Sequence alignment for CL0133

PF05055

U496P_ARATH/28-380LK-------------SFDSELQQKTSNLIN------SFTSDAK.......TGLVPLPQHAAYKEFT--------------
U496I_ARATH/47-375LE-------------SFDSALHERTNRVIN------KLASGVE.......IKSLS...FDSLREVT--------------
U496O_ARATH/12-347LR-------------RKPISMISPTMFLLS------SPTTSSSIGHSNGMLRSRS...EDNLNKLG--------------
U496G_ARATH/55-391LK-------------SFDSLLHERTNSIIS------SLAAQAK.......TRSLN...IESLMEVY--------------
U496C_ARATH/29-372LK-------------SFDASLQQRTNKMID------SLTVEDK.......NGSSS..PHDAHMELS--------------
U496A_ARATH/36-363LQ-------------SFDTCLQARTSHVIS------TLATGVE.......VRALS...FDSLKEVT--------------
U496F_ARATH/55-392LK-------------SFDSSLHQRTNIIIT------SLAARAE.......TQSLN...LDSLMEVY--------------

PF05633

Q9CAK4_ARATH/2-404RPAQDNQG.......SFLGRISIRRNQFV.......DVNNEQEQE....DLELFQKHIADRFTELLSPPQPPPSDEINTV
O81749_ARATH/2-390ARATEFQG.......SFLSRISIRRNQIVSM.....DVNHEQELE....ELEYFQKHVAERFSDLITSPSPPPSSSSSAV
I1PR59_ORYGL/1-420MPATDSSSAAAPLTSFGRSFLSHRRDQIPPPPPDHHSHSHTQHPSSSDLEIDAFHRHAADLLHDLL.......SDSNSD.
Q6DYE2_ARATH/31-406MPETEYS........FGRSFLSLRRDQAHLM.....DPTSFSEPMTMEVELDSFQRQVAEKFIDLN.......ASADE..
Q9CA69_ARATH/1-390MPATEYQR......SFGRSFLNLRRDTAVNSV...ESTTVTPELTQMEAELVSFQRKVAERFIDLN.......ASSC...
Q9M9U5_ARATH/1-382MPATDFQG......SFGRSLLSLRRDQVDSSTV.VSGSSSHHEPSTMEVELDSFQRQVAEKFIDLN.......ASS....
Q9SUT1_ARATH/2-369APATEHQS.......SFLSRLS.RRNQVVSM.....EVNHEQEQE....ELEDFQKHVAERFAELLP.....PSDSPE..

PF03087

B9HQY4_POPTR/51-287---------------------------------------------------------KLSSLQDLH--------------
C5Z203_SORBI/59-286---------------------------------------------------------.LAHVRALL--------------
I1LQ17_SOYBN/43-281---------------------------------------------------------KLNALQDLH--------------
M4DMJ2_BRARP/50-278---------------------------------------------------------GLARLVELY--------------
I1P792_ORYGL/80-324---------------------------------------------------------....LVRLL--------------
O81799_ARATH/65-307---------------------------------------------------------GLVNLTELY--------------
B9R8L0_RICCO/69-295---------------------------------------------------------GLTSLKALH--------------
B9R8J9_RICCO/6-227---------------------------------------------------------.FNALTELH--------------
I1JSX1_SOYBN/73-309---------------------------------------------------------GLTLLKDTH--------------
I1JCB7_SOYBN/63-312---------------------------------------------------------GLSGLAELY--------------
Q6DR26_ARATH/51-289---------------------------------------------------------GLSGLEDLY--------------
I1LI84_SOYBN/47-288---------------------------------------------------------GLSLLQDLH--------------
F6I7N0_VITVI/54-299---------------------------------------------------------GLFGLVELY--------------
D7U4W8_VITVI/52-295---------------------------------------------------------RLSGLKDLH--------------
M1AM45_SOLTU/84-311---------------------------------------------------------GLNQLKIVH--------------
B9SCB1_RICCO/57-288---------------------------------------------------------KLAGLKELY--------------
B9GQ37_POPTR/6-226---------------------------------------------------------.FNALRDLH--------------
M4F6V0_BRARP/38-268---------------------------------------------------------SLSFLSELY--------------
W1NLL6_AMBTC/47-272---------------------------------------------------------....LLELY--------------
B9S6Q9_RICCO/61-307---------------------------------------------------------RLTGLKEIY--------------
D7U4W5_VITVI/53-295---------------------------------------------------------RLSGLKDLH--------------
W1NLG7_AMBTC/39-272---------------------------------------------------------NLSALESLY--------------
M4DWB0_BRARP/47-256---------------------------------------------------------RLSNLQDLH--------------
B9H691_POPTR/55-300---------------------------------------------------------SLTKLAELF--------------
I1K763_SOYBN/55-271---------------------------------------------------------KLNGLLDLH--------------
B9HQY2_POPTR/55-285---------------------------------------------------------KLSSLQDLY--------------
W1NLL3_AMBTC/62-284---------------------------------------------------------GLTSLKGLY--------------
I1LQ18_SOYBN/52-289---------------------------------------------------------KLIGLQDLH--------------
B9H1Q2_POPTR/54-287---------------------------------------------------------KLSSLQDVY--------------
B9S6R5_RICCO/44-276---------------------------------------------------------GLSGLEDLY--------------
I1MMY5_SOYBN/60-307---------------------------------------------------------GLSGLAELY--------------
I1J8F0_SOYBN/47-288---------------------------------------------------------GLSLLEDLY--------------
I1LQ24_SOYBN/53-284---------------------------------------------------------KLGGLQDLH--------------
I1LI87_SOYBN/59-300---------------------------------------------------------DLVVLAELY--------------
I1K7E7_SOYBN/73-312---------------------------------------------------------GLTLLKDTH--------------
O81802_ARATH/49-280---------------------------------------------------------GLAGLEELY--------------
M0ZMH9_SOLTU/52-268---------------------------------------------------------SLLGLEELQ--------------
M0ZMI3_SOLTU/62-304---------------------------------------------------------..SGLVELY--------------
W1NMB3_AMBTC/49-272---------------------------------------------------------...SLVDIY--------------
M1CV32_SOLTU/6-232---------------------------------------------------------.FDALRDLH--------------
K3XYN7_SETIT/66-279---------------------------------------------------------.....RALL--------------
B9SCA8_RICCO/40-274---------------------------------------------------------KLAALKDLS--------------
B9GQ33_POPTR/45-272---------------------------------------------------------...GLRVLY--------------
I1J8E6_SOYBN/49-289---------------------------------------------------------GLSLLQDLH--------------
B9GQ28_POPTR/70-294---------------------------------------------------------GLSRLKDVQ--------------
B9MX80_POPTR/54-301---------------------------------------------------------RLSSLGEIY--------------
B9H1P9_POPTR/51-287---------------------------------------------------------KLSSLQDLH--------------
B9H5F4_POPTR/47-286---------------------------------------------------------KLSALKDLH--------------
C5X725_SORBI/48-313---------------------------------------------------------.LHDLSDLH--------------
B9R8K3_RICCO/50-283---------------------------------------------------------RLSGLKDLY--------------
M0ZMH7_SOLTU/50-280---------------------------------------------------------GLVGFGEVH--------------
K4BAG9_SOLLC/50-281---------------------------------------------------------GLIGLGEVH--------------
F6I0V3_VITVI/51-294---------------------------------------------------------KFSGLKDLH--------------
C5Z1Z9_SORBI/69-279---------------------------------------------------------GLAHVDALH--------------
B9R8K1_RICCO/43-287---------------------------------------------------------KLDGLKGLY--------------
I1Q5F1_ORYGL/73-283---------------------------------------------------------GLAHIHALH--------------
F6HRY9_VITVI/47-287---------------------------------------------------------GLSGMEELY--------------
D7L8R0_ARALL/47-260---------------------------------------------------------RLENLQELH--------------
I1LI89_SOYBN/55-296---------------------------------------------------------GLTWLAELY--------------
F6GZJ1_VITVI/47-287---------------------------------------------------------GLSGLQELY--------------
B9HQY3_POPTR/48-292---------------------------------------------------------KLSCLQDLH--------------
K4BAG8_SOLLC/50-281---------------------------------------------------------GLVGFGEVH--------------
B9GQ35_POPTR/42-271---------------------------------------------------------KLSGLKVLY--------------
Q9LMV9_ARATH/5-223---------------------------------------------------------DLEGLRELQ--------------
I1JSM4_SOYBN/57-290---------------------------------------------------------RLNDLQDLQ--------------
I1LQ21_SOYBN/54-281---------------------------------------------------------KLNDMLDLH--------------
Q9SGR3_ARATH/5-223---------------------------------------------------------NFEGLRELH--------------
Q9T007_ARATH/44-253---------------------------------------------------------RLSNLQDLH--------------
W1NLH4_AMBTC/87-311---------------------------------------------------------....LVAIY--------------
W1NMB1_AMBTC/47-278---------------------------------------------------------..GNLRNLY--------------
B9H1Q3_POPTR/51-286---------------------------------------------------------KLSRLQDLH--------------
F6I0U8_VITVI/56-299---------------------------------------------------------RLRGLKDLH--------------
M4D572_BRARP/65-293---------------------------------------------------------GLVNLTELY--------------
B9SIC8_RICCO/82-325---------------------------------------------------------KLSGLQDLH--------------
O81797_ARATH/56-285---------------------------------------------------------GLAKLVELY--------------
M0S0X1_MUSAM/73-287---------------------------------------------------------.FTGIGRLH--------------
K4BFJ4_SOLLC/67-285---------------------------------------------------------GLLGLEELY--------------
M4DMJ4_BRARP/264-522---------------------------------------------------------GLSGLTELY--------------
B9SCA9_RICCO/40-280---------------------------------------------------------KLSGLKDLY--------------
M1BLS9_SOLTU/57-276---------------------------------------------------------.FGDLENLL--------------
K7VCR8_MAIZE/68-278---------------------------------------------------------GLALIDALH--------------
U5GEW5_POPTR/47-282---------------------------------------------------------GLSGLEDLY--------------
F6H0B4_VITVI/70-289---------------------------------------------------------GLSRLRTVH--------------
W1NM94_AMBTC/47-271---------------------------------------------------------...SLVSVY--------------
W1NMA8_AMBTC/46-265---------------------------------------------------------....LSNLY--------------
I1GVA3_BRADI/67-295---------------------------------------------------------GLELLASLH--------------
O81800_ARATH/49-281---------------------------------------------------------GLEGLEELY--------------
I1KLK8_SOYBN/6-235---------------------------------------------------------.FVALKDLH--------------
K3Y257_SETIT/64-278---------------------------------------------------------GLAHVDALH--------------
B9R8K2_RICCO/43-279---------------------------------------------------------KLGGLKDLY--------------
I1LJB5_SOYBN/50-289---------------------------------------------------------KLDGLHALY--------------
C5Z200_SORBI/56-284---------------------------------------------------------GLAHLDALH--------------
I1JCB9_SOYBN/49-286---------------------------------------------------------GLSLLEDLY--------------
U5G7V1_POPTR/53-297---------------------------------------------------------SLTKLAELF--------------
Q9SGR2_ARATH/44-253---------------------------------------------------------KLGVLKNLY--------------
M0ZMH2_SOLTU/54-289---------------------------------------------------------GIVGLVELY--------------
K7K6E8_SOYBN/53-294---------------------------------------------------------DLVVLAELY--------------
B9S6R0_RICCO/59-301---------------------------------------------------------GLVGLAELY--------------
F6I0V1_VITVI/52-295---------------------------------------------------------KLSGLRDVH--------------
I1Q5E9_ORYGL/69-278---------------------------------------------------------GLAHLDALH--------------
I1GVA4_BRADI/72-281---------------------------------------------------------GLAHLAALH--------------
C6TJE7_SOYBN/52-289---------------------------------------------------------DLAALAELY--------------
K4BAH7_SOLLC/51-266---------------------------------------------------------GLLILERLY--------------
I1LI81_SOYBN/55-305---------------------------------------------------------GLSGLANLY--------------
M0ZMH8_SOLTU/54-271---------------------------------------------------------SLLGLEELQ--------------
I1LI83_SOYBN/47-287---------------------------------------------------------GLSLLQDLH--------------
M1AM42_SOLTU/6-226---------------------------------------------------------.FDALRDLH--------------
M1DZL7_SOLTU/49-265---------------------------------------------------------GLIGLEKLY--------------
F6I0U9_VITVI/51-294---------------------------------------------------------KLSGLRDLH--------------
B9GQ32_POPTR/54-282---------------------------------------------------------...LLKNLY--------------
D7U4W6_VITVI/50-293---------------------------------------------------------KLNGLKDLH--------------
U7DWD7_POPTR/42-272---------------------------------------------------------KLSGLKVLY--------------
D7U4W7_VITVI/52-295---------------------------------------------------------KLSGLKDVH--------------
Q501A3_ARATH/75-304---------------------------------------------------------GLSLLKDVQ--------------
I1JSM3_SOYBN/51-293---------------------------------------------------------NLTNLLDLH--------------
I1LQ22_SOYBN/53-289---------------------------------------------------------KLGGLQDLH--------------
M4F849_BRARP/51-285---------------------------------------------------------GLVGLEDLY--------------
I1K762_SOYBN/55-292---------------------------------------------------------..GGLQDLI--------------
Q9SD09_ARATH/38-272---------------------------------------------------------SLSLLSNLY--------------
B9RN27_RICCO/47-287---------------------------------------------------------KLSGLQDLH--------------
F6I0V5_VITVI/51-294---------------------------------------------------------KLSGLKDLH--------------
I1LJB8_SOYBN/56-296---------------------------------------------------------KLTGLQTLH--------------
B9S6R6_RICCO/45-268---------------------------------------------------------GLSGLEDLY--------------

PF05055

U496P_ARATH/28-380------KHLAEVN--QQVSDYIIGYGE.------------VVWENST---------LRSLVETYFESAKKTLDIA-ENVT
U496I_ARATH/47-375------QCLLDMN--QDVVKVILQDKE.------------DIWNNQD---------LFSLVNLYFESTAKTMDFC-SELE
U496O_ARATH/12-347------ECMDNMD--EDVSKLFIEFQQT------------DLREDPD---------LFRLLNHYFTTSKGVSQLC-ESLR
U496G_ARATH/55-391------GYLLELN--QDTVRVIIESKE.------------DVLKNND---------LKALVDVYFKSTSKTLDFC-NTVE
U496C_ARATH/29-372------KHLVEVT--QGVADFITEIED.------------DVWDNQA---------LKYLVLAYFENTKKTLEIF-KTIE
U496A_ARATH/36-363------QCLLEMN--QEVVKVILDCKK.------------DIWKNQE---------MFELVEDYFENSLKTLDFC-AALE
U496F_ARATH/55-392------GFLLELN--QNAVRVIIESRE.------------DVWKNKD---------LKSLVDVYFKSTSKTLDFC-NTVE

PF05633

Q9CAK4_ARATH/2-404ASVAATEQIMSVTWLRKLMDVFLCCEAEFKAILLMGRDPTQISKPP.---------FDRLVPEMLDRSIKALDIC-TAVV
O81749_ARATH/2-390..SQPSDPILSIPWLQNLLDVFMSCEAEFKAVLST....TQISKSPS---------LERVLPEMLDRILKALDLC-NAVV
I1PR59_ORYGL/1-420...PSAPDLLSLAWTRRLLDSFLICLEEFRAILFALADSQPLSRPP.---------LDRLLLDFLDRAVKALDLC-NALR
Q6DYE2_ARATH/31-406......AEILSLEWIGKLLDSFLCCQEDFRVIIFNHKP..QLLKQP.---------MDRLIEEYFERSVKALDVC-NAIR
Q9CA69_ARATH/1-390......EDLLSLEWVGKLLDSFLSCQEEFRSIVINHRS..MITKPP.---------MDRLVSDYFERSVKALDVC-NAIR
Q9M9U5_ARATH/1-382......NDLLSLEWIGKLLDSFLCCQEEFRAIVFNHRS..QISKSP.---------MDRLISDYFERSIKALDVC-NAIR
Q9SUT1_ARATH/2-369.....SYPILSIQWLRKLLDVFMSIESEFHSVLTSN.P.SQISKPP.---------LDKLVPEMLDRIVKALDIC-TAVV

PF03087

B9HQY4_POPTR/51-287------DCV------NKLL..FLPLNQ-------------QAIAQEN.........NGKLIEELLDGSLQVLDLC.NTAK
C5Z203_SORBI/59-286------CVL------DELL..RLPLAQ-------------AALSR...........AADSDDGLLDGFLLLADAF.GTFL
I1LQ17_SOYBN/43-281------ECA------DKLL..LLPITQ-------------QALAREC.........SNECVDELLDGSVRILDIC.STIK
M4DMJ2_BRARP/50-278------DFV------NQQVI.SSPQGQ-------------QVLCLSH.........NAKLVEESLDESILLLDVA.DFAR
I1P792_ORYGL/80-324------AGL------TELL..HHPQAQ-------------DPLRPPRK........AAPWTERLLDDLLLLADAH.GCFR
O81799_ARATH/65-307------GCV------HELL..ESPYVK-------------HTLLHHQ.........EGKLLDESLDGSVLLLDVY.EGTR
B9R8L0_RICCO/69-295------DSL------DDIL..HLPQTQ-------------ESLRR...........HPKWIEKLLDDFLRFVDVY.GTFQ
B9R8J9_RICCO/6-227------NSA------NNLL..HSPEIQ-------------RVLVHQK.........QEKWVQEVCDASLRMLDVC.GISK
I1JSX1_SOYBN/73-309------ETL------QHIL..QLPQTL-------------ETLRS...........HPLWVEKLLEDFLRFVDAF.GMFQ
I1JCB7_SOYBN/63-312------KCI------EDLL..KLPLTQ-------------QAIGQHQ.........NEKWVNELLDCPVGFLDLL.GKTR
Q6DR26_ARATH/51-289------DCS------EDLL..KMGSTQ-------------RVLSFSDEKKKKKRKVKGEFMEEMLDGSLRLMDIC.NVSR
I1LI84_SOYBN/47-288------IRL------EDLL..NMASTQ-------------KMISNHQ.........GEECIEELLDGSVRILDIC.GITR
F6I7N0_VITVI/54-299------RCV------EELL..NLPLTQ-------------QALAQYQ.........HEKWVNELLDGSVKYLDIC.SKAS
D7U4W8_VITVI/52-295------DCV------DDLL..LLPLTQ-------------QTLAHHR.........HEKWVNELLDGSLKLLDVC.GTAK
M1AM45_SOLTU/84-311------ESL------DDLL..LLPQTR-------------ESLHG...........HSDLVEKLLDDFLHFVDVY.GIFQ
B9SCB1_RICCO/57-288------ECF------NDFL..QLSLTQ-------------KTLSQEK.........QNQSVEEALNGSLGLLDMC.STIR
B9GQ37_POPTR/6-226------NSA------NDLL..HSPEIQ-------------QVLVSQK.........QEKWLHEVSEASLRMLDVC.GVSK
M4F6V0_BRARP/38-268------DSL------SNLF..KESPAS-------------LLLPHHS............FFTHLLDLSLVHLDLC.SKLR
W1NLL6_AMBTC/47-272------DVF------DDLL..QLPQTL-------------DALHS...........EDKSVNEMLDDSLNLLDVC.SVMR
B9S6Q9_RICCO/61-307------TCI------ESLL..NLPLTQ-------------QALAQHQ.........QEKWVGDMLDGLIRHLDVC.SNTR
D7U4W5_VITVI/53-295------DCV------DDLL..LLPLTQ-------------QALAQHR.........HEKWVDELLDGSLKLLDVC.GTAK
W1NLG7_AMBTC/39-272------DNL------DSLL..SLLLTE-------------DVLCR...........QSEGVNELLEDYLRLVDSC.DKMR
M4DWB0_BRARP/47-256------DSL------DKML..RLSITN-------------KALSQVQ.............VEKLLDGSLRILDLC.NVAK
B9H691_POPTR/55-300------NCI------QDLI..HSPLTQ-------------QAF.HHQ.........HLSHVEGAIEGSVGLLDVC.STVR
I1K763_SOYBN/55-271------DCT------YKLL..QVPIKQ-------------QALAREC.........SDKCVDDILEVSLRLLDIC.STAK
B9HQY2_POPTR/55-285------DSV------DKFL..QLPLTQ-------------QGLAQQR.........NQKCVDELLEGSLRLLDTC.NSTQ
W1NLL3_AMBTC/62-284------DCF------DDLL..QLPQTQ-------------GALSH...........NIKWANALLEDLLKLLDSH.STFR
I1LQ18_SOYBN/52-289------DYA------DKLL..QLPTTQ-------------QAFGHKC.........SDKWVDVLLEGSLGLLDIC.STAQ
B9H1Q2_POPTR/54-287------DSV------DKFL..QLPLTQ-------------QGLAGEH.........NQKCTDEILDGSLRLLDVC.NSAK
B9S6R5_RICCO/44-276------NGF------NDLL..NMSTAQ-------------EVLTHSR.........NEKCLDELLDGSVKLLDIC.GITR
I1MMY5_SOYBN/60-307------KCI------EDLL..KLPLTQ-------------QALGQHQ.........NEKWVNELLDCPVGFLDLL.GKTR
I1J8F0_SOYBN/47-288------ICL------EDLL..NVASTQ-------------KVISNHQ.........GEKCMEELLDGSVGILDIC.GITR
I1LQ24_SOYBN/53-284------ECV------EKLF..QLPLSQ-------------EALNHEC.........QENRVDELLNGSLRLLDVC.TAAK
I1LI87_SOYBN/59-300------NCM------EELF..HSPQTK-------------QTLLRYQ.........DGKLVEEALRGSVTLLDAC.ESAR
I1K7E7_SOYBN/73-312------ETL------QHIL..QLPQTL-------------ETLRS...........HPLWVEKLLEDFLRFVDAF.GMFQ
O81802_ARATH/49-280------IFL------EEFL..KMGSKQ-------------RVMSSG..........GSEFMEEMLDGSLRLMDIC.SVSR
M0ZMH9_SOLTU/52-268------KCT------DDLL..QLPQTF-------------QIISQRQ.........HVKWFEELLGNSIRILDVC.GTTG
M0ZMI3_SOLTU/62-304------ECV------EELL..ALPMTQ-------------RALLQHQ.........DDNFVKELLERSVRFIDIC.SNTR
W1NMB3_AMBTC/49-272------STL------NILL..QLPLTQ-------------ETLRR...........QDEWVSNIVDDSIKLLDLC.NKIR
M1CV32_SOLTU/6-232------ESA------NDML..HSPVIK-------------RDIAHQG.........QEKWTHEVSETSLRMLDVC.GTTK
K3XYN7_SETIT/66-279------CVL------DELL..HLPLAQ-------------GALV...............AADSLLDGFLVLADAF.GTFL
B9SCA8_RICCO/40-274------ECI------DEFL..QLSLTQ-------------QTLSHEK.........QNQSVEATVNGSLGLLDMC.QTTK
B9GQ33_POPTR/45-272------ECV------DDFL..QLPLTQ-------------QTLSNEQ.........QKERAEEVLNGSLLLLDVC.SNTK
I1J8E6_SOYBN/49-289------TCL------EGLL..NMGSTQ-------------KLISNHQ.........GEKCMEELLDGSVRILDIC.GITR
B9GQ28_POPTR/70-294------DSL------DDFL..QLPQTR-------------ESLRR...........QPKWVEKLLEDFLRFVDVY.GIFQ
B9MX80_POPTR/54-301------RCV------EDLL..NLPMTQ-------------QALLQHR.........NEKLMNDMLDDLMRYLDVS.GKTR
B9H1P9_POPTR/51-287------DCV------NKLL..LLPLTQ-------------QAIAQEN.........NGKWVDELLDGSLQVLDLC.NTAK
B9H5F4_POPTR/47-286------DSF------DDLL..HFPLIQ-------------QVLSNEH.........YSKCIEESLERSIRFLDVCGTTTR
C5X725_SORBI/48-313------EYV------EEVV..RLPTNW-------------DALRLPR.........HRRLVEGELEASVTLLDLC.GAAR
B9R8K3_RICCO/50-283------DSV------EDLL..QLPLTQ-------------KDLTNEQ.........HRKSVDEVLDGSLKLVDLC.STTR
M0ZMH7_SOLTU/50-280------KCM------GDLL..NLPSTL-------------QALSQCQ.........NKKWVDEILDKSVRFLDIC.GTTR
K4BAG9_SOLLC/50-281------KCM------IDLL..NLPLTL-------------QSLSQCQ.........NKKWVDEILDKSVRFLDIC.GTTR
F6I0V3_VITVI/51-294------DCV------DNLL..LLPFTQ-------------QSLAQYH.........HEQWIDELLDGSLRLLDLC.DTAK
C5Z1Z9_SORBI/69-279------AAL------GDLL..DLPEAQ-------------AALT............LSATGDRLLDAFLRLADAH.GSFQ
B9R8K1_RICCO/43-287------ESV------DDLL..QIPLAQ-------------RAFSHEQ.........NVKSVQDILDGSVRLLDIC.STTK
I1Q5F1_ORYGL/73-283------AAL------ADLL..LLPDPQ-------------DALRR...........STAAADRLLDAFLLLADAH.QGFH
F6HRY9_VITVI/47-287------KCL------DELL..SLQSTQ-------------QAISHHQ.........HEKWVEELLDGSVSLLDVC.GTTR
D7L8R0_ARALL/47-260------ESL------DKFI..RLPVTQ-------------QALGQEQ.........NKKAVEQLLDGSLRILDLC.NISK
I1LI89_SOYBN/55-296------NCV------EELV..GCPLTQ-------------QALLRHE..........GKHVEKPLDMSVCLLDMC.GSAR
F6GZJ1_VITVI/47-287------KCL------DELL..GLPSTQ-------------QALSHHQ.........HEKWVNDLLDGPVRILDVC.GSVR
B9HQY3_POPTR/48-292------DCV------DKLI..LLPLTQ-------------KYLAQEQ.........NEKWVDDVLDGSLRVLDVC.SMAT
K4BAG8_SOLLC/50-281------RCM------GDLL..NLPSTL-------------QALSQCQ.........NKKWVDEILDKSVRFLDIC.GTTR
B9GQ35_POPTR/42-271------ECV------DDFL..QLPLTQ-------------QTVSNEQ.........HKERAEELLNGSLLLLDVC.GTTR
Q9LMV9_ARATH/5-223------DCA------NYLLD.HCPEAR-------------ESLCQQG.........KENWIEQVSEASLIMLDVC.NVSK
I1JSM4_SOYBN/57-290------ESA------DKLL..QLTISQ-------------QGLAQEC.........RSKQIDELLDRSLRLLDIC.STIK
I1LQ21_SOYBN/54-281------DYT------DKLL..QLPMEQ-------------QVSAQEC.........NDRCVDDLLEGSLRLLDIC.STTK
Q9SGR3_ARATH/5-223------DCV------NYLLH.HCPKTR-------------ESLSQQG.........QEKWTEQVSEASLRMLDIC.NVSK
Q9T007_ARATH/44-253------DSL------EKMI..RLSVTN-------------LALSQDQ.............IEKLLDGSLRILDLC.NIAK
W1NLH4_AMBTC/87-311------DDS------DDLL..RLPFVH-------------EAIRR...........QHKCVEEILDETIMLMDMC.SKMN
W1NMB1_AMBTC/47-278------NDL------DDLL..RLPLAQ-------------HVLCK...........CKDEVEELVEDSLSLLDAC.DKMR
B9H1Q3_POPTR/51-286------DCV------SKVL..LLPLTQ-------------QAIAQEN.........NEKWVDELLDGSLQVLDLC.NTAK
F6I0U8_VITVI/56-299------DSV------DDLL..LLPLTQ-------------QTLAQHR.........HEKWVDELLDGSLRLLDVC.GTAK
M4D572_BRARP/65-293------GCV------HELL..ESPYVR-------------HTLRHHQ.........KGKLLDESLNVSVVLLDVC.EAAR
B9SIC8_RICCO/82-325------DSI------DKLL..LLPLTQ-------------QVLAHQN.........NRKWVDELLDGSLRVLDVC.NAAK
O81797_ARATH/56-285------DFV------NEQVI.SSPQGQ-------------QALRLCR.........NRKLVEDALDESIVLLDVS.DFTR
M0S0X1_MUSAM/73-287------DAL------HDLL..RLPLAR-------------DRLR............PAPWADRLLDAFLRLADAH.GSFR
K4BFJ4_SOLLC/67-285------KCV------NALL..NLPQTL-------------QAFSQYR.........LGKMVEDLLDKSVRLLDLC.GTTR
M4DMJ4_BRARP/264-522------RCL------SEDLFKSSSETQ-------------QALL............NSGLMDKLLEVSLKYLEVC.GGAK
B9SCA9_RICCO/40-280------DCI------DDLL..QLPLTQ-------------QTLSHEK.........QSQCAEEALDGSLRLLDMC.ASTR
M1BLS9_SOLTU/57-276------DYT------EDLL..QLPHVQ-------------QAISLN..............IDELLEGYLKVLDIC.STIK
K7VCR8_MAIZE/68-278------AAL------AELL..LLPEPQ-------------AAVRR...........PSAASDRLLDAFLLLADAH.RGFQ
U5GEW5_POPTR/47-282------KCM------DDLL..NLASTQ-------------QVLSRYE.........NEKCLDELLDGSVRLLDVC.SIGR
F6H0B4_VITVI/70-289------YSL------DDIL..QLPQTQ-------------ELLRR...........QPAAVEKLLEDFLGFVDLY.GRFQ
W1NM94_AMBTC/47-271------DSL------DDLL..HLPLVP-------------EALYR...........QDRWVCQMLEDSLQWIDVC.SRMR
W1NMA8_AMBTC/46-265------NDL------DGLL..QLQLSG-------------EAIRH...........DDKFVSEMLDDTLTLLDAC.SRMG
I1GVA3_BRADI/67-295------ASL------ADLL..ALPEAQ-------------AALLPS..........SSSNGDRLLDAFLRLADAH.GCFQ
O81800_ARATH/49-281------NCT------EDFL..KMGSTQ-------------RVMSSSD.........GSEFMEEMLDGSLRLMDIC.SVSR
I1KLK8_SOYBN/6-235------NSA------NNLL..HSPMVQ-------------QAIVHQT.........EEKWFDDVSESSLRMLEVC.GISK
K3Y257_SETIT/64-278------AAL------GDLL..DLPEAQ-------------AALS............AGASHDRLLDAFLRLADAH.GSFQ
B9R8K2_RICCO/43-279------ERV------DDLF..QLPLIQ-------------QALSHEY.........QDKCVDDLLDGSLRLLDVY.STTR
I1LJB5_SOYBN/50-289------ECT------DKIL..QLSTIQ-------------QALAQES.........CKTRVDELLEGSLRLLDIC.SATK
C5Z200_SORBI/56-284------AAL------AELL..VLPEPR-------------AALATAT.........ATAFSDRLLDGLLALADAH.GAFR
I1JCB9_SOYBN/49-286------ICL------DDLL..NMASTQ-------------KVISHHR.........GDKCVEEVLDGSVRILDIC.GITR
U5G7V1_POPTR/53-297------NCI------QELI..HSPLTQ-------------QAF.HHQ.........HLSQVEEALEGSVALLDVL.SRVR
Q9SGR2_ARATH/44-253------EVV------EVFLRFQTTKTQ-------------KSFTGFE...............DVSDGFIEVLDIC.STIR
M0ZMH2_SOLTU/54-289------NSF------QELL..QCPSTQ-------------KALIQHQ.........NGGFVEEATEGSLELLDSC.ATIR
K7K6E8_SOYBN/53-294------NCM------EELF..NSPQTQ-------------QALLHYQ.........NGKLVEEALCGSVTLLDAC.GTAR
B9S6R0_RICCO/59-301------NYV------EQIF..LTPQAQ-------------QAIIHYQ.........NGKLVEEALDGSLTLLDTC.GTAK
F6I0V1_VITVI/52-295------DCV------DDLL..LLPFTQ-------------QTLAQNR.........HEKWVDELLDGSLRLLDIC.GAAK
I1Q5E9_ORYGL/69-278------AAL------GELL..DLPEAQ-------------AAL..............SAANDRLLDAFLRLADAH.GSFQ
I1GVA4_BRADI/72-281------AAL------ADLL..LLPEAQ-------------SALA............SSASSGGLLDAFLLLADAH.QGFQ
C6TJE7_SOYBN/52-289------NCM------EELF..HSPQTQ-------------QALLHYQ.........NGKLVEEALCGSVTLLDAC.GTAR
K4BAH7_SOLLC/51-266------KSI------DGLL..NLPS.R-------------QTLSQSL.........DAKWVDDLLDKSVRLLDVC.GTTR
I1LI81_SOYBN/55-305------ECM------EDLL..KLPLTQ-------------QALSHHH.........NQKWVDELLDCPVRFLDIL.GETR
M0ZMH8_SOLTU/54-271------KCT------DDLL..KLPQTF-------------RIISQRQ.........HVKWFEELLGNSVRILDIC.GTIK
I1LI83_SOYBN/47-287------IDL------EDLL..NMASTQ-------------KLISNHQ.........GEKCMEELLDGSVRILDIC.GITR
M1AM42_SOLTU/6-226------DSA------NDLL..HSSMIK-------------REIAHQG.........QEKWVHDVSETSLRMLEVC.TTTK
M1DZL7_SOLTU/49-265------KCI------DDLL..NLPQIL-------------QALSQSL.........NAKWLDDLLDKSVRLLDLC.GTIR
F6I0U9_VITVI/51-294------DCV------DDLL..LMPLTQ-------------QILAQYR.........HEQWVDELLDGSLRLLDIC.STAK
B9GQ32_POPTR/54-282------ESV------DDFI..QLPLTY-------------QAISNVQ.........HQGSVDEVLDRSLRLLEVC.GATK
D7U4W6_VITVI/50-293------DCV------DNLL..LLPLTQ-------------KTLAQHY.........DEKWVDELLDGSLRLLDVC.GTAK
U7DWD7_POPTR/42-272------ECV------EDFL..QLPLTQ-------------QTLSNEQ.........QKERGEEVLSGSLLLLDMC.STTR
D7U4W7_VITVI/52-295------DCV------DDLL..LLPLTQ-------------QALAQNC.........LEKWVDELLEGSLKLLDVC.GTAK
Q501A3_ARATH/75-304------ETL------ADIL..QLPQSQ-------------ESLRN...........RPVFFENLLEDLLRFVDAY.GIFR
I1JSM3_SOYBN/51-293------GCI------EKLV..QLPLTQ-------------QALVQEC.........QEKWVDDLLDGSLRLLDAC.TATK
I1LQ22_SOYBN/53-289------ECV------ENLF..QLSLTQ-------------EALHHEC.........QENWVDELLNGSLRLLDVC.TAAK
M4F849_BRARP/51-285------ECT------EECL..KMGSTR-------------NVLSFNAERK....KMKGEFMEEMLDGSLRLMDIC.NASR
I1K762_SOYBN/55-292------ECV------EKLI..QLPLTQ-------------DVFLHEC.........QENWVDELLDGSLRLLDVC.TSAK
Q9SD09_ARATH/38-272------DSV------SHLF..NDSPSS-------------LLVPHHS............FFTHLLDLSLLHLDLC.SKLR
B9RN27_RICCO/47-287------DCV------DKLL..LLPLTQ-------------QALAQQQ.........NRKWIDELLDGSLRLLDVC.NAAK
F6I0V5_VITVI/51-294------DCV------DNLL..LLPLTQ-------------QILAQHG.........HKIWVDELMEGSLSLLDAC.GTAK
I1LJB8_SOYBN/56-296------DCI------EKLV..RLPLTQ-------------EVLVQER.........QEKWVDELLDGSLRLLDVC.TVAK
B9S6R6_RICCO/45-268------EGV------NDLL..NMSSAH-------------EILTHHR.........NEKCIDEFLDGSVKFLDIC.EITR

PF05055

U496P_ARATH/28-380EYVDEAKRGE.RYIVAAVAQFEKDK.ENDVG..KKTKRY-ENTLRELKKFEA---------MG--NPFDGDK.......F
U496I_ARATH/47-375NCLNRARRSQ.VIIQFAVNQFEEENEDK......ENRKY-EKTLEELKRFKV---------AG--EPFTKE........F
U496O_ARATH/12-347TCLERSENNECLLLDEALVDFELEKLGY..GGSLEEASF-RKTYRDLRNFNA---------FY--NNNSGEEDDLDYCEF
U496G_ARATH/55-391KCVKKAEISQ.LIIRFAVKQFETETVDTDLG.ESKKKKY-VKTLEEMNKFKA---------MG--DPFDGE........F
U496C_ARATH/29-372NCVENAEMGQ.LLIREALAEFEKESAEKDVG..GKKKKY-EKTLEDLKSFKE---------MG--DPFDGKV.......L
U496A_ARATH/36-363KGLRRARDSH.LLILVALQQFEDESLVQG......GNGY-KKTLEELKNFKD---------AE--SPFNED........F
U496F_ARATH/55-392NCVKRTEISQ.LIIRFAVKQFEAESVDTDLGGDKKKKKY-TKTLEELNKFKA---------MG--DPFDGE........L

PF05633

Q9CAK4_ARATH/2-404NGIDSVRHYQ-RLAEIAVTALEQR........PLGDGNV-RRAKRALANLVVALSLEDKENVS--GGGGGGG..GGNKTT
O81749_ARATH/2-390NGIDSVRQSR-RFAEIAVTALKQR........PLCDGSV-RRAKRALTSLLIGLNADERRDRN--SGGSGCS..NQRRTT
I1PR59_ORYGL/1-420DGLDLIRQWR-KHLAIAAAALAPAPA...PAAQRGEAQI-RRARKALTDLTILMLDD....KD--AGGVVG...QRNRSF
Q6DYE2_ARATH/31-406DGIEQIRQWQ-KLIEIVISALDTN......QRQLGEGEI-HRAKKALIDLAIGMLDE....KD--SSNT.....HRNRSF
Q9CA69_ARATH/1-390DGVEQIRQWQ-KLIEIVICAFNNNGGGSSGKRPLGEGQF-RRARKTLIELAIGMLDE....KD--SSSSSVSSQHRNRSF
Q9M9U5_ARATH/1-382DGIEQIRQWE-KLADIVISALDSH.......RPIGEGQL-RRAKKALIDLAIGMLDE....KD--HPSGTNL.AHRNRSF
Q9SUT1_ARATH/2-369NGVDSVRQIQ-RCAEIAVTALKQT........PLSDGSV-RRAKRALTSLLAALNAD....KN--SGSSGGG..SGRRSS

PF03087

B9HQY4_POPTR/51-287DALLQTKESV-HELQSILRR...RGCV.E..TGL.TSEV.KKYLTSRKVVKR---------AI..HKA...L.....KV.
C5Z203_SORBI/59-286AALVALRQHA-AELRAP......RD..........GAKL.ASAAREQRQAGR---------EL..EQLANAV.....ARE
I1LQ17_SOYBN/43-281DCLLQHKERV-HELESAIRR...R.RDAE..AGF.TVSS.GKYLASRKQVKK---------AI..RKALGNL.....KG.
M4DMJ2_BRARP/50-278DLIGTFLERI-QDLQSTIRR...RGGD....NSIVQSEI.SAYIRFQKKFKN---------SA..SRQLKSV.....AR.
I1P792_ORYGL/80-324EALLALKQLL-AEAHAALRR...RD..........ATRL.AAALRARRRSDR---------DL..SRLASTLRDLSYRSS
O81799_ARATH/65-307EVIVAMREHV-TNLKSALRR...K.......GSL.EKEA.KAYFNLRKKAKK---------EI..SKQINAL.....KK.
B9R8L0_RICCO/69-295TSFLSLKEDQ-LAAQVAVRK...RD..........DSKI.ALYIKSRKKMAK---------EM..SKLAYTV........
B9R8J9_RICCO/6-227DVLLLAKEHL-IDLQFTLRR...KFLSQPNI....NAKI.AAYNYYRKKLKK---------ET..LKCLRSL.....KG.
I1JSX1_SOYBN/73-309TSIMSLKEEH-SSAQMAIRK...RD..........ESRV.VAYVKAKKKISK---------EM..EKLVSVLRCVHVTQH
I1JCB7_SOYBN/63-312DSILLMKGSV-GELQSALRR...KRV.GD..LYM.ESYL.STYWRLRRNMRK---------EC..TKSWLLL.....KQ.
Q6DR26_ARATH/51-289DLMVETHEHV-LGLQSCVRR...RK..........DVDV.SGYVGFRKNMRK---------EV..KKLLGSL.....KN.
I1LI84_SOYBN/47-288DTMLQTKENV-QALHSALRR...RK..GD..SNI.EKIV.AEYNCFSKKMKK---------NV..KKLMTSL.....KQ.
F6I7N0_VITVI/54-299DTVLLMKESV-RELQSALRR...RKG.GE..FSI.EGNV.AGYTCCRKKMKK---------EV..AKSLSSL.....KQ.
D7U4W8_VITVI/52-295DALLQTREHA-NELQSSLRR...RRGG.Q..NGI.STEV.GEYLTSRKKVKK---------AM..HKALRNL.....KS.
M1AM45_SOLTU/84-311TLILTFKEEH-LAAQVAVRR...KD..........ESKI.ASYAKALRKMAK---------EM..DKLAFNV........
B9SCB1_RICCO/57-288DFFSQMRGCM-QGLEASLRR...RKTG.E..SVF..NEV.DTYMVTRKKLKK---------VI..YRYLRNL.....KK.
B9GQ37_POPTR/6-226DVLLLVREHL-LDLQFTLRR...KRVCKQDI....STEI.AAYNLYRKKLKK---------GT..LKCLKSL.....KG.
M4F6V0_BRARP/38-268DITCRIKDSI-RDLRSAFRR...RRHGGD..STI.QCHV.KAFTRSRRLIHK---------DL..AKLLLLL.....KQT
W1NLL6_AMBTC/47-272DAISRLREQH-QIILSFLRR...RDYTRM......EG...QAHVSARRKMNK---------EL..EKCLSTL.....KR.
B9S6Q9_RICCO/61-307DAILLMKESV-RELQSALRR...SKAGGE..LSI.ESNI.NAYFCSRKKMKK---------EA..AKFLAAL.....KQ.
D7U4W5_VITVI/53-295DALLQTREHA-HELQSSLRR...RRGG.E..NGI.STEV.GEYLTSRKKVKK---------AI..HKALSNL.....KS.
W1NLG7_AMBTC/39-272DVVARVRVEQ-RGVLFMLRR...RDRSGL......EARI.GTYTRSRKQMTK---------EL..TKCLENL.....RH.
M4DWB0_BRARP/47-256DALSQMKEGL-KEIQSILRR...KRGD......L.SAEV.KKYLATRKFLKK---------SF..QKVVKNL.....KV.
B9H691_POPTR/55-300DLFLTMKEHV-QDMQSLLRR...RGAR.D..LSI.ESNV.LAYVSFRKKTTK---------EI..TRSIRTL.....KR.
I1K763_SOYBN/55-271ECQLISKESM-QELHSVIQR...R.KGDE..TVF.TKVG.GKYLASRNKLKK---------T.........M.....KA.
B9HQY2_POPTR/55-285DALLQSKEFI-RELQSVIRR...RQGGVD.......SEI.RKYIASRKVVKK---------SI..KKALRNL.....KG.
W1NLL3_AMBTC/62-284AALLALNEQQ-LGVQVALRR...RDPSI.......RAKL.GSFLRFRKKMTK---------VI..SVFLPVL........
I1LQ18_SOYBN/52-289DCLLQSKESV-HMVQSVIRR...KCPDTE....F.AVEG.GKYLASRKKMKK---------AI..QKALGNL.....KG.
B9H1Q2_POPTR/54-287DALLQSKEYI-RELQSVIRR...RQGGHD.......SEI.RKYIASRKVVKK---------KI..KKALKNL.....KG.
B9S6R5_RICCO/44-276DVMLQFKEQV-QSLQSALRR...RK..GD..SSI.ETSI.SGYTCFRKKMKK---------DA..KTFVANL.....KQ.
I1MMY5_SOYBN/60-307DSILLMKESV-GELQSALRR...KRV.GD..SDR.ESYL.STYWRLRRNMRK---------ES..TKSMLLL.....KQ.
I1J8F0_SOYBN/47-288NTMPQVKENV-QALHSALRR...RK..GD..SSI.EKSV.AEYNFFTKKMKK---------NA..KQLMTSL.....KQ.
I1LQ24_SOYBN/53-284DSLLHTKECM-RELQSVIRR...RKGG.E..VEL.KAEI.KKFLTSRKVVKK---------AI..SKALANL.....KG.
I1LI87_SOYBN/59-300DLLLVLKEHM-QTLHSAVRR...RKG..D..SNI.ESII.SAYESFKKKAKK---------TI..AKQLGQL.....KR.
I1K7E7_SOYBN/73-312TAIMSLKEEH-SSAQMVIRK...RD..........ESKV.VAYVKAKKKISK---------EM..EKLVSVLRCVHVTQH
O81802_ARATH/49-280DLMVETHEHV-RGVQSYVRR...KKVSGGGGGDKIDVAV.SDYVGFRKNMRK---------EA..KKLLGSL.....KK.
M0ZMH9_SOLTU/52-268ELISQYKENI-RALQSSFRR...RK..GD..SSA.EAGI.ARFTSFSKKMKK---------DA..KKLVLSL.....KQ.
M0ZMI3_SOLTU/62-304DTVMCLKESV-RELQSALRR...SKA.GDDLLTI.EGSV.NAYISSRKNTQK---------EI..EKSLTIL.....KQ.
W1NMB3_AMBTC/49-272DAIIQVRGQH-QGLLSALRR...RDHKGL......EGQV.GGYISSLKKMSK---------EF..AKCIGTL.....GK.
M1CV32_SOLTU/6-232DVLLLVKDHV-HDLKCTFRR...ISVGK...NAITENKF.APFHFHRKKLKK---------EM..LKRLHSL.....KG.
K3XYN7_SETIT/66-279AALLALRQHA-SELHAAVRR...RD..........AAKL.ASAARAQRQVGK---------EL..EQLAAAV.....ARE
B9SCA8_RICCO/40-274EFFSQMRDCV-QGLQLSLRK...RKGG.E..SGL..IGI.DSYMVSRKNLNK---------AI..RKYQKHL.....KK.
B9GQ33_POPTR/45-272DVFSSMKECF-KRLESSLRR...RKGG.E..SGI.ASEI.EAYVVSRKQLNK---------TT..RKCFRNL.....KS.
I1J8E6_SOYBN/49-289DTMLQIKENV-QSLHSALRR...RK..GD..SSI.EKII.AQYNFFSKKMKK---------IA..KKLITSL.....KQ.
B9GQ28_POPTR/70-294TLVLAVKDDQ-VAAQVAIRK...KD..........DSKI.ALYLKSRKKMAK---------EM..AKLVSTV........
B9MX80_POPTR/54-301DAAVLMKESI-RDIQSALRR...SKAGGE..LSI.ESNV.NAYFCARKKMKK---------EV..AKSLASL.....KH.
B9H1P9_POPTR/51-287DALLQTKECV-YELQSILRR...KGCR.E..VGL.TSEV.KKYLTWRKIVNK---------AI..HKA...L.....KG.
B9H5F4_POPTR/47-286DVFSQMKECV-QELESSLRR...KRCG.E..SSCSENEV.GAYMISRKRLNK---------VI..SKCFRNL.....KR.
C5X725_SORBI/48-313DGLADAKEQV-RDLRSLLRRH..RRAANSSHGAPRRGGVDAAAASVSARAAE---------AC..AVPLKKVARAIRRE.
B9R8K3_RICCO/50-283DIFSQMKECL-KELESSLRR...RKGG.E..SGL.PSEF.QTYIASRKKLNR---------AV..GKCFRNL.....KT.
M0ZMH7_SOLTU/50-280DLMSQFKEHV-KDVQSSLRR...RK..ED.......LSI.NKYTTFRKKMKK---------DV..KNLVTAL.....KK.
K4BAG9_SOLLC/50-281EITSQFKENV-KDIQSTLRR...RK..GD.......LSI.NKYTTFRKKMKK---------EA..KSLITAL.....KR.
F6I0V3_VITVI/51-294DALLQTREGA-NELQSSMRR...RRGS.E..NGI.SSEI.GKYLTSRKKVKK---------AI..HKALRNL.....KG.
C5Z1Z9_SORBI/69-279EAVVELKRDV-AEALAAVRR...RD..........GARL.ASALRSQRKAGK---------DL..ARLAASA.....ARD
B9R8K1_RICCO/43-287EVLSQVKCCL-QDLESSLRR...NNGC.Q..SRL.ENEI.KKYMVSREKVHK---------IV..EKCLGNL.....KK.
I1Q5F1_ORYGL/73-283EALLDLTHHV-ADARAALRR...SD..........AARL.ASALRSQRRAEK---------EI..ARLASTV.....SAA
F6HRY9_VITVI/47-287DVISEFKENV-GDLQSALRR...RK..GD..VCI.ESSI.NNYICSRKKMNK---------DA..KKLLAAI.....KK.
D7L8R0_ARALL/47-260DALSQMKEGL-MEIQSILRR...KRGD......L.PGEV.KKYLASRRSLKK---------SF..QKVLKSL.....KV.
I1LI89_SOYBN/55-296ELLSLVKEHV-LDLQSALRR...KGV..D..SSV.NSQI.CAYICFRKKAKK---------DI..TKKLKAL.....KT.
F6GZJ1_VITVI/47-287DVIAQFKEKI-RDLQSALRR...RK..GD..LCV.ESSI.SNYICSRKKMNK---------DS..KKLLAAM.....KK.
B9HQY3_POPTR/48-292DALLQTKECA-QELQSIMRR...RRGN.E..IGV.SSEI.KKYLTSRKVVKN---------TI..HKALRGL.....KY.
K4BAG8_SOLLC/50-281ELVSQLEENV-KDVQSSLRR...RK..GD.......LSI.NNYTTFRKKMKK---------EA..KSLITAL.....KR.
B9GQ35_POPTR/42-271DVFSSMKECL-QLLESSLRR...RKGG.E..SGL.ATEV.EAYMVSRKQINK---------TI..RKCFRNL.....KS.
Q9LMV9_ARATH/5-223DVMALVRHGL-QDLQLTLRC...NGSNLS.......EKV.AAYNRYRNKLKK---------ET..LKCLNSL.....KS.
I1JSM4_SOYBN/57-290DCLLQSKDSM-HELGSVIRR...K.RDAE..TGF.TTEG.GKYLACRKKMKR---------AI..AKALRDL.....KA.
I1LQ21_SOYBN/54-281DCLLQSKESM-CDLMSVIRR...K.KSNE..TGF.AVEG.VKYLAARKNMKK---------QI..RKALENL.....K..
Q9SGR3_ARATH/5-223DVMTLVKHSL-QDLQLTLRG...NESSDV......NEKI.AAYNRYKNKLKK---------ET..LKCLNCL.....KN.
Q9T007_ARATH/44-253DAISQMKEGL-MEIQSILRR...KPGD......L.SGEV.KKYLVSRKFLKK---------SL..QKVIKSL.....KV.
W1NLH4_AMBTC/87-311DAIARVREQQ-RGALSALRR...RDHTAL......RGQI.RACILAQKKTTK---------AL..ATCLCAL.....RK.
W1NMB1_AMBTC/47-278GVVAKVREQQ-QGILSTIRR...RDHFGL......DELV.SIYIRSRKKMTK---------DL..TRCLGTI.....AT.
B9H1Q3_POPTR/51-286DSLLQTKECM-HELQSILRR...RGYG.E..IGL.TNEV.KKYLASRKVVRR---------AI..HKA...L.....KV.
F6I0U8_VITVI/56-299DALLQTREHS-HELQSSLRR...RQGG.E..NGI.AAEV.GEYLTSRKTVKK---------AM..HKALRNL.....KG.
M4D572_BRARP/65-293EVVATMREHM-MNLKSALRR...K.......GSV.EKEV.RAYVNVRKKAKK---------EI..SKHLNGL.....KK.
B9SIC8_RICCO/82-325DALLQTKEYT-LELQSTIRR...RQGSCE..NVL.ATEV.RKYITSRKMAKK---------AI..QKAMNDL.....KG.
O81797_ARATH/56-285DLIGTLMEHI-QELQSALRR...RRGN....LSSVQSEI.RSYISFHKKSKT---------EA..ARQVKSL.....AR.
M0S0X1_MUSAM/73-287SAALALRQHL-SEARAATRR...HD..........PGRL.SSALRAHRRAEK---------AL..ARLASA......AKD
K4BFJ4_SOLLC/67-285ELVLQYKENV-RDLQSSLKR...RK..KD..STT.QSSI.TKFTSFSKKIKK---------EA..KRLVVVL.....KQ.
M4DMJ4_BRARP/264-522DSASRIKKSV-VELQSALRR...SKKGGE..FSL.ENDM.DAYMASRKENKK---------EI..KKYMVMS.....KE.
B9SCA9_RICCO/40-280GFFSQMKESV-QELELSLRR...RRAG.D..TGL.TTEV.NAYMESRKKLNK---------VI..YKKLRNL.....KR.
M1BLS9_SOLTU/57-276DLLSNEKQNR-QDLLSALRR...RRNMDD.........I.SGYLTSRRKSKK---------MI..QKVVKSL.....KS.
K7VCR8_MAIZE/68-278EVLLALRRDA-ADARLALRR...RD..........AARL.ASASRAQRRGDR---------EL..ARLA........ARS
U5GEW5_POPTR/47-282DILLRFREQV-QALQSAFRR...RK..GD..SSI.ESSV.ATFTCFRKKMKK---------DA..KKLIASL.....KQ.
F6H0B4_VITVI/70-289TSVLALKEEQ-SAAQVAIRR...RD..........ESKV.ALFVKAQKRMNK---------DM..GKLVSTV........
W1NM94_AMBTC/47-271DSISCVKEQQ-LRLLSALRR...RDYKGL......ESLV.RAYMSSRKEMGM---------EF..AKCLGPL.....RK.
W1NMA8_AMBTC/46-265DAISCLREQH-RDLLSAFRR...RAYIGL......ECQI.SAYISAQKKIAK---------IS..AKCLSIL.....QK.
I1GVA3_BRADI/67-295ETLLALKRDV-AEALAAVRR...RD..........GARL.ASAVRSQRRAGK---------EL..ARLASLVRPPSSTRM
O81800_ARATH/49-281DLMVETQEHV-RGVQSCVRR...KKVVGG..EDQLDVAV.AGYVGFRKNMRK---------EA..KRLLGSL.....KN.
I1KLK8_SOYBN/6-235DVLLLVKEHL-QELQFTLRR...ASIGDPGI....EEKI.AAYNCYRKKLKK---------ET..LKWLKWLKKGMKKG.
K3Y257_SETIT/64-278EALVDLKRDV-AEALAAIRR...HD..........GARL.ASALRSQRRAGK---------EL..ARLAAT......AKD
B9R8K2_RICCO/43-279DVFSQMKECI-QELESSLRR...KRTV.E..SSL.ENEV.KAYMTSRKRLNK---------VI..SKCFGNL.....KR.
I1LJB5_SOYBN/50-289DVLLQSTESI-NGLQLSVRR...K..GGE..AAF.KVEG.AKYLSSRKKAKK---------TI..QNALEKF.....KG.
C5Z200_SORBI/56-284ETLVDLRRHA-AEAQAALRR...RD..........AARL.ASAVRAHRHAEK---------DL..ARLASS......ARA
I1JCB9_SOYBN/49-286DTMLQIKENV-QALHSSLRR...RK..GD..SCV.EASV.AEYKLFTKTMKK---------NA..IKLISSL.....KQ.
U5G7V1_POPTR/53-297DLFLTMKEHV-QELQSVIRR...RGAR.D..SSM.GSNV.HAYISFRKKTKK---------EI..TKSIRIL.....KR.
Q9SGR2_ARATH/44-253DVLMEIKEQV-RELESSLRRRLIRSKSGEDQEAFVARET.DAYVFKRRALSR---------TI..VKQLKKT.....EEK
M0ZMH2_SOLTU/54-289NLFCTIKEQV-QHLQSALRR...KGG..N..SSI.EREI.GNYFTLRKKMKK---------EI..GKYLRKL.....KH.
K7K6E8_SOYBN/53-294DLLLALKEHV-QTLQSAIRR...RRG..D..SSI.ENSI.CEYGGFRKKAKK---------EI..AKQLGAM.....KR.
B9S6R0_RICCO/59-301DLLLMMKEHV-LALQSAFRR...KGG..N..SSN.KSNI.YAYINSRKKVQK---------DI..GKCLVAL.....KK.
F6I0V1_VITVI/52-295DSLLQTREGA-HELQSSMRR...RCRT.E..NGI.SSEI.GNYLTSRKKVKK---------TI..HKCLRNL.....KG.
I1Q5E9_ORYGL/69-278ETVVALKQDV-AEALAAIRR...RD..........GARL.ASAVRSQRKAGK---------EL..ARLAAA......ARD
I1GVA4_BRADI/72-281DALLELKAHA-ADAQAALRR...RD..........APRL.AAALRSTRRADK---------DL..ARLAAS......ARA
C6TJE7_SOYBN/52-289DLLLSLKEHV-QTLQSAMRR...RRG..D..SSI.ENSI.CEYNGFRKKAKK---------EI..ATQLGAM.....KR.
K4BAH7_SOLLC/51-266ELVSQYKEKV-RDLQSSLRR...RK..GD..STT.DDSV.ERFTSFSKKIKR---------DA..KMSILTL.....KQ.
I1LI81_SOYBN/55-305DAIMLMKGNV-RDLQSALRR...RKV.GD..LVI.ESHV.SSYWSLRRNTRK---------QC..TKSLVLL.....KHS
M0ZMH8_SOLTU/54-271EFVSQYKENV-RALQSSLRR...RK..GD..SSA.EAGI.ARFTSFSKKMKK---------DA..KRLVLSL.....KQL
I1LI83_SOYBN/47-287DTILQTKENV-QSLHSALRR...RK..GD..SSI.EKIV.AEYNFFSKKMKK---------NA..KKMISTL.....KQ.
M1AM42_SOLTU/6-226DVLLLVKDHL-HDLKSTFRR...ISVGD.......NNKFTVSFHCQRKKLKK---------EI..LKRLHSL.....KG.
M1DZL7_SOLTU/49-265ELVSQCKENV-RDLQSSLRR...RK..GD..STT.DDSV.ERFTSFCKKIKR---------DA..KRSVSTL.....KQ.
F6I0U9_VITVI/51-294DALLQTREGA-QELQSRMRR...RRGS.E..NGI.SNEI.EKYLSSRKKVKK---------AI..HKALRNL.....TG.
B9GQ32_POPTR/54-282DIFSQMKECL-KDLESSIRR...KR.G.E..SSL.AGDI.EAYMISRKKLKK---------VISKSKSFRSL.....KT.
D7U4W6_VITVI/50-293DALLQTKEHA-HELQSSMRR...RRGG.E..SGI.SSEV.VGYLTSRKKVKK---------AI..HKALKDL.....KG.
U7DWD7_POPTR/42-272DVFSSIKECL-QELESSLRR...RKGG.E..SGF.ASEV.EAYIMSRKQLDK---------TI..RKCFKNL.....KS.
D7U4W7_VITVI/52-295DALLQTRQHA-YELQSSIRR...RRGG.K..NGI.STEV.EEYLTSRKKVVK---------AI..HKALKTL.....KG.
Q501A3_ARATH/75-304TSILCLREHQ-SAAQVALRK...KD..........DEKI.ASYLKSRRSLAR---------DI..AKLTSSIREPKTKHQ
I1JSM3_SOYBN/51-293DALLHTKECT-RELQSTIRR...RRGG.E..VEL.TLEV.KKFLTSRKVVRK---------AI..FKALENL.....KG.
I1LQ22_SOYBN/53-289DSLLHTKECM-RELQSIMRR...RKGG.E..VEL.KAEI.KKFLTSRKVVKK---------AI..SKALANL.....KS.
M4F849_BRARP/51-285DLMVETHEHV-LGLQICARR...RQ..........YVDF.SDYVGFRKNMKK---------EA..RKLLGSL.....KN.
I1K762_SOYBN/55-292EALLHTKECT-RELQSIIRR...KRGG.E..VEL.TAEV.KKFLTSRKVVKK---------AI..SKALANL.....NS.
Q9SD09_ARATH/38-272DITCRIKDCL-RDLRSAFRR...RRHSGD..STI.RCHV.KAFIRSRKAVHK---------DI..AKLLLLL.....KQT
B9RN27_RICCO/47-287DALLQTKEYT-LELQSTIRR...RQGGCN..GDL.SNEV.RKYITSRKMAKK---------AI..QKAINNI.....KG.
F6I0V5_VITVI/51-294EALLQTKEHT-NELQSTLRR...RRRG.E..YRI.STKV.EEYLTSRKKVMK---------AI..HKALNNL.....KG.
I1LJB8_SOYBN/56-296DSLLHMKECA-RELQSIMRR...KRGG.E..MEV.AAEV.RKFLASRKVIKK---------AI..LKALENL.....QA.
B9S6R6_RICCO/45-268DAMSQFKGQV-QSLQSALRR...RK..GD..LSI.ESSI.VNYACFRKKMKK---------DA..KRFIATL.....KQ.

PF05055

U496P_ARATH/28-380TTLFK--------LMHKEQES-------------------LLERVRETKEKLDEELKNIEMEISSRKKWSI--------I
U496I_ARATH/47-375FALFD--------LVYKQQVM-------------------MLEELHKLKRKLDKRLRNI.......KTWRR--------V
U496O_ARATH/12-347LRKFQ--------TCHEELAK-------------------MVVKLEKTMKDIDKKLRRV.......RGRRA--------I
U496G_ARATH/55-391VTQYK--------SVYDEQVL-------------------LLDELRKLKVKLGKKLRNI.......KTWRI--------L
U496C_ARATH/29-372TTQFE--------RIKKQQES-------------------LLEEVSETRKKIQDEISNL.......EKKTL--------I
U496A_ARATH/36-363FKMFQ--------SVYKQQML-------------------MLEKLQHRKNKLDKKLKCI.......HTWRK--------L
U496F_ARATH/55-392VTQFD--------SVYDQQVL-------------------FLEELRKQRRKLDKKQRNV.......KTLRT--------V

PF05633

Q9CAK4_ARATH/2-404ERSWS.........FGRRSGGSSAASKGGATIGQLKSSSWAVGRNWSAAKQIHAMTANL-------TPPRGNEAAG...L
O81749_ARATH/2-390SRSWS.........FGTRSN.....VTGGGLYGQ......VVSKNWSASKQIQAMVANL-------VLPRGAEASG...P
I1PR59_ORYGL/1-420GRAGTTRDSLPHGHGHHRRSSS.GGSSGSGSGSHLRSLSWSVSRTWSAARQLQAIGGGL-------TVPRANDIAATGGL
Q6DYE2_ARATH/31-406TRNKD..........HNQHIG............YIRSLSWSVSRSWSASRQLQGIGNNL-------ATPRASDVMATNGL
Q9CA69_ARATH/1-390GRNKE........QLHHRTIG............HFRSLSWSVSRSWSASKQLQAIGNNL-------ATPRASDITATNGL
Q9M9U5_ARATH/1-382GRVKD.........SHHRSIG............HFRSLSWSVSRSWSASKQLQALASNL-------ATPRPNDVVASNGL
Q9SUT1_ARATH/2-369TDQWS........SFGRRSGG....SSGGGGGGAG.....CVSKNWSAAKQIQAMTANL-------VAPRGGEAS.....

PF03087

B9HQY4_POPTR/51-287.....--------.IKKN.STFTAF....N............GDR..ETTIMFIMLKEV--------------------E
C5Z203_SORBI/59-286AA...--------.RCARGPAAAAAGGMG.............GETHAEAAEVARAVAEA--------------------V
I1LQ17_SOYBN/43-281.....--------.FKNE.LIFASS....N............KDN..ETLSMLSFLKES--------------------E
M4DMJ2_BRARP/50-278.....--------.TQTK.KKCPVIKQSKT............LDQ..HASMVSNILRQS--------------------H
I1P792_ORYGL/80-324SAA..--------.............................ATSDSGEAALAEAVGAA--------------------T
O81799_ARATH/65-307.....--------.METR.DIST......N............TDQ.DSAIASTSVLRET--------------------I
B9R8L0_RICCO/69-295.....--------.................RDISRCYVPGL.DKLSIADAELVGVIGDV--------------------I
B9R8J9_RICCO/6-227.....--------.MKRKSVVISDISTTDH.................KLVVVVEVLREV--------------------R
I1JSX1_SOYBN/73-309QQHST--------LQ...........................VPSSVVDAQLRHVIADV--------------------M
I1JCB7_SOYBN/63-312ME...--------.NESF.GGSPTLD................LSD..HLSAVVRVLREA--------------------S
Q6DR26_ARATH/51-289.....--------.INVG.LVMRDHGYDQD............GDI..HFLAVIHAMRRV--------------------V
I1LI84_SOYBN/47-288MV...--------.ESKF.GVSPLL....N............QDQ..QLASLIKVLREV--------------------I
F6I7N0_VITVI/54-299.....--------.MENKSGTSPILD................LDQ..HLSAVVRVLREA--------------------S
D7U4W8_VITVI/52-295.....--------.MDNK.SRFSPL....N............KDP..ETLSMVSMLREV--------------------E
M1AM45_SOLTU/84-311.....--------.................QCIGKYIVPQQTIPIPDGDAELAEVMKDI--------------------I
B9SCB1_RICCO/57-288.....--------.QEKN.SRTTAS....A............NNS.....DVVDMLKGV--------------------E
B9GQ37_POPTR/6-226.....--------.MTGK.SVTSDASHVDH.................SIVVVVEVLREV--------------------S
M4F6V0_BRARP/38-268EH...--------.SSSE.............................STHPLITLLRQV--------------------C
W1NLL6_AMBTC/47-272.....--------......TFRSISSQLPQ............NHS.IQNEEVEVALSQV--------------------G
B9S6Q9_RICCO/61-307.K...--------.ANSI...SSMLN...A............DDH..YLAAVVKSLREA--------------------N
D7U4W5_VITVI/53-295.....--------.MEKK.CSFSPL....N............KDP..KTLSMVYMLREV--------------------E
W1NLG7_AMBTC/39-272.....--------......VGR.TPVIAHN............HSS.AQDHEVMDVLKQA--------------------R
M4DWB0_BRARP/47-256.....--------.SQNK.ESTDKS...........................LVVFGEA--------------------E
B9H691_POPTR/55-300.....--------.TASN.VNGSYHSS.TE............VDN.QQYSYVIEVINEA--------------------R
I1K763_SOYBN/55-271.....--------.IKSE.FY...........................TLSMLSVLTEA--------------------E
B9HQY2_POPTR/55-285.....--------.MENR.RTFSN.......................EEYPEIIMLREV--------------------E
W1NLL3_AMBTC/62-284.....--------.....................ASIAQSTMPSTPEASSELFAALRDV--------------------R
I1LQ18_SOYBN/52-289.....--------.MKNE.LMDSSS....S............NDS..EVLFILGILKEA--------------------E
B9H1Q2_POPTR/54-287.....--------.IENK.CTFSS..................EDP..EIVTRIGMLREV--------------------E
B9S6R5_RICCO/44-276M....--------.DSKL.EASKF..................QYQ..EDLYLIQLFKQV--------------------I
I1MMY5_SOYBN/60-307ME...--------.NESF.VASPNLD................LSE..HLSAVVRVLREA--------------------S
I1J8F0_SOYBN/47-288M....--------.ESKF.GVYPIL....N............QDQ..DLAAVIRVLREV--------------------I
I1LQ24_SOYBN/53-284.....--------.TSKN.CNISSA....N............KDN..Q...LISLLENV--------------------E
I1LI87_SOYBN/59-300.....--------.MKNK.ANSFSLL...D............QDQ..QLVFLARVIKEA--------------------S
I1K7E7_SOYBN/73-312QQHSM--------LQ...........................VPSFIVDAELRHVIADV--------------------M
O81802_ARATH/49-280.....--------.VDGG.TRSCDNDHEDE.................QLVAVIDRVRRV--------------------V
M0ZMH9_SOLTU/52-268VD...--------.CETL.TAA.FLE................TDQ..ETIAVIRALREA--------------------N
M0ZMI3_SOLTU/62-304.....--------....I.DNTPSAT...M............KDS..QLSAIIRVLEDA--------------------S
W1NMB3_AMBTC/49-272.....--------......TCKPISSSLQS................TQESEVVEAITQV--------------------R
M1CV32_SOLTU/6-232.....--------.MKNNTKCIDSSSSS..............IDNENNLMVVVNVLREV--------------------R
K3XYN7_SETIT/66-279AA...--------.RCARASLASS..................TYSAPAELEVARTVAEA--------------------V
B9SCA8_RICCO/40-274.....--------.QDKN.RRITTL....A............NKS..SLGDVVVTLKDF--------------------E
B9GQ33_POPTR/45-272.....--------.MEKH.........................NT..SAVDAVGMLRDV--------------------K
I1J8E6_SOYBN/49-289M....--------.ESKF.GVSPLL....N............QDQ..QLVALVRVIREV--------------------I
B9GQ28_POPTR/70-294.....--------.................RCIARSPFPGLGSGPSVGDAELVRVIIDV--------------------I
B9MX80_POPTR/54-301.A...--------.DNIF.GDSPLFN...A............SDH..LLSAIVRVLREA--------------------S
B9H1P9_POPTR/51-287.....--------.MQNK.DNFSTS....N............GDH..ETTTIFNMIKEV--------------------E
B9H5F4_POPTR/47-286.....--------.TEKK.STSIPSV...D............KDS..NLFAVVSMIKEV--------------------E
C5X725_SORBI/48-313.....--------.SGRCAGAAALDTTRDD............LGCGGAQPRPLAMLAEV--------------------R
B9R8K3_RICCO/50-283.....--------.EKKN...........H............KDS..NSVAVLALLRKV--------------------E
M0ZMH7_SOLTU/50-280MD...--------.HEEV...VDVME...I............DDQ..LVSAVIRILREV--------------------A
K4BAG9_SOLLC/50-281MD...--------.HEEI...VDVME...V............DDQ..LVSAVTRVLREV--------------------A
F6I0V3_VITVI/51-294.....--------.MGNK.CSFSAL....N............RDP..ETLSTVRMLREV--------------------E
C5Z1Z9_SORBI/69-279GAGAG--------SSRPSRLGL......................GSTAEVEVAGLLAEA--------------------A
B9R8K1_RICCO/43-287.....--------.LQKC.NLAVR.....D............KGP..DLEAIVSILREV--------------------E
I1Q5F1_ORYGL/73-283AA...--------.ATKYSSRLG...................LGATAEETEMTAALMDA--------------------A
F6HRY9_VITVI/47-287M....--------.DNKA.GASPLL....D............QDH..QLSTVIKVLRDV--------------------N
D7L8R0_ARALL/47-260.....--------.KQDQ.ECGDKS...........................LAVFGEA--------------------E
I1LI89_SOYBN/55-296.....--------.MENG.FKSYSSFPLLD............LDH..HLLMVINVLREI--------------------S
F6GZJ1_VITVI/47-287M....--------.NSNT.EASPLF....N............QDH..QLSTVIRVLTEV--------------------N
B9HQY3_POPTR/48-292.....--------.LENK.SSLSPF....N............KDH..EAVAVVSMLKEV--------------------E
K4BAG8_SOLLC/50-281MD...--------.HEEV...VDVME...I............DDQ..LVSAVIRVLREV--------------------A
B9GQ35_POPTR/42-271.....--------.VEKK.........................NT..SAIDTLGMLRDV--------------------K
Q9LMV9_ARATH/5-223.....--------.IEGG.GRGMMEMQSIE................QNLLFVAEVLKEV--------------------R
I1JSM4_SOYBN/57-290.....--------.IQNK.FTVSSS....N............KDE..ETSSMLSFLKEA--------------------E
I1LQ21_SOYBN/54-281.....--------................Q............KDN..NTSPMLNFLNEA--------------------E
Q9SGR3_ARATH/5-223.....--------.MKGNEGRVAMPIEQ...................NLLFVTEVLKEV--------------------R
Q9T007_ARATH/44-253.....--------.CQSK.DSTNAS...........................LVVFGRA--------------------E
W1NLH4_AMBTC/87-311.....--------......TYKSVSYHPQH............QGS.TQDHDVVCALKQM--------------------G
W1NMB1_AMBTC/47-278.....--------......MSKCIPSDGQN............HQSIARDCQVMDVLRLA--------------------R
B9H1Q3_POPTR/51-286.....--------.MQNK.CTFATF....N............GDH..ETTTMFNMLKEA--------------------Q
F6I0U8_VITVI/56-299.....--------.MENK.SNFSPW....N............KDP..DTISIVTMLKEA--------------------E
M4D572_BRARP/65-293.....--------.METR.DISTN..................IDQ.DPAVASTSVLRET--------------------I
B9SIC8_RICCO/82-325.....--------.LENK.YSVSCI....G............SGN..EIATFVSMLREV--------------------E
O81797_ARATH/56-285.....--------.RQTK.KKAWVIKQSGG............LDE..HSSMVSNILRQS--------------------N
M0S0X1_MUSAM/73-287IA...--------.RHPPLA......................PGLPADEAEIADILREA--------------------V
K4BFJ4_SOLLC/67-285.....--------.MDQE.TERALVP................KDADHDTVDMIKTLKEA--------------------N
M4DMJ4_BRARP/264-522.....--------...TD.ACLESSVWRGG............DDQ..EMSSLVRVMQET--------------------S
B9SCA9_RICCO/40-280.....--------.HEKD.CRSSIS....S............DNS..DLSNMINMLKGA--------------------E
M1BLS9_SOLTU/57-276MI...--------.KENN.LASKKP......................ETSAIVGELQDV--------------------Q
K7VCR8_MAIZE/68-278AA...--------.RLPAGAGLG...................GSGTAEEAEMAAALMDA--------------------A
U5GEW5_POPTR/47-282M....--------.DNKL.GASSLL....D............QDQ..HLSAVIRVIREV--------------------N
F6H0B4_VITVI/70-289.....--------.................RST.........GRFPNGDGELISIIRDV--------------------N
W1NM94_AMBTC/47-271.....--------......TCRMVSSGSLS............QES.TQHNEVLEALRQV--------------------G
W1NMA8_AMBTC/46-265.....--------......DHKT.....QH............QQS.AVDNEVLCALKQV--------------------R
I1GVA3_BRADI/67-295MS...--------.PLGG........................IVGHGGSNEFCGVLMEA--------------------A
O81800_ARATH/49-281.....--------.IDGG.LSSSSSVNNGE............QEE..HLVVVVDAMRQV--------------------V
I1KLK8_SOYBN/6-235.....--------.MKSQTATMHPPMINEQ.................KLVLVVDVLREV--------------------R
K3Y257_SETIT/64-278GA...--------.ARPSRLGLGLGL................GGSSAAEVEVAGLLAEA--------------------A
B9R8K2_RICCO/43-279.....--------.MEKN.ATALPS....E............KKS..DLTAAVSMLKEV--------------------E
I1LJB5_SOYBN/50-289.....--------.LKNG.LILTSS....N............TDN..ETLSMISNFKEA--------------------E
C5Z200_SORBI/56-284AA...--------.RHPQLAVTTTTP................AATTVAEVEVSGVLVEA--------------------L
I1JCB9_SOYBN/49-286M....--------.DGKF.GVSPLL....D............LDH..HFAAVIRVLREV--------------------I
U5G7V1_POPTR/53-297.....--------.TEIN.VNGSYRLG.RD............VDN..HLSYVIEVIREA--------------------R
Q9SGR2_ARATH/44-253MR...--------.KRKR.............................DCGDVINVMKRV--------------------E
M0ZMH2_SOLTU/54-289.....--------.MENR.VGCSLFL...D............IEQ.........NFREV--------------------T
K7K6E8_SOYBN/53-294.....--------.TENK.VNTCFLMG.QS............QDQ..HLIYLARVLREA--------------------S
B9S6R0_RICCO/59-301.....--------.LETK.VGCPDVF...D............ADQ..NVSMVVRVIREA--------------------S
F6I0V1_VITVI/52-295.....--------.MKSK.CGFFAS....N............KDT..ETLSMVSMLREV--------------------E
I1Q5E9_ORYGL/69-278GA...--------..RPSRLGL.....................GGSAAEVEVTGLLMES--------------------A
I1GVA4_BRADI/72-281AA...--------.CT..........................KSPSSNGTEVAGAIADS--------------------V
C6TJE7_SOYBN/52-289.....--------.MENK.VNTCSLMG.QS............QDQ..HLIFLARVLREA--------------------S
K4BAH7_SOLLC/51-266.....--------.IDQE.TAVPVLL...D............AEQ..DTIAAIRALREA--------------------N
I1LI81_SOYBN/55-305TE...--------.GSSF.GASSPLD................LNH..HLSAVVRVLREA--------------------S
M0ZMH8_SOLTU/54-271VD...--------.CETL.TATIFLE................ADQ..ETIAVIRALREA--------------------N
I1LI83_SOYBN/47-287T....--------.ESKF.VASPLL....N............QDQ..QLVALVRVLREV--------------------I
M1AM42_SOLTU/6-226.....--------.MKLS.LVSDQSSESKN.................NLMVVVNVLREV--------------------K
M1DZL7_SOLTU/49-265.....--------.MDQE.TAVLVLL...D............ADQ..DTVDVIRALKEA--------------------N
F6I0U9_VITVI/51-294.....--------.MEKE.CRFSTL....N............KDT..ETLSMVSMLREV--------------------E
B9GQ32_POPTR/54-282.....--------.MEKD.IS........V............AQD..KDTTLVTLTREV--------------------E
D7U4W6_VITVI/50-293.....--------.MEKK.CSFSPL....N............KDP..ETISMVSMLRGV--------------------E
U7DWD7_POPTR/42-272.....--------.MEKN.........................IT..SAVDAVSLLTEV--------------------K
D7U4W7_VITVI/52-295.....--------.MENK.CSFSPL....N............KDP..ETISMVSMLREV--------------------E
Q501A3_ARATH/75-304HC...--------.HVDN........................VNGTYGDAELASVIGDV--------------------I
I1JSM3_SOYBN/51-293.....--------.NANK.GNLAITN...Y............KDY..QTMALVNLLKEA--------------------E
I1LQ22_SOYBN/53-289.....--------.TTKS.CNISST....N............KDN..Q...LISLLENV--------------------E
M4F849_BRARP/51-285.....--------.INVG.LVMRDNDLDQD............RDV..HFLAVNHAMRRV--------------------V
I1K762_SOYBN/55-292.....--------.ISKS.CNFSSTA...D............KDH..RTVALISLLQDV--------------------E
Q9SD09_ARATH/38-272GL...--------.SSSE.............................SSHPLITLLQQV--------------------C
B9RN27_RICCO/47-287.....--------.LENK.SSISSL....E............FDN..EIATFVSVLREV--------------------Q
F6I0V5_VITVI/51-294.....--------.MKNK.CSFSPL....N............TDS..EALSMVSMLREV--------------------E
I1LJB8_SOYBN/56-296.....--------.TVKK.AKFPPS....N............KDN..PTVTLASLFKDV--------------------Q
B9S6R6_RICCO/45-268M....--------.DSKP.EASML..................QDP...ALNFIQLLRQV--------------------I

PF05055

U496P_ARATH/28-380SNVLFIGAFVAVAVGSMVLVCTGVGAGVG.VAGLLSLPLIAIG.WVGVHTILENKIQAREKQEEALKKAHRIANEM-DKG
U496I_ARATH/47-375SNMVFVTAFVSVLIFSVVAAAVAAPPVVAAIAGALAVPVGSVGKWCN.........TLWTKYEKVVRGQKEIITSI-RIG
U496O_ARATH/12-347VTAALLAPVIAVIFLSKLVAGL..............VPIEGLSTFVA.........SRWRKSTESLKREKTAMSSM-ERG
U496G_ARATH/55-391SNVVFATAFVTVFVLSVVAAAMMAPPVLSAVASGLTTPIEVVGMWCN.........KMWKEYEKAVKRQRGLVLTM-ELG
U496C_ARATH/29-372TNVVFGAAFAIVAVASIALIATGVGAAAG.F.GALAAPLLAAG.WAGVYTTLDKKKDALNKQLEGLKKVEEIEESV-EKG
U496A_ARATH/36-363SSIIFVATFATVLICSVVAAAMAAPPVAAALAAATAVPLGSMGKWID.........SLWKNYENALKGQKEVISSM-QAG
U496F_ARATH/55-392SNVFFATAYVSVLVLSVVATTMSAPPVVCAVASGSTAPIEITGKWFS.........QMWKKYEKAVKRQRGLVLTM-ESR

PF05633

Q9CAK4_ARATH/2-404PQPMFIMSTVMVFVMWVLTAAVPCQERSGLANHLPVPPKHLN--WAQ---------SLIGIHEKIGDEWKKKEKK.GSAG
O81749_ARATH/2-390AMPVYIMSSVMVLVMWVLVAAVPCQTSSVLVAPLPLP.KHQN--WAS---------AAMSIQERIGEEIKRKEKRCGGGG
I1PR59_ORYGL/1-420ASAVYAMGAVLFVVTWALVAAIPCQDR.GLQAHLTAVPRTFP--WAG---------PLITLFDRILDESKKKDRKH.SCG
Q6DYE2_ARATH/31-406ALTVYTMTSILLFVTWVLVAAIPCQDR.GLHVHFY.FPRHFQ--WAV---------PVMSLHDKIMDESKKRDKKKKGCG
Q9CA69_ARATH/1-390IVPVYTMTTVLLFVMWALVAAIPCQDR.GLQVHFN.VPRNYQ--WGG---------SLMSLHDRIIEESKKRERKN.TCG
Q9M9U5_ARATH/1-382AVPVYTMTSVLLFVMWVLVAAIPCQDR.GLQVNFF.VPRHFQ--WAA---------PVMSLHDKIVEESKRRDRKN.CCG
Q9SUT1_ARATH/2-369..PMYIMSSVMVMVMWTLVVAVPCQTSNGLMVHVP.LPKNQV--WAN---------AAVSISERVGEEMKRKETR..GGG

PF03087

B9HQY4_POPTR/51-287VVSLKAFDSLLSFI........S.GPEAR.T..I....G-----WSL---------.VSK.LVHH....K.KVA..SADE
C5Z203_SORBI/59-286NDTAAAAAAVFLEVGSVADAAAALASPASASTKKSRLPP-----...---------.....LSRTSKQRT..........
I1LQ17_SOYBN/43-281LVTVSSLKAFLLFI........T.GSKGQ.SKQN....R-----WSI---------.ISK.LMQP....N.RVG..CDSQ
M4DMJ2_BRARP/50-278TSTISIFKSLLQFL........SSSSENQ..........-----...---------........................
I1P792_ORYGL/80-324CAAAAASASFFAGLASASASSASRSLASPTAASPAKVAV-----APV---------WWVADLLRWRRRTV..........
O81799_ARATH/65-307QITVSMFRHLLLFL........S.TIPPP.PSPAIFKTT-----IGL---------.LSIPFVSP....S......LSDK
B9R8L0_RICCO/69-295EVTMSVTVALCNGI........SQSI....SSRKSSWIG-----LR.---------.....LPTRAKKAK..........
B9R8J9_RICCO/6-227VVTVSIVESLLSLI........S.IPWLD.QRST....R-----GSF---------.RSKFFSST....S..........
I1JSX1_SOYBN/73-309SVTVSVSVALFNGI........GVSF....ASRRLSWTQ-----MVR---------.....LSRN.GGRE........NN
I1JCB7_SOYBN/63-312CITSSIFESLVVFL........S.SPILK.LK.P...NK-----WAL---------VVSR.LMQK....G.VFA..YNNH
Q6DR26_ARATH/51-289YMTVSVLKSFFEFL........S.GRQNG.NDVR...SK-----LAL---------.V...LMNK....K......FHDH
I1LI84_SOYBN/47-288VMNMSIFQSLLAFL........A.FPTSK.SK.A...TK-----WLM---------.VAK.LMHK....G.VIA..CAEN
F6I7N0_VITVI/54-299LITTSIFQQLLLFL........S.APVLK.PK.P...TK-----WSL---------.VSR.LAHK....G.VIV..CEAQ
D7U4W8_VITVI/52-295GVTLTVLESLLSSI........A.GEAAR.SKPS....S-----WSV---------.VSK.LIHH....K.RVV..CEEA
M1AM45_SOLTU/84-311EVTQLVSIALFNGL........GVSMAY..AKPSCSWIG-----...---------.....LGKKTKKLK..........
B9SCB1_RICCO/57-288EISAVLFESILAFI........S.LPKEK.SK.......-----FSI---------.VPS.FFQS....K.HV....SSK
B9GQ37_POPTR/6-226VTAITIVESLLSLV........S.IPWLE.QGSS....K-----GSF---------IRSTFLRST...............
M4F6V0_BRARP/38-268SQTCLSFRTVLLSL........S.SPVPK.PMPS....K-----WAL---------.VTK.LMIK......NDTNTNAQV
W1NLL6_AMBTC/47-272SASLFVCESHLLRF........K.TPKKR..........-----KSI---------.IST.ILRS...KS........RQ
B9S6Q9_RICCO/61-307WVSISIFSSLLLFL........S.APILK.PK.T...SK-----WSL---------.ISK.LVHK....G.VAA..SESQ
D7U4W5_VITVI/53-295ALTLTVLESLLSSI........A.RATGQ.SKPS....G-----WSL---------.VSK.LMHH....K.RVA..CEDA
W1NLG7_AMBTC/39-272SITVSLFRSLMSKF........V.ERRKK..........-----WCL---------.ISG.FFKSRVWSV........ET
M4DWB0_BRARP/47-256AITVGVFERMFCFM........S.GSKAC.GK.......-----WSL---------.VTK.LMSQ....T.KST..CED.
B9H691_POPTR/55-300AIAISIFRSLVLFL........S.MPEVK.KN.T...GG-----WSL---------.ISK.LIRS....G.LLA..SDKG
I1K763_SOYBN/55-271EVTLRSLESLLLFI........G.DPKGQ.PKQS....R-----WSA---------.ISK.LMQP....K.RVA..CDSQ
B9HQY2_POPTR/55-285SISLAVFESLLSFI........S.EPKSQ.AKKS....G-----WSL---------.VSK.LMNH....H.RIA..CEEE
W1NLL3_AMBTC/62-284TATVTVSGWLFLCL........S................-----...---------.....LRQRPNSIS...RLVCSRP
I1LQ18_SOYBN/52-289AVTMRLLESLLMFV........S.DTKGQ.SKQR....R-----WSI---------.ISK.LMQS....D.RMT..CDSQ
B9H1Q2_POPTR/54-287SISLAVFESLLSFI........S.EPKSQ.AKKS....G-----WSL---------.VSK.LIHH....Q.RIA..CEEE
B9S6R5_RICCO/44-276LINSFIFQSLLSFL........A.SSKPK....Q...SR-----WSV---------.ASK.LMHK....R.AIA..CEEK
I1MMY5_SOYBN/60-307LITSSIFESLVVFL........S.SPILK.LK.P...NK-----WAF---------VVSR.LMQK....G.LFA..YNNH
I1J8F0_SOYBN/47-288TMNMSILQSLLSYM........A.GPASK.SK.S...TK-----WLM---------.VAR.LMHK....KRVIS..CEED
I1LQ24_SOYBN/53-284EVTLSTFQALLQLI........S.GTTQS.KS.S....S-----WSL---------.V......S....K.KV...SCSQ
I1LI87_SOYBN/59-300TITISILHSLLVFM........S.MPTFG.TK......G-----SSL---------.ISK.LKPT....V.LFS..SLKE
I1K7E7_SOYBN/73-312SVTVSVSVALFNGI........GVSF....SSRRITWTQ-----MVK---------.....LSRNYGGRV........NN
O81802_ARATH/49-280SVSVVVLKSFLELL........S.......RRKSNIKSK-----LAS---------.V...LKMK....K........DN
M0ZMH9_SOLTU/52-268AVCILIFQMLLSFL........S.MPLFK.SKHP....K-----WSL---------.VSK.LIHN...............
M0ZMI3_SOLTU/62-304FTTISTFQSLLMFL........S.VPASK.PK.S...NK-----WSL---------.VSK.LVHK....G.VVG..SEGQ
W1NMB3_AMBTC/49-272SIAVDVCKSLMLKI........G.VPMKG..........-----QSL---------.LCT.LIKPFFAKQ..........
M1CV32_SOLTU/6-232VATMSILESLMALM........S.MPSPNATRKT...SK-----GYF---------.GSKLLMRV....N..........
K3XYN7_SETIT/66-279NDTAVASAAVFSEVGAVADAAAALASPAS.SSPKKRLP.-----...---------.....LVNASSRSS..........
B9SCA8_RICCO/40-274EISVAVFESILSFI........S.KAKEQ.SK.......-----LSV---------.VSK.LLQP....K.HV....SCE
B9GQ33_POPTR/45-272EIALEIFQSLLSLV........S.QPKTT.SSSH....G-----WSV---------.VSK.LFQS....K.RA.....SC
I1J8E6_SOYBN/49-289VMNMSIFQSLLSFL........A.VPASK.SK.A...TK-----WLL---------.VAK.LMHK....G.VTA..CDEN
B9GQ28_POPTR/70-294EVSVLVSFALFNGM........SLSF....ASRKSSWIR-----LR.---------.....LPKKVK.............
B9MX80_POPTR/54-301LVTVSIFRSLLLFL........S.VPMLK.PG.P...SK-----WYL---------.VSK.LVHK....G.VVT..CEGQ
B9H1P9_POPTR/51-287VVSLKELHSLLSFI........S.GPKAK.T..T....G-----WSL---------.VSK.LVHH....K.KVA..YADE
B9H5F4_POPTR/47-286EISLLVFESLLSLI........C.RPKAR.T..T....G-----WSA---------.VSK.LLQS....G.RV....SCE
C5X725_SORBI/48-313ELTVCVLQSSMDAL........LRQVVVRPPSAG....K-----WSL---------.VSRALAHN....R.SWSFGSGEA
B9R8K3_RICCO/50-283EISVAVFESVLCMI........S.EPKTR.LGAT....G-----WSV---------.VSK.LLQS....K.RV.....SS
M0ZMH7_SOLTU/50-280TIGISVFQMVLNFL........S.APISK.P..I...SK-----WSL---------.VSR.LVNK.............GD
K4BAG9_SOLLC/50-281TIGIPVLQMLLNYL........P.ASNSK.P..I...SK-----WSL---------.VSR.LVNK....G........GD
F6I0V3_VITVI/51-294TVTLTVIEALLSSI........A.GLTAQ.SKRS....S-----WSL---------.VSK.LMQH....K.RVA..CEEA
C5Z1Z9_SORBI/69-279AATAAALAALFGTVAAM.....SASASAAACSCKRTAA.-----...---------.....LMCRAKKVS..........
B9R8K1_RICCO/43-287GISLATFESFLSSI........C.PPKAR.AKTA...CR-----WSL---------.ITK.LIQS....K.HVP..YDED
I1Q5F1_ORYGL/73-283TASAAASAAVFTAAASM.....SSAAASS.CSCKKTPA.-----...---------.....FAAFAKKAS..........
F6HRY9_VITVI/47-287AMSISIFQSLVLFL........S.SPVLK.SK.P...SR-----WSL---------.VSK.LMQK....G.VVS..CEEK
D7L8R0_ARALL/47-260DVTIALFDSLFCFM........S.GSKTC.SK.......-----WSV---------.VSK.LMNK....K.KVT..CEA.
I1LI89_SOYBN/55-296KITISFFRKFLLYI........C.AQVLK.KN.T...GG-----WSL---------.FTR.IVST....G......SDKQ
F6GZJ1_VITVI/47-287AMSISIFQSLVLFL........S.TPVLK.SK.P...SK-----WSL---------.VSK.YMHK....G.VVS..CEDK
B9HQY3_POPTR/48-292AVTLTVLESLLTLI........SGGAKAQ.SKLS....G-----WSL---------.VSK.LMHH....K.RIA..CETE
K4BAG8_SOLLC/50-281TIGISVFQMVLSFL........S.APICK.P..I...SK-----WSL---------.VSR.LVNK....G........GD
B9GQ35_POPTR/42-271EISLEIFQSLLSLV........S.QPKAR.SSSH....G-----WSV---------.VSK.LFQS....K.RV.....SS
Q9LMV9_ARATH/5-223RAVVTMVESLFSLV........C.VPWLE.RKPS....I-----GSF---------..SSIFTMQFCCFD..........
I1JSM4_SOYBN/57-290MVTMSSFESLLIFI........I.GPKGQ.LKQS....R-----WSV---------.ISK.LVQP....K.RIS..CDSE
I1LQ21_SOYBN/54-281AITLCSLEQLLLFI........S.GPKRH.SKHS....R-----WSA---------.ISM.LMQP....K.RVI..CDSQ
Q9SGR3_ARATH/5-223RVVVTMVESLFSLG........C.IPWLE.KRSS....K-----GSL---------.SSIFSIRSSYLLD..........
Q9T007_ARATH/44-253AVTMALFESLFSFM........S.GSKAC.GK.......-----WSL---------.VSK.MMSQ....N.KVT..CEA.
W1NLH4_AMBTC/87-311SITALVYRSLLSRF........M.TPRKR..........-----LSI---------.IST.FLKTKLQPP..........
W1NMB1_AMBTC/47-278SVTVSYCHTLITGL........A.RGSNR..........-----WSL---------.ISK.FLRMR..PL........ES
B9H1Q3_POPTR/51-286TTSLNVTESLLFFV........S.GPKTK.S..V....G-----WSL---------.VSK.LVHH....K.TVA..SAD.
F6I0U8_VITVI/56-299TVTLTVLESLLSSI........A.GVAAK.SKPS....S-----WSF---------.VSK.LIHH....K.HVA..CEEA
M4D572_BRARP/65-293EISVSILRHLLLFL........S.TTPPP.PPARKIKNI-----IGL---------.FPIPLASR....S......LADR
B9SIC8_RICCO/82-325AITLSVLKTFMSFI........S.GSKAQ.SKPS....N-----WSV---------.VSK.LMIR....K.RVA..FDEE
O81797_ARATH/56-285ASTISILQSLLQFL........STSGENN..........-----...---------........................
M0S0X1_MUSAM/73-287AATATASAAVFAGVAAVSSA..AETAAASALKGSSTVGT-----LMR---------.....LSSTTKKAA..........
K4BFJ4_SOLLC/67-285AMRISMFQMFLCFL........S.VPLLK.PKVS....K-----WSL---------.VSRLLINK....G.RLG..CEGQ
M4DMJ4_BRARP/264-522VVTCFVLRTVLSFL........SSPKGLK.SKSQHQHKG-----WGI---------.VMK.LVKK....G...IDHHNHE
B9SCA9_RICCO/40-280ESSLALFESILSFI........S.EPKVK.SKPS....G-----WSF---------.VSN.ILQA....K.RV....SSE
M1BLS9_SOLTU/57-276LVTLGLFKGFLCYV........N.GTRSQ.SS......S-----WSL---------.LSKIMLSK....G..........
K7VCR8_MAIZE/68-278AASAAASAAVFSAVA.......SVSAAVSLCSNKKALGA-----FV.---------.....AAAFAKKPETPTT......
U5GEW5_POPTR/47-282VINCSIFQSLLMFL........S.KSS.K.PN.Q...SR-----WSL---------.VSK.LMHK....G.VIA..CEEK
F6H0B4_VITVI/70-289QVTVLVSVALFNGV........SSSW....ASRKFPWKG-----LR.---------.....LSKTAKRVK..........
W1NM94_AMBTC/47-271SATVFVCESLLSRF.............IW..........-----QSR---------.VSA.FFKP...KS........QL
W1NMA8_AMBTC/46-265SITIFVYEFLLSRF........I.EPRKR..........-----HSI---------.ISS.ILKPKLQKP..........
I1GVA3_BRADI/67-295AATAAASAALFGAVAAMSASV.AASASASACSCKRTAA.-----...---------.....LVCLVKTTK..........
O81800_ARATH/49-281SVSVAVLRSFLEFL........S......GRRQSNIKSK-----LAS---------.....VLKK....K......KVHH
I1KLK8_SOYBN/6-235MTSICIVESLLSLV........S.SPWLDTKSGK....L-----RSF---------.TSKLVRASLHCCS..........
K3Y257_SETIT/64-278AATASASAALFNTVAAM.....SASASAAACSCKRTAA.-----...---------.....LMCLIKKVP..........
B9R8K2_RICCO/43-279EISIVVLESLLSFV........S.PPKTR.TRST....G-----WNA---------.VTK.LFQS....G.RV....SCE
I1LJB5_SOYBN/50-289AVTLVQLESLLSFI........S.GSRGK.PKER....R-----WLI---------.VSK.LMQP....N.RVY..CDSD
C5Z200_SORBI/56-284AAAASASAAVFSALEAVSS...AATAAAASASSKKPAAT-----AT.---------.....LMSLVTRSS..........
I1JCB9_SOYBN/49-286LINLSVFQFILSFL........T.VSSSN.SK.T...SK-----WSL---------.VAK.LMHK....G.AKP..CDGT
U5G7V1_POPTR/53-297AITISISRSLLLFL........S.MPEMK.KN.T...GG-----WSI---------.ISK.LMLS....G.LLA..SDRS
Q9SGR2_ARATH/44-253KTSFDVLVSLLIEV........V.TKDQRDQKKG...SR-----RGI---------.VSR.IFNK....K.........N
M0ZMH2_SOLTU/54-289GISISVFKALLVFL........C.YQDTK.FK.P...RG-----WSM---------.ISK.LMIT....K..SG..SCQS
K7K6E8_SOYBN/53-294TITISIFRSLLLFL........S.MPGLR.TK......G-----TSM---------.ISK.LKPM....R.LFS..SEKG
B9S6R0_RICCO/59-301IITISIFRSLLLFL........S.MPGMK.TR.S....G-----WAS---------.VSK.LISL....R.SSS..SDKG
F6I0V1_VITVI/52-295TVTLTVLEALLSLI........A.GPTAG.SKTS....G-----WSL---------.VSK.LKQH....K.RVA..CEEA
I1Q5E9_ORYGL/69-278AVTAAASATLFNTVASM.....SASASAAACSCRKTAA.-----...---------.....LVCLIKKTS..........
I1GVA4_BRADI/72-281LAAAHASAAVFAAVE.......SLSASATAVASKKSTAS-----LS.---------.....FMALVKRTK..........
C6TJE7_SOYBN/52-289TITISIFRSLLLFL........S.MPGLR.TK......G-----TSL---------.ISK.LKPM....R.LFS..SEKE
K4BAH7_SOLLC/51-266AVCISIFQTLLSFL........C.VPLLK.PKQS....K-----WSL---------.LSR.LVHK....Q.RIT..PGVQ
I1LI81_SOYBN/55-305LITSSIFQSLVAFL........S.SPILR.SKIN...NK-----WTF---------.VSK.VMRK....G.VLQLQCNNQ
M0ZMH8_SOLTU/54-271AVCILIFHMLLSLL........S.VPLLK.PKQP....K-----WSL---------.VSK.LIHN...............
I1LI83_SOYBN/47-287VMNMSIFQSLLTFL........A.APASK.SK.A...TK-----WLF---------.VAK.LMHK....G.VIA..CEEK
M1AM42_SOLTU/6-226VATMSIVESLMSLM........L.MPSPNNKKLN....K-----GYF---------FGSKLMRVN...............
M1DZL7_SOLTU/49-265AVCLSTFQMLLSFL........C.VPLLK.PKPS....K-----WSL---------.LSR.LVQK....E.RIA..SEYH
F6I0U9_VITVI/51-294TITLTVLGALLSSV........A.GAAAQ.SKRS....G-----WSL---------.VSK.LMQH....K.RVA..CEEA
B9GQ32_POPTR/54-282DISVAVFASLLSSI........SLTPKSK.G..N....G-----WSV---------.VSK.LLKS....R.S........
D7U4W6_VITVI/50-293TVTLKVLESLLSSI........A.GETAQ.SNPS....G-----WSL---------.VSN.LMRH....K.HIA..CEEA
U7DWD7_POPTR/42-272EISLGIFQSLLSMV........S.QTKAR.SSSH....G-----WSV---------.VSK.LFPS....K.RV.....SC
D7U4W7_VITVI/52-295TVTVTVLESLLSSI........A.GATAR.SKPS....G-----WSL---------.VST.LMHQ....K.RVA..FEDA
Q501A3_ARATH/75-304EVTVLVSVALFNGV........YLSLR...ATKTTPFIG-----F..---------.....LKRSEKKEK..........
I1JSM3_SOYBN/51-293VITFSTFESLLNFF........S.GSTQA.KRIS....S-----WAL---------.VSK.LMHN....K.RV...GYAQ
I1LQ22_SOYBN/53-289VVTLSTFQALLQLI........S.GTTQS.KS.S....S-----WSL---------.VSK.LMQS....K.KV...SCSQ
M4F849_BRARP/51-285SMTVSALKSFLEFL........S.GRENG.NDIR...SK-----LAL---------.V...LMKK....K......FHDY
I1K762_SOYBN/55-292VVTLSTFQTLLQFI........S.GSTRS.KS.N....N-----WLS---------.ISK.LIQP....K.RV...GCSL
Q9SD09_ARATH/38-272SQTCQTFRTVLLSL........S.TAVPK.PRPS....K-----WAL---------.VTK.LVIK......NVTSTSGQV
B9RN27_RICCO/47-287AVTLGVLKSFMSFI........S.GTKSH.PKPS....S-----WTL---------.VSK.LMLH....K.RIA..SGEE
F6I0V5_VITVI/51-294MVTLTVLESLLSSI........S.GSTVR.SKSS....S-----WSL---------.VSK.LIHH....K.QVA..CEEA
I1LJB8_SOYBN/56-296VITLSILESLLNFI........S.GPAQS.KP.S....K-----WSL---------.VSK.LMHN....K.KVT..TTTQ
B9S6R6_RICCO/45-268VTNSFIFQALLSFL........A.ASKTK....H...SK-----WLI---------.VSK.LMHK....G.AIA..CE..

PF05055

U496P_ARATH/28-380METDKVDMNS---ISGKVHALKSKITSMLNAVKDATEDGANEVDTKQVMETLTGDVVELTEDIKA-VGDDVAKYSKMIEE
U496I_ARATH/47-375TYISVKEMDN---ISILVRKVEVEIESLLKKAEFAITEEK...EVRLAIDEIKKKLDVFTETIEE-LGEHAGKYCSDVTK
U496O_ARATH/12-347IIVALKQVEK---ISKLVSRLESVERSISLTAEFAVKKRS...SVVVAMREVEEERKRLKSTLVD-LDRETGLCNGFAQF
U496G_ARATH/55-391VQANNVTMVN---IKFEVENLSIRISSILKTVNFAVDREENEMATRFAMQEIKKKVEGFTEKIEE-VGERAANCSKLIAL
U496C_ARATH/29-372IKTNEEATET---VSILVDGLEDRIKNMLKLVDNAIDHEDNEAATRIVLTQISKKVEKLTKKITE-VGESVEDHSKLIAK
U496A_ARATH/36-363TFVAVKDLDN---IRVLIERLEIEITGMVKSAEFAVEH....NAVKIGIDDIKKKLEVFKKNVEE-LGTQADLCSRDIRR
U496F_ARATH/55-392VQVNNEAMKN---IRSDVDELRSWVSSILETVDFAVEREEEEEAMGLAMQGIKKHVDGFTEKMEE-VGENAAKCSKFIAL

PF05633

Q9CAK4_ARATH/2-404LMEEMTRMEK---LGHSLMEF-------ADGFHYPAEKDA.AESAAVQVAEMAEICRRMEEELVP-LQQQIREVFHRIVR
O81749_ARATH/2-390LMEEMQRMEK---IGLSLMEF-------AERFRFPADEEE.EVEVAEKVDEMEEICRRMEVGLED-LQRQVRQVFHRLVR
I1PR59_ORYGL/1-420LLKEIHQIER---CSRQLMEV-------TDAAEFPLADDK.DSEVQEATQELVQVCGSLKDGLDP-LERQVREMFHRVVR
Q6DYE2_ARATH/31-406LLREINQIER---NSRMLSDL-------IDSDNFSLTDEKCTLEVKERVQELMNVCEAIKEGLDP-FDRKVRDVFHQIVR
Q9CA69_ARATH/1-390LLKEIHQFEK---TSRLMNEL-------VDSVQFPLSEEK.EMEVRERVEELGKLQEALKNGLDP-FERKVREVFHRIVR
Q9M9U5_ARATH/1-382LLKEIDRIEK---SSRLMNEL-------IDSIHFPLNDDK.EVEVKQRVDELVQVREALRNGLDP-FERKVREVFHRIVR
Q9SUT1_ARATH/2-369LMEEMQRMER---IGLKLMEF-------SEGFRFNGEED.....VVAEVAEMEEICRKMEDGLEG-LQRRVREVFHRLVK

PF03087

B9HQY4_POPTR/51-287EA.DINEFAK...ADAALLAL--------VDQ.NTSK...S.DN....IKGVQTQLENLELCIQD.IEEGLEYLSRNLIK
C5Z203_SORBI/59-286....................T--------VMGDGGEERR.........EGAALEKLQELEQCVRE.LESESEKVFRSLVQ
I1LQ17_SOYBN/43-281EA.DTNEFEK...VDAALMSL--------INH....K...S....SS.IDNFQSHMENLGMCIEN.LEVGVECLSRQLIR
M4DMJ2_BRARP/50-278..KKNAEVGC...VDNSMIRS--------FYGRIIGKKTAKVID....VKTMLGRLAMLSVSLEA.IMDELSYLSRRLIQ
I1P792_ORYGL/80-324.....SVAACESGAGAKETPL--------DECIDEEEEE.........RKAAMDRLLRLEECVVA.AEDGCEQVYRALVN
O81799_ARATH/65-307SLILIKEMKS...LDDVFLGS--------ILDSRKTL.....FEVET.MENEKMRRDVVEDGFRD.LEAELDSVSKCLVK
B9R8L0_RICCO/69-295..VEEGIQEF...QEVGVESL--------WGLRKKGDEE.........VRMVLKRMRDLEGCISG.IESGGEKVFRSLIN
B9R8J9_RICCO/6-227...NQSLYDF...CDETA...--------...................LQSANKRLEAVEIAIED.LEVELECICRRLIQ
I1JSX1_SOYBN/73-309NKEHEGIEELRNGVGM..ERL--------QNLKKKGDEE.........VRLVLKKMRDLEECVCG.IETVTEKVFRALIN
I1JCB7_SOYBN/63-312QE.DINELEK...VDFALNSL--------ILDNLNKDAE...AEAEK.IQSAHGRLEALVVAIEE.IESGLECLFKRLIN
Q6DR26_ARATH/51-289DKMVKNELEN...VDSAICGD--------SIS................HDDLHEKLEEVEVWIGK.FEKSLEGLFRGLIK
I1LI84_SOYBN/47-288QK.NINELQC...VEASLSSL--------VSAG.........TNVAK.MQAAHERLEALENAIES.IENGLEGVFRRMVK
F6I7N0_VITVI/54-299GK.KINELES...VDIAVSNL--------LVQNPSKD.....PEAEK.IQSAHKRLEALDMSIEG.LENGLGCLFRRLIQ
D7U4W8_VITVI/52-295AG.DLSEFEK...VDCSLFTL--------IGH.KT.K...S.VNQIH.IDTIQNALGKLESSIED.LEEGIEFLSRHLIK
M1AM45_SOLTU/84-311..ENEGIVEF...VEMELENL--------LRKNKGDEE..........VKIVTKKMHELEDCICG.IEKCGEKVFRSLIN
B9SCB1_RICCO/57-288EEVEANEIEK...IDAGLLVL--------KSS....E...D.IN..Q.VQNALKGVKAMELSLQE.AEEELECVYRRLVK
B9GQ37_POPTR/6-226...GQRLYDC...FDETA...--------...................LHSANKRLEAVEIAVED.LEVELECMFRRLIQ
M4F6V0_BRARP/38-268QT...KEFQM...MDEELQSL--------SMAKEIKKER.........IKSLITTLDNVDVAVEE.LESSLETLYRRMIQ
W1NLL6_AMBTC/47-272QNEGNNESEC...ANASICAL--------YTHSGKVDETC........AKDVQRKLASLDKCMRN.IDDRLGCINNRLIR
B9S6Q9_RICCO/61-307EE.NMNELEN...VDVALTNL--------LVPNSGNV.....LDQEEKVQSAQRMLEVLDISIEE.LENELECLFRHLIH
D7U4W5_VITVI/53-295AI.NLTEFEK...MDAALSIL--------IGL.KT.K...S.VNLVQ.IHNMQNELGKLESSIQD.LEEGIELLSRCLIK
W1NLG7_AMBTC/39-272DDMETSEWEK...VAMALQQL--------QAASSKLEENH........VHDVIRLLDSSDEQMGS.IEEILGCFCSRLIR
M4DWB0_BRARP/47-256...EANEFTR...LDFVFES.--------.............GKLLN.MEDVQL....LESCIQD.LEDGTESLSKSMIK
B9H691_POPTR/55-300QK.IFNEVGN...VDIALCSI--------QGQMRKNDAKID.......VQEVQRRLETLDVCING.FNAKLDCIFRCLIQ
I1K763_SOYBN/55-271ES.HTNEFDK...VDEVLYSF--------LSH....K...P....SS.IEYLLSRIENLEMCIQD.LEIGVEHLTRKLIR
B9HQY2_POPTR/55-285ET.NEIGFSM...ADSALQSL--------ISC.KTDK...........MMDVQKKLNNLELCIED.LEDGIDGIFRRMIK
W1NLL3_AMBTC/62-284LEDGIGEVDS...TDDVIRDL--------YRCQKLEEGL.........VQKALKKLVVLEDCISS.LDKGSESVFRGLIQ
I1LQ18_SOYBN/52-289ES.ETNEFAK...VDTTLQSL--------ISH....K...P....LS.IENFQCHMENLETCIED.LEVGVEHLSRKLIR
B9H1Q2_POPTR/54-287EK.NVNEFAM...ADAALESL--------ISC.TTDK...........MMNVQKKLSSLELCIED.LENGIEGLYRRMIK
B9S6R5_RICCO/44-276QE.IVNELES...VDSALAEK--------.............TNSEK.MQIAKRRLEALEMGIQD.IEICLERVFRHLVK
I1MMY5_SOYBN/60-307QE.NINELEK...VDFALNSL--------IVDNLSKD.....AEAEK.IQSAHGRLEALVVAIDE.IENGLECLFKRLIN
I1J8F0_SOYBN/47-288SQ.NFNELQC...VEASLSTL--------LSEG.........TNVSK.VQSVRDRLEALENAIES.LENGLERMFRRLVR
I1LQ24_SOYBN/53-284LA.YESEFAQ...LDEALQSC--------MFA.KTSK...F.ES....MNKLQNQLEKVESLTHD.LEEGLEFLFRRLIK
I1LI87_SOYBN/59-300QK.NTNGVAD...LNNVLCSL--------LRREKNGDSSGE.......FQRALTVLETLNVNIGG.LEGGLDCIFRCLVK
I1K7E7_SOYBN/73-312NKEHEGIEELRNGVELVERLH--------QNLKKKGDEE.........VRLVLKKMRDLEECVCG.IESVTEKVFRALIN
O81802_ARATH/49-280HAPAKNVLET...LDSAIFGD--------FLS................HDDLQNELEEVEMCIGG.FERNLEGLFRRLIR
M0ZMH9_SOLTU/52-268...GRIELEG...LEN.....--------...................ITNMETKVETFEAQLDS.IEKRLEGAFRSLIR
M0ZMI3_SOLTU/62-304RE.KLTELEK...VDTALNNL--------LDHVSGHE.....EEVES.FEFAQRNLENLESSIED.LENGLEMLFKLLIR
W1NMB3_AMBTC/49-272...VKKGATE...CDRTLLCL--------STSSGKIDEKC........LKDAQCRLESLDECLSC.VNIALQRINSQLIQ
M1CV32_SOLTU/6-232...SLSSWEK...CDAMT...--------...................LQCANKRLEAVELAIEN.LEGELECIIRRLIR
K3XYN7_SETIT/66-279.....................--------.KRPASEEQR.........EAVALGKLLELEQCIGE.LESESEKVFRSLVQ
B9SCA8_RICCO/40-274GEVEANEVEK...VDAELQVL--------KSR....K...D.IN..Q.MQNALKGLEALGLSLQE.AEEELDCVYRRLVK
B9GQ33_POPTR/45-272EG.KATEWEK...IDAELLVL--------KSG........KDINPIQ.VKNILKELELLESSIHE.AEEELEAVYRKLLK
I1J8E6_SOYBN/49-289QV.NSNELLC...VEASLSTL--------VSEG.........TNVAK.MQGAHERLEALENAIES.IENGLEIVFRRMVK
B9GQ28_POPTR/70-294..IDEGIQEF...QQIGVESL--------WGLGKKEDEE.........VRMVLKRMQELEGCIGD.IETSGERVFRSLIN
B9MX80_POPTR/54-301QE.NLNELES...VDAALSSL--------VVPNSGKD.....FEARD.IHSVQKRLGILDTSIEE.IENELDSLFRHLIH
B9H1P9_POPTR/51-287ET.DINEFSK...VDAALLAL--------VDQ.NTSR...S.DK....IKGVQSHLESLELCIQD.LESGLECLFRNLIK
B9H5F4_POPTR/47-286GQGCANEVEK...MDSELICL--------IGK....K.....SNHVE.VQTALMGLKDLECSIQE.VEEELECVFRRLLK
C5X725_SORBI/48-313REGAARRANA...DDELVSGS--------FGAIKDVAGGDG.......PLDARSHLQSLEGCIEG.LEDGLERLFRNLIS
B9R8K3_RICCO/50-283EETDTKEVKK...MDEELLGL--------KSS........KNVNSVQ.LQNVMNGLKSLESTVQE.VEEELECVYRQLLK
M0ZMH7_SOLTU/50-280QD.NVNEIES...VDVALSSL--------SKSGP........NEMEK.IQFVQSKLETVEAHFEC.IESGLDNIFRCLIR
K4BAG9_SOLLC/50-281QD.NVNEIES...VDAALSSL--------SKCGP........NEVEK.IQFVQSKLERVATHFEC.IENGLDNIYRCLIR
F6I0V3_VITVI/51-294EA.DLSEFEK...VDTALCTL--------LGH.KN.K...S.VNVMH.VDNVHNEVAKLELSIQD.LEEGIEFLSRHLIK
C5Z1Z9_SORBI/69-279.....................--------.....EEEME.........TVALVER...LEECIDG.LEAGSDKVFRSLVQ
B9R8K1_RICCO/43-287SEKDGNQVEK...VDASLIAL--------SKQ....KFSEN.IHFIQ.VQRLQKGLETLNSSIKE.VEDGLDSVFRCLIK
I1Q5F1_ORYGL/73-283.....................--------.......PET.........AQVALDRFEELEQCIDE.SESSCHKVFRGILH
F6HRY9_VITVI/47-287HE.NVKELEN...IDFALSAI--------SGER.........ADLEK.MQIAQKGLGALEVSIKG.FDNGLECMFRHLIK
D7L8R0_ARALL/47-260...QGNEFTR...VDSEFQS.--------.............EKTLK.MEDVQI....LDSCIQD.LEDGLESLSKSLIK
I1LI89_SOYBN/55-296KR.IISEMGD...IDNVLCTF--------HRCFKKIDTKTD.......LQIMKRKLGELEGSVRE.LEAGLDCLFRCLIQ
F6GZJ1_VITVI/47-287HD.NVKELEN...IDFAVSAL--------SNGR.........ADLEK.MQITHKGLGALEVSIES.LDNGLECMFRHLIK
B9HQY3_POPTR/48-292ET.EVNEFEK...LDSALHTL--------IYQ.KTSK...S.DNTGS.LENVQQQLKDFDLCNQE.LEEGLENLYRRLIK
K4BAG8_SOLLC/50-281QE.NVNEIES...VDAALSTL--------PKCDP........NETEK.IQFVLSKLERVEAHFEC.IENGLDNIFRCLIR
B9GQ35_POPTR/42-271ED.EANELEK...IDAELLAL--------KSS........KDINPVQ.VQNVLKGLEALESSTQE.AEEELEGVYRKLVK
Q9LMV9_ARATH/5-223........DA...WDEVA...--------...................MRSASTRLEAAEITVEE.LEIELECIFRRLIQ
I1JSM4_SOYBN/57-290VS.DTNKFKM...VDKVLKLL--------IGS....K...P....SS.TENFQSHVQNLELCIQD.IEVGVERLSRQLIR
I1LQ21_SOYBN/54-281EA.NTNEFEK...VDAALQSL--------ISH....R...P....SS.IENFHSHMENLEFCIQD.LEIGVDQLSRKLIR
Q9SGR3_ARATH/5-223........DE...WDETA...--------...................VQSATTRLEAAEITVVE.LEIELESIFRRLIQ
Q9T007_ARATH/44-253...EANEFTR...IDSEFQS.--------.............EKSLQ.MEDVQN....LESCIQD.LEDGIESLSKSLIK
W1NLH4_AMBTC/87-311....SDGWDC...VKLALNAL--------YTSSGKVEELC........AINAQNQSESWDECMNY.IDNQLRLISNRLIQ
W1NMB1_AMBTC/47-278GHVETCELEH...LDMILWPL--------HACSSKLKEAC........SQDALRLLDSVEDRLGS.IEEQLGCLCNLLIR
B9H1Q3_POPTR/51-286QT.DRNEFAE...MDAALIGL--------VEH.RTSK...S.DN....IKVVQSQLENLELCIQD.LEEGLECLFRHLIK
F6I0U8_VITVI/56-299AG.DLSEFEK...VDAALCNL--------ISG.KT.K...S.LRPVH.IDDVQNKIGKLETSIQG.LEEGIEFLSRHLIK
M4D572_BRARP/65-293YLDLIKEAKN...LDDVFLGS--------LEKN....................KRRDIVEESFGD.LEAELDSVFKCLVK
B9SIC8_RICCO/82-325ET.KVNEFAT...VDAALESF--------LGCKITSK...Y.DN....METLQNHLKNLEVCIQD.LEEGTHSLFRRMIK
O81797_ARATH/56-285.EKKNGEIGC...VDNSMIRS--------FFGRIIGRKMVKEID....AQTILGRLAMVNVSLEA.IKDELSYLSRRLIQ
M0S0X1_MUSAM/73-287.....................--------.....WESER.........ETAALERLEKAKECIEG.LEKGSERVLRSLMN
K4BFJ4_SOLLC/67-285EE...................--------...................KMDLETRLEPFEAHLDN.FENGLEGIYRCMSR
M4DMJ4_BRARP/264-522KGFSCLELEA...METEIEKL--------VTREDQEEEKEISEEISERIQCSLVRSKEVEAAMEE.LEEGLEGLFKVMIQ
B9SCA9_RICCO/40-280GKVEANEVEK...IDAELITL--------KAS....K...D.INSAE.VHNILKGLEALESNLQE.TEEELECVYRRLVK
M1BLS9_SOLTU/57-276EEVEANEFDN...VDAALCSL--------ISHNKTSK...........YEELTSQLREMEVTIEV.VEEGLECFFRRLIK
K7VCR8_MAIZE/68-278.....................--------...................ADVAQEKHEELERCIDE.CESGSEVVFRSIVR
U5GEW5_POPTR/47-282QE.NVNEIET...VDAALS..--------..EV.........SDSEK.VKIAQKRLEALEMSIDD.LENCLERLSRPLIK
F6H0B4_VITVI/70-289..VEECIQEF...QQVGIDIF--------WGLKKKGNEE.........VRIDLKRMQALENCIRG.IELCSERVFRSLIN
W1NM94_AMBTC/47-271LNCAIVEWDC...TKLSLIAL--------YSIASKVDSLC........AGDALRQLESLEESMSR.IDDRLGCIKSRLIR
W1NMA8_AMBTC/46-265....NGVWES...AKAALNAL--------YTSSGKLDDLC........VKDAQRQLELWDECMTN.MDNQLGCISSHLIR
I1GVA3_BRADI/67-295................TKGKC--------SGSSSMGEEE.........EAAMAERLEELEECVEE.MEAGGEKVFRSLVQ
O81800_ARATH/49-281VEETKNELEN...LDLEIFCS--------...................RNDLQKKLEEVEMSIDG.FEKKLEGLFRRLIR
I1KLK8_SOYBN/6-235.....DDMIY...YDAMV...--------...................LQSENKRLAGVRMAIED.LEVELECMFRRLIH
K3Y257_SETIT/64-278.....................--------.....EEEKE.........TMALMERLEELEECIDD.LESGSDKVFRSLVQ
B9R8K2_RICCO/43-279D...ANEVEK...MDAELIVL--------IGR....K.....FSLVN.MQNALKGLEALESSIQE.MEEELECVYRRLLK
I1LJB5_SOYBN/50-289QS.NTNEFEE...LDNVLQSL--------F.H....K...P.CSNMS.VETFRNHMENLELRIQD.LEGGIERLERQLIR
C5Z200_SORBI/56-284....................K--------QAAAASDEDR.........ELAALEKMEQLHECIAE.MEAGSDKVFRSILH
I1JCB9_SOYBN/49-286N....DEMQC...VEAALSSL--------LNEG.........TNDDK.IHVAHERLEALEDAIES.FENGLESLFRHLIK
U5G7V1_POPTR/53-297QK.IFNEVEN...VDIALCSI--------QGQIRKNDAKVD.......VQEVQRRFETLDACINC.FDAKLDRMFRCLIQ
Q9SGR2_ARATH/44-253QEVDVDEL.............--------........................KKLRETEHEIEE.TEKELECVYKKLLK
M0ZMH2_SOLTU/54-289RQ.FFNEMGN...VDIALGDL--------LEEIKRNDGKVD.......VNIARRRLEMLDESIKG.FEAGLESLYKQLIQ
K7K6E8_SOYBN/53-294QK.NTN.VVD...L.SAMCSL--------LGRAKHSDAKVE.......VQIALRVLETLNVSIDG.LDGGLDCIFRRIVQ
B9S6R0_RICCO/59-301ED.HINEIKS...LDLSLSSL--------HEQLQAGDPKAE.......VKRIQTLLEAVNLSLDS.LEAELECMSRCLVQ
F6I0V1_VITVI/52-295EA.EISEFEK...VDAALCTI--------LAN.KN.K...S.VNVVH.ADNVHNEVAKLESSIQD.LEEGIEFLSRRLIK
I1Q5E9_ORYGL/69-278.....................--------..ASSEEEKE.........TMALVERLEELEECIDE.LDNGSDKVFRSLVQ
I1GVA4_BRADI/72-281.....................--------.AASSPDADE.........EDREMAALENLEACAAE.MESGSDAVFRAILR
C6TJE7_SOYBN/52-289QK.NTN.VVD...L.SAMCSL--------LGR....DAKVE.......VQSALKVLETLNVSIDG.LDCGLDCIFRRIVQ
K4BAH7_SOLLC/51-266EE...................--------...................NTSLETRLETFEAYLDS.FENALEAVFRCLIR
I1LI81_SOYBN/55-305EE.NVNELEK...VDLALCRM--------VMDNATKD.....FEAEN.IQFAHKELEAVVVVIEG.LENGLDCLFKHLIN
M0ZMH8_SOLTU/54-271...GRTEHEG...LEN.....--------...................STILETKVETFEAQLDD.IEKGLEGAFRSLIR
I1LI83_SOYBN/47-287QE.NSNELQC...VEASLSTL--------LSDG.........TNVEK.MQAARERLEKLENAIES.IENALEIVFRRMVK
M1AM42_SOLTU/6-226...SFSSWEK...CDAMT...--------...................LQCANKRLEAVEIVIEDVLEGELECIIRRLIR
M1DZL7_SOLTU/49-265EE...................--------...................NMSLETRLETFEAYLDS.FEDGLEATFRCLIR
F6I0U9_VITVI/51-294ES.DHGEFEM...VDAALCTI--------LCN.KN.K...S.VNLVH.ADDVHNELGKLELSIHD.LEEEIELLSRRLIK
B9GQ32_POPTR/54-282.TVDAKEVGM...INAEVLAW--------RSS....K...D.ISLVQ.VQNLLKHLETSQSSIQE.VEEELEFAYRLLLK
D7U4W6_VITVI/50-293TTIDLGEFEK...VDSALFTL--------TVH.KT.K...S..NPMH.IDIVQTELGKLEISIQD.LEEGLEFLYRRSIK
U7DWD7_POPTR/42-272EA.ELNEFKK...IDAELLVL--------KSS........KDINSVQ.VQNALKGLEALESNIQE.AVEELEAVYRRLLK
D7U4W7_VITVI/52-295AV.DLSEFEK...VDAALYPL--------IGH.KG.R...S.VNLVH.VDRVRNELEKLESSIQD.LEEGIEFLPRRLIK
Q501A3_ARATH/75-304..LDEGIVEL...KQVEEKSL--------IGLSKKKNEE.........VKSLMKRMMELENSIRE.IECESEKVFRGLIS
I1JSM3_SOYBN/51-293GA.DENEFAK...VDAAFQLF--------AFN.MSTK...SNDD....ISDLLKKLENLGTCIPD.LEEGLESLFRRLIK
I1LQ22_SOYBN/53-289LA.DENEFSQ...LDEALQSY--------MFS.QTSK...F.EN....MNKLQTQLEKVESLVQD.LEEGFEFLFRRLIK
M4F849_BRARP/51-285DKIVKNELDD...VDSAISGD--------SCS................QEELHRKLEDLEVWTGR.FEKSLEGLFRRLIR
I1K762_SOYBN/55-292VA.DESEFAQ...LDAALQSF--------V.C.KTCK...F.ED....TNNLQNHLEKMESCIQD.FEEGLEFLFRRLIK
Q9SD09_ARATH/38-272RTGHRNEFQM...MDEELRRF--------SMAEEIKKDR.........IKSMITNLDKVDVAVED.LEESLERLYRRMIQ
B9RN27_RICCO/47-287EA.VANEFSM...TDAALESL--------MGC...TK...Y.DN....MENVQSQLKNLEECIQD.LEEGTHSLFRRMIK
F6I0V5_VITVI/51-294PA.GLTDFEK...VDSALNTL--------IDH.KG.K...S.VNPVH.VDNVQNKLGKLESSIQD.LEEGLEFLSRRLIK
I1LJB8_SOYBN/56-296ES.DPNEFSN...VDAALQSF--------VFH.MTRK...A.DS....ISHLQNQLEDLESVIQG.FVEGLETLFKRFIK
B9S6R6_RICCO/45-268...IENELQS...ADAALTKK--------.............TDFEM.IQ....RLDDVEICIQD.IENCLERVFRRLIK

PF05055

U496P_ARATH/28-380TSYHVLQKI
U496I_ARATH/47-375ARTVILQRI
U496O_ARATH/12-347GRTVALEKI
U496G_ARATH/55-391GRLVVLGHI
U496C_ARATH/29-372ARLQVLQKI
U496A_ARATH/36-363ARTVILQRI
U496F_ARATH/55-392GRLLVLEHI

PF05633

Q9CAK4_ARATH/2-404SRAEILEVL
O81749_ARATH/2-390SRIEIVSLL
I1PR59_ORYGL/1-420TRTEILDYL
Q6DYE2_ARATH/31-406TRTEALDSL
Q9CA69_ARATH/1-390SRTEGLDTV
Q9M9U5_ARATH/1-382SRTESLDSL
Q9SUT1_ARATH/2-369SRSEILEVI

PF03087

B9HQY4_POPTR/51-287TRVSFLNI-
C5Z203_SORBI/59-286TRVSLLNI-
I1LQ17_SOYBN/43-281TRVSLLNI-
M4DMJ2_BRARP/50-278HRASLLNI-
I1P792_ORYGL/80-324ARVSLLNV-
O81799_ARATH/65-307NRVLFLNI-
B9R8L0_RICCO/69-295TKVALLN.-
B9R8J9_RICCO/6-227TRVSLLNI-
I1JSX1_SOYBN/73-309SRVALLNI-
I1JCB7_SOYBN/63-312TRVSFLNI-
Q6DR26_ARATH/51-289TRASLLNI-
I1LI84_SOYBN/47-288TRACLLNI-
F6I7N0_VITVI/54-299TRVSLLNI-
D7U4W8_VITVI/52-295TRVSFLNI-
M1AM45_SOLTU/84-311ARVSLLNV-
B9SCB1_RICCO/57-288IRVSLLNI-
B9GQ37_POPTR/6-226TRVLLLNI-
M4F6V0_BRARP/38-268ARVSILN.-
W1NLL6_AMBTC/47-272SRVSLLNI-
B9S6Q9_RICCO/61-307TRVSLLNI-
D7U4W5_VITVI/53-295TRVSLLN.-
W1NLG7_AMBTC/39-272TRVTVLNV-
M4DWB0_BRARP/47-256YRVSLLNI-
B9H691_POPTR/55-300NRVSLLN.-
I1K763_SOYBN/55-271NR......-
B9HQY2_POPTR/55-285TRASFLNI-
W1NLL3_AMBTC/62-284CRVLLLNV-
I1LQ18_SOYBN/52-289TRVSLLNI-
B9H1Q2_POPTR/54-287TRASFLNI-
B9S6R5_RICCO/44-276TRASILNI-
I1MMY5_SOYBN/60-307TRVSFLNI-
I1J8F0_SOYBN/47-288TRANLLNI-
I1LQ24_SOYBN/53-284TRVALLNI-
I1LI87_SOYBN/59-300NRVSFLNM-
I1K7E7_SOYBN/73-312SRVALLNI-
O81802_ARATH/49-280TRASILNI-
M0ZMH9_SOLTU/52-268SRSSLLNV-
M0ZMI3_SOLTU/62-304TRVSLLNI-
W1NMB3_AMBTC/49-272TRVTLLNI-
M1CV32_SOLTU/6-232TRVSLLN.-
K3XYN7_SETIT/66-279TRVSLLNI-
B9SCA8_RICCO/40-274IRVSLLNI-
B9GQ33_POPTR/45-272TRVSILNI-
I1J8E6_SOYBN/49-289TRASLLNI-
B9GQ28_POPTR/70-294TRVSLLN.-
B9MX80_POPTR/54-301ARVSLLNI-
B9H1P9_POPTR/51-287NRVSLLNI-
B9H5F4_POPTR/47-286VRVSLLN.-
C5X725_SORBI/48-313SRVCLLN.-
B9R8K3_RICCO/50-283ARVAILNM-
M0ZMH7_SOLTU/50-280SRSTLLNV-
K4BAG9_SOLLC/50-281SRSTLLNV-
F6I0V3_VITVI/51-294TRVSLLNI-
C5Z1Z9_SORBI/69-279TRVALLNI-
B9R8K1_RICCO/43-287TRVSILN.-
I1Q5F1_ORYGL/73-283TRVALLNI-
F6HRY9_VITVI/47-287TRASILNI-
D7L8R0_ARALL/47-260YRVSILNI-
I1LI89_SOYBN/55-296QRVSLLN.-
F6GZJ1_VITVI/47-287TRASLLNI-
B9HQY3_POPTR/48-292TRVSLLN.-
K4BAG8_SOLLC/50-281SRSTLLNI-
B9GQ35_POPTR/42-271ARVSILN.-
Q9LMV9_ARATH/5-223TRVSLLNI-
I1JSM4_SOYBN/57-290TRV.....-
I1LQ21_SOYBN/54-281NRVSLLNI-
Q9SGR3_ARATH/5-223TRVSLLNI-
Q9T007_ARATH/44-253YRVSILNI-
W1NLH4_AMBTC/87-311VRVALLNI-
W1NMB1_AMBTC/47-278MRVTLLNI-
B9H1Q3_POPTR/51-286TRVSLLNI-
F6I0U8_VITVI/56-299TRVSILNI-
M4D572_BRARP/65-293NRVLFLNI-
B9SIC8_RICCO/82-325TRVSLLNI-
O81797_ARATH/56-285HRASLLNI-
M0S0X1_MUSAM/73-287NRVSLLNI-
K4BFJ4_SOLLC/67-285SRSSLLNI-
M4DMJ4_BRARP/264-522ARVSLLNI-
B9SCA9_RICCO/40-280TRVSLLNV-
M1BLS9_SOLTU/57-276TRVSLLNV-
K7VCR8_MAIZE/68-278NRVSLLNI-
U5GEW5_POPTR/47-282SRASLLNI-
F6H0B4_VITVI/70-289TRVSLLNI-
W1NM94_AMBTC/47-271TRVTLLNI-
W1NMA8_AMBTC/46-265TRVALLNI-
I1GVA3_BRADI/67-295TRVSLLNI-
O81800_ARATH/49-281TRASLLNI-
I1KLK8_SOYBN/6-235TRVLLLNI-
K3Y257_SETIT/64-278TRVALLNV-
B9R8K2_RICCO/43-279SRVSLLNM-
I1LJB5_SOYBN/50-289TRVSLLNI-
C5Z200_SORBI/56-284TRVALLNI-
I1JCB9_SOYBN/49-286TRASLLNI-
U5G7V1_POPTR/53-297NRMSLLN.-
Q9SGR2_ARATH/44-253TRVSFLNM-
M0ZMH2_SOLTU/54-289TRVSFLNV-
K7K6E8_SOYBN/53-294NRVSFLNM-
B9S6R0_RICCO/59-301NRVSLLNI-
F6I0V1_VITVI/52-295TRVSLLNI-
I1Q5E9_ORYGL/69-278TRVALLNI-
I1GVA4_BRADI/72-281TRVALLNI-
C6TJE7_SOYBN/52-289NRVSFLNM-
K4BAH7_SOLLC/51-266SRSSLLNV-
I1LI81_SOYBN/55-305TRVSFLNI-
M0ZMH8_SOLTU/54-271SRSSLLN.-
I1LI83_SOYBN/47-287TRASLLNI-
M1AM42_SOLTU/6-226TRVSLLNI-
M1DZL7_SOLTU/49-265SRSSLLNI-
F6I0U9_VITVI/51-294TRVSLLNI-
B9GQ32_POPTR/54-282TRVSLLNI-
D7U4W6_VITVI/50-293TRVSFLNI-
U7DWD7_POPTR/42-272TRVTILNI-
D7U4W7_VITVI/52-295TRVSLLNI-
Q501A3_ARATH/75-304TRVSLLN.-
I1JSM3_SOYBN/51-293IRVALLNI-
I1LQ22_SOYBN/53-289TRVALLNI-
M4F849_BRARP/51-285TRTSLLNI-
I1K762_SOYBN/55-292IRVSLLNI-
Q9SD09_ARATH/38-272ARVSLLNI-
B9RN27_RICCO/47-287TRVSLLNI-
F6I0V5_VITVI/51-294TRVSLLNI-
I1LJB8_SOYBN/56-296IRVSLLNI-
B9S6R6_RICCO/45-268TRASILNI-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window