Sequence alignment for CL0132

PF04014

Q7D0B2_AGRT5/8-53RRQGGA------------------------------------------AVMTIPPALLKML.....GLEI...GEQLTLE
Q9YA54_AERPE/13-59LTGRST------------------------------------------YIVSLPKEWVETW.....RLGR...GSEVTLE
S7C4_SULSO/7-54VKVSRN------------------------------------------YQVTIPAKVRQKF.....QIKE...GDLVKVT
Q9YEV8_AERPE/13-58KLGSSS------------------------------------------LVVTLPKEWVREM.....GLKQ...GDPVYVV
Q5KXG5_GEOKA/5-52SKLSSR------------------------------------------GQVVIPAEIRKTL.....GLAE...GDDLTFI
O30311_ARCFU/3-50VKVTRN------------------------------------------FQITIPAEVRRKM.....GLKL...GDVLEVE
Q92MD9_RHIME/7-57FISNRS------------------------------------------QAVRLPKAVAFPEGVHQVDILK..IGRSRVIV
Q8J2X2_PYRAB/14-57KRIDSQ------------------------------------------GRIVLPKEWR.........KKW...GSEVILI
Q739R3_BACC1/8-52RKVDEL------------------------------------------GRIVIPKELRDVL.....GIQI...KSPLEIF
Q974B2_SULTO/3-50VKVTRN------------------------------------------FQITIPAEVREKL.....NIRE...GEYVDVT
Q6D9N2_ERWCT/16-61RKQGRA------------------------------------------IIVTIPKEIALAM.....NWKE...GEDVVLV
Q8ZW18_PYRAE/8-53RVGERS------------------------------------------FGITLPKEWVELH.....GLGV...GSPVKII
Q6L2A8_PICTO/6-51MSVGPN------------------------------------------GQVVIPVTLRKAL.....KITP...GSKVIFK
Q8G1Z3_BRUSU/6-53RKIGNS------------------------------------------YGVIIPKEVLERL.....NLQT...GDTLTLT
Q9HRB9_HALSA/8-53QLGPST------------------------------------------LAMTLPAEWARSQ.....DVVK...GDEVTV.
Q5KYV6_GEOKA/65-112SQVGNS------------------------------------------LSVSIPKDLATML.....NLNK...GDEIEIY
Q607Y0_METCA/7-60FKSGNS------------------------------------------LAIRIPKELAIAEVAQQVEIER..VGNTLVIR
Q9HS09_HALSA/8-53VTGGST------------------------------------------FTVSIPKDWARDH.....SVEA...GDEVGFH
Q97XQ3_SULSO/4-49VKVTRN------------------------------------------YQITIPYEIRQKL.....GIKI...GDKLIVT
Q82UU8_NITEU/4-50SKWGNS------------------------------------------LAVRLPASVVEIL.....DLKE...GDSIEIH
Q67JB5_SYMTH/12-57RKVDEL------------------------------------------GRVVIPIELRRTL.....NIEE...KDSLEIY
Q9A9W9_CAUCR/106-151LSVGAN------------------------------------------GSVVLPPEVLKAL.....GARP...GGLIIAD
Q5V6R8_HALMA/37-83QLGSST------------------------------------------LAVTVPVDWARQH.....DISK...GDEVIVQ
Q81DC4_BACCR/8-52RKADSM------------------------------------------GRIVIPMEIRRSL.....GIVE...KDSLEMF
Q64CM2_9ARCH/7-50TKLSSK------------------------------------------GQIVIPSEMRD.......DFSE...GEKLVII
O29778_ARCFU/8-53LVGGSS------------------------------------------YAISLPKEWISKH.....NLKQ...GDEVVLR
O73992_PYRHO/4-49TKVTRN------------------------------------------YRITIPAEIRKAL.....GIKE...GELLEVK
Q6N3T6_RHOPA/3-50TTITSK------------------------------------------GQVTLPKKVRDAA.....GIKP...GDKVEVR
Q63HH9_BACCZ/8-54RRIDDL------------------------------------------GRVVIPKEIRRTL.....RIRE...GDPLEIF
Q6L1K1_PICTO/8-53LTGGST------------------------------------------YIVSLPSKWIKKN.....NLGK...GDEVFID
Q82XX4_NITEU/4-49AILSQD------------------------------------------GRVVIPKKFRNKL.....EIKE...GDEVIWK
Q74HQ7_LACJO/11-53QKVGNS------------------------------------------VGFSLPASFK.........VEV...GTEYAIH
Q8J2W0_PYRAB/9-54LKVGPK------------------------------------------GQIVIPKVFREAY.....GIKE...GGEVVLE
Q724P1_LISMF/8-52RKIDEL------------------------------------------GRVVIPIEIRRTM.....NLNV...KDPLEIF
O29464_ARCFU/8-53LIGGSS------------------------------------------YMVSLPKNWVKEN.....QLRQ...GDDIYLQ
Q970R6_SULTO/4-49LKVHKK------------------------------------------GIIVIPKEVRDKL.....NIKE...GDEVNVI
Q6LNS7_PHOPR/6-51RKIGNS------------------------------------------LGSIIPATFIRQL.....ELAE...GAEIDVK
Q6D0W2_ERWCT/7-56FKNGNN------------------------------------------RAIRLPRDMDFEGVNELEIVRE...GDTIMLR
Q9UX12_SULSF/11-57LTGGST------------------------------------------YIVSLPKEWIKAL.....SLSA...GDEVEIY
Q98K21_RHILO/18-67FRNNRS------------------------------------------QAVRIPVEFELPGD..KVLISR..EGDRLVIE
Q8RAW9_THETN/4-50AKVTTR------------------------------------------GQITIPKEIRKKL.....NLKE...GDKVVFI
Q98F73_RHILO/1-47MRVTTK------------------------------------------GQVTIPKPIRDHL.....GIGP...GSEVEFV
Q82X03_NITEU/18-67FRNGKN------------------------------------------QAVRIPREFELNAQ..EVIMRR..EGNRLIIE
Q7X3Y2_PEDAC/38-83AKWGNS------------------------------------------KAARIPSQIIKQL.....KLDD..NQDMTITI
Q9RX99_DEIRA/6-51QKWGNS------------------------------------------LALRIPKALAQQV.....GLTQ...SSEVELL
Q6MR51_BDEBA/45-92SKASRK------------------------------------------NQTTIPARVRQAL.....GIAK...GDTLLWT
Q5NZI0_AROAE/7-57FTNNRS------------------------------------------QAVRLPADMRLPANVKQVDIRA..RGLERIIA
O58917_PYRHO/66-115VRLSSK------------------------------------------GLITIPEEVRREL.....GISP...GDTVEVL
Q8PRN0_XANAC/7-52RKVGGS------------------------------------------IMLAVPPAILDML.....RLRA...GATVGLA
Q74AB7_GEOSL/7-55FQNGQS------------------------------------------QAVRLPKEFRFEDS..EVFIKK..SGNVVQLI
Q977A6_SULTO/12-58VTVDER------------------------------------------GRVIIPKQIREKL.....NLKE...GSKVEVD
Q706P9_PSEPU/31-76ATLTSK------------------------------------------GQITLPKPIRQAL.....GVDA...GGKLAFD
Q5KZF4_GEOKA/17-61QKWGNS------------------------------------------LAVRIPSVIAERL.....ALHQ...GSEVEMI
Q8XUX7_RALSO/4-50SKWGNS------------------------------------------LAIRLPAAVVEAL.....QLHE...GDDVEVV
VPB27_MYCTU/3-48AVVDAA------------------------------------------GRIVVPKPLREAL.....GLQP...GSTVEIS
Q97CB8_THEVO/10-55ITGGST------------------------------------------FIVSLPPEWVKRN.....GITK...GSEISIS
Q7WWW2_CUPNH/10-55QKWGNS------------------------------------------LAVRIPTAVARSA.....HFAE...GQEVEVS
VAPB2_HAEIN/7-57FMTNRS------------------------------------------QAVRLPAEVRFSEEIKKLSVRV..SGSDRILS
Q5V0F9_HALMA/8-53VTGGST------------------------------------------YTVSLPKEWATEN.....DVSA...GSVVEFH
Q96Z33_SULTO/5-50IRIGKR------------------------------------------NAIYIPKEIADSL.....NLKE...GDRLVLV
Q9HLW4_THEAC/10-55VTGGST------------------------------------------YIISLPPEWIKRN.....NIGK...GSEVSVI
Q7PBV9_RICSI/6-52RVVISS------------------------------------------KQVVIPKYIRNKL.....GLHS...GSELIIN
Q97A15_THEVO/10-55KIKGGS------------------------------------------YIVSLPSDWVREN.....GLDV...SREVEVF
Q8PN78_XANAC/6-51TAIGNS------------------------------------------AGVILPKELLARL.....RLGK...GDELYAL
Q970W8_SULTO/11-57LTGGST------------------------------------------YIISLPKTWVKQY.....LLQP...GDEIEIF
Q97TK9_CLOAB/14-61VKVGEK------------------------------------------GQIVIPKGARDLF.....DIKP...GDMLLLL
Q65EP9_BACLD/8-52RRIDEL------------------------------------------GRVVLPVEMRRVL.....NINE...KDPLEIY
O28477_ARCFU/9-54FSGKSS------------------------------------------YILTLPKRWAMEN.....GIEP...GSEVVLS
Q96YI0_SULTO/6-51VKVYKK------------------------------------------GIIVIPKEIREKI.....GIKE...GDILELT
Q8P9K2_XANCP/3-48ATVAER------------------------------------------GQITLPKAVRDAL.....GLTK...GTTLKVE
Q82UW7_NITEU/4-51ATLTSK------------------------------------------GQITIPAAVRAGL.....GIDV...GDRVEFI
Q88PS8_PSEPK/6-51QQWGNS------------------------------------------AAIRLPAAVLKQM.....RLGV...GSTLSLD
VPB40_MYCTU/3-48TTIDVA------------------------------------------GRLVIPKRIRERL.....GLRG...NDQVEIT
Q7U8Z5_SYNPX/4-51SVVSAK------------------------------------------EQVTIPKAVLEAL.....GLKA...GDLVSLE
VAPB1_HAEIN/6-58FQSGNS------------------------------------------QAVRIPMDFRFDVDTVEIFRKE...NGDVVLR
Q9AC34_CAUCR/9-61FRSGNS------------------------------------------EAVRLPRDLAFGADVELTLIRS...GDVLTIY
Q8ZVL8_PYRAE/10-56LTGGAT------------------------------------------LIVSLPKEWAKRI.....ALAP...GDEVIVV
Q5V389_HALMA/17-62AKVDSK------------------------------------------GRIVLPQEVREKL.....GISP...GTEVEIH
Q8F5A4_LEPIN/6-51QKWGNS------------------------------------------LGIRIPKAMATEL.....ELND...GSHVELQ
Q6N8B1_RHOPA/9-59FTTGRS------------------------------------------QAVRLPAEFRFEGS..EVFVRRDPRTGDVILS
Q87FP5_VIBPA/6-53VKIGDD------------------------------------------TAVVIPSAILAQL.....GIRE...GDTLEIA
Q9Z384_AGGAC/8-60FRNGRN------------------------------------------QAVRLPVEFEFDAE..QVYIRKEQNGDIVLSL
MAZE_ECOLI/7-52KRWGNS------------------------------------------PAVRIPATLMQAL.....NLNI...DDEVKID
Q8YRI0_NOSS1/4-49TKISNE------------------------------------------GQVILPEELLKAS.....GWEI...GQELIAI
O28268_ARCFU/5-50RTVGKK------------------------------------------GQVTIPKEIREKF.....GLKE...GEKVVFE
Q89E65_BRAJA/66-111TTVSSK------------------------------------------GQVVLPKAIREEH.....RWRA...GTRLTIE
Q8ZZ12_PYRAE/6-51VRVGKR------------------------------------------RTLVIPKLVAERL.....GIDE...GSVIELE
Q7ND94_GLOVI/10-59FRNGRN------------------------------------------QALRIPREFELPGD..EAIIRK..EGDRLIVE
Q97VK4_SULSO/11-56KIKGGS------------------------------------------YIITLPPEWVRRN.....NLDA...KSEVFVI
Q7N820_PHOLL/4-50AKWGNS------------------------------------------LAIRLPASLVEIL.....ELRE...GDDIEIV
Q97UV7_SULSO/7-50KKVDDQ------------------------------------------RRIVIPKEWRA.......GFDT....EDLIMV
Q82VT9_NITEU/6-52RKAGGS------------------------------------------LVMTVPKSFIEQN.....GLSE...GSQVELH
Q5NXJ8_AROAE/7-56FRSGNS------------------------------------------QAVRLPKEFRLDTD..RVEIFR..RGDEIVLR
O57970_PYRHO/8-54FTGRSS------------------------------------------YIVSLPKKWVKEQ.....GLKQ...GDIISMV
Q97D32_CLOAB/8-55RKVDEL------------------------------------------GRIVIPKETRSQL.....NVNE...GDSLEIF
Q8TLD2_METAC/10-56FTGNST------------------------------------------YIVSLPIKWVRDI.....GLKP...GDTLNLT
Q5V7R4_HALMA/9-55TTVNES------------------------------------------YSVTVPAAVRREA.....GVEA...GDKIRWH
Q9V0L9_PYRAB/4-49TKVTRN------------------------------------------YQVTLPAEVRKVL.....GIRE...GDFLEVE
VAPB_DICNO/7-55FTTGRS------------------------------------------QAVRIPKAFQFDTK..EVIIQR..FGNGILLI
Q97WZ1_SULSO/7-51VEVGKK------------------------------------------GYIIIPKSVRDLV.....GIKE...GDILILT
Q8ZUE1_PYRAE/3-48VKVTRN------------------------------------------YQVTIPAEYRRKL.....GIKI...GDVVTVL
Q5V3U8_HALMA/8-53RLGPST------------------------------------------LAMTLPAEWASAH.....DVEK...GDEVSL.
Q97ZI3_SULSO/17-63KLGSSS------------------------------------------LFITLPKKWINKW.....SIKP...GDKVILE
Q5V1Y9_HALMA/5-51TKVTEK------------------------------------------GQTTIPRDLREKY.....GIEP...GDSVEWV
Q970M6_SULTO/5-50IRVGKK------------------------------------------LTIHIPKAVAEEL.....NIKE...GDILSLR
Q8TLE8_METAC/8-54VTGKST------------------------------------------YILTLPKKWVTKS.....ALGA...GSSVNLS
Q973J2_SULTO/18-63DALTRN------------------------------------------YQITIPSTIRNRL.....NIRV...GDRLLVY
Q8PZB9_METMA/6-52FTGNSS------------------------------------------YVVSLPMKWVRDV.....GIEA...GDTLNLI
Q92KY4_RHIME/8-59FQSGNS------------------------------------------QAVRLPKEFRFNVD..RVEITQ..EGDALILR
Q971H7_SULTO/11-57KFGKST------------------------------------------LMVSLPAEWVKEV.....GLNA...GESVYLE
Q9JZS7_NEIMB/5-50QKWGNS------------------------------------------AAVRLPADMLKQL.....DFKI...GDALVAE
Q972N2_SULTO/3-48VKVHKK------------------------------------------GIIVIPADVRRRL.....NISE...GSYMELE
O28094_ARCFU/6-48KKLDRH------------------------------------------GRIVIPKEWR.........ERH...GDEVVVV
O52204_9ZZZZ/19-64KKVGGS------------------------------------------VMLTVPPALLNAL.....SLGT...DNEVGMV
Q72P17_LEPIC/7-55FINGRS------------------------------------------QAVRLPKEFQFTGD..DVLIQK..VGEAVILV
Q9K6K9_BACHD/8-53QKWGNS------------------------------------------LAVRIPNHYAKHI.....NVTQ...GSEIELS
Q649B6_9ARCH/6-51VKVGKK------------------------------------------GELYTPKKLRLQI.....GLEP...GSEFIAV
Q8TR05_METAC/3-49QTGGST------------------------------------------YIISLPKQWAEKV.....GIET...GTRVSIQ
Q6ZEF8_SYNY3/6-51KKWGNS------------------------------------------IGLRIPHPLAISW.....GFDESTVVDLVETE
Q7PBM5_RICSI/7-51VTISEN------------------------------------------GRINIPAKIRDQL.....HLAS...GDQLMLI
CHPS_ECOLI/6-51KRWGNS------------------------------------------AGMVIPNIVMKEL.....NLQP...GQSVEAQ
Q5WIJ2_BACSK/8-53RKVDQL------------------------------------------GRIVVPKELRKTM.....GIDI...GSPLEIY
Q5SMB1_THET8/4-49SRVSSK------------------------------------------GQITLPKAIREAL.....GLRP...GEEVVFE
Q9HHH9_HALSA/10-56VSVSSR------------------------------------------GQATIPKEFREEL.....GIDT...PGRVKFV
Q65K54_BACLD/8-52RKVDEL------------------------------------------GRIVMPIELRRAL.....DISI...KDSIEFF
Q8DW96_STRMU/6-51NKWGNS------------------------------------------SAIRLPKQLVQEL.....QLQT...NDVLDYK
Q82Z18_ENTFA/7-50RKQGNS------------------------------------------LVITIPATLG.........VKE...GEEFVIL
Q5WJA0_BACSK/6-51HPWGNS------------------------------------------SAVPVPSHVRKVL.....GIEN...GSEVEIE
A9CEJ2_AGRT5/13-57TTVTAK------------------------------------------GQVTIPKAVRELL.....GISP...GSSVDFV
Q96XV2_SULTO/8-53KIKGGS------------------------------------------YIISLPSEWVRKN.....GLDV...KSELKVY
Q5WES6_BACSK/8-52RKLDQL------------------------------------------GRIVIPKELRSML.....NIEI...KTPLAIL
O28916_ARCFU/10-55RTGRSS------------------------------------------YIITLPKNWVEEF.....GIKE...GDTLFLE
Q7NJX2_GLOVI/4-49LTIDKF------------------------------------------GRILIPKKVRDQL.....GLSA...SDKLDLE
Q9V2F7_PYRAB/4-49TKVTRN------------------------------------------YQITIPSDVRKKL.....GIKV...GDVLIIE
Q973R7_SULTO/7-54VKVSRN------------------------------------------FQVTIPARIRQKV.....KVRE...GDLVRVI
Q8YS79_NOSS1/6-51AKWGNS------------------------------------------LAVRIPRSIAEQA.....HVTE...GTDINFS
Q745X1_THET2/27-72LTLDAQ------------------------------------------GRVLLPRPLRQAL.....GLGP...GARLVAL
O85908_SPHAR/5-50VTITPN------------------------------------------GRMSLPADIRKRL.....GLAG...GGALLVE
Q7NEK5_GLOVI/10-58FWHGRS------------------------------------------QAVRLPMAFRLPGD..RVRVRR..VGDGILLE
Q5V0G5_HALMA/8-53TVGGGT------------------------------------------YTVSLPKEWAESE.....NCTA...GTTVNLH
Q5P894_AROAE/7-54FTNGRS------------------------------------------QAVRLPKEFRFEGD..EVFIKR..VGDAVVLL
Q973Q9_SULTO/4-49VKVTRN------------------------------------------YQITIPASIRNKI.....NLKE...GDILEVY
Q977C9_SULTO/5-50TKVNKK------------------------------------------GIIVIPKGIRDEI.....GLKE...GDAVKIT
Q96XD5_SULTO/2-49VKLTRK------------------------------------------FQITIPKEVREKI.....NLKP...NEKFEVI
Q82V77_NITEU/1-47MQVTDK------------------------------------------GQVTIPKRLRDAA.....GFLP...GSQVTF.

PF08845

SYME_SALTI/20-71NRHLTV.....................SYASRYPDYT.........RIPALTMKGQWLEAA-----GFAT---GTEVDVR
Q6D1M7_ERWCT/19-69ERFTRV.....................GYRPIKGNHA..........TPAINIAGQWLKDA-----GFTT---GQPLRLR
Q4UUC8_XANC8/67-123PRQCTV.....................SYTHYPGAHD....HAGDQHVPHVRLSGLWLEQL-----GFAI---GTKLRIT
Q7M779_PHOLL/16-76RRSYKV.....................GYARTRHEDRSTGMTRYYSQHPSLHLKGNWLEEA-----GFAT---GQPVQVS
Q7M7D5_PHOLL/20-71PRHYTV.....................GYRPNRGKPN.........PYPQLTIKGRWLAAL-----GFTT---GKPITIT
Q5H4F0_XANOR/196-247TKQCTV.....................GYGYYPNS.........QQRVPTLRLRGGWLEQL-----GFAI---GSKLRVT
Q4UXV0_XANC8/82-138PTSCTV.....................GYAFYEAEPG....RPHSQRIPSVRLRGLWLEQL-----GFAV---GCKLQIT
Q8PIN2_XANAC/62-113PQQCTI.....................GYGYYAAT.........QQYVPTVRLRGRWLEQL-----GFVV---GSKLDIR
Q6CZ58_ERWCT/15-66ARYYTV.....................GYALKNGKPN.........PPPAIDLKCRWLESS-----GFMT---GIPITVT
Q6D1N5_ERWCT/27-107FTANTLFRINLYRNGLMLTLLNEDTDIAALMAELDGNEAEGADWVSDNGELTLAGDWLTQS-----GL.P---DQPLIIE
Q6DA58_ERWCT/11-70ALLHLI.....................SYVSRRHADR.SDMTRYYSRSPSLHLQDHWLEAA-----GFEI---DIPVVIT
Q8CLT6_YERPE/19-70ERYYTV.....................GYVPQRGKRN.........PPPAINLKGRWLEAL-----GFFS---GQPVLIT
Q832D6_ENTFA/13-63NRKLTV.....................CYGHGNYKQA..........PTQIVLQGKWLEQA-----GFSV---GDKITVK
Q3BZF1_XANC5/62-113PQHCTV.....................GYGYYPDS.........HQRIPTLRLRGRWLEQL-----GFTI---GSKLNIS
Q83LZ3_SHIFL/16-76QRRYKV.....................GYVRARHQDRKTGIARYYSQHPSLHLKGDWLKEA-----GFDT---GRGVTVK
Q8GDM5_PHOLU/19-71ERYYTV.....................GYVPNGNRVN........DATPAIHLKGQWLRQA-----GFNT---GGQITVK
Q7N1T9_PHOLL/16-57ERFGKV........................................AKNGISLKGKWLQEA-----GFTF---GMPLKIR
Q57SW6_SALCH/11-49SRVERL...........................................SVRLYGEWMPQA-----GFIN---GMPVKVR
Q2SFN5_HAHCH/22-83QRRLKVRK...................GYYDYHLSSS.RYDYGGFKPVPWMLIKGYWLEQA-----GFGV---DTEVEVS
Q664Z9_YERPS/30-110FTPGAVFKIQQYRNGLIITLIANEIATQQVFNEIENDHHIGMDWIQDNGELSLSGEWLTQT-----GL.T---GQPLAIS
Q5H6K4_XANOR/114-165TQQCTM.....................GYGYYPDS.........HQRVPALRLRGRWLEQL-----GFAI---GCKLRIT
Q390T1_BURS3/39-77PPVLHL...........................................WMKLSSHWIEAA-----GFDP---EQPLKIE
Q6CZ64_ERWCT/19-70ERYYTV.....................GYAPHNGRPN.........PPSAINLKGRWLEES-----GFMT---GMPITVT

PF02381

MRAZ_ECOLI/1-76MFRGAT-----------------------------------LVNLDSKGRLSVPTRYREQL-----LENA---AGQMVCT
MRAZ_MYCTU/72-142LAAGTD-----------------------------------EQHPDSQGRITLSADHRRYA-----SLS.---...KDCV
MRAZ_MYCGE/72-141IFANAN-----------------------------------LVELDSANRILIPNNLISDA-----KLD.---...KEIV
MRAZ_HAEIN/77-148MLGHAT-----------------------------------ECEMDAQGRILLSGPLRQHA-----KLE.---...KGLM
MRAZ_BACSU/1-71MFMGEY-----------------------------------QHTIDAKGRMIVPAKFREGL-----GEQ.---....FVL
MRAZ_MYCTU/1-71MFLGTY-----------------------------------TPKLDDKGRLTLPAKFRDAL-----AGG.---....LMV
MRAZ_STAAU/72-143FFSGAV-----------------------------------EVELDKQGRINIPQNLRKYA-----NLT.---...KECT
MRAZ_TREPA/5-77AFTGAY-----------------------------------SYNLDEKGRLMLPARLRVAL-----SDT.---...RLVL
MRAZ_ENTHR/72-142FYSAAT-----------------------------------ECELDKQGRINIPSTLRNYA-----ALT.---...KECV
MRAZ_ECOLI/77-143LLGHAS-----------------------------------ECQMDGAGRLLIAPVLRQHA-----GLT.---...KEVM
MRAZ_ENTHR/1-71MFMGEF-----------------------------------RHNIDTKGRMIVPSKLREEL-----GEQ.---....FVL
MRAZ_MYCPN/1-71MLLGTF-----------------------------------NITLDAKNRISLPAKLRAFF-----EGS.---....IVI
MRAZ_MYCPN/72-141IFANAN-----------------------------------FVDVDTAGRVLIPNNLINDA-----KLD.---...KEIV
MRAZ_RICPR/79-147IFGEAV-----------------------------------QLAFDGDGRIILPQSLMKHA-----GIE.---...EQAC
MRAZ_HAEIN/1-76MFRGAT-----------------------------------AVNLDSKGRVAIPTRYRAEI-----LEKN---QGQMVCT
MRAZ_BACSU/72-142FFSGAT-----------------------------------ECELDKQGRVNIASSLLNYA-----KLE.---...KECV
MRAZ_TREPA/78-148LIAPAQ-----------------------------------EVELDRAWRLFIPPSLREYA-----ALE.---...KDCL
MRAZ_STAAU/1-71MFMGEY-----------------------------------DHQLDTKGRMIIPSKFRYDL-----NER.---....FII
MRAZ_MYCGE/1-71MLLGTF-----------------------------------NLTLDNKNRISLPAKLRSFF-----DSS.---....IVI
MRAZ_ENTFA/72-142FYSAAT-----------------------------------ECEIDKQGRINIPANLRTHA-----SLE.---...KGCV
MRAZ_MYCLE/72-142LAAGTD-----------------------------------EQHPDMQGRITLSADHRRYA-----NLS.---...KDCV
MRAZ_ENTFA/1-71MLMGEY-----------------------------------QHNIDAKGRLIVPSKFREEL-----GEK.---....FVV
MRAZ_MYCLE/1-71MFLGTH-----------------------------------TPKLDDKGRLTLPAKFRDAL-----VGG.---....LMV

PF04014

Q7D0B2_AGRT5/8-53VD..NG..ALVASPVRLEKK----------------------
Q9YA54_AERPE/13-59VM..PDG.SLKIAPSASERP----------------------
S7C4_SULSO/7-54FD..ESGGVVKIQLLDSKTD----------------------
Q9YEV8_AERPE/13-58VE..GG..SLRIVPAVDSEA----------------------
Q5KXG5_GEOKA/5-52VN..EDGEIKVEVTKKYRLS----------------------
O30311_ARCFU/3-50YN..EEKGEAIIRKLGGERR----------------------
Q92MD9_RHIME/7-57PQ..G...KRWDDLFLSGPR----------------------
Q8J2X2_PYRAB/14-57EL..DDRIEILPRKKPKLSE----------------------
Q739R3_BACC1/8-52VE..EDK..VILQKYQP.YN----------------------
Q974B2_SULTO/3-50IN..EKEGIIIVRPYRKKWT----------------------
Q6D9N2_ERWCT/16-61QD..NG..ALKIMPQTVKPR----------------------
Q8ZW18_PYRAE/8-53VD..RE..KITVLPGTEAGG----------------------
Q6L2A8_PICTO/6-51LD..GD..RIIMEKPKTDSA----------------------
Q8G1Z3_BRUSU/6-53TD..ENGLRLARSTEDAEVL----------------------
Q9HRB9_HALSA/8-53RE..GGR.GSLTVTPASARQ----------------------
Q5KYV6_GEOKA/65-112YD..KERGEIVMKRANRIPK----------------------
Q607Y0_METCA/7-60PV..AQESLADVTDILAMFS----------------------
Q9HS09_HALSA/8-53PD..SG..SLLLTPIDDTDT----------------------
Q97XQ3_SULSO/4-49VD..GD..KIVIEKKKGNIS----------------------
Q82UU8_NITEU/4-50VA..GA.RDIEIMKTPEARE----------------------
Q67JB5_SYMTH/12-57VD..GDK..IILRKYEPACV----------------------
Q9A9W9_CAUCR/106-151LD..DE..RFTLVSGKTGIQ----------------------
Q5V6R8_HALMA/37-83RD..ENG.GSLLVVPEQPTI----------------------
Q81DC4_BACCR/8-52IE..EDQ..IILRKYQ.SPR----------------------
Q64CM2_9ARCH/7-50KS..EK..QLILKKVSDLGK----------------------
O29778_ARCFU/8-53EF..DE..FIVVQPQTVEKE----------------------
O73992_PYRHO/4-49LE..DG..KIIIERLKKERK----------------------
Q6N3T6_RHOPA/3-50ST..ASGGIYIGKSGSEADY----------------------
Q63HH9_BACCZ/8-54VD..RDGE.VILKKYSPISE----------------------
Q6L1K1_PICTO/8-53EQ..GN..SITIYTKTSKKD----------------------
Q82XX4_NITEU/4-49EE..DE..QIILTSRRQELE----------------------
Q74HQ7_LACJO/11-53QK..ADG.SLILIPKISNPY----------------------
Q8J2W0_PYRAB/9-54PT..DKG..LIIRAPIRVDD----------------------
Q724P1_LISMF/8-52TD..EDA..IVLKKYS.AGL----------------------
O29464_ARCFU/8-53V...EDS.VITLYPKSFREF----------------------
Q970R6_SULTO/4-49VD..DEG..IYIFPKESIEK----------------------
Q6LNS7_PHOPR/6-51TV..DG..KIVIEPIRKMKK----------------------
Q6D0W2_ERWCT/7-56PV.K....PNWHSFLQEERA----------------------
Q9UX12_SULSF/11-57QD..TDM.KLLIVPKSANTT----------------------
Q98K21_RHILO/18-67PL..R..KPGLAALLAQWAK----------------------
Q8RAW9_THETN/4-50E...ENGKIIIENSAVFALR----------------------
Q98F73_RHILO/1-47AT..DGG.VRLVPVNENLSH----------------------
Q82X03_NITEU/18-67PV..P..PKGLLVVLAELAP----------------------
Q7X3Y2_PEDAC/38-83EN....G.SIVLTPIKKNPT----------------------
Q9RX99_DEIRA/6-51LQ..D..GQIVIRPVPARQY----------------------
Q6MR51_BDEBA/45-92VN..GDEVNIRIINRKQVDW----------------------
Q5NZI0_AROAE/7-57PV..G...HTWDSFFIDGPQ----------------------
O58917_PYRHO/66-115LVGFHKFDELVTEKGKQIAK----------------------
Q8PRN0_XANAC/7-52VD..H..GRLVIEPTLRPYY----------------------
Q74AB7_GEOSL/7-55PR..S...DSWNSLFGSLKK----------------------
Q977A6_SULTO/12-58LE..KDG.KIVIKVKRISVD----------------------
Q706P9_PSEPU/31-76LR..GS..EVVVTRVDAEHE----------------------
Q5KZF4_GEOKA/17-61VE..N..QAIKLIPKKKK.P----------------------
Q8XUX7_RALSO/4-50IA..GE.RSFGVRRKRAARE----------------------
VPB27_MYCTU/3-48RY..GAG..LHLIPTGRTAR----------------------
Q97CB8_THEVO/10-55DD..GN..DLVISSSNPDLP----------------------
Q7WWW2_CUPNH/10-55VD..E..IGVTVRPVGRRAL----------------------
VAPB2_HAEIN/7-57PL..N...QSWDSFFLNDQA----------------------
Q5V0F9_HALMA/8-53AE..RD..LLLLAPQRDNGR----------------------
Q96Z33_SULTO/5-50VK..DDK..IELIPVRKPSK----------------------
Q9HLW4_THEAC/10-55DQ..GS..DLVVTAPENSEP----------------------
Q7PBV9_RICSI/6-52YK...KNETLELLPIKKDIY----------------------
Q97A15_THEVO/10-55ES..SG..IIKIRPKKDFNF----------------------
Q8PN78_XANAC/6-51ET..PDG..IKLTAFDPTLA----------------------
Q970W8_SULTO/11-57QD..RHA.RLILVPKKSESN----------------------
Q97TK9_CLOAB/14-61AD..KDQGIAIVQSDGYLQF----------------------
Q65EP9_BACLD/8-52TD..GEN..IILTKYA.ANM----------------------
O28477_ARCFU/9-54VG..KN..FITIYPKNPGLK----------------------
Q96YI0_SULTO/6-51VN..GNK..IDIEKPMTLLD----------------------
Q8P9K2_XANCP/3-48LE..GG..RIILRKSVDDAI----------------------
Q82UW7_NITEU/4-51EI..EPGRYEVIAATQSVKA----------------------
Q88PS8_PSEPK/6-51TT..GET..MVLKPVRSKPK----------------------
VPB40_MYCTU/3-48ER..DG..RIEIEPAPTGVE----------------------
Q7U8Z5_SYNPX/4-51LE..GAPVRLRLVSGGDQAY----------------------
VAPB1_HAEIN/6-58PV..SKKTDDFLALFEGFDE----------------------
Q9AC34_CAUCR/9-61PS..KGSIADLVATLNQMPR----------------------
Q8ZVL8_PYRAE/10-56TQ..PDD.TLVLIPKKLGKR----------------------
Q5V389_HALMA/17-62EE..DG..KAVVEPEDNPEQ----------------------
Q8F5A4_LEPIN/6-51YE..GD..KIVIYPMKKASL----------------------
Q6N8B1_RHOPA/9-59RK..P...DSWDGLLQLHQS----------------------
Q87FP5_VIBPA/6-53LN..KDKMEIKKMVLKTSTP----------------------
Q9Z384_AGGAC/8-60TS..SRE.ASWQRLFKLLPK----------------------
MAZE_ECOLI/7-52LV..DG..KLIIEPVRKEPV----------------------
Q8YRI0_NOSS1/4-49NM..GDG..ILIKPKKPFAE----------------------
O28268_ARCFU/5-50IR..GD..EIILRPEKSGRD----------------------
Q89E65_BRAJA/66-111ST..PDG..VLLKPSSPFPA----------------------
Q8ZZ12_PYRAE/6-51VY..GDY..LVLRPLPTAID----------------------
Q7ND94_GLOVI/10-59PV..R..RRSLLAILATLKP----------------------
Q97VK4_SULSO/11-56EK..NG..ELLIKPIRDYIT----------------------
Q7N820_PHOLL/4-50VD..DP.RTFAVCKKPGSEV----------------------
Q97UV7_SULSO/7-50LK..DDR.IEIYPKVSNVSK----------------------
Q82VT9_NITEU/6-52LH...GKKMIVEAPARPRYK----------------------
Q5NXJ8_AROAE/7-56EL..P..GNAAAIFDALIEL----------------------
O57970_PYRHO/8-54IN..PDG.SITIFPGKHKER----------------------
Q97D32_CLOAB/8-55ID..EVESHIVLRKYAPGCT----------------------
Q8TLD2_METAC/10-56SM..PNK.TLLVSSSVLPKE----------------------
Q5V7R4_HALMA/9-55VD..DDG.KLSIKLVKQHYG----------------------
Q9V0L9_PYRAB/4-49VR..GD..EIVMRKLRKNRR----------------------
VAPB_DICNO/7-55PK..N...SDWQGFLEALNE----------------------
Q97WZ1_SULSO/7-51VV..GDK..IILE.PERKVN----------------------
Q8ZUE1_PYRAE/3-48LE..GD..RIVIIPAKKRRI----------------------
Q5V3U8_HALMA/8-53RM..GGK.GTLTVMPESVQT----------------------
Q97ZI3_SULSO/17-63AL..DDG.SLRLIAEKAKTN----------------------
Q5V1Y9_HALMA/5-51ET..EDG.VMLTKAVDGGGR----------------------
Q970M6_SULTO/5-50VK..DNK..IILEHNDAILF----------------------
Q8TLE8_METAC/8-54YQ..EDG.SLVISPLTIRKP----------------------
Q973J2_SULTO/18-63VE..NN..RIIIEKKSGNIA----------------------
Q8PZB9_METMA/6-52TM..PNR.TILVSPGEISRE----------------------
Q92KY4_RHIME/8-59PH..VEQGEQWSSLKAALAR----------------------
Q971H7_SULTO/11-57VD..EDG.SLKIYPPNMKIQ----------------------
Q9JZS7_NEIMB/5-50VH..NG..ELRVRAARRFRL----------------------
Q972N2_SULTO/3-48VE..GDK..IILKRKMTLLD----------------------
O28094_ARCFU/6-48VY..EDKVEILPRKG.NVMR----------------------
O52204_9ZZZZ/19-64ID..N..GRLIVEPHRRPQY----------------------
Q72P17_LEPIC/7-55PK..N...KAWNVFLEGLNG----------------------
Q9K6K9_BACHD/8-53LG..SD.QTIILKPKKRK.P----------------------
Q649B6_9ARCH/6-51VK..GE..EVILRKRKTITN----------------------
Q8TR05_METAC/3-49AQ..PDG.KLLIDPILEGRT----------------------
Q6ZEF8_SYNY3/6-51QG.......LMIRKRSSPGS----------------------
Q7PBM5_RICSI/7-51LD....K.ELTLIPLKNKIK----------------------
CHPS_ECOLI/6-51VS..NN..QLILTPISRRYS----------------------
Q5WIJ2_BACSK/8-53VE..DDR..VIVRKYEPSIK----------------------
Q5SMB1_THET8/4-49LR..EGG..AFLRPRRRVPL----------------------
Q9HHH9_HALSA/10-56RT..DEG.EVIVRPIQSATD----------------------
Q65K54_BACLD/8-52VD..QDK..IVLKKYK.PHG----------------------
Q8DW96_STRMU/6-51VS..GN..KIILEKVNNIPE----------------------
Q82Z18_ENTFA/7-50RK..NNGSIALIPKVEDFFE----------------------
Q5WJA0_BACSK/6-51VK..DG..AMIVKPVKKDEG----------------------
A9CEJ2_AGRT5/13-57RA..PDGRIVLVRADK...K----------------------
Q96XV2_SULTO/8-53EI..YD..GLKIKPERKINN----------------------
Q5WES6_BACSK/8-52ID..GDQ..IVLEKYQ.PYK----------------------
O28916_ARCFU/10-55IK..EN..SICIKPKIEEKS----------------------
Q7NJX2_GLOVI/4-49IR..DG..VILLAPIQQEQK----------------------
Q9V2F7_PYRAB/4-49IE..DG..KAVIKKSDLELP----------------------
Q973R7_SULTO/7-54YD..ENENVVKIIPISREEL----------------------
Q8YS79_NOSS1/6-51VE..G..NSIVITPKRRKKY----------------------
Q745X1_THET2/27-72VE..DG..RLVLTPWERLEE----------------------
O85908_SPHAR/5-50ET..EDG..VILRTVAQSIA----------------------
Q7NEK5_GLOVI/10-58PI..VT...DIDAWFGAMDR----------------------
Q5V0G5_HALMA/8-53TH..ID..GLLVIQTPESRT----------------------
Q5P894_AROAE/7-54PR......HGWGTLFGALEA----------------------
Q973Q9_SULTO/4-49LN..GD..EIVLRKVKSERP----------------------
Q977C9_SULTO/5-50VE..GNK..IVIEKIDLWDK----------------------
Q96XD5_SULTO/2-49VL..NDNEILLRRKVKNPLE----------------------
Q82V77_NITEU/1-47SL..EGGKIIISKTGMGTDD----------------------

PF08845

SYME_SALTI/20-71VM--NG--CIVLTA----------------------------
Q6D1M7_ERWCT/19-69IM--PG--CIVITT----------------------------
Q4UUC8_XANC8/67-123AS--AG--QLLMEV----------------------------
Q7M779_PHOLL/16-76VE--HG--QLIIRL----------------------------
Q7M7D5_PHOLL/20-71SE--AG--QLIIQL----------------------------
Q5H4F0_XANOR/196-247VH--DC--ALVIAV----------------------------
Q4UXV0_XANC8/82-138AR--KG--ELVVTV----------------------------
Q8PIN2_XANAC/62-113MR--EG--ELVMSL----------------------------
Q6CZ58_ERWCT/15-66VE--RR--RLVIET----------------------------
Q6D1N5_ERWCT/27-107VL--PG--RITIRA----------------------------
Q6DA58_ERWCT/11-70VE--QG--QLVIRP----------------------------
Q8CLT6_YERPE/19-70VE--HG--RLVIQP----------------------------
Q832D6_ENTFA/13-63CQ--QG--QLTITK----------------------------
Q3BZF1_XANC5/62-113MR--NG--ELVVSV----------------------------
Q83LZ3_SHIFL/16-76IS--EG--GLTIIA----------------------------
Q8GDM5_PHOLU/19-71VM--DG--CLVLIP----------------------------
Q7N1T9_PHOLL/16-57VM--PD--CIVITA----------------------------
Q57SW6_SALCH/11-49VM--RD--CIVITP----------------------------
Q2SFN5_HAHCH/22-83VS--EG--RIVFTA----------------------------
Q664Z9_YERPS/30-110VM--AG--KVIVRG----------------------------
Q5H6K4_XANOR/114-165VR--DS--ELVITV----------------------------
Q390T1_BURS3/39-77VM--HK--RLVITP----------------------------
Q6CZ64_ERWCT/19-70VE--RG--RIVIET----------------------------

PF02381

MRAZ_ECOLI/1-76ID--IYHPCLLLYPLPEWEIIEQKL.SRLSSMNPVERRVQRL
MRAZ_MYCTU/72-142VI--GAVDYLEIWDAQAWQNYQQI..HEENFSAASDEALGDI
MRAZ_MYCGE/72-141LI--GQFDHLEVWDKVQYEQYLAS...SESLETVAERMKDAK
MRAZ_HAEIN/77-148LV--GQLNKFEIWSDVEWHTQIAED.IEIGSSTDFAADALND
MRAZ_BACSU/1-71TR--GLDQCLFGYPMHEWKQIEEKL.KALPLTKKDARAFTRF
MRAZ_MYCTU/1-71TK--SQDHSLAVYPRAAFEQLARRA.SKAPRSNPEARAFLRN
MRAZ_STAAU/72-143VI--GVSNRIEIWDRETWNDFYERN.LKKSFEDIAEDLIDFD
MRAZ_TREPA/5-77TC--AIESCLWVFPRAQWDRFSSQISARASLFHAPSRAVLRR
MRAZ_ENTHR/72-142VI--GVSNRIEIWDEARWQEFSEV..AAENFDEIAENMIDFG
MRAZ_ECOLI/77-143LV--GQFNKFELWDETTWHQQVKED.IDA...EQLATGDL..
MRAZ_ENTHR/1-71TR--GLDGCLFGYPMKEWANLETKL.NDMPLAKKDARTFVRF
MRAZ_MYCPN/1-71NR--GFENCLEVRKPQDFQKYFEQF.NSFPSTQKDTRTLKRL
MRAZ_MYCPN/72-141LI--GQFDHLEIWDKKLYEDYLAN...SESLETVAERMKDVK
MRAZ_RICPR/79-147FV--GKGIIFEIWQPKNFEKYLSY..AQN..IAHEKRLTLRN
MRAZ_HAEIN/1-76VD--IRQSCLLLYPLDEWEKIEQKL.LALSNFDPTQRRLQRV
MRAZ_BACSU/72-142VI--GVSNRIELWSKVIWEQYTEE..QEDSFAEIAENMIGFD
MRAZ_TREPA/78-148IL--GLSHCLEIWDRARYRAYLAES..EADFRAGTETLQDLC
MRAZ_STAAU/1-71TR--GLDKCLFGYTLDEWQQIEEKM.KTLPMTKKDARKFMRM
MRAZ_MYCGE/1-71NR--GFENCLEIRKPADFESYFQTF.NNFPNTQKDTRTLKRL
MRAZ_ENTFA/72-142VI--GVSNRIEIWSDERWHAFSDE..AEENFDELAETMIDFG
MRAZ_MYCLE/72-142VI--GAVDYLEIWDAQAWHDYQQT..HEENFSAASDEALGDI
MRAZ_ENTFA/1-71TR--GMDGCLFGYPLNEWSQLEAKL.QEMPLAKKDARTFVRF
MRAZ_MYCLE/1-71TK--SQDHSLAVYPRAEFEQLARRA.SKMSRSNPEARAFLRN

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window