Sequence alignment for CL0131

PF04173

Q97X72_SULSO/12-173---------------------------------------------FLPMLRVTLGLMFF-S-AFIR-RA-I---------
Q97XJ3_SULSO/18-183---------------------------------------------YLFPIRFAVGWMFF-D-GGIR-KA-I---------
Q973M6_SULTO/9-177---------------------------------------------WPNFMRLALATIWI-Y-AGVF-EK-L---------
P97207_ACIAM/20-184---------------------------------------------YLFPVRFAVGWMFL-D-GGLR-KA-V---------
Q97UC4_SULSO/10-178---------------------------------------------FTLILRISMASIWL-Y-AGIL-GK-L---------
Q8NKT7_ACIAM/12-174---------------------------------------------FLPIMRVTLGWMFF-S-AFVR-RT-I---------
Q8AAF0_BACTN/18-181---------------------------------------------FTLSLRLIVGWTYF-S-AFWR-RL-V---------

PF07681

Q83CN9_COXBU/12-94---------------------------------------------AALIGRILISLIFI.I-SGIH-KI-T.........
Q87K55_VIBPA/16-104---------------------------------------------SALALRIPIGIIFM.A-HGAQ-KL-FGWF......
Q8KEE1_CHLTE/7-88---------------------------------------------GKLLIRLCVGGLML.F-HGVY-KL-IH........
Q9RTC4_DEIRA/8-92---------------------------------------------GLALLRLVLGVVFV.A-HGLQ-AM-AW........
Q7TUM8_PROMM/37-127---------------------------------------------GILILRLGVSILMV.H-NGLE-KL-Q.........
Q98K39_RHILO/14-90---------------------------------------------ALGVLRIMTALQFV.E-HGSQ-KL-FNFPAS....
Q7VHA8_HELHP/8-89---------------------------------------------GKLIVRLCVGGLML.F-HGVN-KI-TN........
Q8GA66_ECOLX/8-90---------------------------------------------LLLLARLMLACLYM.I-SGVP-KL-L.........
Q89FZ6_BRAJA/10-92---------------------------------------------AALVLRVTLGALFL.A-HAGL-KL-FV........
Q8EDN3_SHEON/21-107---------------------------------------------APLALRLYLAPVLM.Q-AGYN-KL-T.........
Q8KW46_9RHOB/66-148---------------------------------------------AVTAINVGITCPFW.A-SAFV-KA-A.........
Q8A9J9_BACTN/19-101---------------------------------------------FLLAVRIIFGILLM.N-HGIQ-KW-S.........
Q83BV7_COXBU/131-217---------------------------------------------HLTFIRMYIGYDLI.A-HFAE-KL-FAG.......
Q92W39_RHIME/11-107---------------------------------------------AQLALRLALAVPFW.R-SGLG-KW-DGF.......
Q8U4Y0_AGRT5/25-105---------------------------------------------TVAL..LALCSAYI.Q-GPLT-KI-F.........
Q89M65_BRAJA/31-107---------------------------------------------LLSLFRFITGLLLF.Q-YGIA-KL-FKFP......
Q8FX91_BRUSU/12-94---------------------------------------------ATLIIRVFLSVLFI.I-AGYN-KL-T.........
Q7V0B0_PROMP/15-102---------------------------------------------ALLILRVITGTVLI.H-HGFE-KL-AN........
Q82B81_STRAW/12-94---------------------------------------------AIGLFRIVVGLLFA.C-HGAA-SL-FGVLGGA...
Q984Q4_RHILO/6-88---------------------------------------------VQALGALLIGGVFV.W-AGVE-HF-V.........
Q9A3E7_CAUCR/28-117---------------------------------------------LTLVARLGVAAIFF.Q-SGRT-KV-DGL.......
Q983U6_RHILO/19-101---------------------------------------------TILLGRILLAVIFL.L-SGFG-KL-T.........
Q82HN4_STRAW/24-126---------------------------------------------ALLPLRVFLGVTFI.Y-AGLD-KL-TNS.......
Q7VUY8_BORPE/24-126---------------------------------------------IALLGRCSIAATFW.L-SGQT-KV-EGFAVNALA.
Q831Y6_ENTFA/7-87---------------------------------------------GIQVIRIWLGVTML.I-HGVM-KV-T.........
Q983U8_RHILO/8-90---------------------------------------------LLLVSRLLFALMFV.P-SGFQ-AL-A.........
Q7V328_PROMP/44-134---------------------------------------------SIFILRIGFSVLMI.H-HGLE-KL-Q.........
Q9K461_STRCO/11-90---------------------------------------------VIALFRIVVGLLFA.C-HGAA-TL-FDALGG....
Q7MRA2_WOLSU/17-98---------------------------------------------SALLLRLALGGLML.M-HGIH-KL-KN........
Q8F8N5_LEPIN/13-98---------------------------------------------GSLILRLVAGIVIF.P-HGAQ-KL-LGWF......
Q9HYW2_PSEAE/22-108---------------------------------------------APLALRLYLAPVFW.M-AGSQ-KL-A.........
Q88P63_PSEPK/6-95---------------------------------------------LCLVARFGIASIFF.L-SGRT-KV-EGF.......
Q9HWH6_PSEAE/14-96---------------------------------------------LWLTARICLALMFV.A-SGLA-KL-F.........
Q8FR06_COREF/10-94---------------------------------------------ALLLFRVVLGIIFV.A-HGWE-KL-FI........
Q9KYL5_STRCO/4-96---------------------------------------------LRLAGRPMLASMFV.A-GGLQ-SL-R.........
Q8NR01_CORGL/191-281---------------------------------------------GLLIIRAVIGVYLI.V-RGVF-TF-FTLG......
Q8XR31_RALSO/30-119---------------------------------------------ILLIARAYLFYVFF.R-SGLT-KL-HD........
Q92SD1_RHIME/6-88---------------------------------------------IVLIGRILLSIIFI.T-SGFG-KL-T.........
Q7NPD1_GLOVI/22-104---------------------------------------------GLLVLRVFAGLTMA.V-HGLG-KV-P.........
O53252_MYCTU/114-206---------------------------------------------GLLILRVGLGAVLI.A-HGLQ-KL-FGWW......
YPHA_SHIFL/16-98---------------------------------------------LLLIARIAVVLIFI.I-FGFP-KM-M.........
Q7NZE1_CHRVO/10-92---------------------------------------------AALVLRVALGLMYL.S-HGAL-KL-FV........
Q8CZQ7_YERPE/13-94---------------------------------------------GLLVARILMPIIFI.V-AGYG-KM-GD........
Q7VDS1_PROMA/43-133---------------------------------------------SIFVLRVVFSLFMI.H-HGLE-KL-Q.........
O86323_MYCTU/16-94---------------------------------------------VLSLFRLVYGLLFA.G-YGSM-IL-FGWPVTS...
Q7N096_PHOLL/8-89---------------------------------------------ALLLARILMPILFI.V-AGYG-KL-GD........
Q8XWH4_RALSO/12-94---------------------------------------------LILLGRVLMMLLFL.I-SGWG-KL-T.........
Q7VYL1_BORPE/8-89---------------------------------------------GKLILRLALGILVI.M-HGLA-KL-SS........
Q7US51_RHOBA/24-106---------------------------------------------GLLALRVAFGCFML.V-HGLQ-KV-I.........
Q88G88_PSEPK/13-95---------------------------------------------IILIARVLLMVLFV.L-SGWA-KL-T.........
Q812S4_BACCR/6-87---------------------------------------------GNLIIRIVLGVTFF.M-HGLT-KF-QS........
Q88KH7_PSEPK/17-105---------------------------------------------GLSVIRILVGIIFM.A-HGAQ-KL-FGLF......
Q98JU3_RHILO/13-95---------------------------------------------ALLIARLIFAAVFL.M-AVTF-KF-M.........
O05565_MYCLE/52-137---------------------------------------------GLLILRLVLGLTLA.A-HGYN-KF-..FC......
Q89MP6_BRAJA/4-104---------------------------------------------FVTFGRILFAVLFI.Y-TGAT-KL-FAIQATADFI
Q8PGB0_XANAC/14-96---------------------------------------------GTALLRISLGVLFL.V-HGLT-KL-LV........
CATD_BACSU/8-88---------------------------------------------GTLLLRVITGIIFF.V-HGLS-KF-Q.........
Q8EC25_SHEON/16-104---------------------------------------------APLALRIPIGIILM.A-HGAQ-KL-FGWF......
Q7VTR5_BORPE/10-91---------------------------------------------AVLLLRLALGVMYL.A-HGLT-KL-LV........
Q7UE97_RHOBA/16-98---------------------------------------------GMLGLRIAFGCFML.V-HGIQ-KL-M.........
Q7NA66_PHOLL/20-124---------------------------------------------LPLLARISLAATFW.L-SGQS-KV-VGLNIDILET
Q7VBT6_PROMA/9-93---------------------------------------------LDFLGRVFLASTFV.V-AIPS-KF-L.........
O33110_MYCLE/114-202---------------------------------------------GLLVLRVGLGVVLA.A-QGLH-KL-FGWW......
Q9RC47_BACHO/8-89---------------------------------------------GILLLRLFLGVTFF.I-HGLV-KF-QD........
Y886_HAEIN/11-90---------------------------------------------FLAFLRIVVAYMFI.L-HGTA-KF-LEFPIS....
Q8FSC2_COREF/11-95---------------------------------------------ALLLSRVLLGVILI.A-HGWD-KF-QI........
Q98K48_RHILO/27-109---------------------------------------------LLFLGRLLLGGAFV.V-AGLR-NI-Q.........
Q72VB3_LEPIC/18-104---------------------------------------------SPLLLRLGLSICIF.P-HGAQ-KL-LGWF......
Q7NSB1_CHRVO/12-100---------------------------------------------VLLLLRLWLLDVFF.R-SGLT-KI-DD........
Q9HZY2_PSEAE/16-104---------------------------------------------GLAILRIVTGLTLM.S-HGSQ-KL-FGMF......
Q88K91_PSEPK/19-105---------------------------------------------ADVPLRVFLAWEFF.E-SGLE-KF-NGS.......
Q7W6U9_BORPA/7-93---------------------------------------------QLTLIRVYIGLDFT.H-HFAE-KF-G.LL......
Q8EZJ9_LEPIN/12-95---------------------------------------------LVDFLRIYLGGVLI.Y-KGLE-FL-Y.........
Q8Y2U2_RALSO/28-111---------------------------------------------GLLFLRVAGSALLLYV-HGLP-KV-LH........
Q7X1H0_9BACT/12-99---------------------------------------------SAMVLRLGLAGVIL.P-HGFG-KL-LGWF......
A9CHZ6_AGRT5/16-92---------------------------------------------ALGALRIMTALLFI.S-HGTQ-KL-FGFPAS....
Q99V56_STAAM/4-84---------------------------------------------GMLLIRWMLATSFL.V-HGTL-KF-V.........
Q8FPX7_COREF/162-252---------------------------------------------GLLIIRATVGLYLI.L-RGVS-AF-FAIG......
Q9CP47_PASMU/16-102---------------------------------------------GLLGLRLFLAWEFF.E-SGKE-KW-KGE.......
Q9HWS4_PSEAE/24-110---------------------------------------------ADLSLRLFLAWEFF.E-SGWE-KW-NGE.......
Q82PS9_STRAW/30-117---------------------------------------------GILLLRLAVGLLLA.G-HGAQ-KL-FGIF......
MHQP_BACSU/5-93---------------------------------------------GLLLIRIMIGVVFL.F-YGTQ-KL-FGWF......
Q883U2_PSESM/16-104---------------------------------------------GLTLLRVIVGIAFI.A-HGSQ-KL-FGAF......
Q92TK3_RHIME/11-93---------------------------------------------LALIGRLLLAAMFI.L-SGFG-KL-G.........
Q7V7V3_PROMM/10-94---------------------------------------------VDFIGRLCLSAVFV.V-AVPS-KI-T.........
A9CK19_AGRT5/23-105---------------------------------------------LVLIARILLSFIFI.Y-SGFG-KL-T.........
Q7U687_SYNPX/15-102---------------------------------------------GLLLLRVFTGSLLI.H-HGYE-KL-AN........
Q89EW4_BRAJA/19-101---------------------------------------------LWHAARLALVSAYL.L-GGFI-KL-L.........
Y1602_HAEIN/14-100---------------------------------------------SLLILRFFLAWEFF.E-SGLE-KW-NGQ.......
Q98JF9_RHILO/23-103---------------------------------------------TLLAGRLLMSFIFL.H-EGVT-LA-T.........
Q8YSN3_NOSS1/6-88---------------------------------------------IPLVARSFLAVIFI.Y-AGVN-KV-F.........
Q92Y87_RHIME/25-105---------------------------------------------FLAL..LALCSAYI.Q-GPLM-KI-Y.........
YQJF_ECOLI/8-88---------------------------------------------GVLVARILMPILFI.T-AGWG-KI-T.........
Q812I5_BACCR/5-93---------------------------------------------GLLIIRLIIGITFM.G-HGAQ-KL-FGWF......
Q8NT59_CORGL/10-94---------------------------------------------AFLIARILLGVILI.A-HGWD-KF-AI........
Q9KY40_STRCO/14-95---------------------------------------------VLGLFRIVVSLLFA.C-HGAA-SL-FGVLGGA...
Q87KG0_VIBPA/27-115---------------------------------------------LLLFCRLWVAWVFF.N-SGLI-KI-AS........
Q8P8R3_XANCP/15-111---------------------------------------------ALLMLRLAGGGFLL.P-HGLG-KL-LGWF......
Q89SK7_BRAJA/66-148---------------------------------------------LILIGRVLLAWVFV.G-SAYG-AI-S.........
Q82AZ6_STRAW/10-97---------------------------------------------GLLLLRLGTGGVLA.A-HGAQ-KL-FGWF......
Q82V34_NITEU/11-94---------------------------------------------GKLTLRLTVGVLIL.L-HGVH-KI-FNP.......
Q82UE4_NITEU/22-102---------------------------------------------SQFVARLFLGQIFL.L-AGIS-KI-S.........
Q8DDM4_VIBVU/23-111---------------------------------------------VLLFCRLWVAWVFF.N-AGLS-KI-TS........

PF13564

D1AAS7_THECD/7-112------------------------------------------------ILQALLAVMFA-M.AGVM.KS.T...RP....
D2SF07_GEOOG/7-113------------------------------------------------IVAGLLAVAFL-A.AGLM.KL.T...QP....
C5BX04_BEUC1/7-113------------------------------------------------ITAGLLALAFL-G.SGAV.KL.V...KS....
D3Q9W4_STANL/7-109------------------------------------------------VVTVVTIAVNL-A.VAVA.DF.A...KA....
D1BDS4_SANKS/7-113------------------------------------------------ILAGLLAVAFF-A.SGLS.KI.V...GTR...
A0QFH8_MYCA1/7-109------------------------------------------------GITLFTAAITA-A.IAVA.DF.V...PA....
C2Q8E8_BACCE/7-108------------------------------------------------VLQCLLIFAFF-F.SSVS.KI.A...GA....
D1BYA3_XYLCX/7-112------------------------------------------------VIAGLLAAVYF-T.VGCV.KL.L...RG....
B5HYY5_9ACTO/7-112------------------------------------------------IVAGLLALFYF-Y.AGTM.KV.I...RS....
D1BVK9_XYLCX/7-113------------------------------------------------IGAGLLALFYL-Y.SGGI.KV.A...QS....
A9B5S7_HERA2/7-113------------------------------------------------IIQGLLALVFG-G.AGAF.KL.I...QP....
D3Q6B3_STANL/7-112------------------------------------------------IVQIVLAVAFA-A.IGAL.KT.T...RP....
C3BLY8_9BACI/20-124------------------------------------------------TVTLLLAAAIM-L.SGIG.QL.M...QY....
C5C629_BEUC1/7-115------------------------------------------------IVAGLMAAVFL-V.AGST.KL.F...IP....
D3PWB3_STANL/7-114------------------------------------------------IVTGILAAAFA-F.AGST.KL.FI.PRE....
B0AKY3_BACAN/4-107------------------------------------------------VLQVVLAIFIV-V.GGFI.KI.F...RI....
D3EH52_GEOS4/7-112------------------------------------------------IIQGLAALGFV-Y.SGWL.KA.F...QF....
A4F848_SACEN/7-108------------------------------------------------TVTIMTALCNL-A.AAAV.DF.A...RS....
C4RG94_9ACTO/7-114------------------------------------------------VVQGALAAVFL-G.AGLT.KI.A...KP....
A1SIQ7_NOCSJ/7-109------------------------------------------------IATVLLAFLAV-N.SAAM.KL.R...QN....
C6WJU0_ACTMD/7-113------------------------------------------------VLQGLLAVAFV-A.AGGM.KL.A...TP....
B5I6V7_9ACTO/19-120------------------------------------------------VVTLLAAAMAG-Y.SGTV.VL.T...RA....
A8M6Z9_SALAI/7-108------------------------------------------------VLTLVLTAVLL-A.AAVP.KL.T...GQ....
C6VZE8_DYAFD/11-112------------------------------------------------IFTAWLALGMT-S.TGVV.QL.M...KM....
Q0SGE8_RHOSR/7-112------------------------------------------------VCGVLLAVSAV-A.VSIP.KL.R...LK....
D5UX83_TSUPD/7-115------------------------------------------------IITGVLAAGFA-A.GGAA.LL.A...LP....
D3PZS4_STANL/7-112------------------------------------------------ILQVALALFFA-N.AGFA.KV.S...QP....
D3PUC2_STANL/7-110------------------------------------------------TLTLITAAANL-F.SGGL.AL.A...GF....
C9Z9S2_STRSW/7-108------------------------------------------------TLAVALSLIFF-S.FGTA.KI.A...AV....
A1TE84_MYCVP/11-113------------------------------------------------AVTLTCAVANA-A.VAAA.DL.A...RA....
D2AS43_STRRD/5-106------------------------------------------------IVTVLAAAWVA-F.SAYA.IL.T...RA....
A4T6B5_MYCGI/6-108------------------------------------------------LVTIVCVVANA-A.IAIA.DY.A...KA....
D2PZ45_KRIFD/7-114------------------------------------------------IVSALLAVLFA-A.SGVA.KS.TM.SRD....
B1MM14_MYCA9/10-112------------------------------------------------ITTVLCIATNG-F.EVVA.KA.V...KA....
A6FZU9_9DELT/14-115------------------------------------------------ITTGIVAFIMG-A.SGLA.DL.I...AF....
Q65HS4_BACLD/5-107------------------------------------------------FLKAGLAAFML-T.GGVI.KV.L...HV....
Q5YWI3_NOCFA/31-132------------------------------------------------VLTALAAAAAA-F.AAGV.DL.V...RP....
D3F1P3_CONWI/7-108------------------------------------------------VLSTLLAVLLT-A.SAAS.KL.A...RR....
C7PZU5_CATAD/19-125------------------------------------------------ILQAVLAAFFA-L.SGLG.KA.F...QS....
A8M8B0_SALAI/7-107------------------------------------------------VVTLLASALNG-S.AAVA.NL.I...GH....
B5H4W5_STRPR/7-108------------------------------------------------VFTLLAAATSG-Y.SAAN.HL.I...RP....
A1UGV4_MYCSK/7-109------------------------------------------------IVSVGLAIFMA-V.AGFL.NV.F...FV....
Q11P05_CYTH3/10-110------------------------------------------------VATGIFGAMML-M.SGFM.YF.....TD....
D5UGI3_CELFN/7-114------------------------------------------------TVNALLALAFI-G.TGTF.KL.A...RS....
Q89Y33_BRAJA/62-168------------------------------------------------AAQGLIFFVFA-S.AGLV.KL.L..TPI....
A6G4G5_9DELT/10-111------------------------------------------------ASTGLLAFFLL-A.NAAM.KL.S...GA....
C0ZKK1_BREBN/2-104------------------------------------------------ILSLILALMFS-I.SVLM.KF.L...RA....
B1MDG2_MYCA9/7-115------------------------------------------------VCAGVLAVVHL-A.AGAF.KL.I...TP....
Q7UL85_RHOBA/23-124------------------------------------------------VTLALFCLAMA-G.GGFA.DL.T...QN....
C7PUE7_CHIPD/10-111------------------------------------------------VTTAIIALMMT-Y.SAYA.YL.T....K....
D3Q6A9_STANL/7-109------------------------------------------------ILSIALIAFFG-S.LGGA.KL.V...LA....
A3RXR1_RALSL/22-128------------------------------------------------AAQALICVGFV-I.IGGI.KL.F...KP....
Q82R50_STRAW/28-129------------------------------------------------TLACLIALIFG-A.SGVL.NT.L...AL....
D2QST6_SPILD/17-122------------------------------------------------TAQVVLAVSLI-W.AATM.KL.F...RP....
Q5YXM8_NOCFA/33-141------------------------------------------------IAAGLLAFVAL-G.GGVG.KT.F...FP....
C7PKH0_CHIPD/17-121------------------------------------------------VAQGLLSATLL-W.ASAT.KL.F...KP....
B2JL65_BURP8/47-153------------------------------------------------AAQILVSGFFA-L.AASM.KIGM...SI....
Q72UJ2_LEPIC/13-114------------------------------------------------IVTAVIAANYA-F.ASYA.YF.N...RG....
C0WI63_9CORY/7-112------------------------------------------------FGTYLLAIVLI-G.DAVL.SV.K...PP....
Q1VX62_9FLAO/6-107------------------------------------------------ILVLFISVSFF-F.YGLG.CF.....YS....
D2ASD1_STRRD/34-143------------------------------------------------SLQVLFGFFFA-G.SGFG.KV.L...LY....
B0UIU5_METS4/14-111------------------------------------------------VLRGLITAVFV-L.AAGM.KF.A...AV....
D2PS28_KRIFD/35-136------------------------------------------------ASTVVVVFELI-A.GSVW.NL.A...AI....
A6G6P4_9DELT/10-116------------------------------------------------ITTALFALMML-P.GAGM.NL.A...QP....
C7PYY8_CATAD/7-121------------------------------------------------VVQALLAALFL-L.SGSL.KS.T...WP....
A9GJR9_SORC5/11-117------------------------------------------------VTTGWVALGMV-S.GGVA.HV.L...HV....
B8IER0_METNO/21-116------------------------------------------------SLQVLLALVFL-A.AGGT.KL.A...GV....
Q1IKM4_KORVE/10-111------------------------------------------------ASTVLAALLFM-V.PGLG.LL.G...RV....
A4C0H3_9FLAO/6-106------------------------------------------------ALTWFSGLAFI-Y.FGVN.CF.....YS....
A1ZLE1_9BACT/10-109------------------------------------------------VATGLLSALVL-M.SAGM.YV.F...NY....
C0BG18_9BACT/6-105------------------------------------------------ILSFFSGISFL-F.YGIS.SF.....RS....
A9FEJ3_SORC5/27-126------------------------------------------------ILSGLSVAFLL-F.DSIG.KL.M...RV....
A8ULQ7_9FLAO/10-110------------------------------------------------VATTLLTLMML-F.SVSM.YF.F...KH....
Q2S0Z3_SALRD/8-118------------------------------------------------GSTVLFALMMA-G.SGTM.YF.....VS....
Q11S70_CYTH3/11-112------------------------------------------------LSYTYYLYVFG-Y.ASLF.KV.F...QK....
Q5Z2J9_NOCFA/19-120------------------------------------------------VPVTAVLAETA-V.GAYW.DL.A...RI....
C6X539_FLAB3/10-112------------------------------------------------ITTGIFGLSML-F.SAYM.YL.T...DA....
Q26DR8_FLABB/6-106------------------------------------------------VIAIFSGACFL-F.YGVS.CL.L...S.....
B8JHM2_ANAD2/39-140------------------------------------------------TSTLIVAYEMI-A.GGLW.DL.L...RI....
B5HQQ2_9ACTO/55-152------------------------------------------------TLQVVLALFYV-IASALP.KL.I...AH....
A7H7U7_ANADF/31-130------------------------------------------------ILTALPVLFLL-F.DGTI.KL.L...KL....
B9R073_9RHOB/12-107------------------------------------------------ALKGLLAAVFL-S.AGGA.KL.V...GA....
A5FBV8_FLAJ1/7-111------------------------------------------------IFWITTTIIFL-F.EGVM.PA.LT.SQT....
A1ZY83_9BACT/27-125------------------------------------------------IATGLLTLIMT-F.SATM.YF.T...QY....
D7VTK5_9SPHI/10-113------------------------------------------------IATTILILWEG-V.MPLG.TL.L..FAP....
D2QN87_SPILD/19-118------------------------------------------------TATLLIV.LFD-S.VGAL.GF.....NT....
A9B014_HERA2/18-116------------------------------------------------ILRGLAAAFLL-F.DGSF.KL.F...NP....
A8FU14_SHESH/7-110------------------------------------------------VIIGLLSVFFI-F.AGSI.KL.L...GWQK.M
Q1M3R5_RHIL3/9-110------------------------------------------------ISTALLSVLYL-A.SAYM.YA.T...KK....
D0XES9_VIBHA/3-111------------------------------------------------LIQWLLIAFFL-F.ASSI.KI.IGWVKPI...
B9XQC4_9BACT/28-127------------------------------------------------IMSALITLFML-M.DGVG.KL.V...KP....
B5WCL4_9BURK/11-109------------------------------------------------ILATVVAVLFA-V.AGVV.NL.A...GR....
C6B3P5_RHILS/11-110------------------------------------------------VIAWLLAAFFF-V.GAYG.NT.F...VS....
Q1D110_MYXXD/7-102------------------------------------------------IFTGLVVATLA-F.SASM.KL.G...QS....
B1FVW7_9BURK/9-106------------------------------------------------ILPLVLAAFFV-V.GSLS.NI.V...AP....
C7PKI9_CHIPD/12-107------------------------------------------------VLSGIAGLMLG-A.SAID.KI.V...QS....
B9XR85_9BACT/12-110------------------------------------------------LITGLISFFML-F.SAYF.SG...........
A9F3Z6_SORC5/44-143------------------------------------------------VLSGLGVLFLT-F.DAAV.KV.L...QL....
C9CTS5_9RHOB/7-110------------------------------------------------ILQAFLALHTA-I.GAGW.KL.F...NS....
A5ERI9_BRASB/6-107------------------------------------------------ILSGLVILFLL-F.DGAI.KL.I...PL....
D9QMH9_BRESC/33-140------------------------------------------------TLQGWVAMFFV-A.AGYA.KL.T...ES....
B1KFL4_SHEWM/4-111------------------------------------------------VIATLLAIFFI-F.ASSI.KL.L...GWQK.L
C0IN69_9BACT/7-105------------------------------------------------VMTALVVLFML-G.ASVAPKF.M...GM....
Q0SJ69_RHOSR/31-130------------------------------------------------VVSALVVLFLL-F.DSLI.HI.A...NT....
A3XU47_9VIBR/12-120------------------------------------------------VVSVLLVVFFL-L.ASSI.KT.I...AW....
Q1IPI6_KORVE/25-123------------------------------------------------VLSSVAILFLL-F.DGLM.KV.I...LE....
A9UV76_MONBE/637-749------------------------------------------------ILCLLLTVMFL-M.AGTA.KL.T...DAFVPD
B6AU47_9RHOB/5-108------------------------------------------------IIIVLLSAFFL-F.ASSI.KI.F..AWQKF..
B4RA61_PHEZH/23-122------------------------------------------------TLTGLFTAFML-F.DVGI.KL.A...RL....
A6EKC1_9SPHI/24-124------------------------------------------------ISTALLALFIL-P.G..I.FF.A...GS....
C5C5Y3_BEUC1/41-144------------------------------------------------VLLVWMVVSFT-V.GAIT.KF.Y...PG....
C0Z8W5_BREBN/15-114------------------------------------------------IMSGLVILFML-F.DGVF.KL.I...QP....
B9JK89_AGRRK/29-136------------------------------------------------FLEASIAVVFG-L.SGFL.KI.S...KP....
B1MHX9_MYCA9/33-130------------------------------------------------ALTAIIVLFLL-A.DAIP.KI.F...GA....
A5V4G4_SPHWW/11-106------------------------------------------------VLGYAVAFVMA-T.GVVV.NL.A...GP....

PF07291

MAUE_METEA/3-186-------------------------------------MALLAEPVVTTFVRAFLILLLA-S-AAIP-KL-----------
MAUE_PARDE/2-185-------------------------------------ADFLIQPMVLWALRIFLALLFV-A-AALS-KL-----------
MAUE_METFK/2-184-------------------------------------SWLINDPTAAVLASLFIGIVLA-A-AAIP-KF-----------
MAUE_METME/2-186-------------------------------------ESMVNDPTVAMFASLFVALVLA-A-AAIP-KL-----------
MAUE_PARVE/2-185-------------------------------------QQVLQEPLIHWALRSFLAALFA-T-AALS-KL-----------

PF04224

Q9CJR3_PASMU/1-137--------------------------------MKKWLQHFQQSHLDITLLRLSVILLFF-I-FANT-KW-FEFEVEALKP
O25289_HELPY/5-190--------------------------------KSLLEVITKLQNLGGYLMHIAIFIIFI-W-IGGL-KF-VPYEAEGIAP
YKGB_ECOLI/2-182--------------------------------EKYLHLLSRGDKIGLTLIRLSIAIVFM-W-IGLL-KF-VPYEADSITP
Q9KRP9_VIBCH/1-146--------------------------------MHDSKTHNLTTQYGYLIGVLGVSLILI-W-LGIY-KF-TPTEAKLIEP
Y219_HAEIN/13-209--------------------------------EFVARIVAPMQRQFINFIRIAIFIVMA-W-IGGL-KV-CQYEADGIAH
O87513_ECOLX/1-138--------------------------------MKKFINVYIKSDYDIVILRLSVIIIFM-L-FGTY-KW-FDFEVMALKP

PF05514

Q6RJY8_CAPAN/1-138------------------------------------------MGFLSFLGRVFFASVFI-L-SAWQ-MF-NEF..GDDGG
O23298_ARATH/1-138------------------------------------------MELASFLGRALFVSVFL-L-SAWQ-EF-NDF..GEDGG
Q01MB3_ORYSA/1-138------------------------------------------MGFISFVGRVLFASIFL-L-SAYQ-EF-SEF..GTDGG
Q9LTD0_ARATH/18-201------------------------------------------FPHVETIGRALFASSFF-L-SSWH-DY-MEL..KANWN
Q9LTD1_ARATH/1-132------------------------------------------MPAIAFFGRMAFSFVFF-I-TAIQ-DY-ADHYGGGAGG
Q0IXE1_ORYSJ/1-138------------------------------------------MGFLSFAGRVLFAAAFL-L-SAYQ-EF-SEF..GVDGG
A2XCK0_ORYSI/1-138------------------------------------------MGFVSFAGRVLFASVFL-L-SAYQ-EF-SEF..GADGG
O22690_ARATH/1-138------------------------------------------MGFFSFLGRVLFASLFI-L-SAWQ-MF-NDF..GTDGG
Q570L1_ARATH/18-198------------------------------------------MPYLMPAGRVVFASAFL-V-SAWR-EY-YGF..GL...
P93384_TOBAC/1-138------------------------------------------MAFVSFLGRALFVSVFV-L-SAYQ-EF-SEF..GADGG

PF13781

A0RCI0_BACAH/180-281--------------------------------------------AFVWLYQGIVPKIIF-T-HPQ.-EV-----------
C3GZF4_BACTU/180-281--------------------------------------------AFVWIYQGIVPKLLF-T-HSE.-EV-----------
C2TVP5_BACCE/180-280--------------------------------------------AFVWIYQGIVPKIIF-S-HPE.-EV-----------
C3AK78_BACMY/185-286--------------------------------------------SFVWMYQGLMPKVLF-N-HPE.-EV-----------
D3E5H6_GEOS4/180-281--------------------------------------------VVLWCYEGLVPKLLF-P-EAG.-EL-----------
Q65IN6_BACLD/178-279--------------------------------------------SFVWIYQGLVPKLIM-A-HPG.-EI-----------
A6CEZ9_9PLAN/177-278--------------------------------------------AFVWIYQGLIPKLIA-R-HAD.-EL-----------
C6CYU2_PAESJ/180-281--------------------------------------------CLLWLYEGLVPKWMH-P-EAG.-EL-----------
Q8ESB3_OCEIH/179-280--------------------------------------------SFIWIYQGLVPKILF-Q-HTG.-EL-----------
B3EDV4_CHLL2/19-119--------------------------------------------AFSWIYQGAVPKLVC-R-SSG.-ET-----------
A4SEU6_PROVI/25-125--------------------------------------------AFSWIYQGAVPKLAC-R-SSG.-EV-----------
A1BFB6_CHLPD/25-125--------------------------------------------SFSWIYQGAVPKIVC-Q-STG.-EI-----------
B4SAW4_PELPB/19-119--------------------------------------------AFSWVYQGAVPKIAC-Q-SKG.-EI-----------
B3EQZ0_CHLPB/20-120--------------------------------------------AFSWIYQGAVPKVIC-R-SPG.-EI-----------
B4S7F5_PROA2/21-121--------------------------------------------AFSWIYQGAVPKIAC-Q-SPG.-EI-----------
Q3ARZ2_CHLCH/17-117--------------------------------------------AISWIYQGAVPKLMC-Q-SSG.-EL-----------
B3QTS0_CHLT3/26-127--------------------------------------------AFVWIYHGLVPKLLF-G-HVD.-EI-----------
B1KF78_SHEWM/12-113--------------------------------------------SFSWLYHGIFPKLVQ-I-APL.-EM-----------
A0Y6C6_9GAMM/17-118--------------------------------------------GLSWMYHGFFPKIYH-V-APL.-EK-----------
B3QN36_CHLP8/20-117--------------------------------------------AFVWLYQGAVPKLVC-P-SPV.-EL-----------
B4X4D6_9GAMM/11-112--------------------------------------------AFIWLYQGIVPKLLG-P-HAD.-EL-----------
C0VHX3_9GAMM/20-120--------------------------------------------GLLWIYQGLFPKLIF-K-VED.-EQ-----------
D0BX48_9GAMM/15-115--------------------------------------------AFLWIYQGVVPKIIF-I-NSD.-EI-----------
D0SFQ9_ACIJO/15-115--------------------------------------------AFLWGYQGLIPKILF-I-NPD.-EI-----------
Q1H1D1_METFK/335-436--------------------------------------------AVVWIVTGLVSLGLY-P-VEE.-SY-----------
D0SSK1_ACILW/19-120--------------------------------------------VILWLYQGLIPKILF-Q-SPA.-EI-----------
C7R8T5_KANKD/19-119--------------------------------------------AFLWIFTGLTSV.YF-D-YQT.-GH-----------
B3RB23_CUPTR/328-429--------------------------------------------AFVWIVTAAVSLGLY-P-VAD.-SY-----------
Q2SM61_HAHCH/17-117--------------------------------------------AGVFLYHGLVPKILW-L-SPT.-EL-----------
Q3SHK0_THIDA/314-415--------------------------------------------AVMWVVTGFVSLWVY-P-VAD.-SL-----------
B1KF79_SHEWM/15-115--------------------------------------------AFLWIFTGLTSL.FF-S-PEI.-GY-----------
C0DTU0_EIKCO/36-137--------------------------------------------GFLWLWSGIQPA.LT-A-ADM.-SL-----------
Q2Y734_NITMU/330-431--------------------------------------------AAVWFVAGAVSMGIY-P-VEE.-SY-----------
Q5X5Q5_LEGPA/322-423--------------------------------------------SFVWIWTALCCLFFY-P-KSD.-SL-----------
Q5NY22_AROAE/320-421--------------------------------------------AFVWILTGIVSLGVF-P-VAE.-SH-----------
B1Z1S6_BURA4/308-408--------------------------------------------AIVWIWTAIVSAFVH-P-QSD.-SL-----------
A7BY74_9GAMM/6-107--------------------------------------------GLLWLVTGIISAFIY-P-IAD.-SY-----------
C4GMT5_9NEIS/12-113--------------------------------------------AFLWLWSGIQPA.LF-V-LPQ.-SL-----------
C8NCY7_9GAMM/28-129--------------------------------------------GVLWLWSGLQPALVA-P-.GE.-SL-----------
A1K6I8_AZOSB/336-437--------------------------------------------GVMWIATALVSFGLY-P-VAA.-SL-----------
A6DTJ9_9BACT/15-115--------------------------------------------ALIFFYHGLVPKLLF-K-SEQ.-EV-----------
D4DP38_NEIEG/16-117--------------------------------------------GVLWLWSGLQPV.LT-A-PQE.-SL-----------
Q1LGK6_RALME/315-415--------------------------------------------ALVWLATALVTLFAY-P-LAD.-SL-----------
Q4UMY6_RICFE/322-422--------------------------------------------GLFWIMTGIISS.IF-A-YDA.-SM-----------
C5TJR5_NEIFL/18-119--------------------------------------------GLLWLWSGTQPLFFI-P-.GM.-SL-----------
C1F939_ACIC5/18-120--------------------------------------------AAVWAYEGLWCKLLG-R-MPS.-QF-----------
Q7NW81_CHRVO/13-112--------------------------------------------AALWLWSGLQPP.LT-V-WSE.-SI-----------
A8UH51_9FLAO/12-113--------------------------------------------AIVWIINGLFCKILN-L-VPR.-HQ-----------
Q11TY1_CYTH3/19-119--------------------------------------------TLVWLANGLLCKVLN-L-VPR.-HQ-----------
C7PI03_CHIPD/14-115--------------------------------------------ALVWLVNGLLCKVLH-L-VPR.-HE-----------
C9YGF9_9BURK/7-107--------------------------------------------VLVWLLTAICSVWEL-E-GQS.-RA-----------
A1VMB6_POLNA/12-112--------------------------------------------IAVWLGTAAVSL.LE-L-EGQ.-SA-----------
Q0ANG5_MARMM/322-422--------------------------------------------GLYWLLTGVLAL.TV-A-RDH.-AY-----------
A9C3F1_DELAS/21-121--------------------------------------------IAVWLGTALVSA.IE-H-RGL.-SV-----------
Q4K472_PSEF5/309-409--------------------------------------------VLIWLGTALVCI.GP-G-YAW.-GL-----------
Q89WY4_BRAJA/329-429--------------------------------------------AAFWVVSGFIALF.V-S-YRA.-AA-----------
Q2BMK1_9GAMM/316-416--------------------------------------------SVIWLLSAVS.GFSA-T-QGQ.-FA-----------
A5E8R6_BRASB/331-431--------------------------------------------VLFWIASGSIAL.FV-S-FPA.-TT-----------
C9CYE4_9RHOB/339-438--------------------------------------------SFFWVISGLIPF..F-D-LSG.-TI-----------
A3K709_9RHOB/331-430--------------------------------------------SLFWLLSGIIGLCQI-G-PAA.-EH-----------
Q1YK40_MOBAS/336-436--------------------------------------------ALFWIASGGIAISVA-F-DP..-AV-----------
Q2K6I2_RHIEC/316-414--------------------------------------------SVFWLLSGLIPLLAL-E-KT..-ST-----------
A1TNI5_ACIAC/22-122--------------------------------------------VAVWLGTAVASV.AE-F-HGQ.-SR-----------
B8H2E0_CAUCN/321-421--------------------------------------------FAFWLVSGLIGLTVG-F-EPA.-VA-----------
B6RA56_9RHOB/326-425--------------------------------------------SLFWLASGIIGAIQL-N-EAQ.-SV-----------
C4WL85_9RHIZ/327-426--------------------------------------------ALFWCLSGLFAL..I-S-PMR.-AI-----------
B9JGJ5_AGRRK/322-420--------------------------------------------ALFWMLSGIVPL.LA-P-IAA.-SR-----------
A9EWZ0_9RHOB/307-406--------------------------------------------CLFWLASGLIGV..W-Q-VES.-AA-----------
B4WB77_9CAUL/325-424--------------------------------------------GLFWLITGLISFG.P-G-WNG.-AV-----------
A5V930_SPHWW/323-422--------------------------------------------FLLWMGSAVATFLHF-D-EA..-.A-----------
Q2JZG1_RHIEC/327-426--------------------------------------------PLFWISTGIISLTSG-F-.EQ.-GV-----------
Q02U83_PSEAB/307-409--------------------------------------------ALVLIWLGTLVACLG-P-GYGW-GL-----------
Q11CJ7_MESSB/321-420--------------------------------------------PLFWIGTGIVSLTIG-Y-RE..-GI-----------
A4F044_9RHOB/306-405--------------------------------------------ANFWLLSGLITL..I-D-PAR.-AM-----------
A7IKV9_XANP2/322-421--------------------------------------------SLFWIVTGLISLGPA-A-SAG.-EA-----------
Q2S702_HAHCH/327-427--------------------------------------------VVVWLLSGVAGFAAR-P-EAF.-EP-----------

PF02077

SURF4_CAEEL/11-277-----------------------NEMLAKAEDAAE.DFFRKTRTYLPHIARLCLVSTFL-E-DGI--RMYFQWDDQKQFM
YFC7_CAEEL/4-269-----------------------NVVITRCEDYTE.TLARNTRKVLPTIGRLLLISTFV-E-DGL--RLLFNTHDHVNHF
ERV29_YEAST/48-310-----------------------EKFASRIEGLTDNAVVYKLKPYIPSLSRFFIVATFY-E-DSF--RILSQWSDQIFYL
SURF4_SCHPO/33-302-----------------------SERACQFMEQAE.TFMAPFTPYMPLLGRFLIVATYF-E-DAI--RIVTQWPEQVSYM
SURF4_DROME/5-270-----------------------NEYIAKTEDVAE.QVIKRGKNVLPTVARLCLIATFF-E-DGL--RMYIQWNEQREYM
SURF4_HUMAN/4-269-----------------------NDLMGTAEDFAD.QFLRVTKQYLPHVARLCLISTFL-E-DGI--RMWFQWSEQRDYI

PF06762

Q2L6Y0_CAEEL/122-555MYYQWDALLLESTVYVAILAWF...............DNGPADSIALFGIVSLLLRVVF-M-NGAT-KLLS........K
LMF2_BOVIN/122-592LYFQWDSLLLETGFLAMLVAPLGLPPNHKQAPQGRPGGVSPHEGLPFWLVRWLLFRLMF-A-SGVV-KLTS........R
Q826A6_STRAW/121-468YGFGWESLLLEVGFLAVFLGND................EAGPPVVVLFLLRWVLFRVEF-G-AGLI-KM.R........G
A0QMA7_MYCA1/121-478YSFGWESLLLETGFLMIFLGNA................EVAPPLLTLWMARLLLFRVEF-G-AGLI-KM.R........G
Q45WA6_TOXGO/205-777FSVGWEAQLLELGFLAIWMAPFWS........FSRLPPSWPTPKICVWGNRWLVFRVML-G-SGLI-KL.R........T
LMF1_HUMAN/169-551YSFGWESQLLETGFLGIFLCPLWT........LSRLPQHTPTSRIVLWGFRWLIFRIML-G-AGLI-KI.R........G
Q4REY1_TETNG/125-682LYFQWDNLLLETGFLCVLVAPLAL........VRGSRGVREHDRVTFWLVRWLLFRLMF-A-SGVV-KLMS........R
A0QT94_MYCS2/77-431YSFGWESLLLEAGTLAVFLGND................DVAPPLLVLWLVRWLLFRVEF-G-AGMI-KM.R........G
B9M9C6_GEOSF/118-470YAFGWESLLLECGFLAIFLGPV................GVEPPIVIIWLYRWVLFRVMF-G-AGLI-KM.R........G
A1R4Z7_ARTAT/124-480YGFGWEILLLEAGFTVAFLGSN................QCPPPTTILVLIVWLVFRLEF-G-AGMI-KI.R........G
A0JUS2_ARTS2/124-488YGFGWEMLLLEAGFTVAFLGSD................QTPPPRTILILLVWLLFRLEF-G-AGMI-KI.R........G
LMF1_MOUSE/169-553YSFGWESQLLETGFLGIFLSPLWT........LSRLPKNTPTSQIVLWGFRWLIFRIML-G-AGLI-KV.R........G
A4FB78_SACEN/123-469YSFGWESLLLEAGFLAIFLGPA................HVPPPMPVLWLMCWLLFRVEF-G-AGLI-KM.R........G
Q6MNI0_BDEBA/151-510LSYQWDSLLLELGFLGLFFAPWQW........EWIPLAAHNLHPIMLGLVIFLLFKLMF-L-SGVV-KLTH........K
Q54K13_DICDI/157-572FAYQWDQLLLEALYLAIFLSPF............NPKYEEKPNTPIRYLLKWLLFRLMF-G-SGLV-KL...........
A7RJW9_NEMVE/81-464YSFGWESQLLESGFLAIFLCPVFK........LQQVPAQTPIPLVVIYGYRWLIFRIML-G-AGLI-KI.R........G
Q08T93_STIAD/249-611LSFQWDALLLEMGLLGALMAPAG.........LRPGWGRRDASAVEVALFRLLLFRLYL-G-SGLS-KLQS........G
Q1CX59_MYXXD/289-656LSFQWDVLLLEMGLLAALTAPGG.........LRPGLGRDEPSALDVFLFRLLVFRLYF-G-SGLS-KLQS........G
Q234A3_TETTS/136-636FSFQWDIMLLEAGFLTIFITPTV.........RNGQLIVDEISSVTRDLLKWLCFRLNY-A-SGVV-KLTRFTNKQKNSQ
Q4XRT1_PLACH/156-696YVFEIE..LLELVFLCLFIVPLN.........KNSLKSKYSTTFLMKYVCRFFVFKVLI-G-TSLI-RF.R........N
A5K5K3_PLAVS/186-557MVFQCDLLMNELGFLLIFLCLS............DSHHLRHSNTLVICALRLVAFKILF-G-SAVH-KLVY........N
A0LRD9_ACIC1/123-473YAFGWESLLLEAGFFAAFLGSD................STAPPWPVIYCFRWLVFRLEF-G-AGMI-KM.R........G
LMF2_XENTR/122-590LYFQWDSLLLETGFLAVLVAPVHA.......LRWKTSVWSSHDGVTFWLTRWLLFRLMF-A-SGIV-KLTS........R
A1TEH0_MYCVP/123-477YGFGWESLLLEAGFLAMLLGND................DTAPPLLALWLARWLLFRVEF-G-AGLI-KM.R........G
Q4Y900_PLACH/136-509MVFQCDLLMNEFGFLLTFLNLS............DSYYLIYSNTLIICLLRLVCFKILF-N-SGVH-KFVY........E

PF04173

Q97X72_SULSO/12-173------NVPAKL-----D-----P----------NSSAYVGGKLIT----F---LPHAWSPIKGMLESILLNPS-LLY-D
Q97XJ3_SULSO/18-183------LKPAKL-----D-----P----------NSSSFVGGKLVN----F---LPHA.GPFKDFLLMTLENRT-FDV-T
Q973M6_SULTO/9-177------LNPGYL-----N-----P----------SSTSYVGIT.IE----V---LMQG.PIMRPFLEYVVLPHV-LLV-G
P97207_ACIAM/20-184------LKPAKL-----D-----P----------NSASFVGGKLVN----F---LPHA.GPFKGLLLMTLENRS-LDV-T
Q97UC4_SULSO/10-178------LNSGFL-----N-----P----------SSEQYVGFT.IQ----Y---LAQG.SIIRQFLYIVAMPHP-VLV-G
Q8NKT7_ACIAM/12-174------NVPAKL-----N-----P----------SSSAYVGGKLIT----F---LPHAWGPVKGVLISVLENPP-LLY-D
Q8AAF0_BACTN/18-181------LEN.KL-----I-----P----------DATGYIGEKFNH----F---LPNS.IGIKPIIEYLVSTPD-LLW-W

PF07681

Q83CN9_COXBU/12-94...-......GF-----D-----A..........TVSTLA....QT----G---LPS................P-QWL-S
Q87K55_VIBPA/16-104...-...GGYGL-----E-----G..........TGQWMA....SI----G---LGP................G-VLM-A
Q8KEE1_CHLTE/7-88...-......GY-----G-----F..........IAGKLK....AA----H---L..................P-VWL-V
Q9RTC4_DEIRA/8-92...-.....GDL-----G-----P..........LVEQFR....AW----H---IPH................P-LLA-A
Q7TUM8_PROMM/37-127...-......NP-----E-----G..........FSEFVISQHLNF----L---PGD................P-MLW-T
Q98K39_RHILO/14-90...-..AEPHVL-----T-----G......................----.---....................-..L-T
Q7VHA8_HELHP/8-89...-......GV-----S-----G..........IEGFME....SH----G---L..................P-TLF-A
Q8GA66_ECOLX/8-90...-......SF-----T-----G..........TIDKMA....SL----G---LIF................P-AIT-A
Q89FZ6_BRAJA/10-92...-.....FTP-----A-----G..........TAKFFG....SL----G---F..................P-PEL-A
Q8EDN3_SHEON/21-107...-......HF-----D-----D..........TVAWFANPDWGL----G---LPM................P-TLM-A
Q8KW46_9RHOB/66-148...-......DF-----E-----G..........TIAEVA....AI----G---LPA................P-VFV-A
Q8A9J9_BACTN/19-101...-......NF-----Q-----E..........LSTAFP....DP----I---GLG................S-SIS-L
Q83BV7_COXBU/131-217...-....PVSF-----Q-----G..........DVKAFL....GL----G---ITN................P-DFL-V
Q92W39_RHIME/11-107...-.....LEL-----N-----D..........VAVLLFTSEFQL----H---LPGGPY.........PFPAP-AAT-A
Q8U4Y0_AGRT5/25-105...-......DF-----P-----G..........AIAEMN....HF----G---LQP................A-AAF-A
Q89M65_BRAJA/31-107...-...ALPYF-----A-----D......................----.---...................I-PPL-I
Q8FX91_BRUSU/12-94...-......AL-----D-----G..........TADYFA....SI----G---LPM................P-IVT-A
Q7V0B0_PROMP/15-102...-........-----.-----...........IDNFADAFVRPL----H---LPF................P-IFL-S
Q82B81_STRAW/12-94...-MGSNGGTI-----P-----A......................----.---...................G-TWP-G
Q984Q4_RHILO/6-88...-......KF-----K-----P..........MTEYLA....AR----Q---FPA................P-AFL-L
Q9A3E7_CAUCR/28-117...-.....LHI-----T-----D..........GTYALFETEYAL----P---LIP................P-DLA-A
Q983U6_RHILO/19-101...-......AI-----S-----G..........TAAYFG....GL----G---LPV................P-TVT-A
Q82HN4_STRAW/24-126...-....AFMS-----E-----S..........GAGSIG....DM----M---RTVRDSSAIPALVDLALKNP-VGF-G
Q7VUY8_BORPE/24-126.GE-FDLGWPRL-----S-----E..........SAISLFRDEYQV----P---LLP................P-ELA-A
Q831Y6_ENTFA/7-87...-......SL-----E-----D..........TLAFFA......----S---IGL................P-SLF-V
Q983U8_RHILO/8-90...-......NI-----A-----G..........TSDYFA....GL----G---LPL................P-TLA-A
Q7V328_PROMP/44-134...-......DP-----Q-----G..........FGEFVVGKYFPF----L---PGD................P-VLW-T
Q9K461_STRCO/11-90...-..PHGPAP-----G-----F......................----.---...................A-AWP-G
Q7MRA2_WOLSU/17-98...-......GI-----G-----G..........IEKMLV....NN----G---L..................P-EFM-A
Q8F8N5_LEPIN/13-98...-...GGYGF-----S-----G..........TMGYFI....GQ----G---I..................P-API-A
Q9HYW2_PSEAE/22-108...-......DM-----P-----A..........TIEWFGNPDWGL----G---LPF................P-ELL-A
Q88P63_PSEPK/6-95...-.....LTL-----T-----P..........GTYELFRTEYAL----P---LLS................P-WLA-A
Q9HWH6_PSEAE/14-96...-......DY-----Q-----A..........SLEEMR....AA----G---LEP................A-WLF-N
Q8FR06_COREF/10-94...-.....SGT-----T-----A..........TTGQFS....AW----G---VPQ................P-TLS-V
Q9KYL5_STRCO/4-96...-......RP-----Q-----DVAPAAEPVVRPVADRV....PV----L---PDS................T-EQL-V
Q8NR01_CORGL/191-281...-...GSAGL-----A-----G..........LEAEFA......----.---...GY............QWP-EIL-A
Q8XR31_RALSO/30-119...-.....W..-----.-----P..........TTVLLFSEEYKV----P---LLP................P-ALA-A
Q92SD1_RHIME/6-88...-......DP-----S-----A..........TAGMIT....GA----G---WPA................A-TAL-A
Q7NPD1_GLOVI/22-104...-......PN-----E-----G..........LVETVA....SL----G---FPA................P-VFF-A
O53252_MYCTU/114-206...-...DGQGL-----A-----G..........FQNSLS....DI----G---YQH................A-EIL-A
YPHA_SHIFL/16-98...-......GF-----D-----G..........TVQYMA....SL----G---APM................P-MLA-A
Q7NZE1_CHRVO/10-92...-.....FTP-----A-----G..........TAGYFA....SL----G---L..................P-GFV-G
Q8CZQ7_YERPE/13-94...-......AY-----A-----G..........TQQYMQ....AM----G---V..................P-GFF-L
Q7VDS1_PROMA/43-133...-......DP-----Q-----G..........FAEFVVGKYFTF----L---PGD................P-IIW-T
O86323_MYCTU/16-94...-AQPVEF..-----.-----.......................----.---...................G-SWP-G
Q7N096_PHOLL/8-89...-......SY-----A-----G..........TQQYMN....AM----G---V..................P-SFL-L
Q8XWH4_RALSO/12-94...-......GF-----S-----A..........TVGYMG....TV----G---APM................P-MLA-A
Q7VYL1_BORPE/8-89...-......GV-----G-----G..........IAGMLS....SH----G---L..................P-GFL-A
Q7US51_RHOBA/24-106...-......GF-----S-----T..........ISEGFP....DP----L---GMG................H-QLS-L
Q88G88_PSEPK/13-95...-......GF-----D-----G..........TVGYMT....SL----G---APA................P-MLA-A
Q812S4_BACCR/6-87...-......GI-----D-----N..........IAGWFT....SI----G---L..................P-GGL-A
Q88KH7_PSEPK/17-105...-...GGYGL-----E-----G..........TGQWME....SI----G---LAP................G-YLM-A
Q98JU3_RHILO/13-95...-......GM-----G-----A..........TAGFIA....AA----G---FPF................P-LFL-A
O05565_MYCLE/52-137...-....GGRI-----P-----G..........TARWFE....SI----G---MKP................G-TFH-A
Q89MP6_BRAJA/4-104ATK-VVVPDIIA-----P-----Y..........AKQIET....AT----A---MTT................P-QLL-A
Q8PGB0_XANAC/14-96...-.....FTP-----A-----G..........TVAYFQ....SL----G---L..................P-GAL-A
CATD_BACSU/8-88...-......GM-----E-----G..........TIQFFG....SI----G---L..................P-SFM-A
Q8EC25_SHEON/16-104...-...GGYGL-----E-----G..........TGQWMA....SI----G---LTP................G-YLM-A
Q7VTR5_BORPE/10-91...-.....FTL-----P-----G..........TAQFFA....KV----G---F..................A-GWL-A
Q7UE97_RHOBA/16-98...-......GF-----T-----A..........MAESFP....DP----L---GMG................H-QLS-L
Q7NA66_PHOLL/20-124RTP-WQLGIPRV-----T-----D..........SSVSLFTNEYKL----P---LLP................P-DVA-A
Q7VBT6_PROMA/9-93...-......NY-----P-----V..........VLNTII....QK----G---IPET..............QA-NIL-L
O33110_MYCLE/114-202...-...GGQGL-----T-----G..........FKNSLT....QV----G---YQH................A-DIL-A
Q9RC47_BACHO/8-89...-......GI-----G-----Q..........TVGFFD....SI----G---I..................P-GFL-A
Y886_HAEIN/11-90...-..MTGGNG-----A-----V......................----.---...................G-DPM-L
Q8FSC2_COREF/11-95...-.....TGL-----E-----G..........VSGFFA....SL----G---IPA................A-GVV-A
Q98K48_RHILO/27-109...-........-----.-----...........NAAFLTGLMAAR----G---VPQ................A-RLA-L
Q72VB3_LEPIC/18-104...-...GGAGY-----E-----A..........SMDYLV....NT----A---QF.................P-ATL-S
Q7NSB1_CHRVO/12-100...-.....W..-----.-----D..........ITLALFTDEYHV----P---LLP................P-AVA-A
Q9HZY2_PSEAE/16-104...-...GGAGL-----N-----G..........MAQWFE....SI----G---LTP................G-YLL-A
Q88K91_PSEPK/19-105...-.....NWF-----A-----D..........LQSSFP...FPF----N---LLP................A-ELN-W
Q7W6U9_BORPA/7-93...-...GAQAY-----A-----D..........VLHYFS......----T---VTA...............NP-QSM-L
Q8EZJ9_LEPIN/12-95...-......DT-----D-----A..........LIRLME....MN----N---APM...............AS-TLL-A
Q8Y2U2_RALSO/28-111...-........-----.-----...........YSQELARIEDPF----R---LG.................A-APT-L
Q7X1H0_9BACT/12-99...-...GGFGF-----S-----G..........TMGFFT....QK----L---HV.................P-APV-A
A9CHZ6_AGRT5/16-92...-..QMDGSL-----P-----T......................----.---....................-..M-L
Q99V56_STAAM/4-84...-......DL-----D-----G..........TIHFLG....SL----G---L..................P-PTI-A
Q8FPX7_COREF/162-252...-...GSDGL-----A-----G..........LEADYA......----.---...GY............QWP-EVL-A
Q9CP47_PASMU/16-102...-.....NWF-----M-----E..........IQESFP...FPF----N---VIP................S-DLN-W
Q9HWS4_PSEAE/24-110...-.....NWF-----G-----D..........IQSAFP...FPF----D---RLP................A-AFN-W
Q82PS9_STRAW/30-117...-...GGPGL-----S-----A..........TGKGFA....DM----G---YRP................G-DFF-A
MHQP_BACSU/5-93...-...GGYGI-----K-----G..........TGQWFE....SI----G---VKP................G-NVA-A
Q883U2_PSESM/16-104...-...GGYGL-----E-----G..........TAQYME....SL----G---LTP................G-YLM-A
Q92TK3_RHIME/11-93...-......DP-----S-----G..........TIGYIA....SA----G---LPL................P-PVA-Y
Q7V7V3_PROMM/10-94...-......KF-----S-----S..........VVEAIS....GQ----G---IPES..............LA-PFL-L
A9CK19_AGRT5/23-105...-......DP-----A-----G..........TAGMIA....GA----G---MPA................A-TAL-A
Q7U687_SYNPX/15-102...-........-----.-----...........IENFADAFVRPL----H---LPF................P-ILL-S
Q89EW4_BRAJA/19-101...-......DF-----A-----G..........AVAEQE....HF----G---LYP................G-WLW-A
Y1602_HAEIN/14-100...-.....NWF-----A-----E..........IQDRFP...FPF----N---LIP................A-DIN-W
Q98JF9_RHILO/23-103...-......HF-----D-----G..........AARAMA....AL----G---V..................G-LPL-F
Q8YSN3_NOSS1/6-88...-......NF-----A-----Q..........TSESMA....KA----G---LPI................V-GVL-L
Q92Y87_RHIME/25-105...-......DF-----E-----G..........AIAEMN....HF----G---LTP................A-PLF-A
YQJF_ECOLI/8-88...-......GY-----A-----G..........TQQYME....AM----G---V..................P-GFM-L
Q812I5_BACCR/5-93...-...GGYGL-----K-----G..........TGGWME....SI----G---LRP................G-VFM-A
Q8NT59_CORGL/10-94...-.....TGL-----E-----G..........VTGFFD....SL----G---IPA................A-GIA-A
Q9KY40_STRCO/14-95...-.AMTGGTI-----D-----A......................----.---...................G-TWP-G
Q87KG0_VIBPA/27-115...-.....W..-----.-----D..........STLYLFEFEYQV----P---LLP................W-EFA-A
Q8P8R3_XANCP/15-111...-...NGPGL-----A-----G..........FAAELQ....QF----G---LPA................T-APL-P
Q89SK7_BRAJA/66-148...-......DF-----S-----G..........SVGYFR....SL----H---LPA................P-ELF-T
Q82AZ6_STRAW/10-97...-...GGAGL-----E-----G..........TGQFME....SV----G---YAP................G-KAS-A
Q82V34_NITEU/11-94...-.....GSL-----D-----Y..........ISTLLA....NV----N---L..................P-QIL-A
Q82UE4_NITEU/22-102...-......SY-----A-----G..........TQGYMD....AM----G---V..................P-GTL-L
Q8DDM4_VIBVU/23-111...-.....W..-----.-----D..........STLYLFELEYQV----P---ILP................W-ELA-A

PF13564

D1AAS7_THECD/7-112..K.DR.....L.....A....PK----------LP.........W.V.ED...F..----------------P.SGM.V
D2SF07_GEOOG/7-113..K.KK.....L.....AD...SG----------MG.........W.T.ED...F..----------------S.DGA.V
C5BX04_BEUC1/7-113.RD.DV.....V.....A.....A----------YA.........W.A.ED...F..----------------S.KGQ.I
D3Q9W4_STANL/7-109..P.FV.....V.....A.....N----------ST.........T.V..G...V..----------------P.ASW.V
D1BDS4_SANKS/7-113.DQ.MI.....T.....K.....T----------PY.........V.E..D...F..----------------P.QGA.V
A0QFH8_MYCA1/7-109..R.FV.....L.....A.....N----------SA.........E.V..G...V..----------------P.RSW.L
C2Q8E8_BACCE/7-108..K.MQ.....V.....E.....A----------FS.........H.L..G...L..----------------P.QWF.R
D1BYA3_XYLCX/7-112..K.AL.....E.....Q.....R----------MP.........W.V..E..AF..----------------P.GVV.V
B5HYY5_9ACTO/7-112..PDQL.....R.....P.....M----------MA.........W.V.DR...M..----------------P.LPV.V
D1BVK9_XYLCX/7-113..K.EQ.....L.....R....PM----------MA.........W.V.DD...V..----------------P.MRL.V
A9B5S7_HERA2/7-113..KDKI.....A.....A.....Q----------LA.........W.A.KD...F..----------------T.PNT.I
D3Q6B3_STANL/7-112..K.NK.....L.....A....PM----------MP.........W.V.AD...F..----------------S.PAT.V
C3BLY8_9BACI/20-124..G.GN.....V.....E.....L----------VT.........N.L..G...Y..----------------P.LYI.L
C5C629_BEUC1/7-115..R.ST.....L.....A.....E----------APG......GGW.V.GG...F..----------------S.ASF.V
D3PWB3_STANL/7-114..K.LM.....K.....A....PG----------AG.........W.V.ED...F..----------------S.AGF.I
B0AKY3_BACAN/4-107..S.FQ.....V.....E.....H----------WR.........Q.Y..Q...Y..----------------S.LWF.M
D3EH52_GEOS4/7-112..E.KA.....N.....A.....S----------WG.........W.V.KD...V..----------------P.KAF.V
A4F848_SACEN/7-108..K.WV.....L.....G.....N----------MS.........K.Y..G...L..----------------P.HSW.I
C4RG94_9ACTO/7-114..KEEL.....V.....A.....P----------LG.........E.WVRS...F..----------------S.APG.V
A1SIQ7_NOCSJ/7-109..E.QV.....V.....T.....S----------IH........KT.V..G...V..----------------P.MRY.I
C6WJU0_ACTMD/7-113..R.QQL...LE.....K.....G----------MG.........W.V..E...H..----------------R.KDAEV
B5I6V7_9ACTO/19-120..D.WI.....V.....K.....A----------LT.........D.Y..G...V..----------------P.RTW.W
A8M6Z9_SALAI/7-108..A.QM.....R.....A.....R----------MA.........H.L..G...V..----------------S.PER.T
C6VZE8_DYAFD/11-112..E.EE.....V.....K.....M----------FA.........H.L..G...Y..----------------P.EYL.L
Q0SGE8_RHOSR/7-112..G.TA.....W.....T.....G----------LQ.........S.R..G...L..----------------S.GQQ.V
D5UX83_TSUPD/7-115..R.ER.....Y.....R.....A----------LGPN.....QHW.V.DD...F..----------------G.DGH.L
D3PZS4_STANL/7-112.IG.TL.....A.....D.....T----------MT.........W.I..E..YF..----------------P.SGT.V
D3PUC2_STANL/7-110..A.PI.....Y.....P.....A----------MA.........K.A..G...V..----------------P.ASW.V
C9Z9S2_STRSW/7-108..P.FM.....R.....Q.....A----------AA.........H.L..G...L..----------------S.LTL.Y
A1TE84_MYCVP/11-113..P.FV.....L.....A.....N----------SA.........E.V..G...V..----------------A.PRW.I
D2AS43_STRRD/5-106..A.WV.....V.....Q.....P----------LA.........A.Y..G...V..----------------P.SSW.W
A4T6B5_MYCGI/6-108..G.FV.....L.....R.....N----------SA.........Q.V..H...V..----------------P.VSA.L
D2PZ45_KRIFD/7-114..R.LI.....A.....T.....G----------QT.........G.V..A..VF..----------------P.MPL.V
B1MM14_MYCA9/10-112..Q.FV.....V.....Q.....N----------SG.........E.V..G...L..----------------A.PRW.L
A6FZU9_9DELT/14-115..P.EA.....V.....Q.....F----------FL.........D.L..G...Y..----------------P.EYI.V
Q65HS4_BACLD/5-107..P.FQ.....V.....E.....H----------WR.........H.Y..E...Y..----------------P.LWF.L
Q5YWI3_NOCFA/31-132..E.WV.....R.....A.....N----------MR.........T.Y..G...I..----------------P.DRA.L
D3F1P3_CONWI/7-108..P.QI.....V.....A.....S----------AT.........R.V..G...F..----------------P.ADR.L
C7PZU5_CATAD/19-125..K.EK.....V....LV.....K----------AP.........V.L.EN...Y..----------------A.PGT.I
A8M8B0_SALAI/7-107..E.YP.....K.....S.....E----------AD.........R.N..R...V..----------------P.RSW.V
B5H4W5_STRPR/7-108..R.WI.....I.....D.....N----------LT.........S.Y..G...V..----------------P.LTW.L
A1UGV4_MYCSK/7-109..G.DA.....R.....E.....N----------QV.........H.L..R...I..----------------S.VGL.T
Q11P05_CYTH3/10-110..P.KI.....V.....E.....G----------FK.........F.M..G...F..----------------P.DYF.R
D5UGI3_CELFN/7-114..K.EQ.....L.....RA...AG----------MA.........W.T.DD...F..----------------D.AAR.I
Q89Y33_BRAJA/62-168..P.QL.....A.....A.....M----------MP.........W.A..G..QY..----------------S.ETF.V
A6G4G5_9DELT/10-111..E.PL.....V.....E.....S----------MK.........A.L..G...Y..----------------P.TYL.L
C0ZKK1_BREBN/2-104..N.SM.....L.....Q.....H----------WK.........E.Y..G...Y..----------------P.LWF.M
B1MDG2_MYCA9/7-115.HE.KI.....A.....AN...AN----------LA.........W.A.ND...F..----------------S.PHV.V
Q7UL85_RHOBA/23-124..A.AI.....M.....E.....S----------MT.........R.L..G...F..----------------P.SYV.A
C7PUE7_CHIPD/10-111..P.EM.....D.....Q.....A----------FQ.........H.I..G...Y..----------------P.AYF.R
D3Q6A9_STANL/7-109..P.SV.....V.....E.....H----------VT.........A.L..G...F..----------------S.MRA.C
A3RXR1_RALSL/22-128.IP.EL.....A.....A.....M----------WP.........W.T.GQ...F..----------------P.EAF.V
Q82R50_STRAW/28-129..P.KA.....R.....E.....L----------AA.........E.T..G...F..----------------S.VAA.Y
D2QST6_SPILD/17-122..A.DQ.....L.....A.....T----------MW........PW.T..A...E..----------------H.TNL.V
Q5YXM8_NOCFA/33-141..V.EK.....L.....A.....A----------APG......GGWTA..A...V..----------------R.PGF.V
C7PKH0_CHIPD/17-121..AAEL.....A.....A.....M----------WP.........W.T..A...E..----------------H.RGL.V
B2JL65_BURP8/47-153..E.PL.....A.....K.....I----------FP.........W.M..G..QV..----------------P.SWV.V
Q72UJ2_LEPIC/13-114..P.EV.....V.....A.....G----------IT.........K.L..G...Y..----------------P.MYF.I
C0WI63_9CORY/7-112..K.FI.....S.....R.....C----------LR.........G.V..N...F..----------------P.QDW.W
Q1VX62_9FLAO/6-107..P.TM.....Y.....K.....E----------FK.........R.F..G...L..----------------S.KGQ.R
D2ASD1_STRRD/34-143..D.GA.....LYAAAPR.....A----------VA.........W.Y.AA...V..----------------P.QSL.I
B0UIU5_METS4/14-111..P.FE.....V.....S.....G----------FL.........R.F..G...Y..----------------P.LWF.M
D2PS28_KRIFD/35-136..E.WV.....Q.....V.....Q----------TS.........H.L..G...Y..----------------P.DYF.I
A6G6P4_9DELT/10-116..Q.MV.....V.....E.....M----------AE.........A.L..G...V..----------------P.LAL.L
C7PYY8_CATAD/7-121..K.DR.....L.....I.....A----------SG.........Q.T..GVTPF..----------------P.LPL.L
A9GJR9_SORC5/11-117..P.AS.....V.....D.....G----------FV.........R.L..G...Y..----------------P.LHF.V
B8IER0_METNO/21-116..P.MM.....V.....Q.....V----------YD.........L.I..G...V..----------------G.QWF.R
Q1IKM4_KORVE/10-111..S.HF.....T.....D.....D----------MA.........H.L..G...Y..----------------P.LYF.L
A4C0H3_9FLAO/6-106..K.FI.....I.....A.....E----------FE.........R.Y..A...L..----------------P..KF.R
A1ZLE1_9BACT/10-109..E.NI.....K.....V.....V----------FA.........N.L..G...Y..----------------P.TYI.I
C0BG18_9BACT/6-105..R.RM.....K.....A.....E----------FE.........R.W..G...F..----------------L..NH.R
A9FEJ3_SORC5/27-126..P.QV.....L.....E.....G----------SE.........Q.L..G...Y..----------------P.VSS.V
A8ULQ7_9FLAO/10-110..E.DI.....V.....T.....A----------FT.........S.F..G...Y..----------------P.TYL.I
Q2S0Z3_SALRD/8-118..E.NM.....A.....A.....K----------FA.........Q.L..G...F..----------------P.DYF.R
Q11S70_CYTH3/11-112..T.TM.....M.....Q.....S----------MQ.........S.F..G...F..----------------N.KTW.T
Q5Z2J9_NOCFA/19-120..S.YV.....R.....E.....S----------FD.........H.L..G...Y..----------------P.LYF.A
C6X539_FLAB3/10-112..E.VK.....A.....G.....F----------SS.........H.L..G...I..----------------P.DYL.R
Q26DR8_FLABB/6-106..Q.RM.....V.....L.....E----------FE.........R.F..G...I..----------------P.QY..R
B8JHM2_ANAD2/39-140..E.YV.....R.....V.....V----------ME.........H.L..G...Y..----------------P.LYV.L
B5HQQ2_9ACTO/55-152..P.SA.....A.....E.....G----------FD.........K.M..G...W..----------------G.SAG.M
A7H7U7_ANADF/31-130..D.PV.....V.....E.....S----------FA.........R.L..G...Y..----------------P.ATI.A
B9R073_9RHOB/12-107..P.MM.....V.....Q.....T----------FE.........A.L..G...I..----------------G.QWF.R
A5FBV8_FLAJ1/7-111..E.LA.....K.....E.....G----------IR.........H.L..G...Y..----------------P.EYF.G
A1ZY83_9BACT/27-125..E.MV.....S.....E.....N----------FP.........K.A..G...F..----------------P.VFI.I
D7VTK5_9SPHI/10-113..Q.YV.....N.....A.....G----------TK.........P.L..G...Y..----------------P.DYF.A
D2QN87_SPILD/19-118..P.LA.....I.....E.....G----------TR.........H.L..G...F..----------------P.DYF.R
A9B014_HERA2/18-116..A.PV.....A.....K.....S----------FA.........A.L..G...Y..----------------P.AGI.A
A8FU14_SHESH/7-110IFE.KQ.....L.....E.....F----------FH.........S.Y..G...L..----------------N.RQI.M
Q1M3R5_RHIL3/9-110..Q.WV.....R.....E.....A----------LT.........E.L..G...Y..----------------SANNL.V
D0XES9_VIBHA/3-111.FE.PQ.....L.....A.....F----------FH.........K.Y..G...L..----------------N.RAA.M
B9XQC4_9BACT/28-127..A.PV.....V.....K.....G----------TV.........E.L..G...Y..----------------P.ESV.I
B5WCL4_9BURK/11-109..G.AV.....K.....R.....D----------FA.........R.W..G...Y..----------------P.AWF.H
C6B3P5_RHILS/11-110..P.EI.....A.....A.....D----------YA.........R.W..G...Y..----------------P.ESF.H
Q1D110_MYXXD/7-102..P.EA.....I.....Q.....G----------IE.........K.S..G...Y..----------------P.GSV.L
B1FVW7_9BURK/9-106..R.SI.....F.....E.....E----------YL.........K.W..G...Y..----------------P.HWF.H
C7PKI9_CHIPD/12-107..G.HA.....L.....Q.....M----------SA.........S.F..G...L..----------------S.GGV.Y
B9XR85_9BACT/12-110....TH.....K.....V.....E----------FA.........H.L..G...F..----------------P.NYF.R
A9F3Z6_SORC5/44-143..F.PA.....D.....A.....A----------TA.........Q.L..G...F..----------------P.ASL.V
C9CTS5_9RHOB/7-110..E.QA.....V.....P.....T----------LA.........A........T..----------------P.NAV.W
A5ERI9_BRASB/6-107..D.VV.....T.....Q.....T----------MD.........Q.M..G...YGG----------------S.DAM.A
D9QMH9_BRESC/33-140.IS.NL.....T.....A.....L----------MS.........W.P.AL...V..----------------S.ESL.V
B1KFL4_SHEWM/4-111IFE.TQ.....L.....S.....F----------FL.........K.Y..G...L..----------------N.RAM.M
C0IN69_9BACT/7-105..A.AA.....T.....D.....S----------MT.........Q.I..G...W..----------------P.TKY.L
Q0SJ69_RHOSR/31-130..Q.MV.....R.....E.....A----------MA.........E.L..G...F..----------------A.ENL.N
A3XU47_9VIBR/12-120..Q.KK.....V.....FEIQLGF----------FK.........S.Y..G...L..----------------N.RVI.M
Q1IPI6_KORVE/25-123..P.HV.....V.....A.....A----------SG.........P.L..G...F..----------------D.PPT.I
A9UV76_MONBE/637-749LHN.EL.....V.....G.....K----------FETYAKVLQTVQ.Y..G...V..----------------SGSTF.R
B6AU47_9RHOB/5-108IFE.TQ.....L.....G.....M----------FI.........K.Y..G...L..----------------N.RQI.M
B4RA61_PHEZH/23-122..P.IV.....E.....V.....T----------GA.........Q.L..G...L..----------------P.PGS.G
A6EKC1_9SPHI/24-124..E.MA.....L.....E.....G----------TK.........H.L..G...L..----------------P.MWF.H
C5C5Y3_BEUC1/41-144..E.TFFGAPYS.....V.....K----------FV.........E.W..G...Y..----------------P.SWF.R
C0Z8W5_BREBN/15-114..A.PV.....V.....E.....G----------TL.........V.L..G...Y..----------------A.QHH.I
B9JK89_AGRRK/29-136..I.EY.....L.....GS...LG----------MD.........S.V..T..VL..----------------P.EWA.V
B1MHX9_MYCA9/33-130..Q.FS.....R.....S.....A----------TE.........A.L..G...F..----------------P.SYQ.T
A5V4G4_SPHWW/11-106..A.GI.....R.....A.....A----------YA.........R.W..G...Y..----------------P.AGF.R

PF07291

MAUE_METEA/3-186-----------------R----------------HGEEFFGVVRNFRLMPE---W------------------LARPF-A
MAUE_PARDE/2-185-----------------R----------------HVEEFYGVVRNFRVLPD---L------------------ASRVV-A
MAUE_METFK/2-184-----------------R----------------HPDEFQGVVANYKLLPS---F------------------LVAPV-A
MAUE_METME/2-186-----------------R----------------SQDEFLGVVANYKLLPG---F------------------LVAPF-A
MAUE_PARVE/2-185-----------------T----------------GMEEFHGVVRNFRLLPD---M------------------ASRAV-A

PF04224

Q9CJR3_PASMU/1-137IISAS.WLSFLY-----D-----L----------F.......................................GVYKTS
O25289_HELPY/5-190FVANSPFFSFMY-----K-----F----------EK.PAYKQHKMSESQSMQEEMQDNPK...IVENKEWHKENRTYLVA
YKGB_ECOLI/2-182FVANSPLMSFFY-----E-----H----------PEDYKQYLTHEGEYK...............PEARAWQTANNTYGFS
Q9KRP9_VIBCH/1-146LVLNHPLMGWIY-----Q-----F----------LS.......................................IQAVS
Y219_HAEIN/13-209FVSNSPFFSYMY-----E-----.----------.KGPNLVPNDKGE.LVMEYTLHKNPEGKMVAKNIEWHKENGTYTAS
O87513_ECOLX/1-138LISPT.WLNILY-----I-----M----------F.......................................GVHGGS

PF05514

Q6RJY8_CAPAN/1-138PAAKELAPKVAG----------------------LQDLLESKL....GAGV----------------------PKIDVRH
O23298_ARATH/1-138RSAKSLKPKFNA----------------------FVNHVTTHT....GQQL----------------------PPVDMKI
Q01MB3_ORYSA/1-138PAAKALKPKFNL----------------------FMQQVSKSL....GMAV----------------------PHIDIKT
Q9LTD0_ARATH/18-201GTEDYWSPKFGY----------------------SGD..............----------------------...QIKH
Q9LTD1_ARATH/1-132PLEKTMGPAVNM----------------------LSKYGSKALTFYFGMQV----------------------VAFDVRL
Q0IXE1_ORYSJ/1-138PAAKALQPKFNT----------------------IVANISTRT....GLVV----------------------PHIELKH
A2XCK0_ORYSI/1-138PAAKALRPKYNV----------------------FTKNISAHL....GVAV----------------------PHVELKH
O22690_ARATH/1-138PAAKELAPKLDL----------------------TKAHLSSIL....GVSL----------------------PNLEVKQ
Q570L1_ARATH/18-198.AADELRPKLGF----------------------FEN..............----------------------...QAKA
P93384_TOBAC/1-138PAAKALRPKFNI----------------------FSKHVATHT....GFQV----------------------PHVEMKH

PF13781

A0RCI0_BACAH/180-281-----------------K----------------MLSVI.IGSTEN---------------------------S-IFI-L
C3GZF4_BACTU/180-281-----------------K----------------MLSVL.IGSNES---------------------------S-VYI-L
C2TVP5_BACCE/180-280-----------------K----------------MLSL..IGSNES---------------------------S-VFI-L
C3AK78_BACMY/185-286-----------------Q----------------MLSVL.IGSNEN---------------------------S-ILA-L
D3E5H6_GEOS4/180-281-----------------D----------------LLRQS.GLAAGR---------------------------E-GVV-L
Q65IN6_BACLD/178-279-----------------S----------------MLSAF.TGGRFH---------------------------P-ETL-L
A6CEZ9_9PLAN/177-278-----------------A----------------MLADA.GVAASV---------------------------A-PAF-L
C6CYU2_PAESJ/180-281-----------------G----------------IMQSM.HMFPGI---------------------------E-LQA-L
Q8ESB3_OCEIH/179-280-----------------D----------------LVQSI.GWFQGY---------------------------E-SVL-L
B3EDV4_CHLL2/19-119-----------------E----------------LLGHV.IPVYQW---------------------------A-CIA-V
A4SEU6_PROVI/25-125-----------------E----------------LLGHL.IPVYRW---------------------------A-CMA-V
A1BFB6_CHLPD/25-125-----------------D----------------LLGHV.IPVYQW---------------------------A-CMA-V
B4SAW4_PELPB/19-119-----------------D----------------LLGHL.IPVYQW---------------------------A-CEA-V
B3EQZ0_CHLPB/20-120-----------------Q----------------LLEYV.IRNNEL---------------------------A-CAM-V
B4S7F5_PROA2/21-121-----------------E----------------LIGHV.IKVYEI---------------------------A-CQL-V
Q3ARZ2_CHLCH/17-117-----------------E----------------LLGHI.IPIYKW---------------------------A-CIA-M
B3QTS0_CHLT3/26-127-----------------R----------------LLQAG.GIDFAT---------------------------A-KSV-L
B1KF78_SHEWM/12-113-----------------V----------------MTTSL.GLSNEL---------------------------S-YLV-I
A0Y6C6_9GAMM/17-118-----------------L----------------MTGSA.GYSAQV---------------------------S-DLI-T
B3QN36_CHLP8/20-117-----------------G----------------LLSHL.GPL...---------------------------F-GFM-C
B4X4D6_9GAMM/11-112-----------------R----------------MNMAL.GLNEAQ---------------------------A-HLL-S
C0VHX3_9GAMM/20-120-----------------Y----------------FWQYM.GLASEY---------------------------I-FWI-I
D0BX48_9GAMM/15-115-----------------F----------------VWQMI.GLSFDY---------------------------A-KLA-G
D0SFQ9_ACIJO/15-115-----------------A----------------IWQTF.GLSYVQ---------------------------A-QLA-G
Q1H1D1_METFK/335-436-----------------A----------------LLAEV.GLEGTA---------------------------A-SVA-L
D0SSK1_ACILW/19-120-----------------T----------------IWQNM.GFELGL---------------------------A-KVL-V
C7R8T5_KANKD/19-119-----------------E----------------LLINF.GFNDSI---------------------------T-LTL-I
B3RB23_CUPTR/328-429-----------------A----------------LLARA.GVPPAL---------------------------Q-PLA-L
Q2SM61_HAHCH/17-117-----------------A----------------MIEAQ.GLG.QY---------------------------A-PQI-A
Q3SHK0_THIDA/314-415-----------------E----------------LLRRV.GVPAAL---------------------------G-PLM-L
B1KF79_SHEWM/15-115-----------------Q----------------ILTEA.NISGSF---------------------------A-DVA-I
C0DTU0_EIKCO/36-137-----------------D----------------LLGRA.GIAAEW---------------------------Q-AVA-F
Q2Y734_NITMU/330-431-----------------V----------------LLARV.GITGGL---------------------------A-PIA-L
Q5X5Q5_LEGPA/322-423-----------------S----------------LFAQI.GFSSLW---------------------------Q-LFL-F
Q5NY22_AROAE/320-421-----------------A----------------LLARA.GVPEAL---------------------------R-SAA-L
B1Z1S6_BURA4/308-408-----------------A----------------MLARA.HLTGLP---------------------------A-LIA-L
A7BY74_9GAMM/6-107-----------------Q----------------LLAAT.GITGVW---------------------------A-PIM-L
C4GMT5_9NEIS/12-113-----------------D----------------LLARV.GFQAAY---------------------------C-LPM-F
C8NCY7_9GAMM/28-129-----------------Q----------------LLAQI.GVPPAL---------------------------Q-QPL-F
A1K6I8_AZOSB/336-437-----------------E----------------LLARA.GVPEGL---------------------------R-LLA-L
A6DTJ9_9BACT/15-115-----------------.----------------LMNNT.FMPFME---------------------------K-DFA-L
D4DP38_NEIEG/16-117-----------------S----------------LLAEV.GFQTAF---------------------------Q-WPL-L
Q1LGK6_RALME/315-415-----------------A----------------LLGAV.GLHGTP---------------------------A-IVT-L
Q4UMY6_RICFE/322-422-----------------Q----------------IIISL.GFDKQI---------------------------A-PYI-L
C5TJR5_NEIFL/18-119-----------------D----------------LLHSV.GIPDPL---------------------------Q-WPT-L
C1F939_ACIC5/18-120-----------------A----------------MMIELPGCTAER---------------------------A-VLL-L
Q7NW81_CHRVO/13-112-----------------A----------------MLARL.GLPQAA---------------------------L-APL-F
A8UH51_9FLAO/12-113-----------------E----------------IISE..ILGTEY---------------------------S-SVL-T
Q11TY1_CYTH3/19-119-----------------Q----------------IVAR..ILGNEH---------------------------A-RVL-T
C7PI03_CHIPD/14-115-----------------A----------------IVAR..ILGAQY---------------------------A-GPL-T
C9YGF9_9BURK/7-107-----------------L----------------LLAGG.IADPLL---------------------------A-NVL-V
A1VMB6_POLNA/12-112-----------------Q----------------LLHAA.GLSQPL---------------------------L-VQA-L
Q0ANG5_MARMM/322-422-----------------S----------------VLAAG.GFSEAA---------------------------Q-PPV-L
A9C3F1_DELAS/21-121-----------------Q----------------VLADA.GIHDAR---------------------------W-QTF-L
Q4K472_PSEF5/309-409-----------------R----------------IMAEA.GVQGIW---------------------------A-ALA-V
Q89WY4_BRAJA/329-429-----------------G----------------ILSAH.NFAPAL---------------------------V-DPI-T
Q2BMK1_9GAMM/316-416-----------------P----------------ILSAV.GFPAAA---------------------------H-SGL-V
A5E8R6_BRASB/331-431-----------------A----------------ILTTR.GWPEGF---------------------------A-IPF-A
C9CYE4_9RHOB/339-438-----------------S----------------ILTDR.GAPSWL---------------------------S-ALA-V
A3K709_9RHOB/331-430-----------------.----------------.LTRI.GWPQTL---------------------------A-TAS-V
Q1YK40_MOBAS/336-436-----------------K----------------ILTDH.GFGSLP---------------------------A-TVV-T
Q2K6I2_RHIEC/316-414-----------------H----------------FLP...FMPEAA---------------------------A-TAL-T
A1TNI5_ACIAC/22-122-----------------D----------------LLVAA.GMQNTL---------------------------L-MQA-I
B8H2E0_CAUCN/321-421-----------------T----------------LTT.A.GVGREL---------------------------A-VAA-V
B6RA56_9RHOB/326-425-----------------.----------------LLER..SFPPAL---------------------------S-LLF-V
C4WL85_9RHIZ/327-426-----------------A----------------ILEGH.HVPAWL---------------------------A-GIT-V
B9JGJ5_AGRRK/322-420-----------------H----------------FLP...FMSSGM---------------------------A-TTL-T
A9EWZ0_9RHOB/307-406-----------------K----------------LLQAT.GWSAPL---------------------------S-KAS-V
B4WB77_9CAUL/325-424-----------------A----------------ILHE..GGYGRW---------------------------A-GPV-A
A5V930_SPHWW/323-422-----------------G----------------LLRAG.GLDDRL---------------------------A-RFL-G
Q2JZG1_RHIEC/327-426-----------------E----------------LMMG..GGASSL---------------------------A-APT-V
Q02U83_PSEAB/307-409-----------------R----------------ILGEA.GIHGWP---------------------------A-SLA-V
Q11CJ7_MESSB/321-420-----------------E----------------LMLRT.GAGPL.---------------------------S-ASG-V
A4F044_9RHOB/306-405-----------------S----------------VLTER.SVSSWV---------------------------I-APT-V
A7IKV9_XANP2/322-421-----------------F----------------LQEA..G.TGPL---------------------------A-LPL-A
Q2S702_HAHCH/327-427-----------------.----------------VLKAI.SLPETL---------------------------W-RPM-V

PF02077

SURF4_CAEEL/11-277QESWSCGWFIATLFVIYN----------------FFGQFIPVLMIM--------LRKKVLVACGILASIVILQTIAYHIL
YFC7_CAEEL/4-269SYNWGLNYHFSLFLTIVM----------------IINLLFGSLFVM--------MRYKVTESSAVLGFTIFAQVILYQLY
ERV29_YEAST/48-310NKWKHYPYFFVVVFLVVV----------------TVSMLIGASLLV--------LRKQTNYATGVLCACVISQALVYGLF
SURF4_SCHPO/33-302RDYRRFRFGTAPLLLFVC----------------VVLMLVGSTLVV--------FKKRQAYAIGSLLFVTLLQAFAYGLI
SURF4_DROME/5-270DMSWGCGKFLATVFVLVN----------------LLGQLGGCGMVM--------ARFKVDIAVGLLFFIVVLQTVAYSIL
SURF4_HUMAN/4-269DTTWNCGYLLASSFVFLN----------------LLGQLTGCVLVL--------SRNFVQYACFGLFGIIALQTIAYSIL

PF06762

Q2L6Y0_CAEEL/122-555CPTWWNLTALNYHFESQP----------------LPTPFAWYAHYF---------------------------P-QFF-K
LMF2_BOVIN/122-592CPAWWGLTALTYHYETQC----------------LPTPAAWFAHHL---------------------------P-VWL-H
Q826A6_STRAW/121-468DACWRKLTCLYYHHETQP----------------MPGPLSCFFHHL---------------------------P-KPL-H
A0QMA7_MYCA1/121-478DPCWRDLTCLYYHHETQP----------------MPGPLSWFFHHL---------------------------P-KPL-H
Q45WA6_TOXGO/205-777DRAWKDLTALDYHYETQP----------------LPNPLSWYFQNQ---------------------------S-HGV-H
LMF1_HUMAN/169-551DRCWRDLTCMDFHYETQP----------------MPNPVAYYLHHS---------------------------P-WWF-H
Q4REY1_TETNG/125-682CPTWWGLTALTYHYETQC----------------IPTPLAWFAHQL---------------------------P-VWW-Q
A0QT94_MYCS2/77-431DRCWRDLTCLYYHHETQP----------------MPGPLSWFFHHL---------------------------P-KPL-H
B9M9C6_GEOSF/118-470DPCWRDLSCLDYHFETQP----------------MPNPVSRFFHLL---------------------------P-AVL-R
A1R4Z7_ARTAT/124-480GREWRDMTAMFYHHETQP----------------MPGPLSRQAHLL---------------------------P-RPL-H
A0JUS2_ARTS2/124-488GSEWRDLTALYYHHETQP----------------MPGPLSRQAHLL---------------------------P-KPL-H
LMF1_MOUSE/169-553DKCWLDLTCMDFHYETQP----------------VPNPIAYYLHRS---------------------------P-WWF-H
A4FB78_SACEN/123-469DSCWRDLTALYYHHETQP----------------MPGPLSRRFHQL---------------------------P-RPL-H
Q6MNI0_BDEBA/151-510DGSWKDLTALTYHYWTQP----------------LPTPLAYFAHKM---------------------------P-RWF-Q
Q54K13_DICDI/157-572TPIWAGLQAMNFQYETQC----------------IPNILSWYLNQM---------------------------P-HVF-H
A7RJW9_NEMVE/81-464DQCWRDLTCMNYHYETQP----------------VPNPISYYMHHS---------------------------P-ELF-H
Q08T93_STIAD/249-611DRTWRELTACQHYYETAP----------------LPTRGGWYAHHL---------------------------P-VRA-Q
Q1CX59_MYXXD/289-656DRTWRELSACEHYYETAP----------------LPTRGGWYAHHL---------------------------P-RRL-Q
Q234A3_TETTS/136-636CPTWWQLTALHYHFESQP----------------LPNPISYYFHQL---------------------------P-SWL-K
Q4XRT1_PLACH/156-696TDVWGKLEGKYYLYETQP----------------LPTIVSYFFHT.---------------------------Y-EFL-S
A5K5K3_PLAVS/186-557SPQWLHLEACQNLFFCQP----------------APSILSHIANC.---------------------------.-TFN-K
A0LRD9_ACIC1/123-473DPCWRDFTCLYYHHETQP----------------MPGPFSWYFHRL---------------------------P-KIL-H
LMF2_XENTR/122-590CPTWWGLTALTYHYETQC----------------IPNPAAWFAHQL---------------------------P-VWF-Q
A1TEH0_MYCVP/123-477DPCWRDLSCLDYHHETQP----------------MPGPLSWFFHHL---------------------------P-KPL-H
Q4Y900_PLACH/136-509GSQWLHLKGCENLFLCQP----------------LPSILSHIAYC.---------------------------.-KFD-K

PF04173

Q97X72_SULSO/12-173FI-ILFTAI-EAIFGLFMI-----I-G----------------FLT-R----LSGL---VL-AGMAW-------------
Q97XJ3_SULSO/18-183FL-TIFSYV-EILVGLFLI-----I-G----------------FLT-R----LSAF---GA-AVMAI-------------
Q973M6_SULTO/9-177EL-VMIG..-EISFGILNL-----L-G----------------LMT-R----FTNT---VA-FYTNL-------------
P97207_ACIAM/20-184FL-TVFSYI-EIIAGLFII-----I-G----------------LLT-R----LAAL---GA-LAMSV-------------
Q97UC4_SULSO/10-178TL-VMIG..-EISFGILTL-----I-G----------------LMS-R----LCSV---VA-FYTNL-------------
Q8NKT7_ACIAM/12-174FL-IMFTVL-EAIFGLLMM-----L-G----------------LLT-R----LSGL---VL-AGLAW-------------
Q8AAF0_BACTN/18-181AM-VIFTLV-EGIVGLLYM-----L-G----------------FFT-R----LMSI---GV-FSLAF-------------

PF07681

Q83CN9_COXBU/12-94IL-SIIF---ELGGGILVF-----F-G----------------LFT-R....FGAF---LL-LVFVL-------------
Q87K55_VIBPA/16-104FL-AGSA---EFFGGLFIL-----L-G----------------LLT-R....PAAV---AL-SFTMV-------------
Q8KEE1_CHLTE/7-88AG-VPVG---EVFAPLLIV-----L-G----------------IYT-R....PAAL---VE-AFLMG-------------
Q9RTC4_DEIRA/8-92PL-VATI---ETVGGVLLF-----L-G----------------LAA-R....TVAF---LL-SCIMF-------------
Q7TUM8_PROMM/37-127YA-AALT---EIICPIGIA-----F-G----------------LAT-R....LCAL---GL-LSTMA-------------
Q98K39_RHILO/14-90TA-AGIL---EFAGGILLA-----L-G----------------LFT-R....PVAF---LL-AGEMA-------------
Q7VHA8_HELHP/8-89YG-AYIG---EVLAPLMII-----V-G----------------YQV-R....IAAA---LE-AFTML-------------
Q8GA66_ECOLX/8-90AI-VVLV---EIVGALMIV-----F-G----------------FFT-R....PVSI---IL-CLYTV-------------
Q89FZ6_BRAJA/10-92YL-IMTV---EVLSGVALI-----L-G----------------VWT-R....YAAL---AG-IPILL-------------
Q8EDN3_SHEON/21-107AL-AAGT---EFFGAILLL-----L-G----------------LAT-R....LISI---PL-MITML-------------
Q8KW46_9RHOB/66-148AM-IILV---QAGGSISLI-----T-G----------------LFA-P....LGAA---AL-VIFSL-------------
Q8A9J9_BACTN/19-101GL-AIFG---ELVCSMGFI-----F-G----------------FLY-R....LAMI---PM-IFTMI-------------
Q83BV7_COXBU/131-217RL-AGLC---ELGGAIAIG-----L-G----------------FLT-R....LGSL---GI-TLYLI-------------
Q92W39_RHIME/11-107FV-VAFA---EVMLPIFLA-----L-G----------------LAT-R....LAAL---GL-LAMAI-------------
Q8U4Y0_AGRT5/25-105VF-VIIF---ELTASAMVV-----T-G----------------VLR-W....VGAL---AL-SGFTL-------------
Q89M65_BRAJA/31-107YA-AGTL---ELVLGAALM-----L-G----------------LFT-R....ITAF---IL-SGEMA-------------
Q8FX91_BRUSU/12-94VV-VGLI---EFVGGLAIL-----F-G----------------FKT-R....IAAV---IV-GLFTL-------------
Q7V0B0_PROMP/15-102YV-AAFS---EIGGSWLLI-----L-G----------------LAT-R....FGAL---AI-VGTIS-------------
Q82B81_STRAW/12-94WY-AAVI---QLVGGSLVA-----L-G----------------LGT-R....AAAF---IS-SGSMA-------------
Q984Q4_RHILO/6-88AA-GSAL---EIVAGLLVA-----V-G----------------IAV-P....FAAG---AL-VVFTL-------------
Q9A3E7_CAUCR/28-117HA-ATYS---EHLFSILLV-----L-G----------------LFT-R....MSAL---AF-LGMTA-------------
Q983U6_RHILO/19-101VV-VGLI---ELLGGLAIL-----V-G----------------FQT-R....IAAW---VL-AIFTV-------------
Q82HN4_STRAW/24-126YA-IALG---ELAVGIGTL-----I-G----------------LLT-R....LAAL---GG-ALISL-------------
Q7VUY8_BORPE/24-126LL-AASV---EHILPVLLI-----L-G----------------LAT-R....WSAL---GL-LLMTL-------------
Q831Y6_ENTFA/7-87YG-VAAI---ELIGGLFMI-----I-G----------------FLI-P....LVSV---GF-IAVLV-------------
Q983U8_RHILO/8-90WG-TGLF---ELIAGLLIL-----I-G----------------FQT-R....IVAL---QL-AAFCV-------------
Q7V328_PROMP/44-134YG-AAIT---QLVCPLGLA-----L-G----------------VFA-R....LSSL---GL-FSTMA-------------
Q9K461_STRCO/11-90WW-AAVV---QLVGGTLVL-----C-G----------------LAT-R....TAAV---LC-SGSMA-------------
Q7MRA2_WOLSU/17-98YG-TYIG---EIFSPALLI-----L-G----------------LYT-R....LNAL---VI-ALTMV-------------
Q8F8N5_LEPIN/13-98FL-VIIG---ESLGALGLI-----F-G----------------FLT-R....LSAF---GI-GIIMI-------------
Q9HYW2_PSEAE/22-108WL-AALS---EAGGAVLLL-----C-G----------------LAV-R....WISL---PL-MVTML-------------
Q88P63_PSEPK/6-95HL-AAYA---EHLFPLLLV-----L-G----------------LMT-R....LSAL---AL-LGMTL-------------
Q9HWH6_PSEAE/14-96IA-TAVT---LLAGSALVL-----L-D----------------RKL-W....LGAG---AL-AVFLL-------------
Q8FR06_COREF/10-94WI-AAVA---ELLGGAFLV-----V-G----------------LLT-T....FVAG---AL-ALLML-------------
Q9KYL5_STRCO/4-96RL-NGAV---HVVGGIMLG-----L-G----------------RCP-R....LAAL---AL-AVTLV-------------
Q8NR01_CORGL/191-281IL-LPSI---ELAAGVFLL-----L-G----------------LMT-P....VAAA---VA-TVATS-------------
Q8XR31_RALSO/30-119AL-GTFG---ELVFPSLML-----I-G----------------IVP-R....LAAA---GL-FFVNL-------------
Q92SD1_RHIME/6-88YL-AGLF---ELVAGLAIL-----V-G----------------FQT-R....IASY---LL-AAFCV-------------
Q7NPD1_GLOVI/22-104WS-AGLA---ELVGGILLA-----V-G----------------LLT-R....PAAA---AV-LFTML-------------
O53252_MYCTU/114-206YV-SAGG---EIVAGVLLV-----L-G----------------LFT-P....LAAA---GA-LAFLI-------------
YPHA_SHIFL/16-98II-AVVM---EVPAAILIV-----L-G----------------FFT-R....PLAV---LF-IFYTL-------------
Q7NZE1_CHRVO/10-92YF-AILI---EIGGGLLLL-----A-G----------------LQA-R....WVAL---LL-IPQLL-------------
Q8CZQ7_YERPE/13-94PL-TILL---EFGGGLAIL-----F-G----------------FLT-R....TTSL---FI-AGFTL-------------
Q7VDS1_PROMA/43-133FA-AGLT---QIICPIGLA-----L-G----------------VLT-R....LAAL---GL-LNTML-------------
O86323_MYCTU/16-94WY-AGVI---ELVAGLLIA-----T-G----------------LFT-R....AVAF---VA-SGEMA-------------
Q7N096_PHOLL/8-89PL-TILL---ELGGGLAVL-----F-G----------------LLT-R....TTAL---FT-FGFCV-------------
Q8XWH4_RALSO/12-94IV-AVIM---EFGVGIALL-----I-G----------------FWT-R....PLAL---LM-ALFVL-------------
Q7VYL1_BORPE/8-89YF-AYVG---EIVGPLLII-----L-G----------------IYC-R....LGAL---LV-VLNMV-------------
Q7US51_RHOBA/24-106VC-AIAT---EVGCSILLI-----L-G----------------LGT-R....VAVS---GL-AFTMF-------------
Q88G88_PSEPK/13-95GI-AVIM---EFLVAILLI-----L-G----------------FYT-R....PLAF---LF-ALFVL-------------
Q812S4_BACCR/6-87YG-VATF---ELVGGLLLI-----L-G----------------LGV-R....YIGL---LF-ALVMV-------------
Q88KH7_PSEPK/17-105LL-SGSA---EFFGGLALV-----V-G----------------LLA-R....PAAL---AL-TVTLI-------------
Q98JU3_RHILO/13-95WC-AAIL---EVALVLCFL-----S-G----------------AFF-T....QAAL---IA-AAYVL-------------
O05565_MYCLE/52-137TV-AATT---EISAGLGLA-----A-G----------------LLT-P....IPAA---GF-VSLMM-------------
Q89MP6_BRAJA/4-104IA-VGAL---EIIAGLMIA-----L-N----------------FGA-R....FFAM---LL-IVYVA-------------
Q8PGB0_XANAC/14-96YV-SMAL---ELGLGVSLL-----L-G----------------LYA-R....WVAL---LG-VPLLL-------------
CATD_BACSU/8-88YV-IAAI---ELIGGVLVF-----F-G----------------LAT-R....IVGV---LF-ALTLI-------------
Q8EC25_SHEON/16-104LM-AGSS---EFFGGLLII-----I-G----------------LLT-R....PTAL---VL-SFTMV-------------
Q7VTR5_BORPE/10-91YP-VTYF---EIVGGVLLI-----L-G----------------IYP-R....WVAA---IA-AVQLL-------------
Q7UE97_RHOBA/16-98LC-AIGA---EVGCSVLLI-----L-G----------------LGT-R....FAVL---NL-AFTMC-------------
Q7NA66_PHOLL/20-124VM-AATA---EHLFPLLLI-----V-G----------------LAT-R....FSAL---AL-MVMTL-------------
Q7VBT6_PROMA/9-93VA-AIFL---LISGSLALV-----F-G----------------KDQ-K....IGAI---FL-LIFLV-------------
O33110_MYCLE/114-202YV-SAGG---EAVAGVLLV-----L-G----------------LFA-P....VVAA---GA-LAFLI-------------
Q9RC47_BACHO/8-89YV-VAIV---ELVGGLAVL-----L-G----------------VGT-K....YVSI---LF-AIIMV-------------
Y886_HAEIN/11-90LV-AGVI---EIVGSILLI-----L-G----------------LFT-R....QAAF---IL-SVEMA-------------
Q8FSC2_COREF/11-95PL-VGAI---ELIGGIMIL-----L-G----------------VFT-R....YVSA---VV-AVVML-------------
Q98K48_RHILO/27-109WA-GIVL---QMIAGVLVM-----A-G----------------LWT-A....LACA---VL-VLFLI-------------
Q72VB3_LEPIC/18-104IL-AIMS---EFFGSIAIL-----L-G----------------FCT-R....LSAF---GI-TCTLA-------------
Q7NSB1_CHRVO/12-100VM-ATCG---ELGLSALLA-----L-G----------------LGG-R....FAAA---GL-FILNA-------------
Q9HZY2_PSEAE/16-104TL-AGSA---EFFGGLALV-----I-G----------------LLV-R....PASV---VV-GFTMI-------------
Q88K91_PSEPK/19-105QL-SMWA---ELVLPLLLL-----L-G----------------LGT-R....LASL---GL-MVVTV-------------
Q7W6U9_BORPA/7-93LL-AGLC---EFAAFIGFT-----F-G----------------LFT-R....VAAA---GT-AAYLV-------------
Q8EZJ9_LEPIN/12-95HY-IVIA---HICGGVLLL-----S-G----------------LLT-R....FAAI---LQ-VPVLI-------------
Q8Y2U2_RALSO/28-111LL-AILS---ETVCPLLIA-----L-G----------------MLA-R....LACL---PI-VFLLL-------------
Q7X1H0_9BACT/12-99FL-VIIG---ESLGSVALL-----M-G----------------FLT-R....FVAV---SF-VMIMV-------------
A9CHZ6_AGRT5/16-92LV-AALL---EAVGGLLVL-----V-G----------------LFT-R....PVAF---IL-SGQMA-------------
Q99V56_STAAM/4-84VL-MSIG---EVVGGLALI-----I-G----------------FLT-P....YVNV---FY-ICVML-------------
Q8FPX7_COREF/162-252IL-LPSL---ELAAGVFLL-----L-G----------------LMT-P....VAAA---VA-TVATS-------------
Q9CP47_PASMU/16-102TL-AMGA---ELLLPFFLI-----L-G----------------FFT-R....CSAL---SL-TILTA-------------
Q9HWS4_PSEAE/24-110EL-SLWA---ELLGALFLL-----L-G----------------LGT-R....LTAL---VL-IVVTL-------------
Q82PS9_STRAW/30-117GL-AGAS---EFLGGLGLA-----V-G----------------LLT-P....LAAA---AV-VGVMI-------------
MHQP_BACSU/5-93AL-SGLG---ELVSGILFI-----L-G----------------VFL-P....LGAA---II-TIIML-------------
Q883U2_PSESM/16-104LM-SGSA---EFFGGVGLL-----L-G----------------LLA-R....PAAV---VV-IVLLL-------------
Q92TK3_RHIME/11-93AV-ALAV---EIGAGILLV-----L-G----------------YRA-R....WVAL---IL-AAFTL-------------
Q7V7V3_PROMM/10-94LA-AIAC---LIVGSVLLL-----F-G----------------KSQ-K....LGAS---LL-LIFLV-------------
A9CK19_AGRT5/23-105YL-AGLF---ELVAGLAIL-----A-G----------------FQT-K....IAAW---AL-AVFCV-------------
Q7U687_SYNPX/15-102YV-AAFS---EVIGSWLLI-----T-G----------------LLT-R....MGAM---AI-AGTIT-------------
Q89EW4_BRAJA/19-101TA-AIVV---ELGGSLLVV-----V-N----------------RFV-W....LGAG---GL-GILTF-------------
Y1602_HAEIN/14-100HV-AMGS---ELIFPFLLI-----F-G----------------VLT-R....FSAL---SL-TILIS-------------
Q98JF9_RHILO/23-103VA-TIAL---QLGAGLSVA-----S-G----------------LLT-R....LGGI---GL-GLFCL-------------
Q8YSN3_NOSS1/6-88IF-TIAF---QILGGLSII-----L-G----------------YKA-E....IGAI---LL-IIFLI-------------
Q92Y87_RHIME/25-105VG-VIVF---ELAMSALIL-----L-G----------------IFR-K....VAAL---CL-AVFTV-------------
YQJF_ECOLI/8-88PL-VILL---EFGGGLAIL-----F-G----------------FLT-R....TTAL---FT-AGFTL-------------
Q812I5_BACCR/5-93FM-AGAT---ELLGGFLFA-----S-G----------------IFI-V....VGSL---FI-VGTML-------------
Q8NT59_CORGL/10-94IA-AAVV---ELLGGILII-----L-G----------------VFT-R....IVAA---FV-AIDML-------------
Q9KY40_STRCO/14-95WY-AAVI---QLVGGGLVL-----L-G----------------LGT-R....PAAV---IC-SGSMA-------------
Q87KG0_VIBPA/27-115YS-GTFA---ELVLPVFLA-----L-G----------------LFT-R....PMAA---ML-FVFNI-------------
Q8P8R3_XANCP/15-111LL-LALV---QSLSGVAVL-----I-G----------------LWT-RASAALAAA---FI-ATTVV-------------
Q89SK7_BRAJA/66-148MT-NIAL---EVLISVGLI-----L-G----------------VGT-R....YCAI---LT-FVFVV-------------
Q82AZ6_STRAW/10-97TA-AGLA---EAGGGTLLA-----L-G----------------LAT-P....AAGA---AA-AGAMV-------------
Q82V34_NITEU/11-94YG-VYLG---EVIAPLMII-----L-G----------------IFS-R....IGGL---LV-FGNTV-------------
Q82UE4_NITEU/22-102PL-VIAL---EIGGGLAII-----A-G----------------WQT-R....LTSI---AL-AVFTL-------------
Q8DDM4_VIBVU/23-111YL-ATAA---ELSLPILLA-----L-G----------------VFT-R....ITSL---VL-FAFNA-------------

PF13564

D1AAS7_THECD/7-112KF.IGVA---ELAAALGLI.....L.P..AATG..IA..P...VLT-P----LAAA---GL-VIVMI-------------
D2SF07_GEOOG/7-113KG.IGAL---EVLGAAGLI.....L.PAALDI....V..P...VLV-P----IAAT---GL-ALLML-------------
C5BX04_BEUC1/7-113RL.IGAA---EVLGAVGLV.....L.PPALGT....M..T...VLT-P----VAAA---GL-ALLMV-------------
D3Q9W4_STANL/7-109VP.LGVL---KAAGALGLL.....L.G..LLG....V..P...FIG-I----AAAA---GL-TLFFV-------------
D1BDS4_SANKS/7-113RL.IGLV---EVLGALGLV.....L.PALLDV....A..P...ALV-P----TAAI---GL-ALVMI-------------
A0QFH8_MYCA1/7-109PA.LGAA---KLAGAAGLV.....V.G..LLG....L..P...ALG-I----AAAA---GL-VVFFV-------------
C2Q8E8_BACCE/7-108IA.TGWI---ALAGVAGLI.....F.G..F.W....N..E...IVL-V----LAAL---WI-ACIML-------------
D1BYA3_XYLCX/7-112RF.IGLC---EIAGALGLI.....L.P..QAT....G..EH.VWLT-P----TAAA---CL-ALLQL-------------
B5HYY5_9ACTO/7-112RA.LGTV---EILGATGLI.....L.P.PLTG...IA..P...WLA-S----AAAI---GF-LLLQL-------------
D1BVK9_XYLCX/7-113RT.IGTL---ELLGAIGLV.....L.PPLIGI....A..P...WLA-L----AAAV---GL-VLLQI-------------
A9B5S7_HERA2/7-113KL.IGGV---EVLGALGLI.....L.P..WLTG..IA..P...ILT-P----LAAL---GL-ALTMF-------------
D3Q6B3_STANL/7-112RF.IGAV---ELLAAVGLI.....G.P..AVTG..VA..T...MLV-P----AAAV---GL-AVTML-------------
C3BLY8_9BACI/20-124TI.LGIW---KVLGVIALV.....V.P....G....F..P...RLK-E----WAHA---GI-FFLMT-------------
C5C629_BEUC1/7-115KV.LGAL---EIAGGVGLV.....L.PAALGV....A..P...FLT-P----VAAS---GL-AIVMV-------------
D3PWB3_STANL/7-114KL.LAVV---EILGALGLI.....L.P..AVTG..IA..P...ILV-P----LAAV---GL-GLIMV-------------
B0AKY3_BACAN/4-107SI.IGFI---EIIGAIGII.....G.G..I.W....N..Q...YLA-L----GANT---LL-AVLMV-------------
D3EH52_GEOS4/7-112VF.IGVA---ELVGAFGLI.....L.P..LAMY..IV..P...KLT-P----IAAA---GL-ATIVL-------------
A4F848_SACEN/7-108YP.LGAV---KTAGALGLM.....A.G..I.A....V..P...WIG-I----AAAA---GL-FLYFI-------------
C4RG94_9ACTO/7-114KL.LGLV---EVLGAVGLV.....V.P.PLAG....V.AP...VLS-P----VAAV---GI-VVIMV-------------
A1SIQ7_NOCSJ/7-109PV.LAAL---EVAGAIGIV.....A.G..L.W....L..E...PLG-I----AAAA---GL-TAYFL-------------
C6WJU0_ACTMD/7-113KA.VGAV---EVLGGLGLV.....L.P..WATG..IA..P...VLT-P----IAAA---GL-VITMV-------------
B5I6V7_9ACTO/19-120NL.LGAA---KIAGAVGLL.....A.G..LF.....L..P...YVG-L----AAGI---GL-VLYFT-------------
A8M6Z9_SALAI/7-108RM.IGGL---EIAAIIGLL.....L.G..LLW....P..P....LG-V----AAAI---GL-ALLMI-------------
C6VZE8_DYAFD/11-112TI.IGVW---KILGVVAVL.....I.P....G....F..P...LLK-E----WAYA---GF-FFCMS-------------
Q0SGE8_RHOSR/7-112RL.IGVA---ELAGGVGVL.....V.G..LYW....T..P....LG-V----IAAV---AL-LILLL-------------
D5UX83_TSUPD/7-115TA.IGTI---KVTGALGLI.....L.P.PLVG....V.AD...VLS-P----IAAC---GL-ALFMA-------------
D3PZS4_STANL/7-112PI.LGAL---EMLAAIGLI.....L.PAAFGI....V..E...ILT-P----LAAT---GL-VLMMI-------------
D3PUC2_STANL/7-110RFPIGTL---KTAGALGLL.....A.G..L.W....L..P...MLG-T----AAAI---GL-VLFFV-------------
C9Z9S2_STRSW/7-108RV.IGAL---EIAGAAGLL.....L.G..LAS....A..P....LG-V----AAAA---GL-ALLMT-------------
A1TE84_MYCVP/11-113PY.LAGL---KLAGAAGLL.....L.G..FVT....T..P...WLG-L----AAAT---GL-VGFFV-------------
D2AS43_STRRD/5-106PW.LGAA---KAAGAAGLL.....V.G..LF.....V..P...VIG-T----LAGI---GL-VLYFV-------------
A4T6B5_MYCGI/6-108PY.LATA---KLAGAVGLV.....I.G..LVA....V..P...WVG-V----AAGI---GL-VLFFI-------------
D2PZ45_KRIFD/7-114RV.VAGC---EILGAVGLV.....V.P..WLTD..TA..R...YLT-P----VAAV---GL-GVVMI-------------
B1MM14_MYCA9/10-112PY.LAVV---EGAGVVGLV.....I.G..LAG....V..R...QIG-L----AAAI---GL-VAFFI-------------
A6FZU9_9DELT/14-115RF.IGLA---KFLGAVAIV.....A.P....K....F..P...RLK-E----WAYA---GI-VIDLS-------------
Q65HS4_BACLD/5-107SV.TGCL---EIAGALGMI.....G.G..I.W....N..V...HLA-V----GSGL---LF-SLLMT-------------
Q5YWI3_NOCFA/31-132YP.LAAV---KAIGALGLL.....A.G..LVV....A..P....VG-L----AAAI---GL-VGYFS-------------
D3F1P3_CONWI/7-108DR.LAVI---LLAGAAGLL.....L.G..LAW....A..P....IG-V----AAAI---GV-VLYFL-------------
C7PZU5_CATAD/19-125RF.IGAA---ELAGAIGLV.....L.PRALGV....A..T...VLT-P----LAAV---GI-AVMML-------------
A8M8B0_SALAI/7-107RP.LGVL---LGAGALGLL.....A.G..I.V....V..P...VLG-I----LAAA---GL-VLYFL-------------
B5H4W5_STRPR/7-108PA.LGAL---KGAGVLGLL.....I.G..IGW....G..P....IG-V----AASV---GL-ILYYA-------------
A1UGV4_MYCSK/7-109RF.IGWC---QWASVVGLI.....G.G..LFW....R..P....LA-I----AAAI---GL-LLLLI-------------
Q11P05_CYTH3/10-110VE.LGTA---KLLGALVLL.....I.P..Q.I....P..T...RVK-E----WAYA---GF-GINLI-------------
D5UGI3_CELFN/7-114KL.AGIA---EVLGALGLV.....L.P..LATG..VA..P...VLT-P----VAAV---AL-AGTMV-------------
Q89Y33_BRAJA/62-168RI.IGLI---DLAGGIGIL.....L.P.ALTR...IL..P...RLT-V----LAAL---GC-TVLQV-------------
A6G4G5_9DELT/10-111TI.LGSW---YLAGAIALL.....A.P....G....F..A...KVK-E----WAYA---GI-TFAFT-------------
C0ZKK1_BREBN/2-104DV.IASL---ELVGVIGVI.....S.S..F.W....I..P...EVL-T----FACI---LF-AILML-------------
B1MDG2_MYCA9/7-115KA.IAGS---EVLGAIGVV.....I.P..YATG..IA..P...VLS-P----LAAA---GL-AVLQA-------------
Q7UL85_RHOBA/23-124TI.LGFW---KIAGVVALL.....L.P....G....F..G...RLK-E----WAYA---GF-FFDLT-------------
C7PUE7_CHIPD/10-111IE.LAIA---KLIGVVLLV.....L.P..LVK.......G...RLK-E----WTYA---GF-TFTFV-------------
D3Q6A9_STANL/7-109RI.IGGL---EIAACLGLI.....V.G..FFW....E..P....VS-L----VASL---GL-FTLMI-------------
A3RXR1_RALSL/22-128RG.LGVI---DAAGGLGIF.....L.P.ALLR....I.KP...GLS-V----LAAL---GC-VALQV-------------
Q82R50_STRAW/28-129RR.IGVL---QLAGVAGVV.....L.G..L.A....V..P...PLG-G----LAGA---GL-LLLLA-------------
D2QST6_SPILD/17-122KL.TGVL---DLLSGIGLV.....L.P.TLLH....I.QP...KLT-R----YAAY---GT-VALMV-------------
Q5YXM8_NOCFA/33-141RT.LGGV---ELLAAAGLI.....L.PPLLGI....A..P...ALV-P----VTAA---CW-VVLMI-------------
C7PKH0_CHIPD/17-121VF.TGIL---DFLGALGLV.....L.P.GILR....I.WP...RLT-R----YAAY---GI-LLLMI-------------
B2JL65_BURP8/47-153RG.TGIF---DLAGALGLV.....L.P..AVTR..VA..P...RLT-I----WAAW---GC-SGLQF-------------
Q72UJ2_LEPIC/13-114TI.LGVW---KLLGAIAIT.....A.P....R....F..P...LLK-E----WAYA---GM-FFNLT-------------
C0WI63_9CORY/7-112WA.LIGI---KALAALGLI.....V.G.AVLN....N..P...SIT-A----TVSV---GV-LGYFI-------------
Q1VX62_9FLAO/6-107KI.TGFF---QVLGACGLS.....Y.G..FYL....N..P...IIG-F----SAAL---GL-SLLMS-------------
D2ASD1_STRRD/34-143VF.IGVC---EVLGGVGLI.....L.P..AMT...GV.KP...KLT-P----LAAV---GL-TLTMI-------------
B0UIU5_METS4/14-111YA.VGAA---QLAGAALLW.....I..............R...GAT-A----LGAF---LL-AAIMA-------------
D2PS28_KRIFD/35-136YI.LGVC---HVAAAAAII.....V.P....G....F..K...LLK-E----WAYA---GT-VFMWS-------------
A6G6P4_9DELT/10-116TL.IGVW---KLLGVAALV.....TPG..LDRRGPHL..Q...RLR-E----WAYA---GF-FFDLT-------------
C7PYY8_CATAD/7-121RF.AAVC---ELFAAAGLI.....L.PRAAGI....A..P...VLT-P----IAAV---GL-CCVMA-------------
A9GJR9_SORC5/11-117TL.LGIW---KILGALALM.....A.P....R....F..P...RLK-E----WAYA---GI-VFDLT-------------
B8IER0_METNO/21-116IV.TGLV---EVAGAVALL.....V.P..G..............YA-V----FAAV---WL-GCTMV-------------
Q1IKM4_KORVE/10-111TF.LGAW---KVLGALAIL.....A.P....G....I..P...RVK-E----WAYA---GM-IFDLS-------------
A4C0H3_9FLAO/6-106RL.TGFL---QLLGAIGLL.....V.G..LYF....S..P...LLL-L----LAAI---GL-SVLML-------------
A1ZLE1_9BACT/10-109YP.LAAA---KVLAVVAIL.....T.K....K....S..A...WLK-E----WAYA---GL-FFDFL-------------
C0BG18_9BACT/6-105FT.IGTF---QILGGLGLL.....L.G..L.L....I..P...YLL-L----ISSL---AL-TLMML-------------
A9FEJ3_SORC5/27-126RG.IGVV---LLASVVTYM.....I.P................RTS-V----LGAI---LL-TGFLG-------------
A8ULQ7_9FLAO/10-110YP.YGVV---KLLGLVALW.....L.P....G....Y..K...SLK-E----WAYS---GF-FFAFV-------------
Q2S0Z3_SALRD/8-118IE.LGIA---KLLGAVALLTPLPRL.G..LSRA.VLA..R...TVK-E----WTYA---GF-TISIV-------------
Q11S70_CYTH3/11-112IS.IGIL---ELTGVLLIV.....A.G..I.V....I..H...RLK-A----IGIL---LL-LPFAI-------------
Q5Z2J9_NOCFA/19-120TI.LGVA---KTAALAAIL.....T.P....G....H..P...RTK-E----WAYA---GL-VFVYG-------------
C6X539_FLAB3/10-112VE.LAVA---KILGSLALM.....L.P..F.V....P..K...GFK-Y----FAYA---GF-TINLI-------------
Q26DR8_FLABB/6-106KL.TGIL---QILGGVSII.....V.G..LYV....L..P...IIG-F----VGSL---GL-SLLMF-------------
B8JHM2_ANAD2/39-140LI.IGVW---KIPCGAVLL.....L.P....R....F..L...RVK-E----WAYT---GS-LLNYA-------------
B5HQQ2_9ACTO/55-152YT.IGVL---ELAGGIALL.....I.P..V..............LQ-S----VAAV---AL-SGLMV-------------
A7H7U7_ANADF/31-130RG.IGGL---ELA....LI.....A.V..T.L....V..P...RTS-L----LGAV---LL-TGYLG-------------
B9R073_9RHOB/12-107YL.TGLI---EVVSAVLLF.....I.P..G......K........Q-A----IGAG---LL-VGTMI-------------
A5FBV8_FLAJ1/7-111NA.LVIF---KILGVLVLV.....I.P..S.V....P..K...NVK-E----WAYA---GF-GFDFI-------------
A1ZY83_9BACT/27-125YP.LAIA---KILGLVAIW.....T.D....K....S..T...MLR-E----WAYA---GF-VFNLL-------------
D7VTK5_9SPHI/10-113YT.LIIC---KVLGVIAIS.....L.P..SVP....V..K....IK-E----WAYA---GL-TFNLI-------------
D2QN87_SPILD/19-118VE.LSLG---KILGGILLV.....L.P..M.I....P..A...RIK-E----WAYV---GF-GISMI-------------
A9B014_HERA2/18-116LS.LGIL---LLVCTVLAI.................I..P...RTA-V----LGTV---LL-TGYFG-------------
A8FU14_SHESH/7-110AV.VGVV---ELIGATSIW.....L.Q.........S..S...ILG-V----LGAA---LL-LATSL-------------
Q1M3R5_RHIL3/9-110PF.MVIV---KILGPLAIL.....S.R..V.S....V..P....LS-D----LAYA---GI-FFHLL-------------
D0XES9_VIBHA/3-111FL.VGLV---EVTGATLML.....I.G..LLS...TN..N...LLS-A----IGAS---FI-VFTSV-------------
B9XQC4_9BACT/28-127FP.LGIV---LTICTL..L.....Y.A.........I..P...RTS-I----LGAI---LL-TGYLG-------------
B5WCL4_9BURK/11-109LL.CGAL---ELLSAALLL.....G.Q..Q......T..R......-V----LGLT---LA-GAIMI-------------
C6B3P5_RHILS/11-110YL.TAIC---EFTTAVMLI.....F.K............P....LR-L----YGSL---LG-SAVML-------------
Q1D110_MYXXD/7-102LA.IGIT---ELICMV.............LYA....V..P...RTA-V----LGAI---LV-TGYLG-------------
B1FVW7_9BURK/9-106FV.TGSL---ELMTAVLLA.....R.A................RTR-L----WGAA---LG-CTVML-------------
C7PKI9_CHIPD/12-107SL.LGII---EILSVALFL.....Y..............T...RTG-V----LGTL---LL-SSYLG-------------
B9XR85_9BACT/12-110IE.LTTA---KIIGALALL.....I.P..Q......V..P..GRIR-E----WIYV---AF-GIVLI-------------
A9F3Z6_SORC5/44-143PT.LGYL---QIACLVTYL.....I.P................RTA-V----LGAV---LW-TGYLG-------------
C9CTS5_9RHOB/7-110VA.LIPF---ELLCAVGLA.....I.P..AV.....A..PSLGWLV-P----IAAI---AI-AVEML-------------
A5ERI9_BRASB/6-107RA.LGLI---TLLCTL..L.....Y.A.........L..P...STS-L----LGAI---LL-TGYLG-------------
D9QMH9_BRESC/33-140RG.VGIV---EIVLALGMV.....A.P..LVSW.KLG..R...WPL-L----VSAV---GL-IAVET-------------
B1KFL4_SHEWM/4-111FI.VGLI---ELTGALLLI.....L.F..LMT...SL..H...EYQ-F----LGAW---LL-GLTSL-------------
C0IN69_9BACT/7-105LL.IGCI---ELAGTI.............LFA....I..P...RTG-L----IGAV---LM-TGLLG-------------
Q0SJ69_RHOSR/31-130RV.IGVV---LLVCLI........L.Y..I......V..P...ATA-I----LGAV---LL-TGYLG-------------
A3XU47_9VIBR/12-120FL.VGMV---EFTGAVLLL.....C.A..LVG....LAPE...HTQ-L----MGGL---IL-ASTSL-------------
Q1IPI6_KORVE/25-123VR.IGAI---LLVCTT.............LYA....I..P...RTS-V----LGAM---LL-TGYLG-------------
A9UV76_MONBE/637-749QF.LGVV---ETAAALLLW.....V.A............P......-Q----LAAS---VL-AIIMT-------------
B6AU47_9RHOB/5-108RF.VGLL---ELSGAIAIW.....F.Q.........A..S...WLG-A----LGAL---AI-LGTSI-------------
B4RA61_PHEZH/23-122FA.IGVM---EA.....IL.....L.G..LYL....Y..P...RTS-V----LGAV---LF-TALFG-------------
A6EKC1_9SPHI/24-124WE.LSIG---KFIGGLILV.....L.P..F.I....P..A...RVK-E----WAYV---AF-GIDFI-------------
C5C5Y3_BEUC1/41-144FV.VGGG---ELVAAAMLI.....S.P..R..............SR-F----LGAL---LL-VVITA-------------
C0Z8W5_BREBN/15-114GV.IGIL---ALVSTV.............LYA....I..P...RTA-V----LGAL---LL-TGFFG-------------
B9JK89_AGRRK/29-136RI.VGTV---ELLSASALL.....V.P.AMLG....V.LV...SLA-P----SAII---VL-LAVEG-------------
B1MHX9_MYCA9/33-130AL.IGWV---LLACTI..V.....F.A.........V..A...RTA-V----LGAV---AL-TAYLG-------------
A5V4G4_SPHWW/11-106FV.TALL---EALSAI..L.....I.P..I.........E...ATR-P----WGLM---LA-AAIML-------------

PF07291

MAUE_METEA/3-186LV-LPWL---ELGIAVGLV-----L--------------PVTAPLA-A----GLAG---GL-MVLFG-------------
MAUE_PARDE/2-185LV-LPVV---EAAVAVGLV-----V--------------TPLAVPA-A----VAAA---AL-LLVFA-------------
MAUE_METFK/2-184KL-LPLV---ELLCAVALM-----I--------------PPAREIA-A----CVAA---GL-FIVFA-------------
MAUE_METME/2-186KL-LPWL---ELGCAIALL-----V--------------PSLRVLA-A----CVAA---AL-FMLFS-------------
MAUE_PARVE/2-185MV-LPVA---ELAVAAGLM-----I--------------PALAAPA-A----LAAA---AL-LGVFG-------------

PF04224

Q9CJR3_PASMU/1-137YL-LGII---ETLAYLGLI-----I-G----------------FRQ-PKAGLLGSG---LV-LITAL-------------
O25289_HELPY/5-190EA-LGIT---IMILGILVL-----L-G----------------LWM-PLMGVIGGL---LV-AGMTI-------------
YKGB_ECOLI/2-182NG-LGVV---EVIIALLVL-----A-N----------------PVN-RWLGLLGGL---MA-FTTPL-------------
Q9KRP9_VIBCH/1-146NL-IGAT---EIIVGIGLL-----I-G----------------LRS-SKVAYYSGI---AS-MVIFI-------------
Y219_HAEIN/13-209YI-IGAI---IVTVGILTL-----A-G----------------IWN-ATAGLAGGL---LT-FGMSI-------------
O87513_ECOLX/1-138YF-LGIV---ETITFLALS-----I-G----------------FFR-PAAGILGDI---IV-IVTGL-------------

PF05514

Q6RJY8_CAPAN/1-138VV-AAFMAL-KGMGGLLFV------------------------FGS-F----TGAV---LL-MFYLT-------------
O23298_ARATH/1-138LV-AAAIAL-KGIGGLLFV------------------------FGS-S----LGAY---LL-LLHQA-------------
Q01MB3_ORYSA/1-138VI-AATMFL-KGFGGLLFI------------------------ISS-S----FGAF---LL-LLYLA-------------
Q9LTD0_ARATH/18-201LM-TVSIIV-RTLGGLIFI------------------------YGS-F----FGAF---LL-LMYQG-------------
Q9LTD1_ARATH/1-132IE-FALISA-KATAALWFI------------------------FGQ-S----IPAY---FL-LATQI-------------
Q0IXE1_ORYSJ/1-138IV-AAMISL-KGLGGLLFI------------------------LSS-S----LGAY---LL-LFHLA-------------
A2XCK0_ORYSI/1-138IV-AATIGL-KGLGGLLFI------------------------LSS-S----FGAY---LL-LIYLA-------------
O22690_ARATH/1-138VV-WAIVAL-KGLGGLLFV------------------------IGN-I----FGAY---LL-AVYLV-------------
Q570L1_ARATH/18-198IV-ALGILM-KFVGGILFI------------------------FNT-Y----VGAA---LL-LVYQA-------------
P93384_TOBAC/1-138LI-LGAIVM-KGLGSLLFI------------------------FGS-S----LGAY---IL-LLHQA-------------

PF13781

A0RCI0_BACAH/180-281KI-IG.L.L.EVIFGVIWL-----L.P----------------FPK.R.NVFILHI.F.VL.IALTI-------------
C3GZF4_BACTU/180-281KI-IG.V.L.EIIFGVVWL-----L.P----------------LTK.R.KLFILHI.I.VL.LVLTL-------------
C2TVP5_BACCE/180-280KM-IG.I.L.EIIFGAIWV-----L.P----------------LPK.R.KIFIMHI.V.ML.IALTI-------------
C3AK78_BACMY/185-286KI-IG.F.L.EIGFGIMWL-----L.P----------------FQK.Q.KLLLLHI.I.IL.IGLTI-------------
D3E5H6_GEOS4/180-281TL-LG.I.T.EIGVGLLTL-----L.F----------------HKN.R.LWYRLIM.I.LL.AILMI-------------
Q65IN6_BACLD/178-279RL-IG.L.A.EVMVGVLWL-----Y.P----------------VRK.R.KWFLLHI.V.LL.VLLSA-------------
A6CEZ9_9PLAN/177-278II-AG.M.A.EVVLGATVL-----I.C----------------FHR.R.WPLVLTV.L.LM.LLVTI-------------
C6CYU2_PAESJ/180-281KW-LG.A.S.EILLGLLLL-----L.Y----------------HRT.K.WIYYLQV.V.GL.LALAG-------------
Q8ESB3_OCEIH/179-280YL-LG.L.F.QILFGLTFL-----L.F----------------GRW.K.SLHILNI.I.AL.LLLGI-------------
B3EDV4_CHLL2/19-119GW-MG.A.G.EIVFGLLLL-----A..----------------VRQ.R.WVFQLNI.F.AL.FSLLI-------------
A4SEU6_PROVI/25-125SW-MG.V.A.EIMFGLLLL-----V.S----------------MR..Y.WVFWFNM.M.AL.AGLLL-------------
A1BFB6_CHLPD/25-125TW-MG.V.V.EILFGIYLL-----V.A----------------RK..S.WAFWLNV.L.TL.FSLLI-------------
B4SAW4_PELPB/19-119FW-IG.A.A.EILFGLFLL-----V.A----------------RS..Q.WVFLLNI.A.AL.TGLLL-------------
B3EQZ0_CHLPB/20-120VW-MG.Y.G.EIVFGAFLL-----V.T----------------RR..G.SVFLLNV.I.AL.SALLV-------------
B4S7F5_PROA2/21-121TS-MG.Y.G.EIVFGIFLL-----F.T----------------RR..S.WLFIANI.L.IL.SLLLG-------------
Q3ARZ2_CHLCH/17-117QW-MG.Y.G.EILFGVFLL-----I.A----------------RW..Q.WAFWLNI.I.AL.IGLLF-------------
B3QTS0_CHLT3/26-127PI-IG.V.A.EILIGVLLL-----L.T----------------WSR.S.WPLALSA.I.AM.IFALL-------------
B1KF78_SHEWM/12-113KL-TG.I.I.EIAFGILFF-----I.Y----------------YRS.K.RIILLNI.I.AL.SSLLC-------------
A0Y6C6_9GAMM/17-118RG-AG.I.A.EVIFGLLLI-----I.F----------------YKN.K.QLVWLNI.F.LL.CGLLG-------------
B3QN36_CHLP8/20-117SV-MG.Y.G.EIAFGILLL-----L.T----------------PW..R.WPFLLNI.A.AM.LSLFG-------------
B4X4D6_9GAMM/11-112YV-GG.G.M.EVVLGLMVW-----V.F----------------YRQ.R.WPYVITI.A.AL.FGLFA-------------
C0VHX3_9GAMM/20-120SL-SG.I.A.EISFGFMFL-----L.F----------------THR.Y..LHRLNI.I.SL.IGLFI-------------
D0BX48_9GAMM/15-115RG-SG.I.A.EVIFGLLFL-----F.S----------------PHK.Y..IHYLSI.L.GL.LDLLL-------------
D0SFQ9_ACIJO/15-115QG-SG.V.L.ECVFALLFL-----F.S----------------SSK.Y..LHYLSI.F.SL.VFLFA-------------
Q1H1D1_METFK/335-436YG-AA.L.L.DIGFGIATL-----W.L----------------RKR.R.LLWQMQI.A.VI.LGYTL-------------
D0SSK1_ACILW/19-120GL-SG.G.C.EMLFGLCFL-----K.W----------------NRS.I.LLHRLNI.I.GL.AGLLL-------------
C7R8T5_KANKD/19-119YS-GA.I.L.DIGLGLWIL-----N.N----------------TKM.K.LCYVVQI.I.VI.TSYTI-------------
B3RB23_CUPTR/328-429YG-AA.L.L.DLAVGVLCV-----L.P----------------RRP.H.WLWLAQI.A.LI.LGYTA-------------
Q2SM61_HAHCH/17-117MA-GG.V.A.EILLGLLIA-----L.P----------------LRS.N.LPLLAAG.V.AL.VGLLL-------------
Q3SHK0_THIDA/314-415YG-AA.G.L.DFALGAGTL-----V.L----------------RRR.R.LLWLAQI.A.LI.VFYTA-------------
B1KF79_SHEWM/15-115YS-GG.F.L.DILIGIWLL-----I.P----------------FKR.K.LCCIAQV.T.VI.VTYTL-------------
C0DTU0_EIKCO/36-137YA-SS.A.L.DIFFGILCF-----T.K----------------FRNYR.FVWLSQF.A.VV.LGYSA-------------
Q2Y734_NITMU/330-431YG-AA.A.M.DIAFGFGTL-----F.L----------------RDR.R.LLWIAQV.T.LI.GVYMV-------------
Q5X5Q5_LEGPA/322-423YA-SA.L.W.DGLLGIAML-----F.N----------------YRF.K.LTSILQL.I.TI.LVYTV-------------
Q5NY22_AROAE/320-421YG-AA.L.L.DLALGVLML-----A.G----------------RGR.A.AVLVVQA.G.LI.LAYTA-------------
B1Z1S6_BURA4/308-408YA-AC.A.L.DFAFGVATV-----A.A----------------PSR.R..LWVAQA.A.LI.VAYSA-------------
A7BY74_9GAMM/6-107YL-AA.I.F.DVLLGIATL-----I.G----------------YRL.R.MVVGLQL.L.LM.IGYMV-------------
C4GMT5_9NEIS/12-113AL-SC.A.L.DVFFGLGCC-----T.R----------------LRD.CAWFWAAQA.A.VV.LGYSV-------------
C8NCY7_9GAMM/28-129YA-AS.A.W.DVVLGMCCF-----TPF----------------ARS.H.ALWGLQA.V.TV.AAYTL-------------
A1K6I8_AZOSB/336-437YG-AA.A.L.DLVLGVLCF-----T.S----------------WQR.R.RVWAAQA.A.LI.AAYTL-------------
A6DTJ9_9BACT/15-115VS-SG.I.A.EVLYAFLLV-----I.F----------------ASN.K.KLLYPAM.A.FS.LLATI-------------
D4DP38_NEIEG/16-117LA-SS.L.L.DIVFGLLCF-----S.R----------------ARRLP.ALWAAQA.A.TV.AAYSL-------------
Q1LGK6_RALME/315-415YA-AV.F.V.DAAMAVGCL-----R.Y----------------PSR.R..LWALQA.A.LV.AGYSL-------------
Q4UMY6_RICFE/322-422YG-SC.F.T.DIILGILLI-----I.K----------------NKI.S.RICSLQI.L.LI.LAYTL-------------
C5TJR5_NEIFL/18-119IV-AS.L.L.DIGFAFLCF-----S.R----------------LRS.RSEIWLLQL.I.TV.AAYSL-------------
C1F939_ACIC5/18-120RL-LG.L.V.EMSLALWVL-----S.G----------------DAP.A.ACALTQA.G.LL.LALNA-------------
Q7NW81_CHRVO/13-112LL-SC.A.L.DVAYAVWIV-----..W----------------RPS.A.LGWRLQA.L.TV.LFYSA-------------
A8UH51_9FLAO/12-113IT-IG.L.M.EVILALWVI-----S.D----------------YKP.K.LNAMLQI.ITVI.TMNII-------------
Q11TY1_CYTH3/19-119TA-IG.V.S.EIIMAVWII-----S.G----------------FKA.R.FNAFTQI.AVII.TMNTM-------------
C7PI03_CHIPD/14-115ML-IG.L.S.EIAMAIWVV-----R.G----------------FKS.R.LNAILQI.A.IVGTMNIL-------------
C9YGF9_9BURK/7-107WS-GA.A.L.DLILGVLLW-----W.K----------------PRR.R.V.FLAAL.I.AM.LLMTV-------------
A1VMB6_POLNA/12-112IV-SGAA.A.DLALGLALW-----L.R----------------PK..R.TTYLAAL.A.LM.LLMTL-------------
Q0ANG5_MARMM/322-422WF-GS.L.F.DIALGLGML-----A.K----------------WRV.R.WLATIMI.L.GT.FAYIF-------------
A9C3F1_DELAS/21-121IW-SG.LLA.DLAVGLALW-----L.R----------------PGR...ESYLAAL.L.LM.AAMTV-------------
Q4K472_PSEF5/309-409IG-GS.L.C.DALLGVGLL-----L.R----------------RWR.R.RALQAQL.G.LM.LGYTL-------------
Q89WY4_BRAJA/329-429IG-TS.L.M.DMSIGVLIA-----F.R----------------RTA.A.VGLVAGI.V.AS.LGYML-------------
Q2BMK1_9GAMM/316-416ML-TS.I.L.DLVLGLMLI-----F.R----------------FKE.R.VTLWLML.F.ST.VGYSV-------------
A5E8R6_BRASB/331-431AI-TS.M.M.DISVGVLIS-----F.R----------------RTA.V.FGLIAGI.V.VS.LGYMA-------------
C9CYE4_9RHOB/339-438IG-GA.V.L.DVALGMAIL-----W.R----------------RWA.A.RAAMGMI.A.LS.AAYVL-------------
A3K709_9RHOB/331-430GF-WA.V.V.DVVLGLAIL-----Y.R----------------PFA.A.RACLAMI.G.VS.LIYIA-------------
Q1YK40_MOBAS/336-436VA-TS.L.M.DISIGILIG-----N.R----------------RTC.R.IGLLGGI.G.LS.LFYMI-------------
Q2K6I2_RHIEC/316-414LV-TC.L.I.DIALGAAVL-----V.R----------------PLA.K.RALLGML.A.VS.LAYLA-------------
A1TNI5_ACIAC/22-122IA-AG.I.AADLAVG.AWL-----W.W----------------RPG.R.PAYAAAL.L.LM.GTMTV-------------
B8H2E0_CAUCN/321-421VG-GS.V.A.DIALALLLA-----H.R----------------RT..A.APALKGMLL.VT.AGYLV-------------
B6RA56_9RHOB/326-425LG-GS.L.A.DITLGTLIL-----F.R----------------KHT.R.LACLGMI.A.VT.LSYLG-------------
C4WL85_9RHIZ/327-426YG-GA.F.A.DIGLGLGIL-----W.R----------------SVT.R.MATVGMI.V.LS.ACYLF-------------
B9JGJ5_AGRRK/322-420IA-TC.F.L.DIALGALAL-----V.R----------------PFT.R.AALHGML.G.VT.LAYLA-------------
A9EWZ0_9RHOB/307-406VF-WS.F.V.DIALAAAIL-----Y.R----------------PWA.G.RACLAMV.T.VS.LVYLI-------------
B4WB77_9CAUL/325-424WW-GA.L.L.DVVLGLALF-----V.R----------------PWT.A.RVAIFMC.L.AT.IGYLI-------------
A5V930_SPHWW/323-422GG-GA.V.V.DGLLALLML-----H.R----------------RAV.C.FALLGTV.A.VT.AAYLL-------------
Q2JZG1_RHIEC/327-426IA-GA.L.T.DIAIGCAIA-----I.R----------------RTA.R.WGLYAAV.L.LS.LFYAA-------------
Q02U83_PSEAB/307-409IA-GA.L.L.DGALGVGLL-----L.R----------------RWR.R.RALLAQF.W.LM.LGYSL-------------
Q11CJ7_MESSB/321-420VA-GA.I.A.DILVGLAIA-----Y.R----------------PTT.R.HGLYGAI.A.LS.VFYII-------------
A4F044_9RHOB/306-405LG-GA.V.A.DILLGIGIL-----W.R----------------PWT.R.HAALGML.A.LS.SIYLI-------------
A7IKV9_XANP2/322-421LA-GA.L.A.DLSIGLGIA-----W.R----------------RTS.R.LALLGGA.G.LS.VLYAL-------------
Q2S702_HAHCH/327-427WF-TS.I.L.DIVLGALLL-----S.R----------------RHM.A.LVGQWML.L.CV.LGYTL-------------

PF02077

SURF4_CAEEL/11-277WDLKFLARNIAVGGGLLLLLAETQEEKAS..LFAGVPTMGDS.NKP-KSYMLLAGR---VL-LIFMF-------------
YFC7_CAEEL/4-269TTYHLLTRNISIVAAIMLLVAENMLRKPKPANYTQLPRDEHE.IEV-TSVLLAACR---VC-LNLML-------------
ERV29_YEAST/48-310TGSSFVLRNFSVIGGLLIAFSDSIVQNKT..TFGMLPELNSKNDKA-KGYLLFAGR---IL-IVLMF-------------
SURF4_SCHPO/33-302TSGEMFFRNMSVIGGLCLVASDTFIHRRIN.RFAGLPAVSE..HNK-RTYFQLAGR---VL-LIFMF-------------
SURF4_DROME/5-270WDFQFLLRNFALIGALLLVLAEARIEGRS..LFAGVPSMGE..NKP-KNFMQLAGR---IL-LAFMF-------------
SURF4_HUMAN/4-269WDLKFLMRNLALGGGLLLLLAESRSEGKS..MFAGVPTMRE..SSP-KQYMQLGGR---VL-LVLMF-------------

PF06762

Q2L6Y0_CAEEL/122-555QLATLQMNFIEILLPPLFL-----I-PLIHVRYFVFFCQVLLTTLT-LFTGNNGFF---NY-NILVL.............
LMF2_BOVIN/122-592KLSVVATFLIEIAVPPLFF-----A-PVRRLRLAAFYSQVLLQVLI-ILTGNYNFF---NL-LTLVL.............
Q826A6_STRAW/121-468RAEVAANHVTQLVVPVLLF-----T-P.QPIATAAAALMILTQLWL-VLSGNFAWL---NW-LTIVL.............
A0QMA7_MYCA1/121-478RIEVAGNHFAQLIVPFGLF-----A-P.QPVAGVAAAIIVVTQLWL-VASGNFAWL---NW-VTILL.............
Q45WA6_TOXGO/205-777AAQVVITHIVECVISFLVI-----L-PFRQCRLFAGIVQIAFQVGI-LLSGNLAFL---NY-LTIVS.............
LMF1_HUMAN/169-551RFETLSNHFIELLVPFFLF-----L-G.RRACIIHGVLQILFQAVL-IVSGNLSFL---NW-LTMVP.............
Q4REY1_TETNG/125-682KLSVIGTFVIEIPVPLLFF-----S-PVRRLRLGSFYLQVLLQVLI-ILSGNYNFF---NL-LTLTL.............
A0QT94_MYCS2/77-431RVEVAGNHVAQLVIPFLLF-----A-P.QPVASTAAAVVIVTQLWL-VASGNFAWL---NW-ITIVL.............
B9M9C6_GEOSF/118-470RCGVAFNHLAELVMPCLYF-----A-P.QPLAVTGGVVSAAFLFFI-IVSGNFAWL---NW-LAFIL.............
A1R4Z7_ARTAT/124-480KVEVVGNHFAQLVVPFFLF-----A-P.QPLASIAAGIIIATQLWL-VGTGNFAWL---NW-VAIVL.............
A0JUS2_ARTS2/124-488RMEVLGNHFAQLVVPFFLF-----A-P.QPLAGVAAGIVIFTQLWL-VASGNFAWL---NW-MAILL.............
LMF1_MOUSE/169-553RFETLSNHFVELLVPFFLF-----L-G.RRMRILHGVLQILFQVIL-IISGNLSFL---NW-LTIVP.............
A4FB78_SACEN/123-469RVEVAANHFTQLVVPFGLF-----A-P.QPVASVAAVIVVVTQLWL-VLSGNFAWL---NL-VTITL.............
Q6MNI0_BDEBA/151-510KVSTVIMFFIELVCPFLML-----V-P.GKTQVIAVALLLSLQFLI-ILTGNYGFF---NL-LTIGL.............
Q54K13_DICDI/157-572EFETMMVLAIEILLPALYF-----A-P.RMYKLFASLTTVLYQMAI-FLTGNYNFF---NY-LTIGL.............
A7RJW9_NEMVE/81-464KFETLVNHFVELVAPFLLF-----L-P.RPLRIWGGLIQIAFQVIL-IISGNLSFL---NW-LTILP.............
Q08T93_STIAD/249-611KLSTAAVLVSETALPLLIF-----T-P.RRLRQWAFGLFSLLQAGI-AATGNYGFF---NL-QSFVL.............
Q1CX59_MYXXD/289-656RASTGAVLWLETVVPFLAF-----G-P.RRLRQFAFWSLSGLQTAI-SATGNYGFF---NV-QAWVL.............
Q234A3_TETTS/136-636KLFVAQNFITLIGGSLLIY-----S-PFRRFRQFGGLMLLSEQFMI-ILTGNYNFF---NF-LTVLVYFFHLIKIQLYKN
Q4XRT1_PLACH/156-696KCDNLFCILCECVFSFFLL-----F-PIRSFRIIGGTFIFFYCILN-FINQNSYLF---YF-LLLAP.............
A5K5K3_PLAVS/186-557KIICFLVLTSELLLSWLIF-----C-S.SILRLIFFTLFVTIHITC-YIICNYIFF---SY-LCLIL.............
A0LRD9_ACIC1/123-473RVEVAANHFAQLIVPFGLF-----A-P.QPAASIAAAVVIVTQLWL-VASGNFAWL---NW-LTIVL.............
LMF2_XENTR/122-590KFSVVATYFIEIGVPLLFF-----L-PFRRLRLFSFYSQVVLQILI-IMTGNYNFF---NL-LTVVL.............
A1TEH0_MYCVP/123-477RVEVAGNHVAQLVVPFALF-----A-P.QPVASVAAGIVIVTQLWL-VLSGNFAWL---NW-LTILL.............
Q4Y900_PLACH/136-509SLICFLIIISEVLSSWLIF-----C-S.SKLRILFYIIFINIHISC-HIICNKIFL---SY-IFIIL.............

PF04173

Q97X72_SULSO/12-173------GIG-----------------------------------------------------------------------
Q97XJ3_SULSO/18-183------GMA-----------------------------------------------------------------------
Q973M6_SULTO/9-177------IYF-----------------------------------------------------------------------
P97207_ACIAM/20-184------GFA-----------------------------------------------------------------------
Q97UC4_SULSO/10-178------IYF-----------------------------------------------------------------------
Q8NKT7_ACIAM/12-174------GIG-----------------------------------------------------------------------
Q8AAF0_BACTN/18-181------GIL-----------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94------LVT...--------------------------------------------------------------------
Q87K55_VIBPA/16-104------VAI...--------------------------------------------------------------------
Q8KEE1_CHLTE/7-88------VAV...--------------------------------------------------------------------
Q9RTC4_DEIRA/8-92------GAI...--------------------------------------------------------------------
Q7TUM8_PROMM/37-127------FAITYH--------------------------------------------------------------------
Q98K39_RHILO/14-90------IAY...--------------------------------------------------------------------
Q7VHA8_HELHP/8-89------VAI...--------------------------------------------------------------------
Q8GA66_ECOLX/8-90------FAS...--------------------------------------------------------------------
Q89FZ6_BRAJA/10-92------GAI...--------------------------------------------------------------------
Q8EDN3_SHEON/21-107------VAA...--------------------------------------------------------------------
Q8KW46_9RHOB/66-148------AAS...--------------------------------------------------------------------
Q8A9J9_BACTN/19-101------VAF...--------------------------------------------------------------------
Q83BV7_COXBU/131-217------ITT...--------------------------------------------------------------------
Q92W39_RHIME/11-107------VIQ...--------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105------LAT...--------------------------------------------------------------------
Q89M65_BRAJA/31-107------FAY...--------------------------------------------------------------------
Q8FX91_BRUSU/12-94------GAT...--------------------------------------------------------------------
Q7V0B0_PROMP/15-102------VAIYHA--------------------------------------------------------------------
Q82B81_STRAW/12-94------YAY...--------------------------------------------------------------------
Q984Q4_RHILO/6-88------AVN...--------------------------------------------------------------------
Q9A3E7_CAUCR/28-117------VIQ...--------------------------------------------------------------------
Q983U6_RHILO/19-101------ATG...--------------------------------------------------------------------
Q82HN4_STRAW/24-126------SLW...--------------------------------------------------------------------
Q7VUY8_BORPE/24-126------VIQ...--------------------------------------------------------------------
Q831Y6_ENTFA/7-87------GAI...--------------------------------------------------------------------
Q983U8_RHILO/8-90------VAG...--------------------------------------------------------------------
Q7V328_PROMP/44-134------FAVYFH--------------------------------------------------------------------
Q9K461_STRCO/11-90------YAY...--------------------------------------------------------------------
Q7MRA2_WOLSU/17-98------VAI...--------------------------------------------------------------------
Q8F8N5_LEPIN/13-98------GAA...--------------------------------------------------------------------
Q9HYW2_PSEAE/22-108------VAI...--------------------------------------------------------------------
Q88P63_PSEPK/6-95------VIE...--------------------------------------------------------------------
Q9HWH6_PSEAE/14-96------LTI...--------------------------------------------------------------------
Q8FR06_COREF/10-94------AAV...--------------------------------------------------------------------
Q9KYL5_STRCO/4-96------PTT...--------------------------------------------------------------------
Q8NR01_CORGL/191-281------FTTLHQ--------------------------------------------------------------------
Q8XR31_RALSO/30-119------VAVGSY--------------------------------------------------------------------
Q92SD1_RHIME/6-88------VTA...--------------------------------------------------------------------
Q7NPD1_GLOVI/22-104------VAG...--------------------------------------------------------------------
O53252_MYCTU/114-206------NGLLAG--------------------------------------------------------------------
YPHA_SHIFL/16-98------GTA...--------------------------------------------------------------------
Q7NZE1_CHRVO/10-92------GAI...--------------------------------------------------------------------
Q8CZQ7_YERPE/13-94------LTA...--------------------------------------------------------------------
Q7VDS1_PROMA/43-133------FALYFH--------------------------------------------------------------------
O86323_MYCTU/16-94------VAY...--------------------------------------------------------------------
Q7N096_PHOLL/8-89------LTA...--------------------------------------------------------------------
Q8XWH4_RALSO/12-94------GTA...--------------------------------------------------------------------
Q7VYL1_BORPE/8-89------VAI...--------------------------------------------------------------------
Q7US51_RHOBA/24-106------VAL...--------------------------------------------------------------------
Q88G88_PSEPK/13-95------GTA...--------------------------------------------------------------------
Q812S4_BACCR/6-87------GAI...--------------------------------------------------------------------
Q88KH7_PSEPK/17-105------VAI...--------------------------------------------------------------------
Q98JU3_RHILO/13-95------FLG...--------------------------------------------------------------------
O05565_MYCLE/52-137------VAA...--------------------------------------------------------------------
Q89MP6_BRAJA/4-104------VAT...--------------------------------------------------------------------
Q8PGB0_XANAC/14-96------GTI...--------------------------------------------------------------------
CATD_BACSU/8-88------GAI...--------------------------------------------------------------------
Q8EC25_SHEON/16-104------VAI...--------------------------------------------------------------------
Q7VTR5_BORPE/10-91------AAA...--------------------------------------------------------------------
Q7UE97_RHOBA/16-98------VAL...--------------------------------------------------------------------
Q7NA66_PHOLL/20-124------VIQ...--------------------------------------------------------------------
Q7VBT6_PROMA/9-93------PTT...--------------------------------------------------------------------
O33110_MYCLE/114-202------NGL...--------------------------------------------------------------------
Q9RC47_BACHO/8-89------GAI...--------------------------------------------------------------------
Y886_HAEIN/11-90------YAY...--------------------------------------------------------------------
Q8FSC2_COREF/11-95------GAA...--------------------------------------------------------------------
Q98K48_RHILO/27-109------VAT...--------------------------------------------------------------------
Q72VB3_LEPIC/18-104------VAG...--------------------------------------------------------------------
Q7NSB1_CHRVO/12-100------VAVI.S--------------------------------------------------------------------
Q9HZY2_PSEAE/16-104------VAI...--------------------------------------------------------------------
Q88K91_PSEPK/19-105------VAI...--------------------------------------------------------------------
Q7W6U9_BORPA/7-93------IAL...--------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95------GAV...--------------------------------------------------------------------
Q8Y2U2_RALSO/28-111------VAL...--------------------------------------------------------------------
Q7X1H0_9BACT/12-99------GAI...--------------------------------------------------------------------
A9CHZ6_AGRT5/16-92------VAY...--------------------------------------------------------------------
Q99V56_STAAM/4-84------GSI...--------------------------------------------------------------------
Q8FPX7_COREF/162-252------FTALHQ--------------------------------------------------------------------
Q9CP47_PASMU/16-102------VAW...--------------------------------------------------------------------
Q9HWS4_PSEAE/24-110------VAT...--------------------------------------------------------------------
Q82PS9_STRAW/30-117------NAM...--------------------------------------------------------------------
MHQP_BACSU/5-93------GAI...--------------------------------------------------------------------
Q883U2_PSESM/16-104------VAI...--------------------------------------------------------------------
Q92TK3_RHIME/11-93------ASA...--------------------------------------------------------------------
Q7V7V3_PROMM/10-94------PTT...--------------------------------------------------------------------
A9CK19_AGRT5/23-105------FTG...--------------------------------------------------------------------
Q7U687_SYNPX/15-102------VAIYHA--------------------------------------------------------------------
Q89EW4_BRAJA/19-101------VAM...--------------------------------------------------------------------
Y1602_HAEIN/14-100------VAW...--------------------------------------------------------------------
Q98JF9_RHILO/23-103------ATA...--------------------------------------------------------------------
Q8YSN3_NOSS1/6-88------PAT...--------------------------------------------------------------------
Q92Y87_RHIME/25-105------AAT...--------------------------------------------------------------------
YQJF_ECOLI/8-88------LTA...--------------------------------------------------------------------
Q812I5_BACCR/5-93------MAI...--------------------------------------------------------------------
Q8NT59_CORGL/10-94------FAA...--------------------------------------------------------------------
Q9KY40_STRCO/14-95------YAY...--------------------------------------------------------------------
Q87KG0_VIBPA/27-115------IAVL.S--------------------------------------------------------------------
Q8P8R3_XANCP/15-111------IAIPKG--------------------------------------------------------------------
Q89SK7_BRAJA/66-148------AAT...--------------------------------------------------------------------
Q82AZ6_STRAW/10-97------GAA...--------------------------------------------------------------------
Q82V34_NITEU/11-94------FAI...--------------------------------------------------------------------
Q82UE4_NITEU/22-102------AAA...--------------------------------------------------------------------
Q8DDM4_VIBVU/23-111------MAVI.S--------------------------------------------------------------------

PF13564

D1AAS7_THECD/7-112------GAMITH--------------------------------------------------------------------
D2SF07_GEOOG/7-113------GAAVTH--------------------------------------------------------------------
C5BX04_BEUC1/7-113------GAVIVH--------------------------------------------------------------------
D3Q9W4_STANL/7-109------GAVAVH--------------------------------------------------------------------
D1BDS4_SANKS/7-113------GAAVVH--------------------------------------------------------------------
A0QFH8_MYCA1/7-109------GAVLTH--------------------------------------------------------------------
C2Q8E8_BACCE/7-108------GAVLSH--------------------------------------------------------------------
D1BYA3_XYLCX/7-112------LAILVH--------------------------------------------------------------------
B5HYY5_9ACTO/7-112------GAVAVH--------------------------------------------------------------------
D1BVK9_XYLCX/7-113------GGTALH--------------------------------------------------------------------
A9B5S7_HERA2/7-113------VAGLVH--------------------------------------------------------------------
D3Q6B3_STANL/7-112------LAAVVH--------------------------------------------------------------------
C3BLY8_9BACI/20-124------GAALSH--------------------------------------------------------------------
C5C629_BEUC1/7-115------GAAVVE--------------------------------------------------------------------
D3PWB3_STANL/7-114------GAAVVE--------------------------------------------------------------------
B0AKY3_BACAN/4-107------GAIHAH--------------------------------------------------------------------
D3EH52_GEOS4/7-112------LGALYH--------------------------------------------------------------------
A4F848_SACEN/7-108------GAVTTV--------------------------------------------------------------------
C4RG94_9ACTO/7-114------GAIVAH--------------------------------------------------------------------
A1SIQ7_NOCSJ/7-109------GAMGGH--------------------------------------------------------------------
C6WJU0_ACTMD/7-113------IAVGVH--------------------------------------------------------------------
B5I6V7_9ACTO/19-120------GAAVTV--------------------------------------------------------------------
A8M6Z9_SALAI/7-108------GAAIHH--------------------------------------------------------------------
C6VZE8_DYAFD/11-112------GAIVSH--------------------------------------------------------------------
Q0SGE8_RHOSR/7-112------CAIAFH--------------------------------------------------------------------
D5UX83_TSUPD/7-115------GAATTR--------------------------------------------------------------------
D3PZS4_STANL/7-112------GAAITH--------------------------------------------------------------------
D3PUC2_STANL/7-110------CAIHTH--------------------------------------------------------------------
C9Z9S2_STRSW/7-108------AAAVVH--------------------------------------------------------------------
A1TE84_MYCVP/11-113------GAVAVH--------------------------------------------------------------------
D2AS43_STRRD/5-106------GAVITV--------------------------------------------------------------------
A4T6B5_MYCGI/6-108------GAVGAH--------------------------------------------------------------------
D2PZ45_KRIFD/7-114------GAAAAH--------------------------------------------------------------------
B1MM14_MYCA9/10-112------GAVGAH--------------------------------------------------------------------
A6FZU9_9DELT/14-115------GAAYSH--------------------------------------------------------------------
Q65HS4_BACLD/5-107------GAIHAH--------------------------------------------------------------------
Q5YWI3_NOCFA/31-132------LAVLTV--------------------------------------------------------------------
D3F1P3_CONWI/7-108------VTVAFH--------------------------------------------------------------------
C7PZU5_CATAD/19-125------LGALAH--------------------------------------------------------------------
A8M8B0_SALAI/7-107------GALGVH--------------------------------------------------------------------
B5H4W5_STRPR/7-108------GAMLVI--------------------------------------------------------------------
A1UGV4_MYCSK/7-109------GAVLAH--------------------------------------------------------------------
Q11P05_CYTH3/10-110------AAAITH--------------------------------------------------------------------
D5UGI3_CELFN/7-114------AATAVH--------------------------------------------------------------------
Q89Y33_BRAJA/62-168------FALVFH--------------------------------------------------------------------
A6G4G5_9DELT/10-111------GAFASH--------------------------------------------------------------------
C0ZKK1_BREBN/2-104------GAIHAH--------------------------------------------------------------------
B1MDG2_MYCA9/7-115------GAFGVH--------------------------------------------------------------------
Q7UL85_RHOBA/23-124------GATAAH--------------------------------------------------------------------
C7PUE7_CHIPD/10-111------SAAIAH--------------------------------------------------------------------
D3Q6A9_STANL/7-109------GALRAQ--------------------------------------------------------------------
A3RXR1_RALSL/22-128------CAMVFH--------------------------------------------------------------------
Q82R50_STRAW/28-129------GAVVVH--------------------------------------------------------------------
D2QST6_SPILD/17-122------AASLFH--------------------------------------------------------------------
Q5YXM8_NOCFA/33-141------GAIITH--------------------------------------------------------------------
C7PKH0_CHIPD/17-121------AASVFH--------------------------------------------------------------------
B2JL65_BURP8/47-153------CAILFH--------------------------------------------------------------------
Q72UJ2_LEPIC/13-114------SASISN--------------------------------------------------------------------
C0WI63_9CORY/7-112------FAIIAH--------------------------------------------------------------------
Q1VX62_9FLAO/6-107------LGFGVR--------------------------------------------------------------------
D2ASD1_STRRD/34-143------LAAGFH--------------------------------------------------------------------
B0UIU5_METS4/14-111------GAVGSH--------------------------------------------------------------------
D2PS28_KRIFD/35-136------GAVASH--------------------------------------------------------------------
A6G6P4_9DELT/10-116------GAAFLH--------------------------------------------------------------------
C7PYY8_CATAD/7-121------GAISSH--------------------------------------------------------------------
A9GJR9_SORC5/11-117------GAAFAW--------------------------------------------------------------------
B8IER0_METNO/21-116------GAVLAH--------------------------------------------------------------------
Q1IKM4_KORVE/10-111------GAMISR--------------------------------------------------------------------
A4C0H3_9FLAO/6-106------MGFVVR--------------------------------------------------------------------
A1ZLE1_9BACT/10-109------LAVAAH--------------------------------------------------------------------
C0BG18_9BACT/6-105------VAILVR--------------------------------------------------------------------
A9FEJ3_SORC5/27-126------GAVATH--------------------------------------------------------------------
A8ULQ7_9FLAO/10-110------LAFFAH--------------------------------------------------------------------
Q2S0Z3_SALRD/8-118------SAMIAH--------------------------------------------------------------------
Q11S70_CYTH3/11-112------GAFTAH--------------------------------------------------------------------
Q5Z2J9_NOCFA/19-120------GAAASH--------------------------------------------------------------------
C6X539_FLAB3/10-112------SASVAH--------------------------------------------------------------------
Q26DR8_FLABB/6-106------LGFGVR--------------------------------------------------------------------
B8JHM2_ANAD2/39-140------GAAASH--------------------------------------------------------------------
B5HQQ2_9ACTO/55-152------GAFVVQ--------------------------------------------------------------------
A7H7U7_ANADF/31-130------GAVSTH--------------------------------------------------------------------
B9R073_9RHOB/12-107------GAAAAH--------------------------------------------------------------------
A5FBV8_FLAJ1/7-111------FASISH--------------------------------------------------------------------
A1ZY83_9BACT/27-125------FAIGAH--------------------------------------------------------------------
D7VTK5_9SPHI/10-113------FAFISH--------------------------------------------------------------------
D2QN87_SPILD/19-118------SAIIAN--------------------------------------------------------------------
A9B014_HERA2/18-116------GAIASH--------------------------------------------------------------------
A8FU14_SHESH/7-110------GAIFFH--------------------------------------------------------------------
Q1M3R5_RHIL3/9-110------LSGLAH--------------------------------------------------------------------
D0XES9_VIBHA/3-111------GAMFFH--------------------------------------------------------------------
B9XQC4_9BACT/28-127------GAIASQ--------------------------------------------------------------------
B5WCL4_9BURK/11-109------AALFTL--------------------------------------------------------------------
C6B3P5_RHILS/11-110------AAAGTV--------------------------------------------------------------------
Q1D110_MYXXD/7-102------GATSTH--------------------------------------------------------------------
B1FVW7_9BURK/9-106------AALATV--------------------------------------------------------------------
C7PKI9_CHIPD/12-107------GAIATH--------------------------------------------------------------------
B9XR85_9BACT/12-110------SAAIAK--------------------------------------------------------------------
A9F3Z6_SORC5/44-143------GAIAIH--------------------------------------------------------------------
C9CTS5_9RHOB/7-110------VFSGTH--------------------------------------------------------------------
A5ERI9_BRASB/6-107------GAIAAH--------------------------------------------------------------------
D9QMH9_BRESC/33-140------AMLAVH--------------------------------------------------------------------
B1KFL4_SHEWM/4-111------GALFFH--------------------------------------------------------------------
C0IN69_9BACT/7-105------GAIASH--------------------------------------------------------------------
Q0SJ69_RHOSR/31-130------GAVATN--------------------------------------------------------------------
A3XU47_9VIBR/12-120------GAIYFH--------------------------------------------------------------------
Q1IPI6_KORVE/25-123------GAVVTN--------------------------------------------------------------------
A9UV76_MONBE/637-749------GAIYTH--------------------------------------------------------------------
B6AU47_9RHOB/5-108------GAIGCH--------------------------------------------------------------------
B4RA61_PHEZH/23-122------GTCAVH--------------------------------------------------------------------
A6EKC1_9SPHI/24-124------SATIAL--------------------------------------------------------------------
C5C5Y3_BEUC1/41-144------GAVVTH--------------------------------------------------------------------
C0Z8W5_BREBN/15-114------GVIATQ--------------------------------------------------------------------
B9JK89_AGRRK/29-136------FAIILE--------------------------------------------------------------------
B1MHX9_MYCA9/33-130------GAVTID--------------------------------------------------------------------
A5V4G4_SPHWW/11-106------AAIATL--------------------------------------------------------------------

PF07291

MAUE_METEA/3-186------IAIAIN--------------------------------------------------------------------
MAUE_PARDE/2-185------AALAIN--------------------------------------------------------------------
MAUE_METFK/2-184------LALAIN--------------------------------------------------------------------
MAUE_METME/2-186------FAIAVN--------------------------------------------------------------------
MAUE_PARVE/2-185------LAIAVN--------------------------------------------------------------------

PF04224

Q9CJR3_PASMU/1-137------VTVSLL--------------------------------------------------------------------
O25289_HELPY/5-190------TTLSFL--------------------------------------------------------------------
YKGB_ECOLI/2-182------VTLSFL--------------------------------------------------------------------
Q9KRP9_VIBCH/1-146------STLSFL--------------------------------------------------------------------
Y219_HAEIN/13-209------VTLSFL--------------------------------------------------------------------
O87513_ECOLX/1-138------VTLSLL--------------------------------------------------------------------

PF05514

Q6RJY8_CAPAN/1-138------MATPLL--------------------------------------------------------------------
O23298_ARATH/1-138------VATPIL--------------------------------------------------------------------
Q01MB3_ORYSA/1-138------FITPVV--------------------------------------------------------------------
Q9LTD0_ARATH/18-201------IATMVH--------------------------------------------------------------------
Q9LTD1_ARATH/1-132------FSTVI.--------------------------------------------------------------------
Q0IXE1_ORYSJ/1-138------FITPVV--------------------------------------------------------------------
A2XCK0_ORYSI/1-138------FITPVV--------------------------------------------------------------------
O22690_ARATH/1-138------VVSPIL--------------------------------------------------------------------
Q570L1_ARATH/18-198------ILSPIL--------------------------------------------------------------------
P93384_TOBAC/1-138------IASPIL--------------------------------------------------------------------

PF13781

A0RCI0_BACAH/180-281------AAGFTN--------------------------------------------------------------------
C3GZF4_BACTU/180-281------AAGFTN--------------------------------------------------------------------
C2TVP5_BACCE/180-280------AAGWTN--------------------------------------------------------------------
C3AK78_BACMY/185-286------VAGFTN--------------------------------------------------------------------
D3E5H6_GEOS4/180-281------GAWMTD--------------------------------------------------------------------
Q65IN6_BACLD/178-279------SAGMAD--------------------------------------------------------------------
A6CEZ9_9PLAN/177-278------GVAISS--------------------------------------------------------------------
C6CYU2_PAESJ/180-281------GALIYT--------------------------------------------------------------------
Q8ESB3_OCEIH/179-280------AATISD--------------------------------------------------------------------
B3EDV4_CHLL2/19-119------YVMLFE--------------------------------------------------------------------
A4SEU6_PROVI/25-125------FVALFE--------------------------------------------------------------------
A1BFB6_CHLPD/25-125------YVALFE--------------------------------------------------------------------
B4SAW4_PELPB/19-119------FVALFE--------------------------------------------------------------------
B3EQZ0_CHLPB/20-120------YVAVFE--------------------------------------------------------------------
B4S7F5_PROA2/21-121------YVALFQ--------------------------------------------------------------------
Q3ARZ2_CHLCH/17-117------FVGIFE--------------------------------------------------------------------
B3QTS0_CHLT3/26-127------GVAFTS--------------------------------------------------------------------
B1KF78_SHEWM/12-113------FVTFMQ--------------------------------------------------------------------
A0Y6C6_9GAMM/17-118------AVAVMQ--------------------------------------------------------------------
B3QN36_CHLP8/20-117------FVAWHE--------------------------------------------------------------------
B4X4D6_9GAMM/11-112------FTLFVV--------------------------------------------------------------------
C0VHX3_9GAMM/20-120------FVLLIY--------------------------------------------------------------------
D0BX48_9GAMM/15-115------LIGFLI--------------------------------------------------------------------
D0SFQ9_ACIJO/15-115------LVALLI--------------------------------------------------------------------
Q1H1D1_METFK/335-436------ILSWFI--------------------------------------------------------------------
D0SSK1_ACILW/19-120------LIAFTA--------------------------------------------------------------------
C7R8T5_KANKD/19-119------LLTMIE--------------------------------------------------------------------
B3RB23_CUPTR/328-429------IISVRL--------------------------------------------------------------------
Q2SM61_HAHCH/17-117------DVAWFS--------------------------------------------------------------------
Q3SHK0_THIDA/314-415------AISLYL--------------------------------------------------------------------
B1KF79_SHEWM/15-115------LLTFID--------------------------------------------------------------------
C0DTU0_EIKCO/36-137------IVAYRL--------------------------------------------------------------------
Q2Y734_NITMU/330-431------AITLFL--------------------------------------------------------------------
Q5X5Q5_LEGPA/322-423------IITIKL--------------------------------------------------------------------
Q5NY22_AROAE/320-421------IISWKL--------------------------------------------------------------------
B1Z1S6_BURA4/308-408------VIAVTM--------------------------------------------------------------------
A7BY74_9GAMM/6-107------IITWAL--------------------------------------------------------------------
C4GMT5_9NEIS/12-113------IIAFRL--------------------------------------------------------------------
C8NCY7_9GAMM/28-129------IVAWCL--------------------------------------------------------------------
A1K6I8_AZOSB/336-437------IISWKL--------------------------------------------------------------------
A6DTJ9_9BACT/15-115------AIFIQL--------------------------------------------------------------------
D4DP38_NEIEG/16-117------IIAFAL--------------------------------------------------------------------
Q1LGK6_RALME/315-415------IIAVAL--------------------------------------------------------------------
Q4UMY6_RICFE/322-422------LLTYLK--------------------------------------------------------------------
C5TJR5_NEIFL/18-119------IIAFRL--------------------------------------------------------------------
C1F939_ACIC5/18-120------NGIFWA--------------------------------------------------------------------
Q7NW81_CHRVO/13-112------AVAVAL--------------------------------------------------------------------
A8UH51_9FLAO/12-113------EFFLVP--------------------------------------------------------------------
Q11TY1_CYTH3/19-119------EFILVP--------------------------------------------------------------------
C7PI03_CHIPD/14-115------EFMLVP--------------------------------------------------------------------
C9YGF9_9BURK/7-107------VATLLT--------------------------------------------------------------------
A1VMB6_POLNA/12-112------AATMLL--------------------------------------------------------------------
Q0ANG5_MARMM/322-422------TLSMTL--------------------------------------------------------------------
A9C3F1_DELAS/21-121------LATVLQ--------------------------------------------------------------------
Q4K472_PSEF5/309-409------IISLIL--------------------------------------------------------------------
Q89WY4_BRAJA/329-429------GAAILT--------------------------------------------------------------------
Q2BMK1_9GAMM/316-416------LLGMMA--------------------------------------------------------------------
A5E8R6_BRASB/331-431------GCALLT--------------------------------------------------------------------
C9CYE4_9RHOB/339-438------GSLITA--------------------------------------------------------------------
A3K709_9RHOB/331-430------SATVFT--------------------------------------------------------------------
Q1YK40_MOBAS/336-436------GAAVLT--------------------------------------------------------------------
Q2K6I2_RHIEC/316-414------GATMLE--------------------------------------------------------------------
A1TNI5_ACIAC/22-122------IATFLL--------------------------------------------------------------------
B8H2E0_CAUCN/321-421------GGALVR--------------------------------------------------------------------
B6RA56_9RHOB/326-425------AGTIWA--------------------------------------------------------------------
C4WL85_9RHIZ/327-426------GGLVVA--------------------------------------------------------------------
B9JGJ5_AGRRK/322-420------GGTLLE--------------------------------------------------------------------
A9EWZ0_9RHOB/307-406------SATIVT--------------------------------------------------------------------
B4WB77_9CAUL/325-424------AGTLSL--------------------------------------------------------------------
A5V930_SPHWW/323-422------GATIVR--------------------------------------------------------------------
Q2JZG1_RHIEC/327-426------AATAVL--------------------------------------------------------------------
Q02U83_PSEAB/307-409------AISLIL--------------------------------------------------------------------
Q11CJ7_MESSB/321-420------SGTILL--------------------------------------------------------------------
A4F044_9RHOB/306-405------GSLIAA--------------------------------------------------------------------
A7IKV9_XANP2/322-421------AATALV--------------------------------------------------------------------
Q2S702_HAHCH/327-427------TLGALA--------------------------------------------------------------------

PF02077

SURF4_CAEEL/11-277------MSLMHF--------------------------------------------------------------------
YFC7_CAEEL/4-269------ISMVHF--------------------------------------------------------------------
ERV29_YEAST/48-310------IAFTFS--------------------------------------------------------------------
SURF4_SCHPO/33-302------LGLLAK--------------------------------------------------------------------
SURF4_DROME/5-270------ITLIRF--------------------------------------------------------------------
SURF4_HUMAN/4-269------MTLLHF--------------------------------------------------------------------

PF06762

Q2L6Y0_CAEEL/122-555......MVSLLQTPRVPIGASFLAAIVFAKIGFEVVYR..........................................
LMF2_BOVIN/122-592......TTALLD.......DTHLAAK.SST..................................................
Q826A6_STRAW/121-468......ALSAVA.......FP...........................................................
A0QMA7_MYCA1/121-478......ACSAID.......DSSVALL.LPK..................................................
Q45WA6_TOXGO/205-777......AIMCLD.......DHFLTCL.FPSAILSRLPELVRGCAGYWSLPQIQAWPFPQLFPGEEHGKGKGRQANDRPEA
LMF1_HUMAN/169-551......SLACFD.......DATLGFL.FPSGPGSLK............................................
Q4REY1_TETNG/125-682......CLSLLD.......DQHIRFW.LRR..................................................
A0QT94_MYCS2/77-431......ACGVVS.......DTALSAV.VGV..................................................
B9M9C6_GEOSF/118-470......CFSTVT.......TGQLPFLALEV..................................................
A1R4Z7_ARTAT/124-480......AFAAVS.......DPVAHAV.FPFIPL...............................................
A0JUS2_ARTS2/124-488......AFAAVS.......DPVAHAV.LPVIPLD..............................................
LMF1_MOUSE/169-553......SLACFD.......DAALGFL.FPSGPQGLK............................................
A4FB78_SACEN/123-469......AFAAMG.......PQVLGWLPVPL..................................................
Q6MNI0_BDEBA/151-510......CLAVLP.......DSAWGFK......................................................
Q54K13_DICDI/157-572......CTLLMD.......DAFLLSLPMPDKVRIKLI...........................................
A7RJW9_NEMVE/81-464......SIACFD.......DSSLAWL.FSSFSGAR.............................................
Q08T93_STIAD/249-611......GVWLLD.......DEALTGL.LRR..................................................
Q1CX59_MYXXD/289-656......GVWLLD.......DAALRRV.LPL..................................................
Q234A3_TETTS/136-636VSNLKSTLATFD.......DKFLKYW.TPKFILSLLGD..........................................
Q4XRT1_PLACH/156-696......LMYCFD.......DKILFHIFTKSKKNKII............................................
A5K5K3_PLAVS/186-557......FLSSLD.......DSILNLFFHPG..................................................
A0LRD9_ACIC1/123-473......AFSAVD.......DG....F.LHL..................................................
LMF2_XENTR/122-590......CCSLLD.......DQHITFF.QRH..................................................
A1TEH0_MYCVP/123-477......AFSAVD.......QSVFAVV.LPM..................................................
Q4Y900_PLACH/136-509......FFSSFD.......DSILNSFSTSG..................................................

PF04173

Q97X72_SULSO/12-173--------------------------------------------------------------------------------
Q97XJ3_SULSO/18-183--------------------------------------------------------------------------------
Q973M6_SULTO/9-177--------------------------------------------------------------------------------
P97207_ACIAM/20-184--------------------------------------------------------------------------------
Q97UC4_SULSO/10-178--------------------------------------------------------------------------------
Q8NKT7_ACIAM/12-174--------------------------------------------------------------------------------
Q8AAF0_BACTN/18-181--------------------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94--------------------------------------------------------------------------------
Q87K55_VIBPA/16-104--------------------------------------------------------------------------------
Q8KEE1_CHLTE/7-88--------------------------------------------------------------------------------
Q9RTC4_DEIRA/8-92--------------------------------------------------------------------------------
Q7TUM8_PROMM/37-127--------------------------------------------------------------------------------
Q98K39_RHILO/14-90--------------------------------------------------------------------------------
Q7VHA8_HELHP/8-89--------------------------------------------------------------------------------
Q8GA66_ECOLX/8-90--------------------------------------------------------------------------------
Q89FZ6_BRAJA/10-92--------------------------------------------------------------------------------
Q8EDN3_SHEON/21-107--------------------------------------------------------------------------------
Q8KW46_9RHOB/66-148--------------------------------------------------------------------------------
Q8A9J9_BACTN/19-101--------------------------------------------------------------------------------
Q83BV7_COXBU/131-217--------------------------------------------------------------------------------
Q92W39_RHIME/11-107--------------------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105--------------------------------------------------------------------------------
Q89M65_BRAJA/31-107--------------------------------------------------------------------------------
Q8FX91_BRUSU/12-94--------------------------------------------------------------------------------
Q7V0B0_PROMP/15-102--------------------------------------------------------------------------------
Q82B81_STRAW/12-94--------------------------------------------------------------------------------
Q984Q4_RHILO/6-88--------------------------------------------------------------------------------
Q9A3E7_CAUCR/28-117--------------------------------------------------------------------------------
Q983U6_RHILO/19-101--------------------------------------------------------------------------------
Q82HN4_STRAW/24-126--------------------------------------------------------------------------------
Q7VUY8_BORPE/24-126--------------------------------------------------------------------------------
Q831Y6_ENTFA/7-87--------------------------------------------------------------------------------
Q983U8_RHILO/8-90--------------------------------------------------------------------------------
Q7V328_PROMP/44-134--------------------------------------------------------------------------------
Q9K461_STRCO/11-90--------------------------------------------------------------------------------
Q7MRA2_WOLSU/17-98--------------------------------------------------------------------------------
Q8F8N5_LEPIN/13-98--------------------------------------------------------------------------------
Q9HYW2_PSEAE/22-108--------------------------------------------------------------------------------
Q88P63_PSEPK/6-95--------------------------------------------------------------------------------
Q9HWH6_PSEAE/14-96--------------------------------------------------------------------------------
Q8FR06_COREF/10-94--------------------------------------------------------------------------------
Q9KYL5_STRCO/4-96--------------------------------------------------------------------------------
Q8NR01_CORGL/191-281--------------------------------------------------------------------------------
Q8XR31_RALSO/30-119--------------------------------------------------------------------------------
Q92SD1_RHIME/6-88--------------------------------------------------------------------------------
Q7NPD1_GLOVI/22-104--------------------------------------------------------------------------------
O53252_MYCTU/114-206--------------------------------------------------------------------------------
YPHA_SHIFL/16-98--------------------------------------------------------------------------------
Q7NZE1_CHRVO/10-92--------------------------------------------------------------------------------
Q8CZQ7_YERPE/13-94--------------------------------------------------------------------------------
Q7VDS1_PROMA/43-133--------------------------------------------------------------------------------
O86323_MYCTU/16-94--------------------------------------------------------------------------------
Q7N096_PHOLL/8-89--------------------------------------------------------------------------------
Q8XWH4_RALSO/12-94--------------------------------------------------------------------------------
Q7VYL1_BORPE/8-89--------------------------------------------------------------------------------
Q7US51_RHOBA/24-106--------------------------------------------------------------------------------
Q88G88_PSEPK/13-95--------------------------------------------------------------------------------
Q812S4_BACCR/6-87--------------------------------------------------------------------------------
Q88KH7_PSEPK/17-105--------------------------------------------------------------------------------
Q98JU3_RHILO/13-95--------------------------------------------------------------------------------
O05565_MYCLE/52-137--------------------------------------------------------------------------------
Q89MP6_BRAJA/4-104--------------------------------------------------------------------------------
Q8PGB0_XANAC/14-96--------------------------------------------------------------------------------
CATD_BACSU/8-88--------------------------------------------------------------------------------
Q8EC25_SHEON/16-104--------------------------------------------------------------------------------
Q7VTR5_BORPE/10-91--------------------------------------------------------------------------------
Q7UE97_RHOBA/16-98--------------------------------------------------------------------------------
Q7NA66_PHOLL/20-124--------------------------------------------------------------------------------
Q7VBT6_PROMA/9-93--------------------------------------------------------------------------------
O33110_MYCLE/114-202--------------------------------------------------------------------------------
Q9RC47_BACHO/8-89--------------------------------------------------------------------------------
Y886_HAEIN/11-90--------------------------------------------------------------------------------
Q8FSC2_COREF/11-95--------------------------------------------------------------------------------
Q98K48_RHILO/27-109--------------------------------------------------------------------------------
Q72VB3_LEPIC/18-104--------------------------------------------------------------------------------
Q7NSB1_CHRVO/12-100--------------------------------------------------------------------------------
Q9HZY2_PSEAE/16-104--------------------------------------------------------------------------------
Q88K91_PSEPK/19-105--------------------------------------------------------------------------------
Q7W6U9_BORPA/7-93--------------------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95--------------------------------------------------------------------------------
Q8Y2U2_RALSO/28-111--------------------------------------------------------------------------------
Q7X1H0_9BACT/12-99--------------------------------------------------------------------------------
A9CHZ6_AGRT5/16-92--------------------------------------------------------------------------------
Q99V56_STAAM/4-84--------------------------------------------------------------------------------
Q8FPX7_COREF/162-252--------------------------------------------------------------------------------
Q9CP47_PASMU/16-102--------------------------------------------------------------------------------
Q9HWS4_PSEAE/24-110--------------------------------------------------------------------------------
Q82PS9_STRAW/30-117--------------------------------------------------------------------------------
MHQP_BACSU/5-93--------------------------------------------------------------------------------
Q883U2_PSESM/16-104--------------------------------------------------------------------------------
Q92TK3_RHIME/11-93--------------------------------------------------------------------------------
Q7V7V3_PROMM/10-94--------------------------------------------------------------------------------
A9CK19_AGRT5/23-105--------------------------------------------------------------------------------
Q7U687_SYNPX/15-102--------------------------------------------------------------------------------
Q89EW4_BRAJA/19-101--------------------------------------------------------------------------------
Y1602_HAEIN/14-100--------------------------------------------------------------------------------
Q98JF9_RHILO/23-103--------------------------------------------------------------------------------
Q8YSN3_NOSS1/6-88--------------------------------------------------------------------------------
Q92Y87_RHIME/25-105--------------------------------------------------------------------------------
YQJF_ECOLI/8-88--------------------------------------------------------------------------------
Q812I5_BACCR/5-93--------------------------------------------------------------------------------
Q8NT59_CORGL/10-94--------------------------------------------------------------------------------
Q9KY40_STRCO/14-95--------------------------------------------------------------------------------
Q87KG0_VIBPA/27-115--------------------------------------------------------------------------------
Q8P8R3_XANCP/15-111--------------------------------------------------------------------------------
Q89SK7_BRAJA/66-148--------------------------------------------------------------------------------
Q82AZ6_STRAW/10-97--------------------------------------------------------------------------------
Q82V34_NITEU/11-94--------------------------------------------------------------------------------
Q82UE4_NITEU/22-102--------------------------------------------------------------------------------
Q8DDM4_VIBVU/23-111--------------------------------------------------------------------------------

PF13564

D1AAS7_THECD/7-112--------------------------------------------------------------------------------
D2SF07_GEOOG/7-113--------------------------------------------------------------------------------
C5BX04_BEUC1/7-113--------------------------------------------------------------------------------
D3Q9W4_STANL/7-109--------------------------------------------------------------------------------
D1BDS4_SANKS/7-113--------------------------------------------------------------------------------
A0QFH8_MYCA1/7-109--------------------------------------------------------------------------------
C2Q8E8_BACCE/7-108--------------------------------------------------------------------------------
D1BYA3_XYLCX/7-112--------------------------------------------------------------------------------
B5HYY5_9ACTO/7-112--------------------------------------------------------------------------------
D1BVK9_XYLCX/7-113--------------------------------------------------------------------------------
A9B5S7_HERA2/7-113--------------------------------------------------------------------------------
D3Q6B3_STANL/7-112--------------------------------------------------------------------------------
C3BLY8_9BACI/20-124--------------------------------------------------------------------------------
C5C629_BEUC1/7-115--------------------------------------------------------------------------------
D3PWB3_STANL/7-114--------------------------------------------------------------------------------
B0AKY3_BACAN/4-107--------------------------------------------------------------------------------
D3EH52_GEOS4/7-112--------------------------------------------------------------------------------
A4F848_SACEN/7-108--------------------------------------------------------------------------------
C4RG94_9ACTO/7-114--------------------------------------------------------------------------------
A1SIQ7_NOCSJ/7-109--------------------------------------------------------------------------------
C6WJU0_ACTMD/7-113--------------------------------------------------------------------------------
B5I6V7_9ACTO/19-120--------------------------------------------------------------------------------
A8M6Z9_SALAI/7-108--------------------------------------------------------------------------------
C6VZE8_DYAFD/11-112--------------------------------------------------------------------------------
Q0SGE8_RHOSR/7-112--------------------------------------------------------------------------------
D5UX83_TSUPD/7-115--------------------------------------------------------------------------------
D3PZS4_STANL/7-112--------------------------------------------------------------------------------
D3PUC2_STANL/7-110--------------------------------------------------------------------------------
C9Z9S2_STRSW/7-108--------------------------------------------------------------------------------
A1TE84_MYCVP/11-113--------------------------------------------------------------------------------
D2AS43_STRRD/5-106--------------------------------------------------------------------------------
A4T6B5_MYCGI/6-108--------------------------------------------------------------------------------
D2PZ45_KRIFD/7-114--------------------------------------------------------------------------------
B1MM14_MYCA9/10-112--------------------------------------------------------------------------------
A6FZU9_9DELT/14-115--------------------------------------------------------------------------------
Q65HS4_BACLD/5-107--------------------------------------------------------------------------------
Q5YWI3_NOCFA/31-132--------------------------------------------------------------------------------
D3F1P3_CONWI/7-108--------------------------------------------------------------------------------
C7PZU5_CATAD/19-125--------------------------------------------------------------------------------
A8M8B0_SALAI/7-107--------------------------------------------------------------------------------
B5H4W5_STRPR/7-108--------------------------------------------------------------------------------
A1UGV4_MYCSK/7-109--------------------------------------------------------------------------------
Q11P05_CYTH3/10-110--------------------------------------------------------------------------------
D5UGI3_CELFN/7-114--------------------------------------------------------------------------------
Q89Y33_BRAJA/62-168--------------------------------------------------------------------------------
A6G4G5_9DELT/10-111--------------------------------------------------------------------------------
C0ZKK1_BREBN/2-104--------------------------------------------------------------------------------
B1MDG2_MYCA9/7-115--------------------------------------------------------------------------------
Q7UL85_RHOBA/23-124--------------------------------------------------------------------------------
C7PUE7_CHIPD/10-111--------------------------------------------------------------------------------
D3Q6A9_STANL/7-109--------------------------------------------------------------------------------
A3RXR1_RALSL/22-128--------------------------------------------------------------------------------
Q82R50_STRAW/28-129--------------------------------------------------------------------------------
D2QST6_SPILD/17-122--------------------------------------------------------------------------------
Q5YXM8_NOCFA/33-141--------------------------------------------------------------------------------
C7PKH0_CHIPD/17-121--------------------------------------------------------------------------------
B2JL65_BURP8/47-153--------------------------------------------------------------------------------
Q72UJ2_LEPIC/13-114--------------------------------------------------------------------------------
C0WI63_9CORY/7-112--------------------------------------------------------------------------------
Q1VX62_9FLAO/6-107--------------------------------------------------------------------------------
D2ASD1_STRRD/34-143--------------------------------------------------------------------------------
B0UIU5_METS4/14-111--------------------------------------------------------------------------------
D2PS28_KRIFD/35-136--------------------------------------------------------------------------------
A6G6P4_9DELT/10-116--------------------------------------------------------------------------------
C7PYY8_CATAD/7-121--------------------------------------------------------------------------------
A9GJR9_SORC5/11-117--------------------------------------------------------------------------------
B8IER0_METNO/21-116--------------------------------------------------------------------------------
Q1IKM4_KORVE/10-111--------------------------------------------------------------------------------
A4C0H3_9FLAO/6-106--------------------------------------------------------------------------------
A1ZLE1_9BACT/10-109--------------------------------------------------------------------------------
C0BG18_9BACT/6-105--------------------------------------------------------------------------------
A9FEJ3_SORC5/27-126--------------------------------------------------------------------------------
A8ULQ7_9FLAO/10-110--------------------------------------------------------------------------------
Q2S0Z3_SALRD/8-118--------------------------------------------------------------------------------
Q11S70_CYTH3/11-112--------------------------------------------------------------------------------
Q5Z2J9_NOCFA/19-120--------------------------------------------------------------------------------
C6X539_FLAB3/10-112--------------------------------------------------------------------------------
Q26DR8_FLABB/6-106--------------------------------------------------------------------------------
B8JHM2_ANAD2/39-140--------------------------------------------------------------------------------
B5HQQ2_9ACTO/55-152--------------------------------------------------------------------------------
A7H7U7_ANADF/31-130--------------------------------------------------------------------------------
B9R073_9RHOB/12-107--------------------------------------------------------------------------------
A5FBV8_FLAJ1/7-111--------------------------------------------------------------------------------
A1ZY83_9BACT/27-125--------------------------------------------------------------------------------
D7VTK5_9SPHI/10-113--------------------------------------------------------------------------------
D2QN87_SPILD/19-118--------------------------------------------------------------------------------
A9B014_HERA2/18-116--------------------------------------------------------------------------------
A8FU14_SHESH/7-110--------------------------------------------------------------------------------
Q1M3R5_RHIL3/9-110--------------------------------------------------------------------------------
D0XES9_VIBHA/3-111--------------------------------------------------------------------------------
B9XQC4_9BACT/28-127--------------------------------------------------------------------------------
B5WCL4_9BURK/11-109--------------------------------------------------------------------------------
C6B3P5_RHILS/11-110--------------------------------------------------------------------------------
Q1D110_MYXXD/7-102--------------------------------------------------------------------------------
B1FVW7_9BURK/9-106--------------------------------------------------------------------------------
C7PKI9_CHIPD/12-107--------------------------------------------------------------------------------
B9XR85_9BACT/12-110--------------------------------------------------------------------------------
A9F3Z6_SORC5/44-143--------------------------------------------------------------------------------
C9CTS5_9RHOB/7-110--------------------------------------------------------------------------------
A5ERI9_BRASB/6-107--------------------------------------------------------------------------------
D9QMH9_BRESC/33-140--------------------------------------------------------------------------------
B1KFL4_SHEWM/4-111--------------------------------------------------------------------------------
C0IN69_9BACT/7-105--------------------------------------------------------------------------------
Q0SJ69_RHOSR/31-130--------------------------------------------------------------------------------
A3XU47_9VIBR/12-120--------------------------------------------------------------------------------
Q1IPI6_KORVE/25-123--------------------------------------------------------------------------------
A9UV76_MONBE/637-749--------------------------------------------------------------------------------
B6AU47_9RHOB/5-108--------------------------------------------------------------------------------
B4RA61_PHEZH/23-122--------------------------------------------------------------------------------
A6EKC1_9SPHI/24-124--------------------------------------------------------------------------------
C5C5Y3_BEUC1/41-144--------------------------------------------------------------------------------
C0Z8W5_BREBN/15-114--------------------------------------------------------------------------------
B9JK89_AGRRK/29-136--------------------------------------------------------------------------------
B1MHX9_MYCA9/33-130--------------------------------------------------------------------------------
A5V4G4_SPHWW/11-106--------------------------------------------------------------------------------

PF07291

MAUE_METEA/3-186--------------------------------------------------------------------------------
MAUE_PARDE/2-185--------------------------------------------------------------------------------
MAUE_METFK/2-184--------------------------------------------------------------------------------
MAUE_METME/2-186--------------------------------------------------------------------------------
MAUE_PARVE/2-185--------------------------------------------------------------------------------

PF04224

Q9CJR3_PASMU/1-137--------------------------------------------------------------------------------
O25289_HELPY/5-190--------------------------------------------------------------------------------
YKGB_ECOLI/2-182--------------------------------------------------------------------------------
Q9KRP9_VIBCH/1-146--------------------------------------------------------------------------------
Y219_HAEIN/13-209--------------------------------------------------------------------------------
O87513_ECOLX/1-138--------------------------------------------------------------------------------

PF05514

Q6RJY8_CAPAN/1-138--------------------------------------------------------------------------------
O23298_ARATH/1-138--------------------------------------------------------------------------------
Q01MB3_ORYSA/1-138--------------------------------------------------------------------------------
Q9LTD0_ARATH/18-201--------------------------------------------------------------------------------
Q9LTD1_ARATH/1-132--------------------------------------------------------------------------------
Q0IXE1_ORYSJ/1-138--------------------------------------------------------------------------------
A2XCK0_ORYSI/1-138--------------------------------------------------------------------------------
O22690_ARATH/1-138--------------------------------------------------------------------------------
Q570L1_ARATH/18-198--------------------------------------------------------------------------------
P93384_TOBAC/1-138--------------------------------------------------------------------------------

PF13781

A0RCI0_BACAH/180-281--------------------------------------------------------------------------------
C3GZF4_BACTU/180-281--------------------------------------------------------------------------------
C2TVP5_BACCE/180-280--------------------------------------------------------------------------------
C3AK78_BACMY/185-286--------------------------------------------------------------------------------
D3E5H6_GEOS4/180-281--------------------------------------------------------------------------------
Q65IN6_BACLD/178-279--------------------------------------------------------------------------------
A6CEZ9_9PLAN/177-278--------------------------------------------------------------------------------
C6CYU2_PAESJ/180-281--------------------------------------------------------------------------------
Q8ESB3_OCEIH/179-280--------------------------------------------------------------------------------
B3EDV4_CHLL2/19-119--------------------------------------------------------------------------------
A4SEU6_PROVI/25-125--------------------------------------------------------------------------------
A1BFB6_CHLPD/25-125--------------------------------------------------------------------------------
B4SAW4_PELPB/19-119--------------------------------------------------------------------------------
B3EQZ0_CHLPB/20-120--------------------------------------------------------------------------------
B4S7F5_PROA2/21-121--------------------------------------------------------------------------------
Q3ARZ2_CHLCH/17-117--------------------------------------------------------------------------------
B3QTS0_CHLT3/26-127--------------------------------------------------------------------------------
B1KF78_SHEWM/12-113--------------------------------------------------------------------------------
A0Y6C6_9GAMM/17-118--------------------------------------------------------------------------------
B3QN36_CHLP8/20-117--------------------------------------------------------------------------------
B4X4D6_9GAMM/11-112--------------------------------------------------------------------------------
C0VHX3_9GAMM/20-120--------------------------------------------------------------------------------
D0BX48_9GAMM/15-115--------------------------------------------------------------------------------
D0SFQ9_ACIJO/15-115--------------------------------------------------------------------------------
Q1H1D1_METFK/335-436--------------------------------------------------------------------------------
D0SSK1_ACILW/19-120--------------------------------------------------------------------------------
C7R8T5_KANKD/19-119--------------------------------------------------------------------------------
B3RB23_CUPTR/328-429--------------------------------------------------------------------------------
Q2SM61_HAHCH/17-117--------------------------------------------------------------------------------
Q3SHK0_THIDA/314-415--------------------------------------------------------------------------------
B1KF79_SHEWM/15-115--------------------------------------------------------------------------------
C0DTU0_EIKCO/36-137--------------------------------------------------------------------------------
Q2Y734_NITMU/330-431--------------------------------------------------------------------------------
Q5X5Q5_LEGPA/322-423--------------------------------------------------------------------------------
Q5NY22_AROAE/320-421--------------------------------------------------------------------------------
B1Z1S6_BURA4/308-408--------------------------------------------------------------------------------
A7BY74_9GAMM/6-107--------------------------------------------------------------------------------
C4GMT5_9NEIS/12-113--------------------------------------------------------------------------------
C8NCY7_9GAMM/28-129--------------------------------------------------------------------------------
A1K6I8_AZOSB/336-437--------------------------------------------------------------------------------
A6DTJ9_9BACT/15-115--------------------------------------------------------------------------------
D4DP38_NEIEG/16-117--------------------------------------------------------------------------------
Q1LGK6_RALME/315-415--------------------------------------------------------------------------------
Q4UMY6_RICFE/322-422--------------------------------------------------------------------------------
C5TJR5_NEIFL/18-119--------------------------------------------------------------------------------
C1F939_ACIC5/18-120--------------------------------------------------------------------------------
Q7NW81_CHRVO/13-112--------------------------------------------------------------------------------
A8UH51_9FLAO/12-113--------------------------------------------------------------------------------
Q11TY1_CYTH3/19-119--------------------------------------------------------------------------------
C7PI03_CHIPD/14-115--------------------------------------------------------------------------------
C9YGF9_9BURK/7-107--------------------------------------------------------------------------------
A1VMB6_POLNA/12-112--------------------------------------------------------------------------------
Q0ANG5_MARMM/322-422--------------------------------------------------------------------------------
A9C3F1_DELAS/21-121--------------------------------------------------------------------------------
Q4K472_PSEF5/309-409--------------------------------------------------------------------------------
Q89WY4_BRAJA/329-429--------------------------------------------------------------------------------
Q2BMK1_9GAMM/316-416--------------------------------------------------------------------------------
A5E8R6_BRASB/331-431--------------------------------------------------------------------------------
C9CYE4_9RHOB/339-438--------------------------------------------------------------------------------
A3K709_9RHOB/331-430--------------------------------------------------------------------------------
Q1YK40_MOBAS/336-436--------------------------------------------------------------------------------
Q2K6I2_RHIEC/316-414--------------------------------------------------------------------------------
A1TNI5_ACIAC/22-122--------------------------------------------------------------------------------
B8H2E0_CAUCN/321-421--------------------------------------------------------------------------------
B6RA56_9RHOB/326-425--------------------------------------------------------------------------------
C4WL85_9RHIZ/327-426--------------------------------------------------------------------------------
B9JGJ5_AGRRK/322-420--------------------------------------------------------------------------------
A9EWZ0_9RHOB/307-406--------------------------------------------------------------------------------
B4WB77_9CAUL/325-424--------------------------------------------------------------------------------
A5V930_SPHWW/323-422--------------------------------------------------------------------------------
Q2JZG1_RHIEC/327-426--------------------------------------------------------------------------------
Q02U83_PSEAB/307-409--------------------------------------------------------------------------------
Q11CJ7_MESSB/321-420--------------------------------------------------------------------------------
A4F044_9RHOB/306-405--------------------------------------------------------------------------------
A7IKV9_XANP2/322-421--------------------------------------------------------------------------------
Q2S702_HAHCH/327-427--------------------------------------------------------------------------------

PF02077

SURF4_CAEEL/11-277--------------------------------------------------------------------------------
YFC7_CAEEL/4-269--------------------------------------------------------------------------------
ERV29_YEAST/48-310--------------------------------------------------------------------------------
SURF4_SCHPO/33-302--------------------------------------------------------------------------------
SURF4_DROME/5-270--------------------------------------------------------------------------------
SURF4_HUMAN/4-269--------------------------------------------------------------------------------

PF06762

Q2L6Y0_CAEEL/122-555..........................................................................LPYKIL
LMF2_BOVIN/122-592................................................................................
Q826A6_STRAW/121-468................................................................................
A0QMA7_MYCA1/121-478................................................................................
Q45WA6_TOXGO/205-777EASLLDKDAGRDETLPFNAATDDSLDSPRSCCCWYRPYFPRIVRSLKIPSRVRKQVKEEIKENWGKMLAEVVASVAMLTC
LMF1_HUMAN/169-551.............................................................................DRV
Q4REY1_TETNG/125-682................................................................................
A0QT94_MYCS2/77-431................................................................................
B9M9C6_GEOSF/118-470................................................................................
A1R4Z7_ARTAT/124-480................................................................................
A0JUS2_ARTS2/124-488...............................................................................W
LMF1_MOUSE/169-553.............................................................................KQV
A4FB78_SACEN/123-469................................................................................
Q6MNI0_BDEBA/151-510................................................................................
Q54K13_DICDI/157-572............................................................................GIES
A7RJW9_NEMVE/81-464.............................................................................IKV
Q08T93_STIAD/249-611................................................................................
Q1CX59_MYXXD/289-656................................................................................
Q234A3_TETTS/136-636..........................................................................YNDCIK
Q4XRT1_PLACH/156-696............................................................................NVIM
A5K5K3_PLAVS/186-557................................................................................
A0LRD9_ACIC1/123-473................................................................................
LMF2_XENTR/122-590................................................................................
A1TEH0_MYCVP/123-477................................................................................
Q4Y900_PLACH/136-509................................................................................

PF04173

Q97X72_SULSO/12-173--------------------------------------------------------------------------------
Q97XJ3_SULSO/18-183--------------------------------------------------------------------------------
Q973M6_SULTO/9-177--------------------------------------------------------------------------------
P97207_ACIAM/20-184--------------------------------------------------------------------------------
Q97UC4_SULSO/10-178--------------------------------------------------------------------------------
Q8NKT7_ACIAM/12-174--------------------------------------------------------------------------------
Q8AAF0_BACTN/18-181--------------------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94--------------------------------------------------------------------------------
Q87K55_VIBPA/16-104--------------------------------------------------------------------------------
Q8KEE1_CHLTE/7-88--------------------------------------------------------------------------------
Q9RTC4_DEIRA/8-92--------------------------------------------------------------------------------
Q7TUM8_PROMM/37-127--------------------------------------------------------------------------------
Q98K39_RHILO/14-90--------------------------------------------------------------------------------
Q7VHA8_HELHP/8-89--------------------------------------------------------------------------------
Q8GA66_ECOLX/8-90--------------------------------------------------------------------------------
Q89FZ6_BRAJA/10-92--------------------------------------------------------------------------------
Q8EDN3_SHEON/21-107--------------------------------------------------------------------------------
Q8KW46_9RHOB/66-148--------------------------------------------------------------------------------
Q8A9J9_BACTN/19-101--------------------------------------------------------------------------------
Q83BV7_COXBU/131-217--------------------------------------------------------------------------------
Q92W39_RHIME/11-107--------------------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105--------------------------------------------------------------------------------
Q89M65_BRAJA/31-107--------------------------------------------------------------------------------
Q8FX91_BRUSU/12-94--------------------------------------------------------------------------------
Q7V0B0_PROMP/15-102--------------------------------------------------------------------------------
Q82B81_STRAW/12-94--------------------------------------------------------------------------------
Q984Q4_RHILO/6-88--------------------------------------------------------------------------------
Q9A3E7_CAUCR/28-117--------------------------------------------------------------------------------
Q983U6_RHILO/19-101--------------------------------------------------------------------------------
Q82HN4_STRAW/24-126--------------------------------------------------------------------------------
Q7VUY8_BORPE/24-126--------------------------------------------------------------------------------
Q831Y6_ENTFA/7-87--------------------------------------------------------------------------------
Q983U8_RHILO/8-90--------------------------------------------------------------------------------
Q7V328_PROMP/44-134--------------------------------------------------------------------------------
Q9K461_STRCO/11-90--------------------------------------------------------------------------------
Q7MRA2_WOLSU/17-98--------------------------------------------------------------------------------
Q8F8N5_LEPIN/13-98--------------------------------------------------------------------------------
Q9HYW2_PSEAE/22-108--------------------------------------------------------------------------------
Q88P63_PSEPK/6-95--------------------------------------------------------------------------------
Q9HWH6_PSEAE/14-96--------------------------------------------------------------------------------
Q8FR06_COREF/10-94--------------------------------------------------------------------------------
Q9KYL5_STRCO/4-96--------------------------------------------------------------------------------
Q8NR01_CORGL/191-281--------------------------------------------------------------------------------
Q8XR31_RALSO/30-119--------------------------------------------------------------------------------
Q92SD1_RHIME/6-88--------------------------------------------------------------------------------
Q7NPD1_GLOVI/22-104--------------------------------------------------------------------------------
O53252_MYCTU/114-206--------------------------------------------------------------------------------
YPHA_SHIFL/16-98--------------------------------------------------------------------------------
Q7NZE1_CHRVO/10-92--------------------------------------------------------------------------------
Q8CZQ7_YERPE/13-94--------------------------------------------------------------------------------
Q7VDS1_PROMA/43-133--------------------------------------------------------------------------------
O86323_MYCTU/16-94--------------------------------------------------------------------------------
Q7N096_PHOLL/8-89--------------------------------------------------------------------------------
Q8XWH4_RALSO/12-94--------------------------------------------------------------------------------
Q7VYL1_BORPE/8-89--------------------------------------------------------------------------------
Q7US51_RHOBA/24-106--------------------------------------------------------------------------------
Q88G88_PSEPK/13-95--------------------------------------------------------------------------------
Q812S4_BACCR/6-87--------------------------------------------------------------------------------
Q88KH7_PSEPK/17-105--------------------------------------------------------------------------------
Q98JU3_RHILO/13-95--------------------------------------------------------------------------------
O05565_MYCLE/52-137--------------------------------------------------------------------------------
Q89MP6_BRAJA/4-104--------------------------------------------------------------------------------
Q8PGB0_XANAC/14-96--------------------------------------------------------------------------------
CATD_BACSU/8-88--------------------------------------------------------------------------------
Q8EC25_SHEON/16-104--------------------------------------------------------------------------------
Q7VTR5_BORPE/10-91--------------------------------------------------------------------------------
Q7UE97_RHOBA/16-98--------------------------------------------------------------------------------
Q7NA66_PHOLL/20-124--------------------------------------------------------------------------------
Q7VBT6_PROMA/9-93--------------------------------------------------------------------------------
O33110_MYCLE/114-202--------------------------------------------------------------------------------
Q9RC47_BACHO/8-89--------------------------------------------------------------------------------
Y886_HAEIN/11-90--------------------------------------------------------------------------------
Q8FSC2_COREF/11-95--------------------------------------------------------------------------------
Q98K48_RHILO/27-109--------------------------------------------------------------------------------
Q72VB3_LEPIC/18-104--------------------------------------------------------------------------------
Q7NSB1_CHRVO/12-100--------------------------------------------------------------------------------
Q9HZY2_PSEAE/16-104--------------------------------------------------------------------------------
Q88K91_PSEPK/19-105--------------------------------------------------------------------------------
Q7W6U9_BORPA/7-93--------------------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95--------------------------------------------------------------------------------
Q8Y2U2_RALSO/28-111--------------------------------------------------------------------------------
Q7X1H0_9BACT/12-99--------------------------------------------------------------------------------
A9CHZ6_AGRT5/16-92--------------------------------------------------------------------------------
Q99V56_STAAM/4-84--------------------------------------------------------------------------------
Q8FPX7_COREF/162-252--------------------------------------------------------------------------------
Q9CP47_PASMU/16-102--------------------------------------------------------------------------------
Q9HWS4_PSEAE/24-110--------------------------------------------------------------------------------
Q82PS9_STRAW/30-117--------------------------------------------------------------------------------
MHQP_BACSU/5-93--------------------------------------------------------------------------------
Q883U2_PSESM/16-104--------------------------------------------------------------------------------
Q92TK3_RHIME/11-93--------------------------------------------------------------------------------
Q7V7V3_PROMM/10-94--------------------------------------------------------------------------------
A9CK19_AGRT5/23-105--------------------------------------------------------------------------------
Q7U687_SYNPX/15-102--------------------------------------------------------------------------------
Q89EW4_BRAJA/19-101--------------------------------------------------------------------------------
Y1602_HAEIN/14-100--------------------------------------------------------------------------------
Q98JF9_RHILO/23-103--------------------------------------------------------------------------------
Q8YSN3_NOSS1/6-88--------------------------------------------------------------------------------
Q92Y87_RHIME/25-105--------------------------------------------------------------------------------
YQJF_ECOLI/8-88--------------------------------------------------------------------------------
Q812I5_BACCR/5-93--------------------------------------------------------------------------------
Q8NT59_CORGL/10-94--------------------------------------------------------------------------------
Q9KY40_STRCO/14-95--------------------------------------------------------------------------------
Q87KG0_VIBPA/27-115--------------------------------------------------------------------------------
Q8P8R3_XANCP/15-111--------------------------------------------------------------------------------
Q89SK7_BRAJA/66-148--------------------------------------------------------------------------------
Q82AZ6_STRAW/10-97--------------------------------------------------------------------------------
Q82V34_NITEU/11-94--------------------------------------------------------------------------------
Q82UE4_NITEU/22-102--------------------------------------------------------------------------------
Q8DDM4_VIBVU/23-111--------------------------------------------------------------------------------

PF13564

D1AAS7_THECD/7-112--------------------------------------------------------------------------------
D2SF07_GEOOG/7-113--------------------------------------------------------------------------------
C5BX04_BEUC1/7-113--------------------------------------------------------------------------------
D3Q9W4_STANL/7-109--------------------------------------------------------------------------------
D1BDS4_SANKS/7-113--------------------------------------------------------------------------------
A0QFH8_MYCA1/7-109--------------------------------------------------------------------------------
C2Q8E8_BACCE/7-108--------------------------------------------------------------------------------
D1BYA3_XYLCX/7-112--------------------------------------------------------------------------------
B5HYY5_9ACTO/7-112--------------------------------------------------------------------------------
D1BVK9_XYLCX/7-113--------------------------------------------------------------------------------
A9B5S7_HERA2/7-113--------------------------------------------------------------------------------
D3Q6B3_STANL/7-112--------------------------------------------------------------------------------
C3BLY8_9BACI/20-124--------------------------------------------------------------------------------
C5C629_BEUC1/7-115--------------------------------------------------------------------------------
D3PWB3_STANL/7-114--------------------------------------------------------------------------------
B0AKY3_BACAN/4-107--------------------------------------------------------------------------------
D3EH52_GEOS4/7-112--------------------------------------------------------------------------------
A4F848_SACEN/7-108--------------------------------------------------------------------------------
C4RG94_9ACTO/7-114--------------------------------------------------------------------------------
A1SIQ7_NOCSJ/7-109--------------------------------------------------------------------------------
C6WJU0_ACTMD/7-113--------------------------------------------------------------------------------
B5I6V7_9ACTO/19-120--------------------------------------------------------------------------------
A8M6Z9_SALAI/7-108--------------------------------------------------------------------------------
C6VZE8_DYAFD/11-112--------------------------------------------------------------------------------
Q0SGE8_RHOSR/7-112--------------------------------------------------------------------------------
D5UX83_TSUPD/7-115--------------------------------------------------------------------------------
D3PZS4_STANL/7-112--------------------------------------------------------------------------------
D3PUC2_STANL/7-110--------------------------------------------------------------------------------
C9Z9S2_STRSW/7-108--------------------------------------------------------------------------------
A1TE84_MYCVP/11-113--------------------------------------------------------------------------------
D2AS43_STRRD/5-106--------------------------------------------------------------------------------
A4T6B5_MYCGI/6-108--------------------------------------------------------------------------------
D2PZ45_KRIFD/7-114--------------------------------------------------------------------------------
B1MM14_MYCA9/10-112--------------------------------------------------------------------------------
A6FZU9_9DELT/14-115--------------------------------------------------------------------------------
Q65HS4_BACLD/5-107--------------------------------------------------------------------------------
Q5YWI3_NOCFA/31-132--------------------------------------------------------------------------------
D3F1P3_CONWI/7-108--------------------------------------------------------------------------------
C7PZU5_CATAD/19-125--------------------------------------------------------------------------------
A8M8B0_SALAI/7-107--------------------------------------------------------------------------------
B5H4W5_STRPR/7-108--------------------------------------------------------------------------------
A1UGV4_MYCSK/7-109--------------------------------------------------------------------------------
Q11P05_CYTH3/10-110--------------------------------------------------------------------------------
D5UGI3_CELFN/7-114--------------------------------------------------------------------------------
Q89Y33_BRAJA/62-168--------------------------------------------------------------------------------
A6G4G5_9DELT/10-111--------------------------------------------------------------------------------
C0ZKK1_BREBN/2-104--------------------------------------------------------------------------------
B1MDG2_MYCA9/7-115--------------------------------------------------------------------------------
Q7UL85_RHOBA/23-124--------------------------------------------------------------------------------
C7PUE7_CHIPD/10-111--------------------------------------------------------------------------------
D3Q6A9_STANL/7-109--------------------------------------------------------------------------------
A3RXR1_RALSL/22-128--------------------------------------------------------------------------------
Q82R50_STRAW/28-129--------------------------------------------------------------------------------
D2QST6_SPILD/17-122--------------------------------------------------------------------------------
Q5YXM8_NOCFA/33-141--------------------------------------------------------------------------------
C7PKH0_CHIPD/17-121--------------------------------------------------------------------------------
B2JL65_BURP8/47-153--------------------------------------------------------------------------------
Q72UJ2_LEPIC/13-114--------------------------------------------------------------------------------
C0WI63_9CORY/7-112--------------------------------------------------------------------------------
Q1VX62_9FLAO/6-107--------------------------------------------------------------------------------
D2ASD1_STRRD/34-143--------------------------------------------------------------------------------
B0UIU5_METS4/14-111--------------------------------------------------------------------------------
D2PS28_KRIFD/35-136--------------------------------------------------------------------------------
A6G6P4_9DELT/10-116--------------------------------------------------------------------------------
C7PYY8_CATAD/7-121--------------------------------------------------------------------------------
A9GJR9_SORC5/11-117--------------------------------------------------------------------------------
B8IER0_METNO/21-116--------------------------------------------------------------------------------
Q1IKM4_KORVE/10-111--------------------------------------------------------------------------------
A4C0H3_9FLAO/6-106--------------------------------------------------------------------------------
A1ZLE1_9BACT/10-109--------------------------------------------------------------------------------
C0BG18_9BACT/6-105--------------------------------------------------------------------------------
A9FEJ3_SORC5/27-126--------------------------------------------------------------------------------
A8ULQ7_9FLAO/10-110--------------------------------------------------------------------------------
Q2S0Z3_SALRD/8-118--------------------------------------------------------------------------------
Q11S70_CYTH3/11-112--------------------------------------------------------------------------------
Q5Z2J9_NOCFA/19-120--------------------------------------------------------------------------------
C6X539_FLAB3/10-112--------------------------------------------------------------------------------
Q26DR8_FLABB/6-106--------------------------------------------------------------------------------
B8JHM2_ANAD2/39-140--------------------------------------------------------------------------------
B5HQQ2_9ACTO/55-152--------------------------------------------------------------------------------
A7H7U7_ANADF/31-130--------------------------------------------------------------------------------
B9R073_9RHOB/12-107--------------------------------------------------------------------------------
A5FBV8_FLAJ1/7-111--------------------------------------------------------------------------------
A1ZY83_9BACT/27-125--------------------------------------------------------------------------------
D7VTK5_9SPHI/10-113--------------------------------------------------------------------------------
D2QN87_SPILD/19-118--------------------------------------------------------------------------------
A9B014_HERA2/18-116--------------------------------------------------------------------------------
A8FU14_SHESH/7-110--------------------------------------------------------------------------------
Q1M3R5_RHIL3/9-110--------------------------------------------------------------------------------
D0XES9_VIBHA/3-111--------------------------------------------------------------------------------
B9XQC4_9BACT/28-127--------------------------------------------------------------------------------
B5WCL4_9BURK/11-109--------------------------------------------------------------------------------
C6B3P5_RHILS/11-110--------------------------------------------------------------------------------
Q1D110_MYXXD/7-102--------------------------------------------------------------------------------
B1FVW7_9BURK/9-106--------------------------------------------------------------------------------
C7PKI9_CHIPD/12-107--------------------------------------------------------------------------------
B9XR85_9BACT/12-110--------------------------------------------------------------------------------
A9F3Z6_SORC5/44-143--------------------------------------------------------------------------------
C9CTS5_9RHOB/7-110--------------------------------------------------------------------------------
A5ERI9_BRASB/6-107--------------------------------------------------------------------------------
D9QMH9_BRESC/33-140--------------------------------------------------------------------------------
B1KFL4_SHEWM/4-111--------------------------------------------------------------------------------
C0IN69_9BACT/7-105--------------------------------------------------------------------------------
Q0SJ69_RHOSR/31-130--------------------------------------------------------------------------------
A3XU47_9VIBR/12-120--------------------------------------------------------------------------------
Q1IPI6_KORVE/25-123--------------------------------------------------------------------------------
A9UV76_MONBE/637-749--------------------------------------------------------------------------------
B6AU47_9RHOB/5-108--------------------------------------------------------------------------------
B4RA61_PHEZH/23-122--------------------------------------------------------------------------------
A6EKC1_9SPHI/24-124--------------------------------------------------------------------------------
C5C5Y3_BEUC1/41-144--------------------------------------------------------------------------------
C0Z8W5_BREBN/15-114--------------------------------------------------------------------------------
B9JK89_AGRRK/29-136--------------------------------------------------------------------------------
B1MHX9_MYCA9/33-130--------------------------------------------------------------------------------
A5V4G4_SPHWW/11-106--------------------------------------------------------------------------------

PF07291

MAUE_METEA/3-186--------------------------------------------------------------------------------
MAUE_PARDE/2-185--------------------------------------------------------------------------------
MAUE_METFK/2-184--------------------------------------------------------------------------------
MAUE_METME/2-186--------------------------------------------------------------------------------
MAUE_PARVE/2-185--------------------------------------------------------------------------------

PF04224

Q9CJR3_PASMU/1-137--------------------------------------------------------------------------------
O25289_HELPY/5-190--------------------------------------------------------------------------------
YKGB_ECOLI/2-182--------------------------------------------------------------------------------
Q9KRP9_VIBCH/1-146--------------------------------------------------------------------------------
Y219_HAEIN/13-209--------------------------------------------------------------------------------
O87513_ECOLX/1-138--------------------------------------------------------------------------------

PF05514

Q6RJY8_CAPAN/1-138--------------------------------------------------------------------------------
O23298_ARATH/1-138--------------------------------------------------------------------------------
Q01MB3_ORYSA/1-138--------------------------------------------------------------------------------
Q9LTD0_ARATH/18-201--------------------------------------------------------------------------------
Q9LTD1_ARATH/1-132--------------------------------------------------------------------------------
Q0IXE1_ORYSJ/1-138--------------------------------------------------------------------------------
A2XCK0_ORYSI/1-138--------------------------------------------------------------------------------
O22690_ARATH/1-138--------------------------------------------------------------------------------
Q570L1_ARATH/18-198--------------------------------------------------------------------------------
P93384_TOBAC/1-138--------------------------------------------------------------------------------

PF13781

A0RCI0_BACAH/180-281--------------------------------------------------------------------------------
C3GZF4_BACTU/180-281--------------------------------------------------------------------------------
C2TVP5_BACCE/180-280--------------------------------------------------------------------------------
C3AK78_BACMY/185-286--------------------------------------------------------------------------------
D3E5H6_GEOS4/180-281--------------------------------------------------------------------------------
Q65IN6_BACLD/178-279--------------------------------------------------------------------------------
A6CEZ9_9PLAN/177-278--------------------------------------------------------------------------------
C6CYU2_PAESJ/180-281--------------------------------------------------------------------------------
Q8ESB3_OCEIH/179-280--------------------------------------------------------------------------------
B3EDV4_CHLL2/19-119--------------------------------------------------------------------------------
A4SEU6_PROVI/25-125--------------------------------------------------------------------------------
A1BFB6_CHLPD/25-125--------------------------------------------------------------------------------
B4SAW4_PELPB/19-119--------------------------------------------------------------------------------
B3EQZ0_CHLPB/20-120--------------------------------------------------------------------------------
B4S7F5_PROA2/21-121--------------------------------------------------------------------------------
Q3ARZ2_CHLCH/17-117--------------------------------------------------------------------------------
B3QTS0_CHLT3/26-127--------------------------------------------------------------------------------
B1KF78_SHEWM/12-113--------------------------------------------------------------------------------
A0Y6C6_9GAMM/17-118--------------------------------------------------------------------------------
B3QN36_CHLP8/20-117--------------------------------------------------------------------------------
B4X4D6_9GAMM/11-112--------------------------------------------------------------------------------
C0VHX3_9GAMM/20-120--------------------------------------------------------------------------------
D0BX48_9GAMM/15-115--------------------------------------------------------------------------------
D0SFQ9_ACIJO/15-115--------------------------------------------------------------------------------
Q1H1D1_METFK/335-436--------------------------------------------------------------------------------
D0SSK1_ACILW/19-120--------------------------------------------------------------------------------
C7R8T5_KANKD/19-119--------------------------------------------------------------------------------
B3RB23_CUPTR/328-429--------------------------------------------------------------------------------
Q2SM61_HAHCH/17-117--------------------------------------------------------------------------------
Q3SHK0_THIDA/314-415--------------------------------------------------------------------------------
B1KF79_SHEWM/15-115--------------------------------------------------------------------------------
C0DTU0_EIKCO/36-137--------------------------------------------------------------------------------
Q2Y734_NITMU/330-431--------------------------------------------------------------------------------
Q5X5Q5_LEGPA/322-423--------------------------------------------------------------------------------
Q5NY22_AROAE/320-421--------------------------------------------------------------------------------
B1Z1S6_BURA4/308-408--------------------------------------------------------------------------------
A7BY74_9GAMM/6-107--------------------------------------------------------------------------------
C4GMT5_9NEIS/12-113--------------------------------------------------------------------------------
C8NCY7_9GAMM/28-129--------------------------------------------------------------------------------
A1K6I8_AZOSB/336-437--------------------------------------------------------------------------------
A6DTJ9_9BACT/15-115--------------------------------------------------------------------------------
D4DP38_NEIEG/16-117--------------------------------------------------------------------------------
Q1LGK6_RALME/315-415--------------------------------------------------------------------------------
Q4UMY6_RICFE/322-422--------------------------------------------------------------------------------
C5TJR5_NEIFL/18-119--------------------------------------------------------------------------------
C1F939_ACIC5/18-120--------------------------------------------------------------------------------
Q7NW81_CHRVO/13-112--------------------------------------------------------------------------------
A8UH51_9FLAO/12-113--------------------------------------------------------------------------------
Q11TY1_CYTH3/19-119--------------------------------------------------------------------------------
C7PI03_CHIPD/14-115--------------------------------------------------------------------------------
C9YGF9_9BURK/7-107--------------------------------------------------------------------------------
A1VMB6_POLNA/12-112--------------------------------------------------------------------------------
Q0ANG5_MARMM/322-422--------------------------------------------------------------------------------
A9C3F1_DELAS/21-121--------------------------------------------------------------------------------
Q4K472_PSEF5/309-409--------------------------------------------------------------------------------
Q89WY4_BRAJA/329-429--------------------------------------------------------------------------------
Q2BMK1_9GAMM/316-416--------------------------------------------------------------------------------
A5E8R6_BRASB/331-431--------------------------------------------------------------------------------
C9CYE4_9RHOB/339-438--------------------------------------------------------------------------------
A3K709_9RHOB/331-430--------------------------------------------------------------------------------
Q1YK40_MOBAS/336-436--------------------------------------------------------------------------------
Q2K6I2_RHIEC/316-414--------------------------------------------------------------------------------
A1TNI5_ACIAC/22-122--------------------------------------------------------------------------------
B8H2E0_CAUCN/321-421--------------------------------------------------------------------------------
B6RA56_9RHOB/326-425--------------------------------------------------------------------------------
C4WL85_9RHIZ/327-426--------------------------------------------------------------------------------
B9JGJ5_AGRRK/322-420--------------------------------------------------------------------------------
A9EWZ0_9RHOB/307-406--------------------------------------------------------------------------------
B4WB77_9CAUL/325-424--------------------------------------------------------------------------------
A5V930_SPHWW/323-422--------------------------------------------------------------------------------
Q2JZG1_RHIEC/327-426--------------------------------------------------------------------------------
Q02U83_PSEAB/307-409--------------------------------------------------------------------------------
Q11CJ7_MESSB/321-420--------------------------------------------------------------------------------
A4F044_9RHOB/306-405--------------------------------------------------------------------------------
A7IKV9_XANP2/322-421--------------------------------------------------------------------------------
Q2S702_HAHCH/327-427--------------------------------------------------------------------------------

PF02077

SURF4_CAEEL/11-277--------------------------------------------------------------------------------
YFC7_CAEEL/4-269--------------------------------------------------------------------------------
ERV29_YEAST/48-310--------------------------------------------------------------------------------
SURF4_SCHPO/33-302--------------------------------------------------------------------------------
SURF4_DROME/5-270--------------------------------------------------------------------------------
SURF4_HUMAN/4-269--------------------------------------------------------------------------------

PF06762

Q2L6Y0_CAEEL/122-555FEDDRLPSFAL.....................................................................
LMF2_BOVIN/122-592.....SRRKR......................................................................
Q826A6_STRAW/121-468...GTPPDVP......................................................................
A0QMA7_MYCA1/121-478...SVLPGQG......................................................................
Q45WA6_TOXGO/205-777MAFVTNPATSAVWMVIAVFFLAIILSASSTFFTNTLVSNAFTELVLLIVTLWSCIAIYQHGPAVWSVWLTTCLFTVLIAF
LMF1_HUMAN/169-551LQMQR.DIRGA.....................................................................
Q4REY1_TETNG/125-682....RPISSES.....................................................................
A0QT94_MYCS2/77-431...SAAPDVG......................................................................
B9M9C6_GEOSF/118-470......PPFA......................................................................
A1R4Z7_ARTAT/124-480EWH.............................................................................
A0JUS2_ARTS2/124-488HTYGSTDSSG......................................................................
LMF1_MOUSE/169-553LEIQREDTQRV.....................................................................
A4FB78_SACEN/123-469................................................................................
Q6MNI0_BDEBA/151-510................................................................................
Q54K13_DICDI/157-572KRFKDSPNGRQKS..................................................................T
A7RJW9_NEMVE/81-464QEIQKAEKEH......................................................................
Q08T93_STIAD/249-611....LPRR........................................................................
Q1CX59_MYXXD/289-656....KDGP........................................................................
Q234A3_TETTS/136-636KPLKKETKSKD.....................................................................
Q4XRT1_PLACH/156-696DKIKNKHKSR......................................................................
A5K5K3_PLAVS/186-557....EIPVLH......................................................................
A0LRD9_ACIC1/123-473...RHAPASS......................................................................
LMF2_XENTR/122-590....KKPQHKG.....................................................................
A1TEH0_MYCVP/123-477...SAPPARA......................................................................
Q4Y900_PLACH/136-509....NVPDLY......................................................................

PF04173

Q97X72_SULSO/12-173--------------------------------------------------------------------------------
Q97XJ3_SULSO/18-183--------------------------------------------------------------------------------
Q973M6_SULTO/9-177--------------------------------------------------------------------------------
P97207_ACIAM/20-184--------------------------------------------------------------------------------
Q97UC4_SULSO/10-178--------------------------------------------------------------------------------
Q8NKT7_ACIAM/12-174--------------------------------------------------------------------------------
Q8AAF0_BACTN/18-181--------------------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94--------------------------------------------------------------------------------
Q87K55_VIBPA/16-104--------------------------------------------------------------------------------
Q8KEE1_CHLTE/7-88--------------------------------------------------------------------------------
Q9RTC4_DEIRA/8-92--------------------------------------------------------------------------------
Q7TUM8_PROMM/37-127--------------------------------------------------------------------------------
Q98K39_RHILO/14-90--------------------------------------------------------------------------------
Q7VHA8_HELHP/8-89--------------------------------------------------------------------------------
Q8GA66_ECOLX/8-90--------------------------------------------------------------------------------
Q89FZ6_BRAJA/10-92--------------------------------------------------------------------------------
Q8EDN3_SHEON/21-107--------------------------------------------------------------------------------
Q8KW46_9RHOB/66-148--------------------------------------------------------------------------------
Q8A9J9_BACTN/19-101--------------------------------------------------------------------------------
Q83BV7_COXBU/131-217--------------------------------------------------------------------------------
Q92W39_RHIME/11-107--------------------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105--------------------------------------------------------------------------------
Q89M65_BRAJA/31-107--------------------------------------------------------------------------------
Q8FX91_BRUSU/12-94--------------------------------------------------------------------------------
Q7V0B0_PROMP/15-102--------------------------------------------------------------------------------
Q82B81_STRAW/12-94--------------------------------------------------------------------------------
Q984Q4_RHILO/6-88--------------------------------------------------------------------------------
Q9A3E7_CAUCR/28-117--------------------------------------------------------------------------------
Q983U6_RHILO/19-101--------------------------------------------------------------------------------
Q82HN4_STRAW/24-126--------------------------------------------------------------------------------
Q7VUY8_BORPE/24-126--------------------------------------------------------------------------------
Q831Y6_ENTFA/7-87--------------------------------------------------------------------------------
Q983U8_RHILO/8-90--------------------------------------------------------------------------------
Q7V328_PROMP/44-134--------------------------------------------------------------------------------
Q9K461_STRCO/11-90--------------------------------------------------------------------------------
Q7MRA2_WOLSU/17-98--------------------------------------------------------------------------------
Q8F8N5_LEPIN/13-98--------------------------------------------------------------------------------
Q9HYW2_PSEAE/22-108--------------------------------------------------------------------------------
Q88P63_PSEPK/6-95--------------------------------------------------------------------------------
Q9HWH6_PSEAE/14-96--------------------------------------------------------------------------------
Q8FR06_COREF/10-94--------------------------------------------------------------------------------
Q9KYL5_STRCO/4-96--------------------------------------------------------------------------------
Q8NR01_CORGL/191-281--------------------------------------------------------------------------------
Q8XR31_RALSO/30-119--------------------------------------------------------------------------------
Q92SD1_RHIME/6-88--------------------------------------------------------------------------------
Q7NPD1_GLOVI/22-104--------------------------------------------------------------------------------
O53252_MYCTU/114-206--------------------------------------------------------------------------------
YPHA_SHIFL/16-98--------------------------------------------------------------------------------
Q7NZE1_CHRVO/10-92--------------------------------------------------------------------------------
Q8CZQ7_YERPE/13-94--------------------------------------------------------------------------------
Q7VDS1_PROMA/43-133--------------------------------------------------------------------------------
O86323_MYCTU/16-94--------------------------------------------------------------------------------
Q7N096_PHOLL/8-89--------------------------------------------------------------------------------
Q8XWH4_RALSO/12-94--------------------------------------------------------------------------------
Q7VYL1_BORPE/8-89--------------------------------------------------------------------------------
Q7US51_RHOBA/24-106--------------------------------------------------------------------------------
Q88G88_PSEPK/13-95--------------------------------------------------------------------------------
Q812S4_BACCR/6-87--------------------------------------------------------------------------------
Q88KH7_PSEPK/17-105--------------------------------------------------------------------------------
Q98JU3_RHILO/13-95--------------------------------------------------------------------------------
O05565_MYCLE/52-137--------------------------------------------------------------------------------
Q89MP6_BRAJA/4-104--------------------------------------------------------------------------------
Q8PGB0_XANAC/14-96--------------------------------------------------------------------------------
CATD_BACSU/8-88--------------------------------------------------------------------------------
Q8EC25_SHEON/16-104--------------------------------------------------------------------------------
Q7VTR5_BORPE/10-91--------------------------------------------------------------------------------
Q7UE97_RHOBA/16-98--------------------------------------------------------------------------------
Q7NA66_PHOLL/20-124--------------------------------------------------------------------------------
Q7VBT6_PROMA/9-93--------------------------------------------------------------------------------
O33110_MYCLE/114-202--------------------------------------------------------------------------------
Q9RC47_BACHO/8-89--------------------------------------------------------------------------------
Y886_HAEIN/11-90--------------------------------------------------------------------------------
Q8FSC2_COREF/11-95--------------------------------------------------------------------------------
Q98K48_RHILO/27-109--------------------------------------------------------------------------------
Q72VB3_LEPIC/18-104--------------------------------------------------------------------------------
Q7NSB1_CHRVO/12-100--------------------------------------------------------------------------------
Q9HZY2_PSEAE/16-104--------------------------------------------------------------------------------
Q88K91_PSEPK/19-105--------------------------------------------------------------------------------
Q7W6U9_BORPA/7-93--------------------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95--------------------------------------------------------------------------------
Q8Y2U2_RALSO/28-111--------------------------------------------------------------------------------
Q7X1H0_9BACT/12-99--------------------------------------------------------------------------------
A9CHZ6_AGRT5/16-92--------------------------------------------------------------------------------
Q99V56_STAAM/4-84--------------------------------------------------------------------------------
Q8FPX7_COREF/162-252--------------------------------------------------------------------------------
Q9CP47_PASMU/16-102--------------------------------------------------------------------------------
Q9HWS4_PSEAE/24-110--------------------------------------------------------------------------------
Q82PS9_STRAW/30-117--------------------------------------------------------------------------------
MHQP_BACSU/5-93--------------------------------------------------------------------------------
Q883U2_PSESM/16-104--------------------------------------------------------------------------------
Q92TK3_RHIME/11-93--------------------------------------------------------------------------------
Q7V7V3_PROMM/10-94--------------------------------------------------------------------------------
A9CK19_AGRT5/23-105--------------------------------------------------------------------------------
Q7U687_SYNPX/15-102--------------------------------------------------------------------------------
Q89EW4_BRAJA/19-101--------------------------------------------------------------------------------
Y1602_HAEIN/14-100--------------------------------------------------------------------------------
Q98JF9_RHILO/23-103--------------------------------------------------------------------------------
Q8YSN3_NOSS1/6-88--------------------------------------------------------------------------------
Q92Y87_RHIME/25-105--------------------------------------------------------------------------------
YQJF_ECOLI/8-88--------------------------------------------------------------------------------
Q812I5_BACCR/5-93--------------------------------------------------------------------------------
Q8NT59_CORGL/10-94--------------------------------------------------------------------------------
Q9KY40_STRCO/14-95--------------------------------------------------------------------------------
Q87KG0_VIBPA/27-115--------------------------------------------------------------------------------
Q8P8R3_XANCP/15-111--------------------------------------------------------------------------------
Q89SK7_BRAJA/66-148--------------------------------------------------------------------------------
Q82AZ6_STRAW/10-97--------------------------------------------------------------------------------
Q82V34_NITEU/11-94--------------------------------------------------------------------------------
Q82UE4_NITEU/22-102--------------------------------------------------------------------------------
Q8DDM4_VIBVU/23-111--------------------------------------------------------------------------------

PF13564

D1AAS7_THECD/7-112-------------------------------------..A..RRKEP---------------------------------
D2SF07_GEOOG/7-113-------------------------------------..A..RRKES---------------------------------
C5BX04_BEUC1/7-113-------------------------------------..L..RRGET---------------------------------
D3Q9W4_STANL/7-109-------------------------------------..V..RARVF---------------------------------
D1BDS4_SANKS/7-113-------------------------------------..L..RRGDD---------------------------------
A0QFH8_MYCA1/7-109-------------------------------------..L..RAGVL---------------------------------
C2Q8E8_BACCE/7-108-------------------------------------..M..RVKDP---------------------------------
D1BYA3_XYLCX/7-112-------------------------------------..T..RRGET---------------------------------
B5HYY5_9ACTO/7-112-------------------------------------..L..TGDDR---------------------------------
D1BVK9_XYLCX/7-113-------------------------------------..L..SRGEV---------------------------------
A9B5S7_HERA2/7-113-------------------------------------..A..RLKEY---------------------------------
D3Q6B3_STANL/7-112-------------------------------------..V..RRGEA---------------------------------
C3BLY8_9BACI/20-124-------------------------------------..A..FANDY---------------------------------
C5C629_BEUC1/7-115-------------------------------------..I..RRREY---------------------------------
D3PWB3_STANL/7-114-------------------------------------..T..RRQEV---------------------------------
B0AKY3_BACAN/4-107-------------------------------------..I.FRAKQS---------------------------------
D3EH52_GEOS4/7-112-------------------------------------..V..ARKEH---------------------------------
A4F848_SACEN/7-108-------------------------------------..M..RARCH---------------------------------
C4RG94_9ACTO/7-114-------------------------------------..A..RESAG---------------------------------
A1SIQ7_NOCSJ/7-109-------------------------------------..L..RVGDT---------------------------------
C6WJU0_ACTMD/7-113-------------------------------------..L..KEGDV---------------------------------
B5I6V7_9ACTO/19-120-------------------------------------..A..RAHWY---------------------------------
A8M6Z9_SALAI/7-108-------------------------------------..A..RVKDP---------------------------------
C6VZE8_DYAFD/11-112-------------------------------------..I..ALGDP---------------------------------
Q0SGE8_RHOSR/7-112-------------------------------------..V..RHGDY---------------------------------
D5UX83_TSUPD/7-115-------------------------------------..F..RRDEW---------------------------------
D3PZS4_STANL/7-112-------------------------------------..A..TLSEW---------------------------------
D3PUC2_STANL/7-110-------------------------------------..L..LARDR---------------------------------
C9Z9S2_STRSW/7-108-------------------------------------..L..RHGDP---------------------------------
A1TE84_MYCVP/11-113-------------------------------------..V..RTRVF---------------------------------
D2AS43_STRRD/5-106-------------------------------------..L..RARSY---------------------------------
A4T6B5_MYCGI/6-108-------------------------------------..G..RARVF---------------------------------
D2PZ45_KRIFD/7-114-------------------------------------..V..SLKEP---------------------------------
B1MM14_MYCA9/10-112-------------------------------------..I..RSNVL---------------------------------
A6FZU9_9DELT/14-115-------------------------------------..I..ANGDG---------------------------------
Q65HS4_BACLD/5-107-------------------------------------..L.VRARQP---------------------------------
Q5YWI3_NOCFA/31-132-------------------------------------..L..RARVF---------------------------------
D3F1P3_CONWI/7-108-------------------------------------..L..RAGDA---------------------------------
C7PZU5_CATAD/19-125-------------------------------------..F..KRGEW---------------------------------
A8M8B0_SALAI/7-107-------------------------------------..V..RAGNF---------------------------------
B5H4W5_STRPR/7-108-------------------------------------..A..CSGRW---------------------------------
A1UGV4_MYCSK/7-109-------------------------------------..R..RVNDP---------------------------------
Q11P05_CYTH3/10-110-------------------------------------..V..AIDDT---------------------------------
D5UGI3_CELFN/7-114-------------------------------------..L..RRRES---------------------------------
Q89Y33_BRAJA/62-168-------------------------------------..L..SRGET---------------------------------
A6G4G5_9DELT/10-111-------------------------------------..V..LAGEP---------------------------------
C0ZKK1_BREBN/2-104-------------------------------------..L.FRAKHK---------------------------------
B1MDG2_MYCA9/7-115-------------------------------------..V..RRNEG---------------------------------
Q7UL85_RHOBA/23-124-------------------------------------..L..FVKDA---------------------------------
C7PUE7_CHIPD/10-111-------------------------------------..A..ASGDP---------------------------------
D3Q6A9_STANL/7-109-------------------------------------..L..WAGID---------------------------------
A3RXR1_RALSL/22-128-------------------------------------..I..SRGEV---------------------------------
Q82R50_STRAW/28-129-------------------------------------..L..RQGDP---------------------------------
D2QST6_SPILD/17-122-------------------------------------..L..TRGEA---------------------------------
Q5YXM8_NOCFA/33-141-------------------------------------..V..RHDGW---------------------------------
C7PKH0_CHIPD/17-121-------------------------------------..I..SRGEA---------------------------------
B2JL65_BURP8/47-153-------------------------------------..F..SRGEA---------------------------------
Q72UJ2_LEPIC/13-114-------------------------------------..A..AAGME---------------------------------
C0WI63_9CORY/7-112-------------------------------------..I..KANFV---------------------------------
Q1VX62_9FLAO/6-107-------------------------------------..L..KIKDN---------------------------------
D2ASD1_STRRD/34-143-------------------------------------..I..MRSEY---------------------------------
B0UIU5_METS4/14-111-------------------------------------..L..RAGDP---------------------------------
D2PS28_KRIFD/35-136-------------------------------------..L..VNGDG---------------------------------
A6G6P4_9DELT/10-116-------------------------------------..M..AVGDF---------------------------------
C7PYY8_CATAD/7-121-------------------------------------CYL..LRRDV---------------------------------
A9GJR9_SORC5/11-117-------------------------------------..A..VVGAS---------------------------------
B8IER0_METNO/21-116-------------------------------------..L..LVLPT---------------------------------
Q1IKM4_KORVE/10-111-------------------------------------..A..VMGDG---------------------------------
A4C0H3_9FLAO/6-106-------------------------------------..L..KIKDN---------------------------------
A1ZLE1_9BACT/10-109-------------------------------------..V..AIADG---------------------------------
C0BG18_9BACT/6-105-------------------------------------..I..RIKDE---------------------------------
A9FEJ3_SORC5/27-126-------------------------------------..V..RVDNP---------------------------------
A8ULQ7_9FLAO/10-110-------------------------------------..Y..MIGDG---------------------------------
Q2S0Z3_SALRD/8-118-------------------------------------..T..ASGDP---------------------------------
Q11S70_CYTH3/11-112-------------------------------------..M..AHQEY---------------------------------
Q5Z2J9_NOCFA/19-120-------------------------------------..M..AAGDG---------------------------------
C6X539_FLAB3/10-112-------------------------------------..I..AVGDP---------------------------------
Q26DR8_FLABB/6-106-------------------------------------..L..KIKDS---------------------------------
B8JHM2_ANAD2/39-140-------------------------------------..F..LVGDR---------------------------------
B5HQQ2_9ACTO/55-152-------------------------------------..L..TYFDG---------------------------------
A7H7U7_ANADF/31-130-------------------------------------..V..RVGDP---------------------------------
B9R073_9RHOB/12-107-------------------------------------..L..FILGP---------------------------------
A5FBV8_FLAJ1/7-111-------------------------------------..F..AVDGI---------------------------------
A1ZY83_9BACT/27-125-------------------------------------..A..HVQDG---------------------------------
D7VTK5_9SPHI/10-113-------------------------------------..A..YVDQV---------------------------------
D2QN87_SPILD/19-118-------------------------------------..L..VVDGP---------------------------------
A9B014_HERA2/18-116-------------------------------------..V..RVGDP---------------------------------
A8FU14_SHESH/7-110-------------------------------------..L..RFDTW---------------------------------
Q1M3R5_RHIL3/9-110-------------------------------------..I..GVRKP---------------------------------
D0XES9_VIBHA/3-111-------------------------------------..F..RFDTW---------------------------------
B9XQC4_9BACT/28-127-------------------------------------..V..RVGNP---------------------------------
B5WCL4_9BURK/11-109-------------------------------------..L..RNREP---------------------------------
C6B3P5_RHILS/11-110-------------------------------------..L..FHGEY---------------------------------
Q1D110_MYXXD/7-102-------------------------------------..V..RLSEP---------------------------------
B1FVW7_9BURK/9-106-------------------------------------..T..VHGEY---------------------------------
C7PKI9_CHIPD/12-107-------------------------------------..L..QHQQD---------------------------------
B9XR85_9BACT/12-110-------------------------------------..F..NSGYP---------------------------------
A9F3Z6_SORC5/44-143-------------------------------------..V..RVGSP---------------------------------
C9CTS5_9RHOB/7-110-------------------------------------..L..YAGAE---------------------------------
A5ERI9_BRASB/6-107-------------------------------------..V..RIGSP---------------------------------
D9QMH9_BRESC/33-140-------------------------------------..A..IGLDL---------------------------------
B1KFL4_SHEWM/4-111-------------------------------------..F..KFDKW---------------------------------
C0IN69_9BACT/7-105-------------------------------------..L..RAGSP---------------------------------
Q0SJ69_RHOSR/31-130-------------------------------------..M..LTEQP---------------------------------
A3XU47_9VIBR/12-120-------------------------------------..L..RFDTW---------------------------------
Q1IPI6_KORVE/25-123-------------------------------------..L..RVHSV---------------------------------
A9UV76_MONBE/637-749-------------------------------------..L..LVEDP---------------------------------
B6AU47_9RHOB/5-108-------------------------------------..L..IWDTW---------------------------------
B4RA61_PHEZH/23-122-------------------------------------..L..LAGDP---------------------------------
A6EKC1_9SPHI/24-124-------------------------------------..V..AVDGF---------------------------------
C5C5Y3_BEUC1/41-144-------------------------------------..W..VNGDP---------------------------------
C0Z8W5_BREBN/15-114-------------------------------------..I..RVDAP---------------------------------
B9JK89_AGRRK/29-136-------------------------------------..LAVVHGDY---------------------------------
B1MHX9_MYCA9/33-130-------------------------------------..M..HEEAW---------------------------------
A5V4G4_SPHWW/11-106-------------------------------------..V..RSREH---------------------------------

PF07291

MAUE_METEA/3-186-------------------------------------VARGRTAIDC---------------------------------
MAUE_PARDE/2-185-------------------------------------VLRGRTQIDC---------------------------------
MAUE_METFK/2-184-------------------------------------VGRGRTHIDC---------------------------------
MAUE_METME/2-186-------------------------------------VGRGRTHIDC---------------------------------
MAUE_PARVE/2-185-------------------------------------VLRGRTQIDC---------------------------------

PF04224

Q9CJR3_PASMU/1-137-------------------------------------..........---------------------------------
O25289_HELPY/5-190-------------------------------------FTTPEVFVNQ---------------------------------
YKGB_ECOLI/2-182-------------------------------------ITTPEAWVPA---------------------------------
Q9KRP9_VIBCH/1-146-------------------------------------ITTPDTWKVS---------------------------------
Y219_HAEIN/13-209-------------------------------------ITTPEAWVPN---------------------------------
O87513_ECOLX/1-138-------------------------------------..........---------------------------------

PF05514

Q6RJY8_CAPAN/1-138-------------------------------------HDFYHYKFGE---------------------------------
O23298_ARATH/1-138-------------------------------------YDFYNYDVDR---------------------------------
Q01MB3_ORYSA/1-138-------------------------------------YDFYNYEMES---------------------------------
Q9LTD0_ARATH/18-201-------------------------------------HDFYNHRLDT---------------------------------
Q9LTD1_ARATH/1-132-------------------------------------..........---------------------------------
Q0IXE1_ORYSJ/1-138-------------------------------------HDFYNYDIES---------------------------------
A2XCK0_ORYSI/1-138-------------------------------------YDFYNYNMEK---------------------------------
O22690_ARATH/1-138-------------------------------------YDFYNYGPED---------------------------------
Q570L1_ARATH/18-198-------------------------------------YDFYNRDYDR---------------------------------
P93384_TOBAC/1-138-------------------------------------YDFYNYDVDK---------------------------------

PF13781

A0RCI0_BACAH/180-281-------------------------------------IVS----------------------------------------
C3GZF4_BACTU/180-281-------------------------------------IAS----------------------------------------
C2TVP5_BACCE/180-280-------------------------------------IAS----------------------------------------
C3AK78_BACMY/185-286-------------------------------------ILS----------------------------------------
D3E5H6_GEOS4/180-281-------------------------------------AEL----------------------------------------
Q65IN6_BACLD/178-279-------------------------------------IAS----------------------------------------
A6CEZ9_9PLAN/177-278-------------------------------------PQY----------------------------------------
C6CYU2_PAESJ/180-281-------------------------------------PSL----------------------------------------
Q8ESB3_OCEIH/179-280-------------------------------------VTT----------------------------------------
B3EDV4_CHLL2/19-119-------------------------------------PVL----------------------------------------
A4SEU6_PROVI/25-125-------------------------------------PAM----------------------------------------
A1BFB6_CHLPD/25-125-------------------------------------PEL----------------------------------------
B4SAW4_PELPB/19-119-------------------------------------PEL----------------------------------------
B3EQZ0_CHLPB/20-120-------------------------------------PEL----------------------------------------
B4S7F5_PROA2/21-121-------------------------------------ADL----------------------------------------
Q3ARZ2_CHLCH/17-117-------------------------------------PTM----------------------------------------
B3QTS0_CHLT3/26-127-------------------------------------PAY----------------------------------------
B1KF78_SHEWM/12-113-------------------------------------PHL----------------------------------------
A0Y6C6_9GAMM/17-118-------------------------------------PNL----------------------------------------
B3QN36_CHLP8/20-117-------------------------------------PHL----------------------------------------
B4X4D6_9GAMM/11-112-------------------------------------PAF----------------------------------------
C0VHX3_9GAMM/20-120-------------------------------------PNK----------------------------------------
D0BX48_9GAMM/15-115-------------------------------------PST----------------------------------------
D0SFQ9_ACIJO/15-115-------------------------------------PDS----------------------------------------
Q1H1D1_METFK/335-436-------------------------------------PAF----------------------------------------
D0SSK1_ACILW/19-120-------------------------------------PLQ----------------------------------------
C7R8T5_KANKD/19-119-------------------------------------PSY----------------------------------------
B3RB23_CUPTR/328-429-------------------------------------PEY----------------------------------------
Q2SM61_HAHCH/17-117-------------------------------------PGL----------------------------------------
Q3SHK0_THIDA/314-415-------------------------------------PEF----------------------------------------
B1KF79_SHEWM/15-115-------------------------------------IGF----------------------------------------
C0DTU0_EIKCO/36-137-------------------------------------PEM----------------------------------------
Q2Y734_NITMU/330-431-------------------------------------PEF----------------------------------------
Q5X5Q5_LEGPA/322-423-------------------------------------PYL----------------------------------------
Q5NY22_AROAE/320-421-------------------------------------PEF----------------------------------------
B1Z1S6_BURA4/308-408-------------------------------------PSL----------------------------------------
A7BY74_9GAMM/6-107-------------------------------------PAF----------------------------------------
C4GMT5_9NEIS/12-113-------------------------------------PEM----------------------------------------
C8NCY7_9GAMM/28-129-------------------------------------PQA----------------------------------------
A1K6I8_AZOSB/336-437-------------------------------------PEF----------------------------------------
A6DTJ9_9BACT/15-115-------------------------------------PQL----------------------------------------
D4DP38_NEIEG/16-117-------------------------------------PQM----------------------------------------
Q1LGK6_RALME/315-415-------------------------------------PQF----------------------------------------
Q4UMY6_RICFE/322-422-------------------------------------PIL----------------------------------------
C5TJR5_NEIFL/18-119-------------------------------------PEM----------------------------------------
C1F939_ACIC5/18-120-------------------------------------RHL----------------------------------------
Q7NW81_CHRVO/13-112-------------------------------------PEN----------------------------------------
A8UH51_9FLAO/12-113-------------------------------------DIL----------------------------------------
Q11TY1_CYTH3/19-119-------------------------------------DLL----------------------------------------
C7PI03_CHIPD/14-115-------------------------------------DLL----------------------------------------
C9YGF9_9BURK/7-107-------------------------------------PAL----------------------------------------
A1VMB6_POLNA/12-112-------------------------------------PGL----------------------------------------
Q0ANG5_MARMM/322-422-------------------------------------PGL----------------------------------------
A9C3F1_DELAS/21-121-------------------------------------PTL----------------------------------------
Q4K472_PSEF5/309-409-------------------------------------PHF----------------------------------------
Q89WY4_BRAJA/329-429-------------------------------------PDL----------------------------------------
Q2BMK1_9GAMM/316-416-------------------------------------PEL----------------------------------------
A5E8R6_BRASB/331-431-------------------------------------PDL----------------------------------------
C9CYE4_9RHOB/339-438-------------------------------------PDL----------------------------------------
A3K709_9RHOB/331-430-------------------------------------PGM----------------------------------------
Q1YK40_MOBAS/336-436-------------------------------------PDM----------------------------------------
Q2K6I2_RHIEC/316-414-------------------------------------PAL----------------------------------------
A1TNI5_ACIAC/22-122-------------------------------------PGL----------------------------------------
B8H2E0_CAUCN/321-421-------------------------------------PDL----------------------------------------
B6RA56_9RHOB/326-425-------------------------------------TDL----------------------------------------
C4WL85_9RHIZ/327-426-------------------------------------PDL----------------------------------------
B9JGJ5_AGRRK/322-420-------------------------------------PSL----------------------------------------
A9EWZ0_9RHOB/307-406-------------------------------------PGL----------------------------------------
B4WB77_9CAUL/325-424-------------------------------------PHY----------------------------------------
A5V930_SPHWW/323-422-------------------------------------PDF----------------------------------------
Q2JZG1_RHIEC/327-426-------------------------------------PEL----------------------------------------
Q02U83_PSEAB/307-409-------------------------------------PHY----------------------------------------
Q11CJ7_MESSB/321-420-------------------------------------PSL----------------------------------------
A4F044_9RHOB/306-405-------------------------------------PDL----------------------------------------
A7IKV9_XANP2/322-421-------------------------------------PRL----------------------------------------
Q2S702_HAHCH/327-427-------------------------------------PAL----------------------------------------

PF02077

SURF4_CAEEL/11-277-------------------------------------E...MSFMQV---------------------------------
YFC7_CAEEL/4-269-------------------------------------D...MSYTRI---------------------------------
ERV29_YEAST/48-310-------------------------------------K....SWFTV---------------------------------
SURF4_SCHPO/33-302-------------------------------------EGSGISWTRI---------------------------------
SURF4_DROME/5-270-------------------------------------E...LSVWQV---------------------------------
SURF4_HUMAN/4-269-------------------------------------D...ASFFSI---------------------------------

PF06762

Q2L6Y0_CAEEL/122-555.TLTHESFRKFMIYYIDVIVATMAIIFTI........VNCYSMLKVG......SSQNGRMKKWVHLAFVLCSVLFLGVYG
LMF2_BOVIN/122-592...MPSSWPKALLAMLTLLLELAVYGLLA........CGVVHYFGLE......VDWE.......QHVVRSRTMFTFHQLS
Q826A6_STRAW/121-468....GA...PLWYEIVVLAVAAGLVGLSY........RPARNMLSRR......QV.........................
A0QMA7_MYCA1/121-478....EPSASPLWFVVVVVAVTAAVLVMSY........WPIRNMLSSR......QR.........................
Q45WA6_TOXGO/205-777AYTTLTNAALIFKIHVEVLIFLLIAALSV........PVVANLISPD......QV.........................
LMF1_HUMAN/169-551.RPEPR.FGSVVRRAANVSLGVLLAWLSV........PVVLNLLSSR......QV.........................
Q4REY1_TETNG/125-682..G.SASWP.....WLCYLLELAVWSLLI........AGTIVCFGVK......LDPDKMT.LGFRTEFTYHQFAQFMKTV
A0QT94_MYCS2/77-431....DP...PVWYVAAVVAFTAMVVSLSF........WPLRNLVTKR......QR.........................
B9M9C6_GEOSF/118-470....PP...PPLFDAACWGVAILVAIRSI........QPMLNMISPA......QI.........................
A1R4Z7_ARTAT/124-480....QSTETPVWWLAVVVLVTVLLLVFSY........QPLLNLFSSR......QL.........................
A0JUS2_ARTS2/124-488....AGAQTPVWWLAVVLAVTVLLLVLSY........WPARNLLQHR......QL.........................
LMF1_MOUSE/169-553.QPKPRDRGCLVRQVVNISLGILVAWLSV........PVVINLLSSR......QI.........................
A4FB78_SACEN/123-469....PDSPAPVWWLALVLVLTATMVALSY........WPVRNMLGRR......QV.........................
Q6MNI0_BDEBA/151-510...INWVEATTLPTPVMLIPALILVPSSL........FWILKTLSENSTKLNFML.........................
Q54K13_DICDI/157-572RGLESGLSSLNPKNLLVPFVFILIGTSSL........VNVTQYFQKQTTPSLIQR.........................
A7RJW9_NEMVE/81-464..PSKPTWGLCVRRTFEIMLGLVLAYLSI........PVVQNLLSTR......QA.........................
Q08T93_STIAD/249-611....PAPSPALGNSLVKGALALPVFALGV........SELLARFTPF......QR.AP.....EVLER............
Q1CX59_MYXXD/289-656....PAQPRPWWRTGVSALVVSPLLVLGA........SEVLRRFEGW......QRYRPER.VGAMLTW............
Q234A3_TETTS/136-636..LKNDPYSPLMKKLKLLICILIFIAMVI........YAYLTYFPLE......AIFEN.....GKVDFTLADIRVNLVNG
Q4XRT1_PLACH/156-696.............RYFKSFDIFYFMGMNE........DEVYNMYDSYFNIDYINSQNGLTTNHKNHTEDSDDDKDEKESG
A5K5K3_PLAVS/186-557...ENGAPPNTVTFLLVGCVNLVILLFY..........ALIVLINLVP...FVEQWNVDDLKCFHLCY............
A0LRD9_ACIC1/123-473....LG...PVWWVGVVCAFTALVVVLSY........WPTRNLVSRH......QL.........................
LMF2_XENTR/122-590.GRVTSAFS...LYSLISLLDVPIFGLLV........FWTVKYFDLQ......INWEKHS.VESRTAFTYHDFQQWLRTI
A1TEH0_MYCVP/123-477....GP...PPWFAALVIAGTALTVVLSY........WPVRNMLGRR......QQ.........................
Q4Y900_PLACH/136-509...KNNGLVNLSIYLIVCLINIIISLFYLVIQIIHRDTVLIMLYNIFYNFFICRKWDILDFQPFRNAY............

PF04173

Q97X72_SULSO/12-173--------------------------------------------------------------------------------
Q97XJ3_SULSO/18-183--------------------------------------------------------------------------------
Q973M6_SULTO/9-177--------------------------------------------------------------------------------
P97207_ACIAM/20-184--------------------------------------------------------------------------------
Q97UC4_SULSO/10-178--------------------------------------------------------------------------------
Q8NKT7_ACIAM/12-174--------------------------------------------------------------------------------
Q8AAF0_BACTN/18-181--------------------------------------------------------------------------------

PF07681

Q83CN9_COXBU/12-94--------------------------------------------------------------------------------
Q87K55_VIBPA/16-104--------------------------------------------------------------------------------
Q8KEE1_CHLTE/7-88--------------------------------------------------------------------------------
Q9RTC4_DEIRA/8-92--------------------------------------------------------------------------------
Q7TUM8_PROMM/37-127--------------------------------------------------------------------------------
Q98K39_RHILO/14-90--------------------------------------------------------------------------------
Q7VHA8_HELHP/8-89--------------------------------------------------------------------------------
Q8GA66_ECOLX/8-90--------------------------------------------------------------------------------
Q89FZ6_BRAJA/10-92--------------------------------------------------------------------------------
Q8EDN3_SHEON/21-107--------------------------------------------------------------------------------
Q8KW46_9RHOB/66-148--------------------------------------------------------------------------------
Q8A9J9_BACTN/19-101--------------------------------------------------------------------------------
Q83BV7_COXBU/131-217--------------------------------------------------------------------------------
Q92W39_RHIME/11-107--------------------------------------------------------------------------------
Q8U4Y0_AGRT5/25-105--------------------------------------------------------------------------------
Q89M65_BRAJA/31-107--------------------------------------------------------------------------------
Q8FX91_BRUSU/12-94--------------------------------------------------------------------------------
Q7V0B0_PROMP/15-102--------------------------------------------------------------------------------
Q82B81_STRAW/12-94--------------------------------------------------------------------------------
Q984Q4_RHILO/6-88--------------------------------------------------------------------------------
Q9A3E7_CAUCR/28-117--------------------------------------------------------------------------------
Q983U6_RHILO/19-101--------------------------------------------------------------------------------
Q82HN4_STRAW/24-126--------------------------------------------------------------------------------
Q7VUY8_BORPE/24-126--------------------------------------------------------------------------------
Q831Y6_ENTFA/7-87--------------------------------------------------------------------------------
Q983U8_RHILO/8-90--------------------------------------------------------------------------------
Q7V328_PROMP/44-134--------------------------------------------------------------------------------
Q9K461_STRCO/11-90--------------------------------------------------------------------------------
Q7MRA2_WOLSU/17-98--------------------------------------------------------------------------------
Q8F8N5_LEPIN/13-98--------------------------------------------------------------------------------
Q9HYW2_PSEAE/22-108--------------------------------------------------------------------------------
Q88P63_PSEPK/6-95--------------------------------------------------------------------------------
Q9HWH6_PSEAE/14-96--------------------------------------------------------------------------------
Q8FR06_COREF/10-94--------------------------------------------------------------------------------
Q9KYL5_STRCO/4-96--------------------------------------------------------------------------------
Q8NR01_CORGL/191-281--------------------------------------------------------------------------------
Q8XR31_RALSO/30-119--------------------------------------------------------------------------------
Q92SD1_RHIME/6-88--------------------------------------------------------------------------------
Q7NPD1_GLOVI/22-104--------------------------------------------------------------------------------
O53252_MYCTU/114-206--------------------------------------------------------------------------------
YPHA_SHIFL/16-98--------------------------------------------------------------------------------
Q7NZE1_CHRVO/10-92--------------------------------------------------------------------------------
Q8CZQ7_YERPE/13-94--------------------------------------------------------------------------------
Q7VDS1_PROMA/43-133--------------------------------------------------------------------------------
O86323_MYCTU/16-94--------------------------------------------------------------------------------
Q7N096_PHOLL/8-89--------------------------------------------------------------------------------
Q8XWH4_RALSO/12-94--------------------------------------------------------------------------------
Q7VYL1_BORPE/8-89--------------------------------------------------------------------------------
Q7US51_RHOBA/24-106--------------------------------------------------------------------------------
Q88G88_PSEPK/13-95--------------------------------------------------------------------------------
Q812S4_BACCR/6-87--------------------------------------------------------------------------------
Q88KH7_PSEPK/17-105--------------------------------------------------------------------------------
Q98JU3_RHILO/13-95--------------------------------------------------------------------------------
O05565_MYCLE/52-137--------------------------------------------------------------------------------
Q89MP6_BRAJA/4-104--------------------------------------------------------------------------------
Q8PGB0_XANAC/14-96--------------------------------------------------------------------------------
CATD_BACSU/8-88--------------------------------------------------------------------------------
Q8EC25_SHEON/16-104--------------------------------------------------------------------------------
Q7VTR5_BORPE/10-91--------------------------------------------------------------------------------
Q7UE97_RHOBA/16-98--------------------------------------------------------------------------------
Q7NA66_PHOLL/20-124--------------------------------------------------------------------------------
Q7VBT6_PROMA/9-93--------------------------------------------------------------------------------
O33110_MYCLE/114-202--------------------------------------------------------------------------------
Q9RC47_BACHO/8-89--------------------------------------------------------------------------------
Y886_HAEIN/11-90--------------------------------------------------------------------------------
Q8FSC2_COREF/11-95--------------------------------------------------------------------------------
Q98K48_RHILO/27-109--------------------------------------------------------------------------------
Q72VB3_LEPIC/18-104--------------------------------------------------------------------------------
Q7NSB1_CHRVO/12-100--------------------------------------------------------------------------------
Q9HZY2_PSEAE/16-104--------------------------------------------------------------------------------
Q88K91_PSEPK/19-105--------------------------------------------------------------------------------
Q7W6U9_BORPA/7-93--------------------------------------------------------------------------------
Q8EZJ9_LEPIN/12-95--------------------------------------------------------------------------------
Q8Y2U2_RALSO/28-111--------------------------------------------------------------------------------
Q7X1H0_9BACT/12-99--------------------------------------------------------------------------------
A9CHZ6_AGRT5/16-92--------------------------------------------------------------------------------
Q99V56_STAAM/4-84--------------------------------------------------------------------------------
Q8FPX7_COREF/162-252--------------------------------------------------------------------------------
Q9CP47_PASMU/16-102--------------------------------------------------------------------------------
Q9HWS4_PSEAE/24-110--------------------------------------------------------------------------------
Q82PS9_STRAW/30-117--------------------------------------------------------------------------------
MHQP_BACSU/5-93-------------------