Sequence alignment for CL0133

PF05633

Q9CAK4_ARATH/2-404RPAQDNQG.......SFLGRISIRRNQFV.......DVNNEQEQE....DLELFQKHIADRFTELLSPPQPPPSDEINTV
Q9XIG0_ARATH/1-376MPETEYS........FGRSFLSLRRDQAHLM.....DPTSFSEPMTMEVELDSFQRQVAEKFIDLN.......ASADE..
Q9ST79_ORYSA/1-418MPATDSSSAAAPLTSFGRSFLSHRRDQIPPPPPDHHSHSHTQHPSSSDLEIDAFHRHAADLLHDLL.......SDSNSDP
Q8LA35_ARATH/1-382MPATDFQG......SFGRSLLSLRRDQVDSSTV.VSGSSSHHEPSTMEVELDSFQRQVAEKFIDLN.......ASS....
O81749_ARATH/2-390ARATEFQG.......SFLSRISIRRNQIVSM.....DVNHEQELE....ELEYFQKHVAERFSDLITSPSPPPSSSSSAV
Q8LDW5_ARATH/2-369APATEHQS.......SFLSRLS.RRNQVVSM.....EVNHEQEQE....ELEDFQKHVAERFAELL.....PPSDSP...
Q8LG71_ARATH/1-390MPATEYQR......SFGRSFLNLRRDTAVNS...VESTTVTPELTQMEAELVSFQRKVAERFIDLN.......ASSC...

PF05055

U496I_ARATH/47-375LE-------------SFDSALHERTNRVIN------KLASGVE.......IKSLS...FDSLREVT--------------
U496O_ARATH/12-347LR-------------RKPISMISPTMFLLS------SPTTSSSIGHSNGMLRSRS...EDNLNKLG--------------
U496D_ARATH/28-380LK-------------SFDSELQQKTSNLIN------SFTSDAK.......TGLVPLPQHAAYKEFT--------------
U496G_ARATH/55-391LK-------------SFDSLLHERTNSIIS------SLAAQAK.......TRSLN...IESLMEVY--------------
U496C_ARATH/29-372LK-------------SFDASLQQRTNKMID------SLTVEDK.......NGSSS..PHDAHMELS--------------
U496A_ARATH/36-363LQ-------------SFDTCLQARTSHVIS------TLATGVE.......VRALS...FDSLKEVT--------------
U496F_ARATH/55-392LK-------------SFDSSLHQRTNIIIT------SLAARAE.......TQSLN...LDSLMEVY--------------

PF03087

O81800_ARATH/48-281MG--------------------------------------------------------LEGLEELY--------------
Q9SGR3_ARATH/4-223IN--------------------------------------------------------FEGLRELH--------------
Q9SD08_ARATH/49-250AS--------------------------------------------------------LLNLSELY--------------
Q9T008_ARATH/43-250QR--------------------------------------------------------LSNLQDLH--------------
Q9SGR0_ARATH/147-378DG--------------------------------------------------------LSLLKDVQ--------------
Q9SD09_ARATH/37-272NS--------------------------------------------------------LSLLSNLY--------------
O81803_ARATH/55-322DS--------------------------------------------------------LSGLTELY--------------
O81799_ARATH/64-307VG--------------------------------------------------------LVNLTELY--------------
Q9SGR2_ARATH/43-253RK--------------------------------------------------------LGVLKNLY--------------
O81802_ARATH/48-280MG--------------------------------------------------------LAGLEELY--------------
O81797_ARATH/55-285LG--------------------------------------------------------LAKLVELY--------------

PF05633

Q9CAK4_ARATH/2-404ASVAATEQIMSVTWLRKLMDVFLCCEAEFKAILLMGRDPTQISKPP.FDRLVPEMLDRSIKALDICTAVVNGIDSVRHYQ
Q9XIG0_ARATH/1-376......AEILSLEWIGKLLDSFLCCQEDFRVIIFNHKP..QLLKQP.MDRLIEEYFERSVKALDVCNAIRDGIEQIRQWQ
Q9ST79_ORYSA/1-418S....APDLLSLAWTRRLLDSFLICLEEFRAILFALADSQPLSRPP.LDRLLLDFLDRAVKALDLCNALRDGLDLIRQWR
Q8LA35_ARATH/1-382......NDLLSLEWIGKLLDSFLCCQEEFRAIVFNHRS..QISKSP.MDRLISDYFERSIKALDVCNAIRDGIEQIRQWE
O81749_ARATH/2-390S..QPSDPILSIPWLQNLLDVFMSCEAEFKAVLST....TQISKSPSLERVLPEMLDRILKALDLCNAVVNGIDSVRQSR
Q8LDW5_ARATH/2-369....ESYPILSIQWLRKLLDVFMSIESEFHSVLTSN..PSQISKPP.LDKLVPEMLDRIVKALDICTAVVNGVDSVRQIQ
Q8LG71_ARATH/1-390......EDLLSLEWVGKLLDSFLSCQEEFRSIVINHRS..MITKPP.MDRLVSDYFERSVKALDVCNAIRDGVEQIRQWQ

PF05055

U496I_ARATH/47-375------QCLLDMN--QDVVKVILQDKE.------------DIWNNQDLFSLVNLYFESTAKTMDFCSELENCLNRARRSQ
U496O_ARATH/12-347------ECMDNMD--EDVSKLFIEFQQT------------DLREDPDLFRLLNHYFTTSKGVSQLCESLRTCLERSENNE
U496D_ARATH/28-380------KHLAEVN--QQVSDYIIGYGE.------------VVWENSTLRSLVETYFESAKKTLDIAENVTEYVDEAKRGE
U496G_ARATH/55-391------GYLLELN--QDTVRVIIESKE.------------DVLKNNDLKALVDVYFKSTSKTLDFCNTVEKCVKKAEISQ
U496C_ARATH/29-372------KHLVEVT--QGVADFITEIED.------------DVWDNQALKYLVLAYFENTKKTLEIFKTIENCVENAEMGQ
U496A_ARATH/36-363------QCLLEMN--QEVVKVILDCKK.------------DIWKNQEMFELVEDYFENSLKTLDFCAALEKGLRRARDSH
U496F_ARATH/55-392------GFLLELN--QNAVRVIIESRE.------------DVWKNKDLKSLVDVYFKSTSKTLDFCNTVENCVKRTEISQ

PF03087

O81800_ARATH/48-281------NCTEDFLKMGSTQR--------------------VMSSSD.GSEFMEEMLDGSLRLMDICSVSRDLMVETQEHV
Q9SGR3_ARATH/4-223------DCVNYLLHHCPKTR--------------------ESLSQQGQEKWTEQVSEASLRMLDICNVSKDVMTLVKHSL
Q9SD08_ARATH/49-250------HSLHQLNHSLPTAQ--------------------AEHSL..........DVSAT.LLDSCDAARNLVLTLREHL
Q9T008_ARATH/43-250------DSLEKMIRLSVTNQ--------------------ALSQDQ.....IEKLLDGSIKILDLCSISKDGLSQMKESL
Q9SGR0_ARATH/147-378------ETLADILQLPQSQE--------------------SLRNRP...VFFENLLEDLLRFVDAYGIFRTSILCLREHQ
Q9SD09_ARATH/37-272------DSVSHLFNDSPSSL--------------------LVPHHS....FFTHLLDLSLLHLDLCSKLRDITCRIKDCL
O81803_ARATH/55-322------RCLSEDLFKSSSET--------------------QQALLNG.DGLMEELLEVSLKYLEVCGGAKDAASRIKKIV
O81799_ARATH/64-307------GCVHELLESPYVKH--------------------TLLHHQE.GKLLDESLDGSVLLLDVYEGTREVIVAMREHV
Q9SGR2_ARATH/43-253------EVVEVFLRFQTTKT--------------------QKSFTG.....FEDVSDGFIEVLDICSTIRDVLMEIKEQV
O81802_ARATH/48-280------IFLEEFLKMGSKQR--------------------VMSSG..GSEFMEEMLDGSLRLMDICSVSRDLMVETHEHV
O81797_ARATH/55-285------DFVNEQVISSPQGQ--------------------QALRLCRNRKLVEDALDESIVLLDVSDFTRDLIGTLMEHI

PF05633

Q9CAK4_ARATH/2-404-RLAEIAVTALEQR........PLGDGNVRRAKRALANLVVALSLEDKENVSGGGGGGG..GGNKTTERSWS........
Q9XIG0_ARATH/1-376-KLIEIVISALDTN......QRQLGEGEIHRAKKALIDLAIGMLDE....KDSSNT.....HRNRSFTRNKD........
Q9ST79_ORYSA/1-418-KHLAIAAAALAPAP.....AAQRGEAQIRRARKALTDLTILMLDD....KDAGGVVG...QRNRSFGRAGTTRDSLPHG
Q8LA35_ARATH/1-382-KLADIVISALDSH.......RPIGEGQLRRAKKALIDLAIGMLDE....KDHPSG.TNLAHRNRSFGRVKD........
O81749_ARATH/2-390-RFAEIAVTALKQR........PLCDGSVRRAKRALTSLLIGLNADERRDRNSGGSGCS..NQRRTTSRSWS........
Q8LDW5_ARATH/2-369-RCAEIAVTALKQT........PLSDGSVRRAKRALTSLLAALNAD....KNSGSSGGG..SGRRSSTDQWSS.......
Q8LG71_ARATH/1-390-KLIEIVICAFNNNAGGSSGKRPLGEGQFRRARKTLIELAIGMLDE....KDSSSSSVSSQHRNRSFGRNKEQ.......

PF05055

U496I_ARATH/47-375.VIIQFAVNQFEEENEDK......ENRKYEKTLEELKRFKV---------AGEPFTKE........FFALFDL-------
U496O_ARATH/12-347CLLLDEALVDFELEKLGY..GGSLEEASFRKTYRDLRNFNA---------FYNNNSGEEDDLDYCEFLRKFQT-------
U496D_ARATH/28-380.RYIVAAVAQFEKDK.ENDVG..KKTKRYENTLRELKKFEA---------MGNPFDGDK.......FTTLFKL-------
U496G_ARATH/55-391.LIIRFAVKQFETETVDTDLG.ESKKKKYVKTLEEMNKFKA---------MGDPFDGE........FVTQYKS-------
U496C_ARATH/29-372.LLIREALAEFEKESAEKDVG..GKKKKYEKTLEDLKSFKE---------MGDPFDGKV.......LTTQFER-------
U496A_ARATH/36-363.LLILVALQQFEDESLVQG......GNGYKKTLEELKNFKD---------AESPFNED........FFKMFQS-------
U496F_ARATH/55-392.LIIRFAVKQFEAESVDTDLGGDKKKKKYTKTLEELNKFKA---------MGDPFDGE........LVTQFDS-------

PF03087

O81800_ARATH/48-281-RGVQSCVRRKKVVGGE..DQLDVAVAGYVGFRKNMRK------------------------------------------
Q9SGR3_ARATH/4-223-QDLQLTLRGNE.SSD.....VNEKIAAYNRYKNKLKK------------------------------------------
Q9SD08_ARATH/49-250-LNLQSALRRKD..KS.....MEVQIKEYFSFRKKIKK------------------------------------------
Q9T008_ARATH/43-250-KEIQSIVRRKR..G....D.LSAEVKKYLASRKFLKK------------------------------------------
Q9SGR0_ARATH/147-378-SAAQVALRKKD..........DEKIASYLKSRRSLAR------------------------------------------
Q9SD09_ARATH/37-272-RDLRSAFRRRRHSGDS...TIRCHVKAFIRSRKAVHK------------------------------------------
O81803_ARATH/55-322-VELQSALRRSKKGGEFS...LESDVDAYVASRKEIKQ------------------------------------------
O81799_ARATH/64-307-TNLKSALRRKG..S......LEKEAKAYFNLRKKAKK------------------------------------------
Q9SGR2_ARATH/43-253-RELESSLRRRL...........IRSKSGEDQEAFVAR------------------------------------------
O81802_ARATH/48-280-RGVQSYVRRKKVSGGGGGDKIDVAVSDYVGFRKNMRK------------------------------------------
O81797_ARATH/55-285-QELQSALRRRRGNLSS....VQSEIRSYISFHKKSKT------------------------------------------

PF05633

Q9CAK4_ARATH/2-404.FGRRSGGSSAASKGGATIGQLKSSSWAVGRNWSAAKQIHAMTANL-------TPPRGNEAAG...LPQPMFIMSTVMVF
Q9XIG0_ARATH/1-376..HNQHIG............YIRSLSWSVSRSWSASRQLQGIGNNL-------ATPRASDVMATNGLALTVYTMTSILLF
Q9ST79_ORYSA/1-418HGHHRRSSSGG.SSGSGSGSHLRSLSWSVSRTWSAARQLQAIGGGL-------TVPRANDIAATGGLASAVYAMGAVLFV
Q8LA35_ARATH/1-382.SHHRSIG............HFRSLTWSVSRSWSASKQLQALASNL-------ATPRPNDVVASNGLAVPVYTMTSVLLF
O81749_ARATH/2-390.FGTRSN.....VTGGGLYGQ......VVSKNWSASKQIQAMVANL-------VLPRGAEASG...PAMPVYIMSSVMVL
Q8LDW5_ARATH/2-369.FGRRSGG....SSGGGGGGAG.....CVSKNWSAAKQIQAMTANL-------VAPRGGEAS.......PMYIMSSVMVM
Q8LG71_ARATH/1-390.LHHRTIG............HFRSLSWSVSRSWSAXKQLQAIGNNL-------ATPRASDITATNGLIVPVYTMTSVLLF

PF05055

U496I_ARATH/47-375-VYKQQVM-------------------MLEELHKLKRKLDKRLRNI.......KTWRR--------VSNMVFVTAFVSVL
U496O_ARATH/12-347-CHEELAK-------------------MVVKLEKTMKDIDKKLRRV.......RGRRA--------IVTAALLAPVIAVI
U496D_ARATH/28-380-MHKEQES-------------------LLERVRETKEKLDEELKNIEMEISSRKKWSI--------ISNVLFIGAFVAVA
U496G_ARATH/55-391-VYDEQVL-------------------LLDELRKLKVKLGKKLRNI.......KTWRI--------LSNVVFATAFVTVF
U496C_ARATH/29-372-IKKQQES-------------------LLEEVSETRKKIQDEISNL.......EKKTL--------ITNVVFGAAFAIVA
U496A_ARATH/36-363-VYKQQML-------------------MLEKLQHRKNKLDKKLKCI.......HTWRK--------LSSIIFVATFATVL
U496F_ARATH/55-392-VYDQQVL-------------------FLEELRKQRRKLDKKQRNV.......KTLRT--------VSNVFFATAYVSVL

PF03087

O81800_ARATH/48-281---------------------------EAKRLLGSLKNIDGGLSSS-------SSVNNGEQEE...HLVVVVDAMRQVVS
Q9SGR3_ARATH/4-223---------------------------ETLKCLNCLKNMKG.....-------.............NEGRVAMPIEQNLL
Q9SD08_ARATH/49-250---------------------------ETNKLLLGLKKKLD.....-------..............DSETTELS.....
Q9T008_ARATH/43-250---------------------------SFEKVLKSLKTSQ......-------.............NKNDALAVFGEAET
Q9SGR0_ARATH/147-378---------------------------DIAKLTSSIREPKTKHQHC-------HVDNVNGTYGDAELASVIGDVIEVTVL
Q9SD09_ARATH/37-272---------------------------DIAKLLLLLKQTGLS....-------........SSE..SSHPLITLLQQVCS
O81803_ARATH/55-322---------------------------EIKKYMVMSKETDASLES.-------.VWCDGDDQE....MSALVRVMQETSV
O81799_ARATH/64-307---------------------------EISKQINALKKMETR....-------.DISTNTDQD...SAIASTSVLRETIQ
Q9SGR2_ARATH/43-253---------------------------ETDAYVFKRRALSR.....-------.............TIVKQLKKTEEKMR
O81802_ARATH/48-280---------------------------EAKKLLGSLKKVDGGTR..-------.SCDNDHEDE...QLVAVIDRVRRVVS
O81797_ARATH/55-285---------------------------EAARQVKSLARRQTKKK..-------.AWVIKQSGGLDEHSSMVSNILRQSNA

PF05633

Q9CAK4_ARATH/2-404VMWVLTAAVPCQERSGLANHLPVPPKHLN--WAQ---------SLIGIHEKIGDEWKKKEKK.GSAGLMEEMTRMEKLGH
Q9XIG0_ARATH/1-376VTWVLVAAIPCQDR.GLHVHFY.FPRHFQ--WAV---------PVMSLHDKIMDESKKRDKKKKGCGLLREINQIERNSR
Q9ST79_ORYSA/1-418VTWALVAAIPCQDR.GLQAHLTAVPRTFP--WAG---------PLITLFDRILDESKKKDRKH.SCGLLKEIHQIERCSR
Q8LA35_ARATH/1-382VMWVLVAAIPCQDR.GLQVNFF.VPRHFQ--WAA---------PVMSLHDKIVEESKRRDRKN.CCGLLKEIDRIEKSSR
O81749_ARATH/2-390VMWVLVAAVPCQTSSVLVAPLPLP.KHQN--WAS---------AAMSIQERIGEEIKRKEKRCGGGGLMEEMQRMEKIGL
Q8LDW5_ARATH/2-369VMWTLVVAVPCQTSNGLMVHVPLP.KNQV--WAS---------AAVSISERVGEEMKRKETR..GGGLMEEMQRMERIWL
Q8LG71_ARATH/1-390VMWALVAAIPCQDR.GLQVHFN.VPRNYQ--WGG---------SLMSLHDRIIEESKKRERKN.TCGLLKEIHQFEKTSR

PF05055

U496I_ARATH/47-375IFSVVAAAVAAPPVVAAIAGALAVPVGSVGKWCN.........TLWTKYEKVVRGQKEIITSI-RIGTYISVKEMDNISI
U496O_ARATH/12-347FLSKLVAGL..............VPIEGLSTFVA.........SRWRKSTESLKREKTAMSSM-ERGIIVALKQVEKISK
U496D_ARATH/28-380VGSMVLVCTGVGAGVG.VAGLLSLPLIAIG.WVGVHTILENKIQAREKQEEALKKAHRIANEM-DKGMETDKVDMNSISG
U496G_ARATH/55-391VLSVVAAAMMAPPVLSAVASGLTTPIEVVGMWCN.........KMWKEYEKAVKRQRGLVLTM-ELGVQANNVTMVNIKF
U496C_ARATH/29-372VASIALIATGVGAAAG.F.GALAAPLLAAG.WAGVYTTLDKKKDALNKQLEGLKKVEEIEESV-EKGIKTNEEATETVSI
U496A_ARATH/36-363ICSVVAAAMAAPPVAAALAAATAVPLGSMGKWID.........SLWKNYENALKGQKEVISSM-QAGTFVAVKDLDNIRV
U496F_ARATH/55-392VLSVVATTMSAPPVVCAVASGSTAPIEITGKWFS.........QMWKKYEKAVKRQRGLVLTM-ESRVQVNNEAMKNIRS

PF03087

O81800_ARATH/48-281VSVAVLR------------------------------------SFLEFLSG.....RRQSN.I-KSKLASVLKKKKVH..
Q9SGR3_ARATH/4-223FVTEVLK------------------------------------EVRRVVVT....MVESLFSL-GCIPWLEKRSSKGSLS
Q9SD08_ARATH/49-250..VSIFR------------------------------------SLFMFLST.....TSTMKTK-TCSLKFVSRLISGGHR
Q9T008_ARATH/43-250VTIALFE------------------------------------SLFSFMSG.....SKACG..-KWSLVSKMMSQSKG..
Q9SGR0_ARATH/147-378VSVALFN------------------------------------GVYLSLRA.....TKTTPFI-GFLKRSEKKEKLDEGI
Q9SD09_ARATH/37-272QTCQTFR------------------------------------TVLLSLST....AVPKPRPS-KWALVTKLVIKNVTST
O81803_ARATH/55-322MTCFVLR------------------------------------SVFSFLSSPKGLKTKNHHHH-KGWGIVMKLVKKGIEH
O81799_ARATH/64-307ITVSMFR------------------------------------HLLLFLSTIPPPPSPAIFKT-TIGLLSIPFVSPSLSD
Q9SGR2_ARATH/43-253KRKRDCG------------------------------------DVINVMKR....VEKTSFDV-LVSLLIEVVTKDQRDQ
O81802_ARATH/48-280VSVVVLK------------------------------------SFLELLS......RRKSN.I-KSKLASVLKMKKDN..
O81797_ARATH/55-285STISILQ------------------------------------SLLQFLST............-.SGENNEKKNGEIGCV

PF05633

Q9CAK4_ARATH/2-404SLMEF-------A------DGFHYPAEKDA.AESAAVQVAEMAEICRRMEEE-----------LVPLQQQIREVFHRIVR
Q9XIG0_ARATH/1-376MLSDL-------I------DSDNFSLTDEKCTLEVKERVQELMNVCEAIKEG-----------LDPFDRKVRDVFHQIVR
Q9ST79_ORYSA/1-418QLMEV-------T------DAAEFPLADDK.DSEVQEATQELVQVCGSLKDG-----------LDPLERQVREMFHRVVR
Q8LA35_ARATH/1-382LMNEL-------I------DSIHFPLNDDK.EVEVKQRVDELVQVREALRNG-----------LDPFERKVREVFHRIVR
O81749_ARATH/2-390SLMEF-------A------ERFRFPADEEE.EVEVAEKVDEMEEICRRMEVG-----------LEDLQRQVRQVFHRLVR
Q8LDW5_ARATH/2-369KLMEF-------S------EGFRFNGEED.....VVAEVAEMEEICRKMEDG-----------LEGLQRRVREVFHRLVK
Q8LG71_ARATH/1-390LMNEL-------V------DSVQFPLSEEK.EMEVRERVEELGKLQEALKNG-----------LDPFERKVREVFHRIVR

PF05055

U496I_ARATH/47-375LVRKVEVEIESLL------KKAEFAITEEK...EVRLAIDEIKKKLDVFTET-----------IEELGEHAGKYCSDVTK
U496O_ARATH/12-347LVSRLESVERSIS------LTAEFAVKKRS...SVVVAMREVEEERKRLKST-----------LVDLDRETGLCNGFAQF
U496D_ARATH/28-380KVHALKSKITSML------NAVKDATEDGANEVDTKQVMETLTGDVVELTED-----------IKAVGDDVAKYSKMIEE
U496G_ARATH/55-391EVENLSIRISSIL------KTVNFAVDREENEMATRFAMQEIKKKVEGFTEK-----------IEEVGERAANCSKLIAL
U496C_ARATH/29-372LVDGLEDRIKNML------KLVDNAIDHEDNEAATRIVLTQISKKVEKLTKK-----------ITEVGESVEDHSKLIAK
U496A_ARATH/36-363LIERLEIEITGMV------KSAEFAVEH....NAVKIGIDDIKKKLEVFKKN-----------VEELGTQADLCSRDIRR
U496F_ARATH/55-392DVDELRSWVSSIL------ETVDFAVEREEEEEAMGLAMQGIKKHVDGFTEK-----------MEEVGENAAKCSKFIAL

PF03087

O81800_ARATH/48-281HVEE...............TKNELENLDLEIF....CSRNDLQKKLEEVEMS...........IDGFEKKLEGLFRRLIR
Q9SGR3_ARATH/4-223SIFS...............IRSSYLLDDEWDET....AVQSATTRLEAAEIT...........VVELEIELESIFRRLIQ
Q9SD08_ARATH/49-250SSSS...............IMSELQNLDAVLRS.DGDNSKEIKKMLERLEER...........TEELETALDSLFKSLVQ
Q9T008_ARATH/43-250TCEA...............EANEFTRVDMEFQ....SEKSLQMEDVQNLEIC...........IQDLEDGIGSLSKSLIK
Q9SGR0_ARATH/147-378VELK...............QVEEKSLIGLSKKK..NEEVKSLMKRMMELENS...........IREIECESEKVFRGLIS
Q9SD09_ARATH/37-272SGQVRTG............HRNEFQMMDEELRR.FSMAEEIKKDRIKSMITN....LDKVDVAVEDLEESLERLYRRMIQ
O81803_ARATH/55-322HHQEKRDYETGFSCLVLEAMESELGKLVVMMTREDQEEEKKISEEVSERVQCALVRSEGVEAAMEELEEGLEGLFKVMIQ
O81799_ARATH/64-307KSLI...............LIKEMKSLDDVFLG.SILDSRKTLFEVETMENEKMRR.DVVEDGFRDLEAELDSVSKCLVK
Q9SGR2_ARATH/43-253KKGS...............RRGIVSRIFNKKNQ...EVDVDELKKLRETEHE...........IEETEKELECVYKKLLK
O81802_ARATH/48-280HAP................AKNVLETLDSAIFG.DFLSHDDLQNELEEVEMC...........IGGFERNLEGLFRRLIR
O81797_ARATH/55-285DNSM...............IRSFFGRIIGRKMV.KEIDAQTILGRLAMVNVS...........LEAIKDELSYLSRRLIQ

PF05633

Q9CAK4_ARATH/2-404SRAEILEVL
Q9XIG0_ARATH/1-376TRTEALDSL
Q9ST79_ORYSA/1-418TRTEILDYL
Q8LA35_ARATH/1-382SRTESLDSL
O81749_ARATH/2-390SRIEIVSLL
Q8LDW5_ARATH/2-369SRSEILEVI
Q8LG71_ARATH/1-390SRTEGLDTV

PF05055

U496I_ARATH/47-375ARTVILQRI
U496O_ARATH/12-347GRTVALEKI
U496D_ARATH/28-380TSYHVLQKI
U496G_ARATH/55-391GRLVVLGHI
U496C_ARATH/29-372ARLQVLQKI
U496A_ARATH/36-363ARTVILQRI
U496F_ARATH/55-392GRLLVLEHI

PF03087

O81800_ARATH/48-281TRASLLNI-
Q9SGR3_ARATH/4-223TRVSLLNI-
Q9SD08_ARATH/49-250YRVYLLNI-
Q9T008_ARATH/43-250YRVSILNI-
Q9SGR0_ARATH/147-378TRVSLLNA-
Q9SD09_ARATH/37-272ARVSLLNI-
O81803_ARATH/55-322ARVSLLNI-
O81799_ARATH/64-307NRVLFLNI-
Q9SGR2_ARATH/43-253TRVSFLNM-
O81802_ARATH/48-280TRASILNI-
O81797_ARATH/55-285HRASLLNI-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window