3_OCEIH/179-280--------------------------------------------------------------------------------
A1BFB6_CHLPD/25-125--------------------------------------------------------------------------------
B4SAW4_PELPB/19-119--------------------------------------------------------------------------------
B3EQZ0_CHLPB/20-120--------------------------------------------------------------------------------
B4S7F5_PROA2/21-121--------------------------------------------------------------------------------
Q3ARZ2_CHLCH/17-117--------------------------------------------------------------------------------
B3QTS0_CHLT3/26-127--------------------------------------------------------------------------------
Q1H1D1_METFK/335-436--------------------------------------------------------------------------------
C7R8T5_KANKD/19-119--------------------------------------------------------------------------------
Q2SM61_HAHCH/17-117--------------------------------------------------------------------------------
Q3SHK0_THIDA/314-415--------------------------------------------------------------------------------
Q2Y734_NITMU/330-431--------------------------------------------------------------------------------
Q5NY22_AROAE/320-421--------------------------------------------------------------------------------
A1K6I8_AZOSB/336-437--------------------------------------------------------------------------------
Q1LGK6_RALME/315-415--------------------------------------------------------------------------------
C1F939_ACIC5/18-120--------------------------------------------------------------------------------
Q7NW81_CHRVO/13-112--------------------------------------------------------------------------------
Q11TY1_CYTH3/19-119--------------------------------------------------------------------------------
C7PI03_CHIPD/14-115--------------------------------------------------------------------------------
A1VMB6_POLNA/12-112--------------------------------------------------------------------------------
Q0ANG5_MARMM/322-422--------------------------------------------------------------------------------
A9C3F1_DELAS/21-121--------------------------------------------------------------------------------
Q4K472_PSEF5/309-409--------------------------------------------------------------------------------
Q89WY4_BRADU/329-429--------------------------------------------------------------------------------
Q2K6I2_RHIEC/316-414--------------------------------------------------------------------------------
A1TNI5_ACIAC/22-122--------------------------------------------------------------------------------
B9JGJ5_AGRRK/322-420--------------------------------------------------------------------------------
A5V930_SPHWW/323-422--------------------------------------------------------------------------------
Q2JZG1_RHIEC/327-426--------------------------------------------------------------------------------
Q11CJ7_CHESB/321-420--------------------------------------------------------------------------------
A7IKV9_XANP2/322-421--------------------------------------------------------------------------------
Q2S702_HAHCH/327-427--------------------------------------------------------------------------------
C2WZH4_BACCE/180-281--------------------------------------------------------------------------------
G8PNG3_PSEUV/327-425--------------------------------------------------------------------------------
Q5ZVY7_LEGPH/322-422--------------------------------------------------------------------------------
Q9A4D7_CAUCR/322-420--------------------------------------------------------------------------------
Q9I6F8_PSEAE/307-408--------------------------------------------------------------------------------

PF06762

K1QJR5_CRAGI/165-541GR..............AGSVK....................DRVNRLQ..DRASQQ..L.....................
LMF2_XENTR/122-588................................................................................
E4N190_KITSK/121-477VGP.............DPAYG..........................PAYGSTYGPQPGW....................
F2UH93_SALR5/134-601................................................................................
I3KCS2_ORENI/122-585................................................................................
F1P0J3_CHICK/7-472................................................................................
E1GDX1_LOALO/74-452................................................................................
E2B8W4_HARSA/122-575................................................................................
F0Y0J4_AURAN/130-628................................................................................
Q08T93_STIAD/249-609................................................................................
K7J1M5_NASVI/123-578................................................................................
E5SED2_TRISP/131-543................................................................................
A1TEH0_MYCVP/123-475MSA.............PPARA..........................GP........PPW....................
F8L1K9_PARAV/119-467................................................................................
F5YS29_MYCSD/125-477GLR.............PPEMP..........................ES........PVW....................
G3UCY5_LOXAF/167-547SR..............PGGLR....................DRVLQLQERE.PGSSPHL.....................
Q4N0L2_THEPA/112-755................................................................................
H9GJK7_ANOCA/78-542................................................................................
G3VQT8_SARHA/6-467................................................................................
A0QT94_MYCS2/77-429VSA.............APDVG..........................DP........PVW....................
B3DXT0_METI4/128-489................................................................................
H9GAZ9_ANOCA/164-545SF..............PLSLD....................TRVLDNQRLLSACRQLP......................
T1KS50_TETUR/132-583................................................................................
M3ZPC1_XIPMA/122-585................................................................................
Q234A3_TETTS/140-610................................................................................
W5KQN4_ASTMX/197-654................................................................................
G1QIY9_NOMLE/23-406................................................................................
F4WBZ8_ACREC/123-579................................................................................
F1Q4Q4_DANRE/125-588................................................................................
W5KBQ4_ASTMX/194-574PT...............GGPR....................KTLRSIQAEDTAEHSPPP.....................
G0MSI2_CAEBE/122-480................................................................................
U6IKR5_HYMMI/134-572................................................................................
Q1IR35_KORVE/151-523................................................................................
Z4YJR1_MOUSE/170-551SG..............PQGLK....................KQVLEIQREDTQRVQPKPR....................
M4AS74_XIPMA/175-556CG...............SRAK....................EAALEIQKKEVTGQVPKPT....................
A8XC70_CAEBR/122-552................................................................................
C5BX37_BEUC1/125-479FLPEPADDGVASGANIG...............................................................
V4Z567_TOXGO/197-765SKTLERLQPLLQGCLGAWSLPKHQAWPVDSCSEHTNEHQGVGSVKDPEA.......AALL..NDGGSQ..LEWSVDTDDD
G2NZI2_STRVO/121-473LPR.............PPALA..........................AP........PVW....................
H6RBI8_NOCCG/121-470I.E.............PAAAP..........................DG........PLW....................
H8MNZ0_CORCM/241-604................................................................................
E9GA51_DAPPU/120-571................................................................................
J9JZT7_ACYPI/128-582................................................................................
N0BDW0_9RHIZ/243-594................................................................................
D7EJW8_TRICA/90-537................................................................................
LMF2_BOVIN/122-590................................................................................
R4VWD1_9EURY/128-492AGPSA...........VGAAP....................S...............PLI....................
G8TN66_NIAKG/129-490KR.......................................LVRKADAARENAAYSKPMQ....................
E9JDB8_SOLIN/123-577................................................................................
W5QF34_SHEEP/126-543................................................................................
E9T639_COREQ/121-473VSS.............PSEMT..........................SS........PPW....................
Q1CX59_MYXXD/289-654................................................................................
W5TQD8_9NOCA/121-473LPA.............PPDAP..........................AA........PPW....................
B9M9C6_GEODF/118-468VPPFA...........P...P....................P...............PLF....................
Q6MNI0_BDEBA/151-506................................................................................
J9KB65_ACYPI/128-591................................................................................
A8Q0Q7_BRUMA/122-570................................................................................
Q16NM9_AEDAE/95-538................................................................................
H3FMM6_PRIPA/124-598................................................................................
G4VFY8_SCHMA/126-567................................................................................
B3DK37_DANRE/122-584................................................................................
B2HN18_MYCMM/121-472IPV.............RAALP..........................PP........PTW....................
D0NCT8_PHYIT/130-640................................................................................
H3B2B1_LATCH/185-566SR..............EGGVK....................DQVSRLRKEEEAGLKLPT.....................
F6FUF5_ISOV2/129-486WL..............PFVPD....................AGTAAGGAAGGAPGGLPVA....................
B8C9U9_THAPS/126-526PTTNAFVASVFSNHLTPRITP...........................................................
H2ULX4_TAKRU/122-510................................................................................
B0WW43_CULQU/88-531................................................................................
U6I483_ECHMU/120-559................................................................................
W5K8X7_ASTMX/123-584................................................................................
T1G9T0_HELRO/127-575................................................................................
Q45WA6_TOXGO/205-775SAILSRLPELVRGCAGYWSLPQIQAWPFPQLFPGEEH....GKGKGRQANDRPEAEASLL.DKDAGRDETLPFNAATDDS
B7FQF3_PHATC/171-536VATS...........RPSIL............................................................
A1R4Z7_ARTAT/124-478FIPLEWHQSTET.............................................PVW....................
H2ULX3_TAKRU/164-554................................................................................
E0W2V6_PEDHC/123-573................................................................................
LMF2_RAT/122-589................................................................................
G7Q042_MACFA/113-483SG..............PGSLK....................DRVLQMQR.EIRGARPKP.....................
A0C620_PARTE/119-569................................................................................
Q73TN3_MYCPA/121-476................KSVLP....................GHGEPSAS........PLW....................
G3PHM6_GASAC/9-458................................................................................
L0J1F6_MYCSM/123-475VPE.............PPALS..........................NP........PLW....................
W5NJI5_LEPOC/122-585................................................................................
T1HC95_RHOPR/92-555................................................................................
W5JUK3_ANODA/140-616................................................................................
T1G1C1_HELRO/128-506KT..............E...V....................INVKLIQRQNELEKQTPL.....................
D2RQ81_HALTV/123-476V..TA...........PETVA....................T...............PLY....................
E3LDC7_CAERE/122-552................................................................................
E2AAK1_CAMFO/89-546................................................................................
D7FTX6_ECTSI/148-515GA.........................................ARSVAEAASVGVTPPI.....................
Q7PZH8_ANOGA/94-545................................................................................
F0VNS7_NEOCL/190-761SATLSRLPELVRGCRGTWSCPLVQAWPFRKSPLGASA....GEAKDPQAKNGSDAESPLLGNRDAGREGTLPLSASTDDS
F4Q4V3_DICFS/211-592................................................................................
U1NTR0_ASCSU/122-570................................................................................
C3Z738_BRAFL/141-522SW..............RGGTK....................WQVAQIQQEERSGRAPPP.....................
A7RJW9_NEMVE/81-462SF..............SGA.R....................IKVQEIQKAEKEHPS.KP.....................
A0JUS2_ARTS2/124-486VIPLDWHTYGSTDSSGAGAQT....................................PVW....................
G1NWH4_MYOLU/169-550SG..............PGSLK....................DRVLKMQKEEAREARPTP.....................
F8JRN7_STREN/121-473LPR.............PPASP..........................AA........PVW....................
D8J6J5_HALJB/125-476V..TA...........PAVAP....................T...............PLY....................
Q21435_CAEEL/1-432................................................................................
A7AW74_BABBO/157-697................................................................................

PF04173

Q97X72_SULSO/12-173--------------------------------------------------------------------------------
Q97XJ3_SULSO/18-183--------------------------------------------------------------------------------
Q973M6_SULTO/9-177--------------------------------------------------------------------------------
Q97UC4_SULSO/10-178--------------------------------------------------------------------------------
Q8AAF0_BACTN/18-181--------------------------------------------------------------------------------
F4B442_ACIHW/20-184--------------------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94--------------------------------------------------------------------------------
Q87K55_VIBPA/16-104--------------------------------------------------------------------------------
Q8KEE1_CHLTE/7-88--------------------------------------------------------------------------------
Q9RTC4_DEIRA/8-92--------------------------------------------------------------------------------
Q7TUM8_PROMM/37-127--------------------------------------------------------------------------------
Q7VHA8_HELHP/8-89--------------------------------------------------------------------------------
Q89FZ6_BRADU/10-92--------------------------------------------------------------------------------
Q8EDN3_SHEON/21-107--------------------------------------------------------------------------------
Q8A9J9_BACTN/19-101--------------------------------------------------------------------------------
Q83BV7_COXBU/131-217--------------------------------------------------------------------------------
Q92W39_RHIME/11-107--------------------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105--------------------------------------------------------------------------------
Q7V0B0_PROMP/15-102--------------------------------------------------------------------------------
Q984Q4_RHILO/6-88--------------------------------------------------------------------------------
Q9A3E7_CAUCR/28-117--------------------------------------------------------------------------------
Q983U6_RHILO/19-101--------------------------------------------------------------------------------
Q82HN4_STRAW/24-126--------------------------------------------------------------------------------
Q7VUY8_BORPE/24-126--------------------------------------------------------------------------------
Q831Y6_ENTFA/7-87--------------------------------------------------------------------------------
Q983U8_RHILO/8-90--------------------------------------------------------------------------------
Q7V328_PROMP/44-134--------------------------------------------------------------------------------
Q7MRA2_WOLSU/17-98--------------------------------------------------------------------------------
Q8F8N5_LEPIN/13-98--------------------------------------------------------------------------------
Q9HYW2_PSEAE/22-108--------------------------------------------------------------------------------
Q88P63_PSEPK/6-95--------------------------------------------------------------------------------
Q9HWH6_PSEAE/14-96--------------------------------------------------------------------------------
Q8FR06_COREF/10-94--------------------------------------------------------------------------------
Q9KYL5_STRCO/4-96--------------------------------------------------------------------------------
Q8NR01_CORGL/191-281--------------------------------------------------------------------------------
Q8XR31_RALSO/30-119--------------------------------------------------------------------------------
Q92SD1_RHIME/6-88--------------------------------------------------------------------------------
Q7NPD1_GLOVI/22-104--------------------------------------------------------------------------------
Q7NZE1_CHRVO/10-92--------------------------------------------------------------------------------
Q7VDS1_PROMA/43-133--------------------------------------------------------------------------------
Q7N096_PHOLL/8-89--------------------------------------------------------------------------------
Q8XWH4_RALSO/12-94--------------------------------------------------------------------------------
Q7VYL1_BORPE/8-89--------------------------------------------------------------------------------
Q7US51_RHOBA/24-106--------------------------------------------------------------------------------
Q88G88_PSEPK/13-95--------------------------------------------------------------------------------
Q812S4_BACCR/6-87--------------------------------------------------------------------------------
Q88KH7_PSEPK/17-105--------------------------------------------------------------------------------
Q98JU3_RHILO/13-95--------------------------------------------------------------------------------
Q89MP6_BRADU/4-104--------------------------------------------------------------------------------
CATD_BACSU/8-88--------------------------------------------------------------------------------
Q7VTR5_BORPE/10-91--------------------------------------------------------------------------------
Q7UE97_RHOBA/16-98--------------------------------------------------------------------------------
Q7NA66_PHOLL/20-124--------------------------------------------------------------------------------
Q7VBT6_PROMA/9-93--------------------------------------------------------------------------------
Q8FSC2_COREF/11-95--------------------------------------------------------------------------------
Q98K48_RHILO/27-109--------------------------------------------------------------------------------
Q7NSB1_CHRVO/12-100--------------------------------------------------------------------------------
Q9HZY2_PSEAE/16-104--------------------------------------------------------------------------------
Q88K91_PSEPK/19-105--------------------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95--------------------------------------------------------------------------------
Q8Y2U2_RALSO/28-111--------------------------------------------------------------------------------
Q9CP47_PASMU/16-102--------------------------------------------------------------------------------
Q9HWS4_PSEAE/24-110--------------------------------------------------------------------------------
Q82PS9_STRAW/30-117--------------------------------------------------------------------------------
MHQP_BACSU/5-93--------------------------------------------------------------------------------
Q883U2_PSESM/16-104--------------------------------------------------------------------------------
Q92TK3_RHIME/11-93--------------------------------------------------------------------------------
Q7V7V3_PROMM/10-94--------------------------------------------------------------------------------
A9CK19_AGRT5/23-105--------------------------------------------------------------------------------
Q7U687_SYNPX/15-102--------------------------------------------------------------------------------
Q89EW4_BRADU/19-101--------------------------------------------------------------------------------
Y1602_HAEIN/14-100--------------------------------------------------------------------------------
Q98JF9_RHILO/23-103--------------------------------------------------------------------------------
Q8YSN3_NOSS1/6-88--------------------------------------------------------------------------------
Q92Y87_RHIME/25-105--------------------------------------------------------------------------------
YQJF_ECOLI/8-88--------------------------------------------------------------------------------
Q812I5_BACCR/5-93--------------------------------------------------------------------------------
Q8NT59_CORGL/10-94--------------------------------------------------------------------------------
Q87KG0_VIBPA/27-115--------------------------------------------------------------------------------
Q8P8R3_XANCP/15-111--------------------------------------------------------------------------------
Q89SK7_BRADU/66-148--------------------------------------------------------------------------------
Q82AZ6_STRAW/10-97--------------------------------------------------------------------------------
Q82V34_NITEU/11-94--------------------------------------------------------------------------------
Q82UE4_NITEU/22-102--------------------------------------------------------------------------------
I0IQM6_LEPFC/14-98--------------------------------------------------------------------------------
I6XG31_MYCTU/17-94--------------------------------------------------------------------------------
I6YAV3_MYCTU/114-195--------------------------------------------------------------------------------
YPHA_ECOLI/16-98--------------------------------------------------------------------------------
Q2FZM5_STAA8/5-82--------------------------------------------------------------------------------
Q2YIJ7_BRUA2/13-93--------------------------------------------------------------------------------
Q7AJS4_BACHD/8-89--------------------------------------------------------------------------------
Q7MGN3_VIBVY/23-104--------------------------------------------------------------------------------
Q8F8V4_LEPIN/14-97--------------------------------------------------------------------------------
Q9CCC8_MYCLE/7-92--------------------------------------------------------------------------------

PF13564

D1AAS7_THECD/7-112--------------------------------------------------------------------------------
D2SF07_GEOOG/7-113--------------------------------------------------------------------------------
C5BX04_BEUC1/7-113--------------------------------------------------------------------------------
D3Q9W4_STANL/7-109--------------------------------------------------------------------------------
D1BDS4_SANKS/7-113--------------------------------------------------------------------------------
D1BYA3_XYLCX/7-112--------------------------------------------------------------------------------
B5HYY5_9ACTO/7-112--------------------------------------------------------------------------------
D1BVK9_XYLCX/7-113--------------------------------------------------------------------------------
A9B5S7_HERA2/7-113--------------------------------------------------------------------------------
D3Q6B3_STANL/7-112--------------------------------------------------------------------------------
C5C629_BEUC1/7-115--------------------------------------------------------------------------------
D3PWB3_STANL/7-114--------------------------------------------------------------------------------
D3EH52_GEOS4/7-112--------------------------------------------------------------------------------
A4F848_SACEN/7-108--------------------------------------------------------------------------------
A1SIQ7_NOCSJ/7-109--------------------------------------------------------------------------------
C6WJU0_ACTMD/7-113--------------------------------------------------------------------------------
B5I6V7_9ACTO/19-120--------------------------------------------------------------------------------
C6VZE8_DYAFD/11-112--------------------------------------------------------------------------------
Q0SGE8_RHOSR/7-112--------------------------------------------------------------------------------
D5UX83_TSUPD/7-115--------------------------------------------------------------------------------
D3PZS4_STANL/7-112--------------------------------------------------------------------------------
D3PUC2_STANL/7-110--------------------------------------------------------------------------------
C9Z9S2_STRSW/7-108--------------------------------------------------------------------------------
A1TE84_MYCVP/11-113--------------------------------------------------------------------------------
D2AS43_STRRD/5-106--------------------------------------------------------------------------------
D2PZ45_KRIFD/7-114--------------------------------------------------------------------------------
B1MM14_MYCA9/10-112--------------------------------------------------------------------------------
Q65HS4_BACLD/5-107--------------------------------------------------------------------------------
Q5YWI3_NOCFA/31-132--------------------------------------------------------------------------------
D3F1P3_CONWI/7-108--------------------------------------------------------------------------------
C7PZU5_CATAD/19-125--------------------------------------------------------------------------------
B5H4W5_STRPR/7-108--------------------------------------------------------------------------------
Q11P05_CYTH3/10-110--------------------------------------------------------------------------------
D5UGI3_CELFN/7-114--------------------------------------------------------------------------------
Q89Y33_BRADU/62-168--------------------------------------------------------------------------------
C0ZKK1_BREBN/2-104--------------------------------------------------------------------------------
B1MDG2_MYCA9/7-115--------------------------------------------------------------------------------
Q7UL85_RHOBA/23-124--------------------------------------------------------------------------------
C7PUE7_CHIPD/10-111--------------------------------------------------------------------------------
D3Q6A9_STANL/7-109--------------------------------------------------------------------------------
Q82R50_STRAW/28-129--------------------------------------------------------------------------------
D2QST6_SPILD/17-122--------------------------------------------------------------------------------
Q5YXM8_NOCFA/33-141--------------------------------------------------------------------------------
C7PKH0_CHIPD/17-121--------------------------------------------------------------------------------
B2JL65_BURP8/47-153--------------------------------------------------------------------------------
D2ASD1_STRRD/34-143--------------------------------------------------------------------------------
B0UIU5_METS4/14-111--------------------------------------------------------------------------------
D2PS28_KRIFD/35-136--------------------------------------------------------------------------------
C7PYY8_CATAD/7-121--------------------------------------------------------------------------------
A9GJR9_SORC5/11-117--------------------------------------------------------------------------------
B8IER0_METNO/21-116--------------------------------------------------------------------------------
Q1IKM4_KORVE/10-111--------------------------------------------------------------------------------
A9FEJ3_SORC5/27-126--------------------------------------------------------------------------------
Q2S0Z3_SALRD/8-118--------------------------------------------------------------------------------
Q11S70_CYTH3/11-112--------------------------------------------------------------------------------
Q5Z2J9_NOCFA/19-120--------------------------------------------------------------------------------
C6X539_FLAB3/10-112--------------------------------------------------------------------------------
B5HQQ2_9ACTO/55-152--------------------------------------------------------------------------------
A7H7U7_ANADF/31-130--------------------------------------------------------------------------------
A5FBV8_FLAJ1/7-111--------------------------------------------------------------------------------
D2QN87_SPILD/19-118--------------------------------------------------------------------------------
A9B014_HERA2/18-116--------------------------------------------------------------------------------
Q1D110_MYXXD/7-102--------------------------------------------------------------------------------
C7PKI9_CHIPD/12-107--------------------------------------------------------------------------------
A9F3Z6_SORC5/44-143--------------------------------------------------------------------------------
D9QMH9_BRESC/33-140--------------------------------------------------------------------------------
Q0SJ69_RHOSR/31-130--------------------------------------------------------------------------------
Q1IPI6_KORVE/25-123--------------------------------------------------------------------------------
A9UV76_MONBE/637-749--------------------------------------------------------------------------------
B4RA61_PHEZH/23-122--------------------------------------------------------------------------------
C5C5Y3_BEUC1/41-144--------------------------------------------------------------------------------
C0Z8W5_BREBN/15-114--------------------------------------------------------------------------------
B9JK89_AGRRK/29-136--------------------------------------------------------------------------------
B1MHX9_MYCA9/33-130--------------------------------------------------------------------------------
A5V4G4_SPHWW/11-106--------------------------------------------------------------------------------
A4YMD8_BRASO/6-106--------------------------------------------------------------------------------
B7VRG5_VIBSL/12-116--------------------------------------------------------------------------------
C3AVH4_BACMY/21-123--------------------------------------------------------------------------------
Q73Z31_MYCPA/32-131--------------------------------------------------------------------------------
Q81NN7_BACAN/4-103--------------------------------------------------------------------------------
Q81U50_BACAN/7-106--------------------------------------------------------------------------------
Q8F0G1_LEPIN/13-113--------------------------------------------------------------------------------

PF07291

MAUE_METEA/3-186--------------------------------------------------------------------------------
MAUE_METFK/2-184--------------------------------------------------------------------------------
A1BB98_PARDP/3-185--------------------------------------------------------------------------------

PF04224

Q9CJR3_PASMU/1-137--------------------------------------------------------------------------------
O25289_HELPY/5-190--------------------------------------------------------------------------------
RCLC_ECOLI/2-182--------------------------------------------------------------------------------
Q9KRP9_VIBCH/1-146--------------------------------------------------------------------------------
Y219_HAEIN/13-209--------------------------------------------------------------------------------

PF05514

O23298_ARATH/1-138--------------------------------------------------------------------------------
Q9LTD0_ARATH/18-201--------------------------------------------------------------------------------
Q0IXE1_ORYSJ/1-138--------------------------------------------------------------------------------
O22690_ARATH/1-138--------------------------------------------------------------------------------
I1PJ49_ORYGL/1-138--------------------------------------------------------------------------------
Q8GYI3_ARATH/20-151--------------------------------------------------------------------------------
Q8H080_ORYSJ/1-138--------------------------------------------------------------------------------

PF02077

SURF4_CAEEL/11-277--------------------------------------------------------------------------------
YFC7_CAEEL/4-269--------------------------------------------------------------------------------
ERV29_YEAST/48-310--------------------------------------------------------------------------------
SURF4_SCHPO/33-302--------------------------------------------------------------------------------
SURF4_DROME/5-270--------------------------------------------------------------------------------
SURF4_HUMAN/4-269--------------------------------------------------------------------------------

PF13781

C3AK78_BACMY/185-286--------------------------------------------------------------------------------
D3E5H6_GEOS4/180-281--------------------------------------------------------------------------------
Q65IN6_BACLD/178-279--------------------------------------------------------------------------------
C6CYU2_PAESJ/180-281--------------------------------------------------------------------------------
Q8ESB3_OCEIH/179-280--------------------------------------------------------------------------------
A1BFB6_CHLPD/25-125--------------------------------------------------------------------------------
B4SAW4_PELPB/19-119--------------------------------------------------------------------------------
B3EQZ0_CHLPB/20-120--------------------------------------------------------------------------------
B4S7F5_PROA2/21-121--------------------------------------------------------------------------------
Q3ARZ2_CHLCH/17-117--------------------------------------------------------------------------------
B3QTS0_CHLT3/26-127--------------------------------------------------------------------------------
Q1H1D1_METFK/335-436--------------------------------------------------------------------------------
C7R8T5_KANKD/19-119--------------------------------------------------------------------------------
Q2SM61_HAHCH/17-117--------------------------------------------------------------------------------
Q3SHK0_THIDA/314-415--------------------------------------------------------------------------------
Q2Y734_NITMU/330-431--------------------------------------------------------------------------------
Q5NY22_AROAE/320-421--------------------------------------------------------------------------------
A1K6I8_AZOSB/336-437--------------------------------------------------------------------------------
Q1LGK6_RALME/315-415--------------------------------------------------------------------------------
C1F939_ACIC5/18-120--------------------------------------------------------------------------------
Q7NW81_CHRVO/13-112--------------------------------------------------------------------------------
Q11TY1_CYTH3/19-119--------------------------------------------------------------------------------
C7PI03_CHIPD/14-115--------------------------------------------------------------------------------
A1VMB6_POLNA/12-112--------------------------------------------------------------------------------
Q0ANG5_MARMM/322-422--------------------------------------------------------------------------------
A9C3F1_DELAS/21-121--------------------------------------------------------------------------------
Q4K472_PSEF5/309-409--------------------------------------------------------------------------------
Q89WY4_BRADU/329-429--------------------------------------------------------------------------------
Q2K6I2_RHIEC/316-414--------------------------------------------------------------------------------
A1TNI5_ACIAC/22-122--------------------------------------------------------------------------------
B9JGJ5_AGRRK/322-420--------------------------------------------------------------------------------
A5V930_SPHWW/323-422--------------------------------------------------------------------------------
Q2JZG1_RHIEC/327-426--------------------------------------------------------------------------------
Q11CJ7_CHESB/321-420--------------------------------------------------------------------------------
A7IKV9_XANP2/322-421--------------------------------------------------------------------------------
Q2S702_HAHCH/327-427--------------------------------------------------------------------------------
C2WZH4_BACCE/180-281--------------------------------------------------------------------------------
G8PNG3_PSEUV/327-425--------------------------------------------------------------------------------
Q5ZVY7_LEGPH/322-422--------------------------------------------------------------------------------
Q9A4D7_CAUCR/322-420--------------------------------------------------------------------------------
Q9I6F8_PSEAE/307-408--------------------------------------------------------------------------------

PF06762

K1QJR5_CRAGI/165-541................................................................................
LMF2_XENTR/122-588.................................FQRHKKPQHKGG................................RVT
E4N190_KITSK/121-477................................................................................
F2UH93_SALR5/134-601.................................VVSSRFVDMHVS................................ARK
I3KCS2_ORENI/122-585.................................WLRKAYKTDNGN...................................
F1P0J3_CHICK/7-472.................................WMGRGKRKHGSS..................................A
E1GDX1_LOALO/74-452.................................FSTKGIYPR..Y...................................
E2B8W4_HARSA/122-575..................................RRSRGDASHML...................................
F0Y0J4_AURAN/130-628...............................................................................F
Q08T93_STIAD/249-609.................................LLRR...........................................
K7J1M5_NASVI/123-578..................................KKSRTENSKI....................................
E5SED2_TRISP/131-543................................................................................
A1TEH0_MYCVP/123-475................................................................................
F8L1K9_PARAV/119-467.................................NVWE...........................................
F5YS29_MYCSD/125-477................................................................................
G3UCY5_LOXAF/167-547................................................................................
Q4N0L2_THEPA/112-755.........FTQWKFNPFAKSDTLMKKVSIDLIESLTNSGDSVESVENVE.NEDPVDTVESVDNVDNVLECNTVRSEECT
H9GJK7_ANOCA/78-542.................................WLGHGRKKAAST...................................
G3VQT8_SARHA/6-467.................................WLGAGRTKQPPA..................................S
A0QT94_MYCS2/77-429................................................................................
B3DXT0_METI4/128-489................................................................................
H9GAZ9_ANOCA/164-545................................................................................
T1KS50_TETUR/132-583.................................FLRRSHRVPPA....................................
M3ZPC1_XIPMA/122-585.................................WLRKADKSGDEN...................................
Q234A3_TETTS/140-610..................................................WTPKFILSLLGDYNDCIKKPLKKETKSKDL
W5KQN4_ASTMX/197-654.................................HKKK.....TKT.................................KT
G1QIY9_NOMLE/23-406.................................EPGHGSRKKTAT..................................C
F4WBZ8_ACREC/123-579..................................RKSKNNKSRI....................................
F1Q4Q4_DANRE/125-588.................................PSKKRKGQEKKT.................................RS
W5KBQ4_ASTMX/194-574................................................................................
G0MSI2_CAEBE/122-480................................................................................
U6IKR5_HYMMI/134-572..............................................................................PK
Q1IR35_KORVE/151-523.................................VFRRKDI........................................
Z4YJR1_MOUSE/170-551................................................................................
M4AS74_XIPMA/175-556................................................................................
A8XC70_CAEBR/122-552................................................................................
C5BX37_BEUC1/125-479................................................................................
V4Z567_TOXGO/197-765SNQASARTCCCWYSPRILQFFRSIPRTIFPSRARNRMKRDMEESWKSMLLELVVSIGVLVLMAVATSSESPSLLSVLAII
G2NZI2_STRVO/121-473................................................................................
H6RBI8_NOCCG/121-470................................................................................
H8MNZ0_CORCM/241-604...................................RV...........................................
E9GA51_DAPPU/120-571.................................SQKPVKSS.......................................
J9JZT7_ACYPI/128-582.................................ELALARTRQ......................................
N0BDW0_9RHIZ/243-594...................................HA...........................................
D7EJW8_TRICA/90-537.................................RRKPFTKWT......................................
LMF2_BOVIN/122-590.................................KSSTSRRKRMPS..................................S
R4VWD1_9EURY/128-492................................................................................
G8TN66_NIAKG/129-490................................................................................
E9JDB8_SOLIN/123-577.................................LRKSKNDKSRI....................................
W5QF34_SHEEP/126-543.................................S..............................................
E9T639_COREQ/121-473................................................................................
Q1CX59_MYXXD/289-654...................................RV...........................................
W5TQD8_9NOCA/121-473................................................................................
B9M9C6_GEODF/118-468................................................................................
Q6MNI0_BDEBA/151-506................................................................................
J9KB65_ACYPI/128-591.................................ELALARTRQ......................................
A8Q0Q7_BRUMA/122-570.................................FSTKGIYPR..F...................................
Q16NM9_AEDAE/95-538...........................................................................RELAR
H3FMM6_PRIPA/124-598.................................YTSAAIRARGLG...................................
G4VFY8_SCHMA/126-567..........................................................................RRRRKW
B3DK37_DANRE/122-584.................................WLRRPTTKTEKT...................................
B2HN18_MYCMM/121-472................................................................................
D0NCT8_PHYIT/130-640.................................SQRESWITRVESAWHAFQTHPQ.........................
H3B2B1_LATCH/185-566................................................................................
F6FUF5_ISOV2/129-486................................................................................
B8C9U9_THAPS/126-526................................................................................
H2ULX4_TAKRU/122-510.................................WLRKRSIGSGGG...................................
B0WW43_CULQU/88-531.............................................................................REL
U6I483_ECHMU/120-559...............................................................................P
W5K8X7_ASTMX/123-584.................................WLCRRTPREERT...................................
T1G9T0_HELRO/127-575.................................WFGPNGCKTRTL...................................
Q45WA6_TOXGO/205-775LD..SPRSCCCWYRPYFPRIVRSLK...IPSRVRKQVKEEIKENWGKMLAEVVASVAMLTCMAFVTNPATSAVWMVIAVF
B7FQF3_PHATC/171-536................................................................................
A1R4Z7_ARTAT/124-478................................................................................
H2ULX3_TAKRU/164-554.................................WLRSASGSR......................................
E0W2V6_PEDHC/123-573.................................SKKKKPTFTQR....................................
LMF2_RAT/122-589.................................EPELRCHKKMPT..................................S
G7Q042_MACFA/113-483................................................................................
A0C620_PARTE/119-569..............................................................YFPSQIKQFINMPKTIEE
Q73TN3_MYCPA/121-476................................................................................
G3PHM6_GASAC/9-458.................................WLRKADKISNTGEINVFWVHWIWTFDYKLYVHPAKVPSVEHHLSLIC
L0J1F6_MYCSM/123-475................................................................................
W5NJI5_LEPOC/122-585.................................WCGHGKKKKYKS...................................
T1HC95_RHOPR/92-555..................................EGKKSTALKR....................................
W5JUK3_ANODA/140-616................................................DDKLLLKLLRDNPGTTNSGNSGVERRTRGGVV
T1G1C1_HELRO/128-506................................................................................
D2RQ81_HALTV/123-476................................................................................
E3LDC7_CAERE/122-552................................................................................
E2AAK1_CAMFO/89-546..................................RKSKNDKSRV....................................
D7FTX6_ECTSI/148-515................................................................................
Q7PZH8_ANOGA/94-545................................................EDELVVTAARQTNST.................
F0VNS7_NEOCL/190-761LD..GPRTCCCWYRPSFSRMVRSLR...IPSRVRTQVQKEIKENWGKMLLELAASAAMLTCMAFVTNPVTSAVWMVIAVF
F4Q4V3_DICFS/211-592................................................................................
U1NTR0_ASCSU/122-570.................................FSTKAITAR..F...................................
C3Z738_BRAFL/141-522................................................................................
A7RJW9_NEMVE/81-462................................................................................
A0JUS2_ARTS2/124-486................................................................................
G1NWH4_MYOLU/169-550................................................................................
F8JRN7_STREN/121-473................................................................................
D8J6J5_HALJB/125-476................................................................................
Q21435_CAEEL/1-432................................................................................
A7AW74_BABBO/157-697............WEEIGCGFLNSLVKHEAEHTLEDLAESRQDDESAPIPDSNSIPMTTPQSLK.................

PF04173

Q97X72_SULSO/12-173--------------------------------------------------------------------------------
Q97XJ3_SULSO/18-183--------------------------------------------------------------------------------
Q973M6_SULTO/9-177--------------------------------------------------------------------------------
Q97UC4_SULSO/10-178--------------------------------------------------------------------------------
Q8AAF0_BACTN/18-181--------------------------------------------------------------------------------
F4B442_ACIHW/20-184--------------------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94--------------------------------------------------------------------------------
Q87K55_VIBPA/16-104--------------------------------------------------------------------------------
Q8KEE1_CHLTE/7-88--------------------------------------------------------------------------------
Q9RTC4_DEIRA/8-92--------------------------------------------------------------------------------
Q7TUM8_PROMM/37-127--------------------------------------------------------------------------------
Q7VHA8_HELHP/8-89--------------------------------------------------------------------------------
Q89FZ6_BRADU/10-92--------------------------------------------------------------------------------
Q8EDN3_SHEON/21-107--------------------------------------------------------------------------------
Q8A9J9_BACTN/19-101--------------------------------------------------------------------------------
Q83BV7_COXBU/131-217--------------------------------------------------------------------------------
Q92W39_RHIME/11-107--------------------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105--------------------------------------------------------------------------------
Q7V0B0_PROMP/15-102--------------------------------------------------------------------------------
Q984Q4_RHILO/6-88--------------------------------------------------------------------------------
Q9A3E7_CAUCR/28-117--------------------------------------------------------------------------------
Q983U6_RHILO/19-101--------------------------------------------------------------------------------
Q82HN4_STRAW/24-126--------------------------------------------------------------------------------
Q7VUY8_BORPE/24-126--------------------------------------------------------------------------------
Q831Y6_ENTFA/7-87--------------------------------------------------------------------------------
Q983U8_RHILO/8-90--------------------------------------------------------------------------------
Q7V328_PROMP/44-134--------------------------------------------------------------------------------
Q7MRA2_WOLSU/17-98--------------------------------------------------------------------------------
Q8F8N5_LEPIN/13-98--------------------------------------------------------------------------------
Q9HYW2_PSEAE/22-108--------------------------------------------------------------------------------
Q88P63_PSEPK/6-95--------------------------------------------------------------------------------
Q9HWH6_PSEAE/14-96--------------------------------------------------------------------------------
Q8FR06_COREF/10-94--------------------------------------------------------------------------------
Q9KYL5_STRCO/4-96--------------------------------------------------------------------------------
Q8NR01_CORGL/191-281--------------------------------------------------------------------------------
Q8XR31_RALSO/30-119--------------------------------------------------------------------------------
Q92SD1_RHIME/6-88--------------------------------------------------------------------------------
Q7NPD1_GLOVI/22-104--------------------------------------------------------------------------------
Q7NZE1_CHRVO/10-92--------------------------------------------------------------------------------
Q7VDS1_PROMA/43-133--------------------------------------------------------------------------------
Q7N096_PHOLL/8-89--------------------------------------------------------------------------------
Q8XWH4_RALSO/12-94--------------------------------------------------------------------------------
Q7VYL1_BORPE/8-89--------------------------------------------------------------------------------
Q7US51_RHOBA/24-106--------------------------------------------------------------------------------
Q88G88_PSEPK/13-95--------------------------------------------------------------------------------
Q812S4_BACCR/6-87--------------------------------------------------------------------------------
Q88KH7_PSEPK/17-105--------------------------------------------------------------------------------
Q98JU3_RHILO/13-95--------------------------------------------------------------------------------
Q89MP6_BRADU/4-104--------------------------------------------------------------------------------
CATD_BACSU/8-88--------------------------------------------------------------------------------
Q7VTR5_BORPE/10-91--------------------------------------------------------------------------------
Q7UE97_RHOBA/16-98--------------------------------------------------------------------------------
Q7NA66_PHOLL/20-124--------------------------------------------------------------------------------
Q7VBT6_PROMA/9-93--------------------------------------------------------------------------------
Q8FSC2_COREF/11-95--------------------------------------------------------------------------------
Q98K48_RHILO/27-109--------------------------------------------------------------------------------
Q7NSB1_CHRVO/12-100--------------------------------------------------------------------------------
Q9HZY2_PSEAE/16-104--------------------------------------------------------------------------------
Q88K91_PSEPK/19-105--------------------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95--------------------------------------------------------------------------------
Q8Y2U2_RALSO/28-111--------------------------------------------------------------------------------
Q9CP47_PASMU/16-102--------------------------------------------------------------------------------
Q9HWS4_PSEAE/24-110--------------------------------------------------------------------------------
Q82PS9_STRAW/30-117--------------------------------------------------------------------------------
MHQP_BACSU/5-93--------------------------------------------------------------------------------
Q883U2_PSESM/16-104--------------------------------------------------------------------------------
Q92TK3_RHIME/11-93--------------------------------------------------------------------------------
Q7V7V3_PROMM/10-94--------------------------------------------------------------------------------
A9CK19_AGRT5/23-105--------------------------------------------------------------------------------
Q7U687_SYNPX/15-102--------------------------------------------------------------------------------
Q89EW4_BRADU/19-101--------------------------------------------------------------------------------
Y1602_HAEIN/14-100--------------------------------------------------------------------------------
Q98JF9_RHILO/23-103--------------------------------------------------------------------------------
Q8YSN3_NOSS1/6-88--------------------------------------------------------------------------------
Q92Y87_RHIME/25-105--------------------------------------------------------------------------------
YQJF_ECOLI/8-88--------------------------------------------------------------------------------
Q812I5_BACCR/5-93--------------------------------------------------------------------------------
Q8NT59_CORGL/10-94--------------------------------------------------------------------------------
Q87KG0_VIBPA/27-115--------------------------------------------------------------------------------
Q8P8R3_XANCP/15-111--------------------------------------------------------------------------------
Q89SK7_BRADU/66-148--------------------------------------------------------------------------------
Q82AZ6_STRAW/10-97--------------------------------------------------------------------------------
Q82V34_NITEU/11-94--------------------------------------------------------------------------------
Q82UE4_NITEU/22-102--------------------------------------------------------------------------------
I0IQM6_LEPFC/14-98--------------------------------------------------------------------------------
I6XG31_MYCTU/17-94--------------------------------------------------------------------------------
I6YAV3_MYCTU/114-195--------------------------------------------------------------------------------
YPHA_ECOLI/16-98--------------------------------------------------------------------------------
Q2FZM5_STAA8/5-82--------------------------------------------------------------------------------
Q2YIJ7_BRUA2/13-93--------------------------------------------------------------------------------
Q7AJS4_BACHD/8-89--------------------------------------------------------------------------------
Q7MGN3_VIBVY/23-104--------------------------------------------------------------------------------
Q8F8V4_LEPIN/14-97--------------------------------------------------------------------------------
Q9CCC8_MYCLE/7-92--------------------------------------------------------------------------------

PF13564

D1AAS7_THECD/7-112--------------------------------------------------------------------------------
D2SF07_GEOOG/7-113--------------------------------------------------------------------------------
C5BX04_BEUC1/7-113--------------------------------------------------------------------------------
D3Q9W4_STANL/7-109--------------------------------------------------------------------------------
D1BDS4_SANKS/7-113--------------------------------------------------------------------------------
D1BYA3_XYLCX/7-112--------------------------------------------------------------------------------
B5HYY5_9ACTO/7-112--------------------------------------------------------------------------------
D1BVK9_XYLCX/7-113--------------------------------------------------------------------------------
A9B5S7_HERA2/7-113--------------------------------------------------------------------------------
D3Q6B3_STANL/7-112--------------------------------------------------------------------------------
C5C629_BEUC1/7-115--------------------------------------------------------------------------------
D3PWB3_STANL/7-114--------------------------------------------------------------------------------
D3EH52_GEOS4/7-112--------------------------------------------------------------------------------
A4F848_SACEN/7-108--------------------------------------------------------------------------------
A1SIQ7_NOCSJ/7-109--------------------------------------------------------------------------------
C6WJU0_ACTMD/7-113--------------------------------------------------------------------------------
B5I6V7_9ACTO/19-120--------------------------------------------------------------------------------
C6VZE8_DYAFD/11-112--------------------------------------------------------------------------------
Q0SGE8_RHOSR/7-112--------------------------------------------------------------------------------
D5UX83_TSUPD/7-115--------------------------------------------------------------------------------
D3PZS4_STANL/7-112--------------------------------------------------------------------------------
D3PUC2_STANL/7-110--------------------------------------------------------------------------------
C9Z9S2_STRSW/7-108--------------------------------------------------------------------------------
A1TE84_MYCVP/11-113--------------------------------------------------------------------------------
D2AS43_STRRD/5-106--------------------------------------------------------------------------------
D2PZ45_KRIFD/7-114--------------------------------------------------------------------------------
B1MM14_MYCA9/10-112--------------------------------------------------------------------------------
Q65HS4_BACLD/5-107--------------------------------------------------------------------------------
Q5YWI3_NOCFA/31-132--------------------------------------------------------------------------------
D3F1P3_CONWI/7-108--------------------------------------------------------------------------------
C7PZU5_CATAD/19-125--------------------------------------------------------------------------------
B5H4W5_STRPR/7-108--------------------------------------------------------------------------------
Q11P05_CYTH3/10-110--------------------------------------------------------------------------------
D5UGI3_CELFN/7-114--------------------------------------------------------------------------------
Q89Y33_BRADU/62-168--------------------------------------------------------------------------------
C0ZKK1_BREBN/2-104--------------------------------------------------------------------------------
B1MDG2_MYCA9/7-115--------------------------------------------------------------------------------
Q7UL85_RHOBA/23-124--------------------------------------------------------------------------------
C7PUE7_CHIPD/10-111--------------------------------------------------------------------------------
D3Q6A9_STANL/7-109--------------------------------------------------------------------------------
Q82R50_STRAW/28-129--------------------------------------------------------------------------------
D2QST6_SPILD/17-122--------------------------------------------------------------------------------
Q5YXM8_NOCFA/33-141--------------------------------------------------------------------------------
C7PKH0_CHIPD/17-121--------------------------------------------------------------------------------
B2JL65_BURP8/47-153--------------------------------------------------------------------------------
D2ASD1_STRRD/34-143--------------------------------------------------------------------------------
B0UIU5_METS4/14-111--------------------------------------------------------------------------------
D2PS28_KRIFD/35-136--------------------------------------------------------------------------------
C7PYY8_CATAD/7-121--------------------------------------------------------------------------------
A9GJR9_SORC5/11-117--------------------------------------------------------------------------------
B8IER0_METNO/21-116--------------------------------------------------------------------------------
Q1IKM4_KORVE/10-111--------------------------------------------------------------------------------
A9FEJ3_SORC5/27-126--------------------------------------------------------------------------------
Q2S0Z3_SALRD/8-118--------------------------------------------------------------------------------
Q11S70_CYTH3/11-112--------------------------------------------------------------------------------
Q5Z2J9_NOCFA/19-120--------------------------------------------------------------------------------
C6X539_FLAB3/10-112--------------------------------------------------------------------------------
B5HQQ2_9ACTO/55-152--------------------------------------------------------------------------------
A7H7U7_ANADF/31-130--------------------------------------------------------------------------------
A5FBV8_FLAJ1/7-111--------------------------------------------------------------------------------
D2QN87_SPILD/19-118--------------------------------------------------------------------------------
A9B014_HERA2/18-116--------------------------------------------------------------------------------
Q1D110_MYXXD/7-102--------------------------------------------------------------------------------
C7PKI9_CHIPD/12-107--------------------------------------------------------------------------------
A9F3Z6_SORC5/44-143--------------------------------------------------------------------------------
D9QMH9_BRESC/33-140--------------------------------------------------------------------------------
Q0SJ69_RHOSR/31-130--------------------------------------------------------------------------------
Q1IPI6_KORVE/25-123--------------------------------------------------------------------------------
A9UV76_MONBE/637-749--------------------------------------------------------------------------------
B4RA61_PHEZH/23-122--------------------------------------------------------------------------------
C5C5Y3_BEUC1/41-144--------------------------------------------------------------------------------
C0Z8W5_BREBN/15-114--------------------------------------------------------------------------------
B9JK89_AGRRK/29-136--------------------------------------------------------------------------------
B1MHX9_MYCA9/33-130--------------------------------------------------------------------------------
A5V4G4_SPHWW/11-106--------------------------------------------------------------------------------
A4YMD8_BRASO/6-106--------------------------------------------------------------------------------
B7VRG5_VIBSL/12-116--------------------------------------------------------------------------------
C3AVH4_BACMY/21-123--------------------------------------------------------------------------------
Q73Z31_MYCPA/32-131--------------------------------------------------------------------------------
Q81NN7_BACAN/4-103--------------------------------------------------------------------------------
Q81U50_BACAN/7-106--------------------------------------------------------------------------------
Q8F0G1_LEPIN/13-113--------------------------------------------------------------------------------

PF07291

MAUE_METEA/3-186--------------------------------------------------------------------------------
MAUE_METFK/2-184--------------------------------------------------------------------------------
A1BB98_PARDP/3-185--------------------------------------------------------------------------------

PF04224

Q9CJR3_PASMU/1-137--------------------------------------------------------------------------------
O25289_HELPY/5-190--------------------------------------------------------------------------------
RCLC_ECOLI/2-182--------------------------------------------------------------------------------
Q9KRP9_VIBCH/1-146--------------------------------------------------------------------------------
Y219_HAEIN/13-209--------------------------------------------------------------------------------

PF05514

O23298_ARATH/1-138--------------------------------------------------------------------------------
Q9LTD0_ARATH/18-201--------------------------------------------------------------------------------
Q0IXE1_ORYSJ/1-138--------------------------------------------------------------------------------
O22690_ARATH/1-138--------------------------------------------------------------------------------
I1PJ49_ORYGL/1-138--------------------------------------------------------------------------------
Q8GYI3_ARATH/20-151--------------------------------------------------------------------------------
Q8H080_ORYSJ/1-138--------------------------------------------------------------------------------

PF02077

SURF4_CAEEL/11-277--------------------------------------------------------------------------------
YFC7_CAEEL/4-269--------------------------------------------------------------------------------
ERV29_YEAST/48-310--------------------------------------------------------------------------------
SURF4_SCHPO/33-302--------------------------------------------------------------------------------
SURF4_DROME/5-270--------------------------------------------------------------------------------
SURF4_HUMAN/4-269--------------------------------------------------------------------------------

PF13781

C3AK78_BACMY/185-286--------------------------------------------------------------------------------
D3E5H6_GEOS4/180-281--------------------------------------------------------------------------------
Q65IN6_BACLD/178-279--------------------------------------------------------------------------------
C6CYU2_PAESJ/180-281--------------------------------------------------------------------------------
Q8ESB3_OCEIH/179-280--------------------------------------------------------------------------------
A1BFB6_CHLPD/25-125--------------------------------------------------------------------------------
B4SAW4_PELPB/19-119--------------------------------------------------------------------------------
B3EQZ0_CHLPB/20-120--------------------------------------------------------------------------------
B4S7F5_PROA2/21-121--------------------------------------------------------------------------------
Q3ARZ2_CHLCH/17-117--------------------------------------------------------------------------------
B3QTS0_CHLT3/26-127--------------------------------------------------------------------------------
Q1H1D1_METFK/335-436--------------------------------------------------------------------------------
C7R8T5_KANKD/19-119--------------------------------------------------------------------------------
Q2SM61_HAHCH/17-117--------------------------------------------------------------------------------
Q3SHK0_THIDA/314-415--------------------------------------------------------------------------------
Q2Y734_NITMU/330-431--------------------------------------------------------------------------------
Q5NY22_AROAE/320-421--------------------------------------------------------------------------------
A1K6I8_AZOSB/336-437--------------------------------------------------------------------------------
Q1LGK6_RALME/315-415--------------------------------------------------------------------------------
C1F939_ACIC5/18-120--------------------------------------------------------------------------------
Q7NW81_CHRVO/13-112--------------------------------------------------------------------------------
Q11TY1_CYTH3/19-119--------------------------------------------------------------------------------
C7PI03_CHIPD/14-115--------------------------------------------------------------------------------
A1VMB6_POLNA/12-112--------------------------------------------------------------------------------
Q0ANG5_MARMM/322-422--------------------------------------------------------------------------------
A9C3F1_DELAS/21-121--------------------------------------------------------------------------------
Q4K472_PSEF5/309-409--------------------------------------------------------------------------------
Q89WY4_BRADU/329-429--------------------------------------------------------------------------------
Q2K6I2_RHIEC/316-414--------------------------------------------------------------------------------
A1TNI5_ACIAC/22-122--------------------------------------------------------------------------------
B9JGJ5_AGRRK/322-420--------------------------------------------------------------------------------
A5V930_SPHWW/323-422--------------------------------------------------------------------------------
Q2JZG1_RHIEC/327-426--------------------------------------------------------------------------------
Q11CJ7_CHESB/321-420--------------------------------------------------------------------------------
A7IKV9_XANP2/322-421--------------------------------------------------------------------------------
Q2S702_HAHCH/327-427--------------------------------------------------------------------------------
C2WZH4_BACCE/180-281--------------------------------------------------------------------------------
G8PNG3_PSEUV/327-425--------------------------------------------------------------------------------
Q5ZVY7_LEGPH/322-422--------------------------------------------------------------------------------
Q9A4D7_CAUCR/322-420--------------------------------------------------------------------------------
Q9I6F8_PSEAE/307-408--------------------------------------------------------------------------------

PF06762

K1QJR5_CRAGI/165-541..................................................................KVGS.......YIR
LMF2_XENTR/122-588SAFSLYSLIS.LLDVPIF....GLLVFWTVKYFDLQINWEKHS.............VESRTAFTYHDFQQ.......WLR
E4N190_KITSK/121-477...................................................................YQG.......LVA
F2UH93_SALR5/134-601QGLRLIKRLPWWAEALFLLIAALAVGTFTAHAFDVHVQADMHV............PITATVAFTKQQFSH.......WLT
I3KCS2_ORENI/122-585DDSKLWSWLCYLLELVVW....ALVIVGTVISFDLQLDTVKKG.............ISSRTAFTYHQFNL.......FLK
F1P0J3_CHICK/7-472WPPTLLSFLSTLLELATY....ALLLYWSVHYFSLEIDWEKGL.............LESKVAFTYHEFTQ.......WLR
E1GDX1_LOALO/74-452..ERSLTRLGTMISAVLI....ASTLYFFVHYFNVDID..GFK.............VTSSIGFSIQQFDE.......FVE
E2B8W4_HARSA/122-575....TMSTESTLLAVVVY....GALMYGTYLCYDLKIT..NWT.............IQSNIAFTKEQFDY.......ILS
F0Y0J4_AURAN/130-628SEASAWETFWRRRRWPVRFGVCAALAYAFRRLFPFSTNGSVAAALAAPAGFVIENRATVRFTKA.............MLD
Q08T93_STIAD/249-609........................................................LP.........RRP.......AP.
K7J1M5_NASVI/123-578.....FGVLSTIACIAVY....AGILYGTYVYYNLRFT.ENWT.............ITSKIGFTEKDFDY.......ALS
E5SED2_TRISP/131-543........................................................MESNFEMEISVFSL..........
A1TEH0_MYCVP/123-475...................................................................FAA.......LVI
F8L1K9_PARAV/119-467........................................................IP......VESVEP.......SL.
F5YS29_MYCSD/125-477...................................................................FTA.......VVI
G3UCY5_LOXAF/167-547..................................................................STGY.......AVR
Q4N0L2_THEPA/112-755EETFGSVYIERILSNLSYNRHREYL.RDFMNLDNLSVSELFKK..................................IIT
H9GJK7_ANOCA/78-542GPRSLASILSFLAELGAY....GLLLYWTRLYFGLEVNWEKKA.............LESKTAFTYHEFMQ.......WLR
G3VQT8_SARHA/6-467RARRVLTALSLLLELAVY....GLLAYGTVHYFGLELDREWGS.............IQAKTAFTFHEFSQ.......WLK
A0QT94_MYCS2/77-429...................................................................YVA.......AVV
B3DXT0_METI4/128-489..............................................................CPSPTFQK..........
H9GAZ9_ANOCA/164-545..................................................................RFHI.......IER
T1KS50_TETUR/132-583.....RRNSSD..TIIASFGI.GFILYETVKLFNLHIE.KDRT.............LSSKVNFQEPELKY.......FIG
M3ZPC1_XIPMA/122-585NDSKLLLWLSRLVELLVW....ALMIFGTIICFDLQVDSAKNS.............VSSRTAFTYHQFNQ.......FLK
Q234A3_TETTS/140-610KNDPYSPLMKKLKLLICILIFIAMVIYAYLTYFPLEAIFENGK.............VDFTLADIRVNLVN..........
W5KQN4_ASTMX/197-654WGQFLGSFLILLVKLAVY....ALIVVGAIILFKLEINWEKKT.............VTSKTDFSHKAFDN.......FLS
G1QIY9_NOMLE/23-406................................................................................
F4WBZ8_ACREC/123-579.....RNYLSTLITILVY....GGVMYGTYIYYGLKII.DNWT.............IESNITFTQEEFGY.......ILY
F1Q4Q4_DANRE/125-588WLQTLASGFVLLVELAVY....AFILYSAITLYQLQIDWEQKR.............VSAKTDFSHGRFAA.......FVL
W5KBQ4_ASTMX/194-574..................................................................TKGM.......YIR
G0MSI2_CAEBE/122-480.SPNLNISIAPFLSGLVF....GKMIYDVLHGSPIEIIIGESK..............HIVLTITQNVFQK.......FVA
U6IKR5_HYMMI/134-572RRPKKRSVLRKLLAGTLFLAVISVMVYVIWDFFGLEKGI.................AQAHLTIPRSLLISNGKKAIAYVI
Q1IR35_KORVE/151-523........................................................VFTTEAQRHRELEF.......LGR
Z4YJR1_MOUSE/170-551..................................................................DRGC.......LVR
M4AS74_XIPMA/175-556..................................................................KVGM.......LIR
A8XC70_CAEBR/122-552.IPRVPQG.EPFLSMLIF....ARIAYDVIYKGRFKIITEVGSW............PTFTLDMNYESFQK.......LVR
C5BX37_BEUC1/125-479...................................................................FGV.......VVA
V4Z567_TOXGO/197-765FLCLALATSSHFYTKTATSNVFTELVLLVVSLWSAVSLYKYGPLPSCLWLTIVLFTILLAFSYKTISNAV.......LVY
G2NZI2_STRVO/121-473...................................................................YEV.......VVL
H6RBI8_NOCCG/121-470...................................................................FTV.......LVT
H8MNZ0_CORCM/241-604........................................................LPEAL...WRDAGP.......AR.
E9GA51_DAPPU/120-571.......RIENIFTGISV....ALLIYFTVLWFGIDFG.KNVP.............VHSEIKFSVQEFET.......ALK
J9JZT7_ACYPI/128-582.......RCSSVFTRFMTFNVISILVAVFPLLYNFRISTKNTP..............DFTIAFTQQQFNV.......ILG
N0BDW0_9RHIZ/243-594........................................................IPQKLSLWVQNRAP.......RPG
D7EJW8_TRICA/90-537.......FIEKVINILTY....GALLLAVVKLYSLKL..DGTI.............IESNIAFTKDQFEY.......VLK
LMF2_BOVIN/122-590WPKALLAMLTLLLELAVY....GLLACGVVHYFGLEVDWEQHV.............VRSRTMFTFHQLSQ.......WLK
R4VWD1_9EURY/128-492..................................................................PLQI.......AAV
G8TN66_NIAKG/129-490...................................................................TTA.......WVV