Sequence alignment for CL0135

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF00339

B4LEM0_DROVI/17-172--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
O76685_CAEEL/6-159--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
H2N0W5_ORYLA/17-173--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
O45782_CAEEL/7-155--------------------------------------------------------------------------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
ARRD4_MOUSE/18-166--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
O17981_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------
O17984_CAEEL/4-157--------------------------------------------------------------------------------
F6SKI7_XENTR/21-176--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
H2L9D1_ORYLA/14-171--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------
E7KUR3_YEASL/144-346--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------A-----------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------R-----------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------L-----------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------R-----------------------------------------------------------------------
Q380N5_ANOGA/183-323--------R-----------------------------------------------------------------------
CRED_ASPOR/181-332--------W-----------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------W-----------------------------------------------------------------------
ARRD5_HUMAN/184-321--------R-----------------------------------------------------------------------
ARRD4_HUMAN/191-318--------T-----------------------------------------------------------------------
Q294M9_DROPS/171-302--------K-----------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------W-----------------------------------------------------------------------
Q294M7_DROPS/174-306--------T-----------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------W-----------------------------------------------------------------------
Q293Z7_DROPS/175-308--------G-----------------------------------------------------------------------
Q9I7K7_DROME/179-320--------W-----------------------------------------------------------------------
A5DM18_PICGU/246-387--------W-----------------------------------------------------------------------
Q294M5_DROPS/171-304--------S-----------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------K-----------------------------------------------------------------------
A0BIT0_PARTE/173-314--------S-----------------------------------------------------------------------
Q4V467_DROME/125-256--------R-----------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------A-----------------------------------------------------------------------
Q66L50_DANRE/187-314--------T-----------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------S-----------------------------------------------------------------------
Q6C993_YARLI/185-326--------W-----------------------------------------------------------------------
O44847_CAEEL/147-273--------S-----------------------------------------------------------------------
A0CWE9_PARTE/173-316--------S-----------------------------------------------------------------------
Q23QU8_TETTS/188-318--------R-----------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------K-----------------------------------------------------------------------
A8WP41_CAEBR/178-317--------K-----------------------------------------------------------------------
Q0E8K8_DROME/169-299--------G-----------------------------------------------------------------------
A0C0J3_PARTE/194-337--------P-----------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------T-----------------------------------------------------------------------
Q23YG0_TETTS/188-318--------K-----------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------S-----------------------------------------------------------------------
ARRB_CAEEL/205-363--------S-----------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------W-----------------------------------------------------------------------
ALY2_SCHPO/345-506--------W-----------------------------------------------------------------------
Q5AM66_CANAL/305-457--------W-----------------------------------------------------------------------
ARRB2_MOUSE/195-350--------D-----------------------------------------------------------------------
A2BIP7_DANRE/186-313--------N-----------------------------------------------------------------------
ARRD1_HUMAN/162-286--------K-----------------------------------------------------------------------
A2QR01_ASPNC/439-613--------W-----------------------------------------------------------------------
Q380P6_ANOGA/182-314--------S-----------------------------------------------------------------------
YC9F_SCHPO/183-325--------W-----------------------------------------------------------------------
Q16H74_AEDAE/171-301--------R-----------------------------------------------------------------------
Q6DH07_DANRE/192-355--------S-----------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------K-----------------------------------------------------------------------
ART1_SCHPO/287-428--------S-----------------------------------------------------------------------
ARRD2_HUMAN/180-307--------N-----------------------------------------------------------------------
Q294M6_DROPS/179-311--------H-----------------------------------------------------------------------
ADCC_DICDI/344-478--------T-----------------------------------------------------------------------
Q6CS19_KLULA/219-373--------W-----------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------W-----------------------------------------------------------------------
Q22NR4_TETTS/187-325--------N-----------------------------------------------------------------------
ROD1_YEAST/232-395--------W-----------------------------------------------------------------------
A0CL31_PARTE/172-315--------K-----------------------------------------------------------------------
APYA_EMENI/180-326--------W-----------------------------------------------------------------------
Q296V0_DROPS/178-310--------A-----------------------------------------------------------------------
Q6CW08_KLULA/282-443--------W-----------------------------------------------------------------------
A8WP33_CAEBR/159-305--------S-----------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------S-----------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------S-----------------------------------------------------------------------
A7TQI8_VANPO/357-526--------W-----------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------L-----------------------------------------------------------------------
Q9W2V2_DROME/420-633--------H-----------------------------------------------------------------------
Q240M9_TETTS/188-318--------K-----------------------------------------------------------------------
A5DUN4_LODEL/264-404--------W-----------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------R-----------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------S-----------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------G-----------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------W-----------------------------------------------------------------------
O17983_CAEEL/173-318--------T-----------------------------------------------------------------------
Q9V393_DROME/233-393--------K-----------------------------------------------------------------------
A0BMC5_PARTE/210-346--------N-----------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------W-----------------------------------------------------------------------
A0D004_PARTE/178-324--------E-----------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------R-----------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------K-----------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------I-----------------------------------------------------------------------
PALF_ASHGO/233-368--------S-----------------------------------------------------------------------
ARRS_MOUSE/200-361--------S-----------------------------------------------------------------------
A8WP37_CAEBR/170-319--------K-----------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------Q-----------------------------------------------------------------------
MU170_SCHPO/266-426--------E-----------------------------------------------------------------------
A5DW17_LODEL/261-403--------W-----------------------------------------------------------------------
A0D012_PARTE/172-315--------K-----------------------------------------------------------------------
ADCA_DICDI/313-441--------T-----------------------------------------------------------------------
Q9I7L0_DROME/174-307--------R-----------------------------------------------------------------------
A7SF55_NEMVE/129-256--------T-----------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------P-----------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------S-----------------------------------------------------------------------
A0E996_PARTE/174-317--------N-----------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------W-----------------------------------------------------------------------
PALF_YEAST/259-394--------P-----------------------------------------------------------------------
Q23672_CAEEL/163-311--------S-----------------------------------------------------------------------
A7TPY5_VANPO/228-381--------W-----------------------------------------------------------------------
Q759V0_ASHGO/221-368--------W-----------------------------------------------------------------------
Q9VGU7_DROME/180-316--------A-----------------------------------------------------------------------
Q6FM62_CANGA/224-379--------W-----------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------V-----------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------A-----------------------------------------------------------------------
ARRD5_MOUSE/170-307--------S-----------------------------------------------------------------------
Q17624_CAEEL/176-340--------C-----------------------------------------------------------------------
A0D9C9_PARTE/194-337--------P-----------------------------------------------------------------------
A0CE97_PARTE/209-345--------N-----------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------A-----------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------K-----------------------------------------------------------------------
A7SL06_NEMVE/167-299--------A-----------------------------------------------------------------------
O45782_CAEEL/179-307--------S-----------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------L-----------------------------------------------------------------------
ADCB_DICDI/337-465--------T-----------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------K-----------------------------------------------------------------------
Q294M3_DROPS/163-297--------V-----------------------------------------------------------------------
A8WP43_CAEBR/183-324--------G-----------------------------------------------------------------------
A3LXL3_PICST/266-408--------W-----------------------------------------------------------------------
O17981_CAEEL/182-333--------R-----------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------P-----------------------------------------------------------------------
A8X383_CAEBR/164-301--------P-----------------------------------------------------------------------
Q20232_CAEEL/173-309--------Q-----------------------------------------------------------------------
A0BCE6_PARTE/199-335--------H-----------------------------------------------------------------------
Q5AP77_CANAL/170-448--------W-----------------------------------------------------------------------
A0BDM3_PARTE/168-302--------P-----------------------------------------------------------------------
Q23674_CAEEL/182-339--------K-----------------------------------------------------------------------
ARRD5_BOVIN/171-309--------S-----------------------------------------------------------------------
YA4C_SCHPO/180-322--------W-----------------------------------------------------------------------
Q294M1_DROPS/173-305--------P-----------------------------------------------------------------------
A0A0D1DR37_USTMA/181-316--------L-----------------------------------------------------------------------
A7TDW3_VANPO/229-389--------W-----------------------------------------------------------------------
Q6FY06_CANGA/237-406--------W-----------------------------------------------------------------------
A6R1F7_AJECN/559-759--------W-----------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------K-----------------------------------------------------------------------
A7TQH7_VANPO/294-447--------W-----------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------K-----------------------------------------------------------------------
PALF_KLULA/263-398--------D-----------------------------------------------------------------------
Q6CG62_YARLI/321-486--------W-----------------------------------------------------------------------
A0A0D1E8U6_USTMA/601-804--------W-----------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------R-----------------------------------------------------------------------
YOA5_SCHPO/223-379--------R-----------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------W-----------------------------------------------------------------------
E7LU16_YEASV/179-340--------W-----------------------------------------------------------------------
F1QAH2_DANRE/171-293--------.-----------------------------------------------------------------------
F6SKI7_XENTR/196-355--------.-----------------------------------------------------------------------
F6Y0E4_XENTR/163-285--------.-----------------------------------------------------------------------
G4VCF9_SCHMA/96-254--------.-----------------------------------------------------------------------
H2N0W5_ORYLA/194-351--------.-----------------------------------------------------------------------
H3CCN8_TETNG/163-285--------.-----------------------------------------------------------------------
H3DDA7_TETNG/203-325--------.-----------------------------------------------------------------------
ART5_YEAST/332-474--------W-----------------------------------------------------------------------
Q08CX7_XENTR/182-306--------.-----------------------------------------------------------------------
TXNIP_MOUSE/176-299--------.-----------------------------------------------------------------------
Q9VI00_DROME/172-303--------.-----------------------------------------------------------------------

PF07070

E3E849_PAEPS/4-211FNKILASAG-----------------------------------------------------------------------
Q9F2L5_STRCO/29-244FKRLLGSLG-----------------------------------------------------------------------
B7VMX8_VIBTL/6-222LKKTLASFG-----------------------------------------------------------------------
Q87KC8_VIBPA/6-222LKKTLASFG-----------------------------------------------------------------------
D2SH36_GEOOG/3-216FRGMMARLG-----------------------------------------------------------------------
U5VQ01_9ACTN/3-218FKKMLGAFG-----------------------------------------------------------------------
A9B5Z7_HERA2/2-209FRKLLASVG-----------------------------------------------------------------------
Q8CK18_STRCO/3-217FKKLLASLG-----------------------------------------------------------------------
A1S9J4_SHEAM/2-218FKKILAAVG-----------------------------------------------------------------------
F8AWR6_FRADG/3-216MKRMMARLG-----------------------------------------------------------------------
D5XEE5_THEPJ/2-202LKKLLASVG-----------------------------------------------------------------------
F6CIG7_DESK7/3-202.TKLLASIG-----------------------------------------------------------------------
E8U7T1_DEIML/4-201FKRMLASVG-----------------------------------------------------------------------
D9SYU9_MICAI/3-218FKRLMQAMG-----------------------------------------------------------------------
SP0M_BACSU/4-212FKKLAASAG-----------------------------------------------------------------------
D6Y483_THEBD/3-219FKRMLGALG-----------------------------------------------------------------------
D7B3X5_NOCDD/3-216FKRLLAAFG-----------------------------------------------------------------------
A6W415_KINRD/4-215.RNLAARFG-----------------------------------------------------------------------
A5D298_PELTS/2-203LKKLLAGIG-----------------------------------------------------------------------
Q7MGK0_VIBVY/6-223LKKTLASFG-----------------------------------------------------------------------
I0JR17_HALH3/2-206FKKFLASVG-----------------------------------------------------------------------
L0A4L1_DEIPD/4-200LRRTLARVG-----------------------------------------------------------------------
C1D0Z4_DEIDV/4-201LKKMMAAVG-----------------------------------------------------------------------
Q8YPP0_NOSS1/22-229FKNLLASVG-----------------------------------------------------------------------
R4LYD7_9ACTN/3-214FDKVLRGFG-----------------------------------------------------------------------
C6WBH8_ACTMD/3-218FKRMLRAFG-----------------------------------------------------------------------
R4SZZ1_AMYOR/2-217FKRMLSAFG-----------------------------------------------------------------------
Q3IE37_PSEHT/2-218FKKILASVG-----------------------------------------------------------------------
E4N440_KITSK/3-218FKRLLGALG-----------------------------------------------------------------------
D3Q3X8_STANL/19-229.RKLTSGVG-----------------------------------------------------------------------
G2NX38_STRVO/3-217FKRVLGSLG-----------------------------------------------------------------------
E2Q1G0_STRC2/1-209.........-----------------------------------------------------------------------
U5W7Z2_9ACTN/3-218FKRMMQAMG-----------------------------------------------------------------------
D4GQ21_HALVD/1-207MKKVLARIG-----------------------------------------------------------------------
C4L3D6_EXISA/2-213FKKILSSIG-----------------------------------------------------------------------
L0JQI9_NATP1/1-204MKRVLSRLG-----------------------------------------------------------------------
U5LEI3_9BACI/4-214FNKVLASVG-----------------------------------------------------------------------
B7GKU0_ANOFW/25-235FNKVLASIG-----------------------------------------------------------------------
C5D3Y3_GEOSW/2-199LKKLLSKLG-----------------------------------------------------------------------
H2K613_STRHJ/3-217FKRLLGAIG-----------------------------------------------------------------------
Q9KVV0_VIBCH/21-237IKKTLASFG-----------------------------------------------------------------------
Q2J8X7_FRASC/3-216MKRFMSRLG-----------------------------------------------------------------------
D9STE5_CLOC7/4-212FKKVLSSVG-----------------------------------------------------------------------
Q81QV7_BACAN/2-213FQKFLASVG-----------------------------------------------------------------------
X5A5U4_9BACL/4-211FKKVLASVG-----------------------------------------------------------------------
D2B8E4_STRRD/3-215FRKLMAAFG-----------------------------------------------------------------------
F2EZY3_SOLSS/4-214FNKVLASVG-----------------------------------------------------------------------
Q5V309_HALMA/3-209MKDVLSRIG-----------------------------------------------------------------------
Q6LLI7_PHOPR/4-219FRKSFASLG-----------------------------------------------------------------------
E4NWJ2_HALBP/1-207MKKILASVG-----------------------------------------------------------------------
E1SSB8_FERBD/2-218FKKLLASVG-----------------------------------------------------------------------
D7AXU0_NOCDD/3-217LKRLLAGIG-----------------------------------------------------------------------
F4FG08_VERMA/3-218FKKMLSALG-----------------------------------------------------------------------
D3EJD4_GEOS4/4-211FNKMLASVG-----------------------------------------------------------------------
I0H7C6_ACTM4/3-218FKKLLGALG-----------------------------------------------------------------------
B1VNV5_STRGG/3-217FKKLLGALG-----------------------------------------------------------------------
H8MVT2_CORCM/3-210FMKMLARLG-----------------------------------------------------------------------
H8GZW1_DEIGI/5-201.GKMMAAVG-----------------------------------------------------------------------
Q5L337_GEOKA/2-211FKKLLSSIG-----------------------------------------------------------------------
C0ZHJ0_BREBN/2-209FKKLLASVG-----------------------------------------------------------------------
H2JK05_STRHJ/3-217FKRLLGSLG-----------------------------------------------------------------------
Q8EMA6_OCEIH/2-211FNKMLSSIG-----------------------------------------------------------------------
F0LQ35_VIBFN/4-220LKKTLASFG-----------------------------------------------------------------------
Q5L3I0_GEOKA/3-199.KKFLSKFG-----------------------------------------------------------------------
E1V3I8_HALED/2-214FDKLMAAVG-----------------------------------------------------------------------
R4SRA3_AMYOR/2-218FQKVLATFG-----------------------------------------------------------------------
G2NQ97_STREK/3-217FKKLLGSLG-----------------------------------------------------------------------
C7MVV3_SACVD/2-217FQRLLSAFG-----------------------------------------------------------------------
Q47QI1_THEFY/3-218FRRLLTAFG-----------------------------------------------------------------------
B1YLT3_EXIS2/2-212FKKILSQIG-----------------------------------------------------------------------
D2RPW6_HALTV/1-204MKRILSSLG-----------------------------------------------------------------------
D1A596_THECD/3-218FKRVLGTFG-----------------------------------------------------------------------
D2ASM7_STRRD/3-218FKRLLGAFG-----------------------------------------------------------------------
N0B2E1_9BACI/13-223FNKVLASVG-----------------------------------------------------------------------
H6NE63_9BACL/4-211FKKVLASVG-----------------------------------------------------------------------
K0K0P9_SACES/2-217FKRMLSAFG-----------------------------------------------------------------------
Q5E1Q2_VIBF1/4-219FKKTLASLG-----------------------------------------------------------------------
I7BQH2_NATSJ/1-201M...LSSLG-----------------------------------------------------------------------
K0JWS7_SACES/3-218FKRMLRAFG-----------------------------------------------------------------------
V6K362_STRNV/3-217FKRLLGSLG-----------------------------------------------------------------------
A4FGU2_SACEN/3-218FKKLLGALG-----------------------------------------------------------------------
Q5YZ34_NOCFA/2-216FKKLLAAAG-----------------------------------------------------------------------
D9T8R1_MICAI/3-218FKKMLGAFG-----------------------------------------------------------------------
C6CSI9_PAESJ/5-212FNRLLASIG-----------------------------------------------------------------------
D1A1F2_THECD/3-218FKKLLKAMG-----------------------------------------------------------------------
G0G8W7_AMYMS/2-215FQKVLATFG-----------------------------------------------------------------------
U5W8Q8_9ACTN/3-214FARVLRAFG-----------------------------------------------------------------------

PF04425

A3GGA7_PICST/92-585SSDSPIAPLSSVSSN.TQTEYFDVLPSFQMF.QSILKR.DDAQFSEDLQTLPPVYGDTTNSSPTP...............
A5DRA9_PICGU/36-464DGGEFNEDDILRSEQANQAPVWSILPSYHMY.KSLYMGMNAPTE..NIHE.PPTYEDVSHTSVSH...............
Q6BJG5_DEBHA/93-577SNSNETNLLSPASSN.TQTEYFDVLPSFQMF.QSILKR.DDSQFSENLSVNPPIYGDVTNSSPTPPSG........LSPI
A5DPQ0_PICGU/115-602TDVNVNADLTTTLSG.TRTEYFHVLPSFQMF.QSILKR.DDAQFNESLSGEPPTYEDSRSASPVLS...........PSL
Q6BSG0_DEBHA/5-422SKEKLKEKHNERILNEEDDLINNILPSYHMHQSTISKNLTPTNE..NFRVDPPMYEMTPVNSLST...............
Q6BVD1_DEBHA/28-455SQNYFSQKDIELTKTTNEAPVWNILPSYHMYTTTIYKGFNVSDE..SLTE.PPSYETSSIHSAGRL...........SSV
Q5ABB5_CANAL/19-455TPSRQASVSSRNQGDDEANELINILPSYQMYRSTITKNLTPSVE..DLRTAPPSYEVTPDLSTVQ.............LH
Q75E04_ASHGO/51-474AEEDDIDNCAGACAC.ADEEICDVLPSFQMY.NALHRHIPRGNVNADQHDLPPSYQEAYNGSVGG...............
BUL1_YEAST/108-543ANATPVETGRSLTDG.DINNVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEANNSTATG...............
A5E3Q9_LODEL/66-535NNSSATNIVATTSSN.TQTEYFDILPSFEMF.QSILKR.DDQQFQEDLTTVPPRYGDTAHSRSSR.............PT
A3LX53_PICST/9-457LKLSSLSLRRKSKSNGNDSELVNILPSYQMYRSTISKQLIPSRE..DLRTQPPSYELSPISSASS..............Y
Q6FUH4_CANGA/102-545AASVPPNKPNLLKRN.SESRVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPTYQEIESQSSTFG............RP
Q6CSE2_KLULA/69-505SGQSKLKNEDGSEVS.DTHHMIDVLPSFEMY.NALHRNIPRGNVNPDQHDLPPSYLEVESQRQTP...............
Q6FP46_CANGA/103-568VAKSSTELNQMNTDSKDPNMIIDVLPSFEFY.NVLHKHIPQGNVDPDIHDFPPTYQEVQTQRLPA...............
Q5AN22_CANAL/97-598TTTTPIAELSTVSSH.SQTEYFDVLPSFQMF.QSILKR.DDRQFQEDLSSLPPGYGDVTNSSPTPPPLPPPPPARSAPTL
A7TIV7_VANPO/87-537NVPFPGQFTKNSNSS.SSSILVDLLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEVQTQHSSILPI........HERP
E7KSA7_YEASL/88-524.......CTQSRLSH.RANMLVDVLPSFEMY.NALHRHIPQGNVDPDRHDFPPSYQEVRTQRMTI...............
G0VB73_NAUCC/105-559......RNLKNGTHGSTDNLLVDVLPSFDMY.NVLHRHIPQGNVNPDIHDFPPTYQEVQTHRDPV...............
G0VC27_NAUCC/80-515..SNDHPTNTPVEHQARDDILLDILPSFEMY.NSLHRHIPQGNVNPDLHDFPPSYQEIQEGSSSS.............GT
G0VC28_NAUCC/152-590...KDLPVGESLDDLDEDDIVFDVLPSFEMY.NALHRHIPQGNVNPDLHDFPPSYGEIQQGMATT...............

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF00339

B4LEM0_DROVI/17-172--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
O76685_CAEEL/6-159--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
H2N0W5_ORYLA/17-173--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
O45782_CAEEL/7-155--------------------------------------------------------------------------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
ARRD4_MOUSE/18-166--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
O17981_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------
O17984_CAEEL/4-157--------------------------------------------------------------------------------
F6SKI7_XENTR/21-176--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
H2L9D1_ORYLA/14-171--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------
E7KUR3_YEASL/144-346--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------------------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------------------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------------------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------------------------------------------------------------------------------
Q380N5_ANOGA/183-323--------------------------------------------------------------------------------
CRED_ASPOR/181-332--------------------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------------------------------------------------------------------------------
ARRD5_HUMAN/184-321--------------------------------------------------------------------------------
ARRD4_HUMAN/191-318--------------------------------------------------------------------------------
Q294M9_DROPS/171-302--------------------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------------------------------------------------------------------------------
Q294M7_DROPS/174-306--------------------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------------------------------------------------------------------------------
Q293Z7_DROPS/175-308--------------------------------------------------------------------------------
Q9I7K7_DROME/179-320--------------------------------------------------------------------------------
A5DM18_PICGU/246-387--------------------------------------------------------------------------------
Q294M5_DROPS/171-304--------------------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------------------------------------------------------------------------------
A0BIT0_PARTE/173-314--------------------------------------------------------------------------------
Q4V467_DROME/125-256--------------------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------------------------------------------------------------------------------
Q66L50_DANRE/187-314--------------------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------------------------------------------------------------------------------
Q6C993_YARLI/185-326--------------------------------------------------------------------------------
O44847_CAEEL/147-273--------------------------------------------------------------------------------
A0CWE9_PARTE/173-316--------------------------------------------------------------------------------
Q23QU8_TETTS/188-318--------------------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------------------------------------------------------------------------------
A8WP41_CAEBR/178-317--------------------------------------------------------------------------------
Q0E8K8_DROME/169-299--------------------------------------------------------------------------------
A0C0J3_PARTE/194-337--------------------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------------------------------------------------------------------------------
Q23YG0_TETTS/188-318--------------------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------------------------------------------------------------------------------
ARRB_CAEEL/205-363--------------------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------------------------------------------------------------------------------
ALY2_SCHPO/345-506--------------------------------------------------------------------------------
Q5AM66_CANAL/305-457--------------------------------------------------------------------------------
ARRB2_MOUSE/195-350--------------------------------------------------------------------------------
A2BIP7_DANRE/186-313--------------------------------------------------------------------------------
ARRD1_HUMAN/162-286--------------------------------------------------------------------------------
A2QR01_ASPNC/439-613--------------------------------------------------------------------------------
Q380P6_ANOGA/182-314--------------------------------------------------------------------------------
YC9F_SCHPO/183-325--------------------------------------------------------------------------------
Q16H74_AEDAE/171-301--------------------------------------------------------------------------------
Q6DH07_DANRE/192-355--------------------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------------------------------------------------------------------------------
ART1_SCHPO/287-428--------------------------------------------------------------------------------
ARRD2_HUMAN/180-307--------------------------------------------------------------------------------
Q294M6_DROPS/179-311--------------------------------------------------------------------------------
ADCC_DICDI/344-478--------------------------------------------------------------------------------
Q6CS19_KLULA/219-373--------------------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------------------------------------------------------------------------------
Q22NR4_TETTS/187-325--------------------------------------------------------------------------------
ROD1_YEAST/232-395--------------------------------------------------------------------------------
A0CL31_PARTE/172-315--------------------------------------------------------------------------------
APYA_EMENI/180-326--------------------------------------------------------------------------------
Q296V0_DROPS/178-310--------------------------------------------------------------------------------
Q6CW08_KLULA/282-443--------------------------------------------------------------------------------
A8WP33_CAEBR/159-305--------------------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------------------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------------------------------------------------------------------------------
A7TQI8_VANPO/357-526--------------------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------------------------------------------------------------------------------
Q9W2V2_DROME/420-633--------------------------------------------------------------------------------
Q240M9_TETTS/188-318--------------------------------------------------------------------------------
A5DUN4_LODEL/264-404--------------------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------------------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------------------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------------------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------------------------------------------------------------------------------
O17983_CAEEL/173-318--------------------------------------------------------------------------------
Q9V393_DROME/233-393--------------------------------------------------------------------------------
A0BMC5_PARTE/210-346--------------------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------------------------------------------------------------------------------
A0D004_PARTE/178-324--------------------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------------------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------------------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------------------------------------------------------------------------------
PALF_ASHGO/233-368--------------------------------------------------------------------------------
ARRS_MOUSE/200-361--------------------------------------------------------------------------------
A8WP37_CAEBR/170-319--------------------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------------------------------------------------------------------------------
MU170_SCHPO/266-426--------------------------------------------------------------------------------
A5DW17_LODEL/261-403--------------------------------------------------------------------------------
A0D012_PARTE/172-315--------------------------------------------------------------------------------
ADCA_DICDI/313-441--------------------------------------------------------------------------------
Q9I7L0_DROME/174-307--------------------------------------------------------------------------------
A7SF55_NEMVE/129-256--------------------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------------------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------------------------------------------------------------------------------
A0E996_PARTE/174-317--------------------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------------------------------------------------------------------------------
PALF_YEAST/259-394--------------------------------------------------------------------------------
Q23672_CAEEL/163-311--------------------------------------------------------------------------------
A7TPY5_VANPO/228-381--------------------------------------------------------------------------------
Q759V0_ASHGO/221-368--------------------------------------------------------------------------------
Q9VGU7_DROME/180-316--------------------------------------------------------------------------------
Q6FM62_CANGA/224-379--------------------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------------------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------------------------------------------------------------------------------
ARRD5_MOUSE/170-307--------------------------------------------------------------------------------
Q17624_CAEEL/176-340--------------------------------------------------------------------------------
A0D9C9_PARTE/194-337--------------------------------------------------------------------------------
A0CE97_PARTE/209-345--------------------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------------------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------------------------------------------------------------------------------
A7SL06_NEMVE/167-299--------------------------------------------------------------------------------
O45782_CAEEL/179-307--------------------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------------------------------------------------------------------------------
ADCB_DICDI/337-465--------------------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------------------------------------------------------------------------------
Q294M3_DROPS/163-297--------------------------------------------------------------------------------
A8WP43_CAEBR/183-324--------------------------------------------------------------------------------
A3LXL3_PICST/266-408--------------------------------------------------------------------------------
O17981_CAEEL/182-333--------------------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------------------------------------------------------------------------------
A8X383_CAEBR/164-301--------------------------------------------------------------------------------
Q20232_CAEEL/173-309--------------------------------------------------------------------------------
A0BCE6_PARTE/199-335--------------------------------------------------------------------------------
Q5AP77_CANAL/170-448--------------------------------------------------------------------------------
A0BDM3_PARTE/168-302--------------------------------------------------------------------------------
Q23674_CAEEL/182-339--------------------------------------------------------------------------------
ARRD5_BOVIN/171-309--------------------------------------------------------------------------------
YA4C_SCHPO/180-322--------------------------------------------------------------------------------
Q294M1_DROPS/173-305--------------------------------------------------------------------------------
A0A0D1DR37_USTMA/181-316--------------------------------------------------------------------------------
A7TDW3_VANPO/229-389--------------------------------------------------------------------------------
Q6FY06_CANGA/237-406--------------------------------------------------------------------------------
A6R1F7_AJECN/559-759--------------------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------------------------------------------------------------------------------
A7TQH7_VANPO/294-447--------------------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------------------------------------------------------------------------------
PALF_KLULA/263-398--------------------------------------------------------------------------------
Q6CG62_YARLI/321-486--------------------------------------------------------------------------------
A0A0D1E8U6_USTMA/601-804--------------------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------------------------------------------------------------------------------
YOA5_SCHPO/223-379--------------------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------------------------------------------------------------------------------
E7LU16_YEASV/179-340--------------------------------------------------------------------------------
F1QAH2_DANRE/171-293--------------------------------------------------------------------------------
F6SKI7_XENTR/196-355--------------------------------------------------------------------------------
F6Y0E4_XENTR/163-285--------------------------------------------------------------------------------
G4VCF9_SCHMA/96-254--------------------------------------------------------------------------------
H2N0W5_ORYLA/194-351--------------------------------------------------------------------------------
H3CCN8_TETNG/163-285--------------------------------------------------------------------------------
H3DDA7_TETNG/203-325--------------------------------------------------------------------------------
ART5_YEAST/332-474--------------------------------------------------------------------------------
Q08CX7_XENTR/182-306--------------------------------------------------------------------------------
TXNIP_MOUSE/176-299--------------------------------------------------------------------------------
Q9VI00_DROME/172-303--------------------------------------------------------------------------------

PF07070

E3E849_PAEPS/4-211--------------------------------------------------------------------------------
Q9F2L5_STRCO/29-244--------------------------------------------------------------------------------
B7VMX8_VIBTL/6-222--------------------------------------------------------------------------------
Q87KC8_VIBPA/6-222--------------------------------------------------------------------------------
D2SH36_GEOOG/3-216--------------------------------------------------------------------------------
U5VQ01_9ACTN/3-218--------------------------------------------------------------------------------
A9B5Z7_HERA2/2-209--------------------------------------------------------------------------------
Q8CK18_STRCO/3-217--------------------------------------------------------------------------------
A1S9J4_SHEAM/2-218--------------------------------------------------------------------------------
F8AWR6_FRADG/3-216--------------------------------------------------------------------------------
D5XEE5_THEPJ/2-202--------------------------------------------------------------------------------
F6CIG7_DESK7/3-202--------------------------------------------------------------------------------
E8U7T1_DEIML/4-201--------------------------------------------------------------------------------
D9SYU9_MICAI/3-218--------------------------------------------------------------------------------
SP0M_BACSU/4-212--------------------------------------------------------------------------------
D6Y483_THEBD/3-219--------------------------------------------------------------------------------
D7B3X5_NOCDD/3-216--------------------------------------------------------------------------------
A6W415_KINRD/4-215--------------------------------------------------------------------------------
A5D298_PELTS/2-203--------------------------------------------------------------------------------
Q7MGK0_VIBVY/6-223--------------------------------------------------------------------------------
I0JR17_HALH3/2-206--------------------------------------------------------------------------------
L0A4L1_DEIPD/4-200--------------------------------------------------------------------------------
C1D0Z4_DEIDV/4-201--------------------------------------------------------------------------------
Q8YPP0_NOSS1/22-229--------------------------------------------------------------------------------
R4LYD7_9ACTN/3-214--------------------------------------------------------------------------------
C6WBH8_ACTMD/3-218--------------------------------------------------------------------------------
R4SZZ1_AMYOR/2-217--------------------------------------------------------------------------------
Q3IE37_PSEHT/2-218--------------------------------------------------------------------------------
E4N440_KITSK/3-218--------------------------------------------------------------------------------
D3Q3X8_STANL/19-229--------------------------------------------------------------------------------
G2NX38_STRVO/3-217--------------------------------------------------------------------------------
E2Q1G0_STRC2/1-209--------------------------------------------------------------------------------
U5W7Z2_9ACTN/3-218--------------------------------------------------------------------------------
D4GQ21_HALVD/1-207--------------------------------------------------------------------------------
C4L3D6_EXISA/2-213--------------------------------------------------------------------------------
L0JQI9_NATP1/1-204--------------------------------------------------------------------------------
U5LEI3_9BACI/4-214--------------------------------------------------------------------------------
B7GKU0_ANOFW/25-235--------------------------------------------------------------------------------
C5D3Y3_GEOSW/2-199--------------------------------------------------------------------------------
H2K613_STRHJ/3-217--------------------------------------------------------------------------------
Q9KVV0_VIBCH/21-237--------------------------------------------------------------------------------
Q2J8X7_FRASC/3-216--------------------------------------------------------------------------------
D9STE5_CLOC7/4-212--------------------------------------------------------------------------------
Q81QV7_BACAN/2-213--------------------------------------------------------------------------------
X5A5U4_9BACL/4-211--------------------------------------------------------------------------------
D2B8E4_STRRD/3-215--------------------------------------------------------------------------------
F2EZY3_SOLSS/4-214--------------------------------------------------------------------------------
Q5V309_HALMA/3-209--------------------------------------------------------------------------------
Q6LLI7_PHOPR/4-219--------------------------------------------------------------------------------
E4NWJ2_HALBP/1-207--------------------------------------------------------------------------------
E1SSB8_FERBD/2-218--------------------------------------------------------------------------------
D7AXU0_NOCDD/3-217--------------------------------------------------------------------------------
F4FG08_VERMA/3-218--------------------------------------------------------------------------------
D3EJD4_GEOS4/4-211--------------------------------------------------------------------------------
I0H7C6_ACTM4/3-218--------------------------------------------------------------------------------
B1VNV5_STRGG/3-217--------------------------------------------------------------------------------
H8MVT2_CORCM/3-210--------------------------------------------------------------------------------
H8GZW1_DEIGI/5-201--------------------------------------------------------------------------------
Q5L337_GEOKA/2-211--------------------------------------------------------------------------------
C0ZHJ0_BREBN/2-209--------------------------------------------------------------------------------
H2JK05_STRHJ/3-217--------------------------------------------------------------------------------
Q8EMA6_OCEIH/2-211--------------------------------------------------------------------------------
F0LQ35_VIBFN/4-220--------------------------------------------------------------------------------
Q5L3I0_GEOKA/3-199--------------------------------------------------------------------------------
E1V3I8_HALED/2-214--------------------------------------------------------------------------------
R4SRA3_AMYOR/2-218--------------------------------------------------------------------------------
G2NQ97_STREK/3-217--------------------------------------------------------------------------------
C7MVV3_SACVD/2-217--------------------------------------------------------------------------------
Q47QI1_THEFY/3-218--------------------------------------------------------------------------------
B1YLT3_EXIS2/2-212--------------------------------------------------------------------------------
D2RPW6_HALTV/1-204--------------------------------------------------------------------------------
D1A596_THECD/3-218--------------------------------------------------------------------------------
D2ASM7_STRRD/3-218--------------------------------------------------------------------------------
N0B2E1_9BACI/13-223--------------------------------------------------------------------------------
H6NE63_9BACL/4-211--------------------------------------------------------------------------------
K0K0P9_SACES/2-217--------------------------------------------------------------------------------
Q5E1Q2_VIBF1/4-219--------------------------------------------------------------------------------
I7BQH2_NATSJ/1-201--------------------------------------------------------------------------------
K0JWS7_SACES/3-218--------------------------------------------------------------------------------
V6K362_STRNV/3-217--------------------------------------------------------------------------------
A4FGU2_SACEN/3-218--------------------------------------------------------------------------------
Q5YZ34_NOCFA/2-216--------------------------------------------------------------------------------
D9T8R1_MICAI/3-218--------------------------------------------------------------------------------
C6CSI9_PAESJ/5-212--------------------------------------------------------------------------------
D1A1F2_THECD/3-218--------------------------------------------------------------------------------
G0G8W7_AMYMS/2-215--------------------------------------------------------------------------------
U5W8Q8_9ACTN/3-214--------------------------------------------------------------------------------

PF04425

A3GGA7_PICST/92-585PGGLSPTTSATQGNSIDTIINDVSSRLE.................................EYQLEREHEERGDYLFEDD
A5DRA9_PICGU/36-464TSVTTSSITASSLSLHNSDTTAPSSNDP....................................................
Q6BJG5_DEBHA/93-577SSNRDNNLDSMMENVSERINEYALDNNDEEENYFF.............GGDENDTNQA...NEHLINEE...........
A5DPQ0_PICGU/115-602SPQTSATSQSGHENHIDGLLSSTADRLN............................EY...QMNDSAYQEQNFYFDDSND
Q6BSG0_DEBHA/5-422TPSVALSAIQSPTSNSSVDEFPFPNQEI.................................HSGLEGGP...........
Q6BVD1_DEBHA/28-455STARSNSVVAQASSVASTRETEDSNDNS.................................QRLIIADE...........
Q5ABB5_CANAL/19-455DYFASVPTSPTLDPMLSEPLDAESAAVQ....................................................
Q75E04_ASHGO/51-474ISVSSSRVNLTTIQSLDGVQSDSC....INL......................QALSA..QQYSLQTPS...........
BUL1_YEAST/108-543AAGSSADLSHQSLSTDALGATRSSSTSNLEN.....................LIPLRT..EHHSIAAHQSTAV.......
A5E3Q9_LODEL/66-535SPRLHAQLS......IDQNLLQVSRRLEDTLQM..................ERDRQQEQMHEHAMVFVDETGLMPV....
A3LX53_PICST/9-457NEYGGFDGIPSTYSLPTSPVRELFANPL....................................................
Q6FUH4_CANGA/102-545NPAVNGDSSQVSYDIDRNQTLLADNDPIDSRAL.................NNLQPLRT..EHHNINSTLSGVH.......
Q6CSE2_KLULA/69-505DSSDGTTVSQLDEMFLSPSPSLYDANTRVGSSQS...............LQSLNTVSSGVLQNSLQALS...........
Q6FP46_CANGA/103-568LQGSSSSQSGSELNVESPLRMNGSQTSIHGNFRNSSSNTLLPTTSGIFGGSSLQPYST..RHYSLNPNQNNPLHPT....
Q5AN22_CANAL/97-598SPSSSR..........DHTIDEAIQRLNEYGLAQERD..........EMNNDEYLFEE...HNNDPHNNTNNTLSP....
A7TIV7_VANPO/87-537DLMSINPFSHSSSDLTVSNTNSIQGSSSSTNLHAHNS..........LIENSLHPLST..QHLNLQSTTSA.........
E7KSA7_YEASL/88-524LPSNDNSVERSQLTAVPGSENACNNATAHSLTNLHPL..........QTQHLTINST...........RSGGQSL.....
G0VB73_NAUCC/105-559LSHDIADVGAATTATTTPNTTSLDHRVEILQDSTQAAPTL...SSTMVNLNNLHPLNT..RHYNISNGADLNSSQS....
G0VC27_NAUCC/80-515TIRIQNDVDYMQSPESPTSMLEGQTDGEQDIYVTPS...........YALRTLHALET..QHQNLNWER...........
G0VC28_NAUCC/152-590.AYIENNVDLTTYPLQQPPLAHHSNSGHDIHITPSY............ALNALHPLNT..QHLTIQPTNDP.........

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------FGTPCNVEFELDNCQNRK
VP26A_HUMAN/8-283--------------------------------------------------------------FGPICEIDIVLNDGETRK
PEP8_YEAST/5-364--------------------------------------------------------------FKPPIDIEILFDNEESRK
VP26A_ARATH/8-283--------------------------------------------------------------FKPACNISITFTDGKNRK
VPS26_SCHPO/5-279--------------------------------------------------------------FKSPIDVDLHLDNEEERT
VPS26_DROME/6-280--------------------------------------------------------------FGQSADIEIVF.DGAEHK
VPS26_CAEEL/7-282--------------------------------------------------------------FGQSAEIQIRLSNEDTRK
DSCR3_MOUSE/1-283--------------------------------------------------------------MGTTLDIKIKR.......

PF00339

B4LEM0_DROVI/17-172--------------------------------------------------------------VTFYLG------------
ARRS_BOVIN/22-180--------------------------------------------------------------VTIYLG------------
O76685_CAEEL/6-159--------------------------------------------------------------LHVIFD------------
Q9I7L0_DROME/5-150--------------------------------------------------------------CEIDFD------------
H2N0W5_ORYLA/17-173--------------------------------------------------------------VAVYLA------------
Q23674_CAEEL/4-159--------------------------------------------------------------CLVEFA------------
O45782_CAEEL/7-155--------------------------------------------------------------FEILFN------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------VTVYLG------------
Q9VGU7_DROME/5-155--------------------------------------------------------------VNFVFD------------
Q20577_CAEEL/7-158--------------------------------------------------------------FGIVFD------------
P91469_CAEEL/7-159--------------------------------------------------------------LQVIFD------------
Q9VI00_DROME/5-148--------------------------------------------------------------CSFELD------------
Q20232_CAEEL/7-150--------------------------------------------------------------FDIRLN------------
ARRD4_MOUSE/18-166--------------------------------------------------------------GLVFED------------
O17983_CAEEL/6-146--------------------------------------------------------------CDPQIS------------
PALF_YEAST/39-201--------------------------------------------------------------FRIDID------------
ARRB1_BOVIN/18-174--------------------------------------------------------------LTVYLG------------
Q8SYU5_DROME/5-157--------------------------------------------------------------CMITFD------------
O17981_CAEEL/6-159--------------------------------------------------------------LHVIFD------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------LRIEYD------------
O17984_CAEEL/4-157--------------------------------------------------------------IFVLFD------------
F6SKI7_XENTR/21-176--------------------------------------------------------------VSVYLG------------
Q9VI53_DROME/6-155--------------------------------------------------------------CELQLD------------
H2L9D1_ORYLA/14-171--------------------------------------------------------------LTLYLG------------
ARRB_CAEEL/22-186--------------------------------------------------------------ITTYLG------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------FLIEFD------------
Q23672_CAEEL/8-142--------------------------------------------------------------VDISFD------------
ARRD2_MOUSE/9-158--------------------------------------------------------------FVVEID------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------VTLKLI------------
C5GL98_AJEDR/142-318--------------------------------------------------------------LRMCLT------------
YNSK_SCHPO/63-242--------------------------------------------------------------LKLQLI------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------VMLTLV------------
E7KUR3_YEASL/144-346--------------------------------------------------------------VTLSLV------------

PF02752

Q7PUI7_ANOGA/236-407-----------------------------------------------------------DGRVNLKAS------------
Q9TYQ0_CAEEL/174-315-----------------------------------------------------------KGALIATMQ------------
Q7PUR5_ANOGA/187-319-----------------------------------------------------------TDPLIVTAT------------
Q7PYD9_ANOGA/175-306-----------------------------------------------------------TKPLFVKVT------------
Q380N5_ANOGA/183-323-----------------------------------------------------------SRPLMVSAT------------
CRED_ASPOR/181-332-----------------------------------------------------------PNKIEYSIS------------
Q752Z4_ASHGO/228-382-----------------------------------------------------------AGRLQYELV------------
ARRD5_HUMAN/184-321-----------------------------------------------------------QGTVCLQIQ------------
ARRD4_HUMAN/191-318-----------------------------------------------------------SGPVSLSAK------------
Q294M9_DROPS/171-302-----------------------------------------------------------TDPLKLELN------------
Q6BI98_DEBHA/278-420-----------------------------------------------------------PNKAQYSVG------------
Q294M7_DROPS/174-306-----------------------------------------------------------SKPLSLRLS------------
Q6BIN4_DEBHA/247-390-----------------------------------------------------------PKKVEYSLN------------
Q293Z7_DROPS/175-308-----------------------------------------------------------TRPITMVAL------------
Q9I7K7_DROME/179-320-----------------------------------------------------------MKPLHLQLQ------------
A5DM18_PICGU/246-387-----------------------------------------------------------PGKVEYRVE------------
Q294M5_DROPS/171-304-----------------------------------------------------------SGPVLSTLI------------
Q16ZK0_AEDAE/170-299-----------------------------------------------------------SRPLLITVE------------
A0BIT0_PARTE/173-314-----------------------------------------------------------TGSTKVKVQ------------
Q4V467_DROME/125-256-----------------------------------------------------------SDPLTLELN------------
Q7SC90_NEUCR/193-351-----------------------------------------------------------DSIVTLGIS------------
Q66L50_DANRE/187-314-----------------------------------------------------------SGPVSLSAK------------
Q95NF3_ANOGA/193-351-----------------------------------------------------------PGELELEVT------------
Q6C993_YARLI/185-326-----------------------------------------------------------PNKVDYEFS------------
O44847_CAEEL/147-273-----------------------------------------------------------NGQPTFKVT------------
A0CWE9_PARTE/173-316-----------------------------------------------------------TGNTKVKIQ------------
Q23QU8_TETTS/188-318-----------------------------------------------------------SGQIKYNIQ------------
Q6ZM71_DANRE/162-286-----------------------------------------------------------NGTVVLNAK------------
A8WP41_CAEBR/178-317-----------------------------------------------------------KGLVSMTVS------------
Q0E8K8_DROME/169-299-----------------------------------------------------------GGQIKCRVS------------
A0C0J3_PARTE/194-337-----------------------------------------------------------LGTISFKFQ------------
Q16ZJ7_AEDAE/171-300-----------------------------------------------------------SNPLYIEVE------------
Q23YG0_TETTS/188-318-----------------------------------------------------------SGQIKYNIT------------
Q9W7R1_ORYLA/193-351-----------------------------------------------------------DKPLHVQAT------------
ARRB_CAEEL/205-363-----------------------------------------------------------SGLLHMEVS------------
Q7RZE0_NEUCR/198-350-----------------------------------------------------------PNKIEYSIM------------
ALY2_SCHPO/345-506-----------------------------------------------------------DERLHYELQ------------
Q5AM66_CANAL/305-457-----------------------------------------------------------PNKVEYSLS------------
ARRB2_MOUSE/195-350-----------------------------------------------------------RRSLHLEAS------------
A2BIP7_DANRE/186-313-----------------------------------------------------------SGNVSMNIS------------
ARRD1_HUMAN/162-286-----------------------------------------------------------TGSVVLTAS------------
A2QR01_ASPNC/439-613-----------------------------------------------------------EDQLHYDIV------------
Q380P6_ANOGA/182-314-----------------------------------------------------------SEPLYISAQ------------
YC9F_SCHPO/183-325-----------------------------------------------------------PLKVNYETS------------
Q16H74_AEDAE/171-301-----------------------------------------------------------SAPMIMTVC------------
Q6DH07_DANRE/192-355-----------------------------------------------------------DKPVLLEAS------------
A8X4Z9_CAEBR/175-315-----------------------------------------------------------KGIVTMTVT------------
ART1_SCHPO/287-428-----------------------------------------------------------DGRVVVEVS------------
ARRD2_HUMAN/180-307-----------------------------------------------------------RGLVSLSAK------------
Q294M6_DROPS/179-311-----------------------------------------------------------THPVELKVT------------
ADCC_DICDI/344-478-----------------------------------------------------------GGNISISCK------------
Q6CS19_KLULA/219-373-----------------------------------------------------------PQKVDYSIS------------
Q2UDU8_ASPOR/60-215-----------------------------------------------------------DNVAQYSIS------------
Q22NR4_TETTS/187-325-----------------------------------------------------------YGLYQQRVF------------
ROD1_YEAST/232-395-----------------------------------------------------------PEKVDYTIS------------
A0CL31_PARTE/172-315-----------------------------------------------------------RGTSSIEVK------------
APYA_EMENI/180-326-----------------------------------------------------------ANKIAYRIG------------
Q296V0_DROPS/178-310-----------------------------------------------------------SGPLAVITS------------
Q6CW08_KLULA/282-443-----------------------------------------------------------PDKLQYEIS------------
A8WP33_CAEBR/159-305-----------------------------------------------------------DGTIQAKFV------------
A0DYQ7_PARTE/173-314-----------------------------------------------------------TGGTKVKIQ------------
A0D2Y0_PARTE/206-342-----------------------------------------------------------GGIVDLKIQ------------
A7TQI8_VANPO/357-526-----------------------------------------------------------EHQLHYDIV------------
Q17EA7_AEDAE/182-314-----------------------------------------------------------TEPLIVTAT------------
Q9W2V2_DROME/420-633-----------------------------------------------------------DGRVGLRAS------------
Q240M9_TETTS/188-318-----------------------------------------------------------SGQINYNIT------------
A5DUN4_LODEL/264-404-----------------------------------------------------------PKKVEYSLS------------
A0NDX6_ANOGA/173-303-----------------------------------------------------------SEPLSINVM------------
Q16ZJ5_AEDAE/174-305-----------------------------------------------------------SAPMLITAE------------
Q7QCL7_ANOGA/170-301-----------------------------------------------------------GGIVKCKII------------
A2QTZ8_ASPNC/184-328-----------------------------------------------------------PQKIIYRVS------------
O17983_CAEEL/173-318-----------------------------------------------------------RGNVIYTLQ------------
Q9V393_DROME/233-393-----------------------------------------------------------PNKIHLEAT------------
A0BMC5_PARTE/210-346-----------------------------------------------------------RGTVELSLK------------
A1C8U8_ASPCL/140-283-----------------------------------------------------------SGKVVYTVS------------
A0D004_PARTE/178-324-----------------------------------------------------------KGSAQITAV------------
Q16ZK1_AEDAE/136-269-----------------------------------------------------------SGPLVVALQ------------
Q17EA8_AEDAE/183-323-----------------------------------------------------------SAPLMVKAT------------
Q16ZJ8_AEDAE/186-315-----------------------------------------------------------SGPMHFSIE------------
PALF_ASHGO/233-368-----------------------------------------------------------SKTVTISVD------------
ARRS_MOUSE/200-361-----------------------------------------------------------DKPLNLSVS------------
A8WP37_CAEBR/170-319-----------------------------------------------------------DGVFSIKLN------------
Q9GYT5_CAEEL/181-328-----------------------------------------------------------GGILEMSLN------------
MU170_SCHPO/266-426-----------------------------------------------------------EAKTTLEVH------------
A5DW17_LODEL/261-403-----------------------------------------------------------VGKLQYCVS------------
A0D012_PARTE/172-315-----------------------------------------------------------QGSSSISAK------------
ADCA_DICDI/313-441-----------------------------------------------------------KGKLHVKTW------------
Q9I7L0_DROME/174-307-----------------------------------------------------------SDPLALQLT------------
A7SF55_NEMVE/129-256-----------------------------------------------------------AAPLHALVY------------
Q16ZK2_AEDAE/273-408-----------------------------------------------------------SGSLVLSVQ------------
A8XYD8_CAEBR/172-316-----------------------------------------------------------RGSVIYELA------------
A0E996_PARTE/174-317-----------------------------------------------------------GGSAQISLQ------------
Q0U5A6_PHANO/182-337-----------------------------------------------------------ANKLAYKIT------------
PALF_YEAST/259-394-----------------------------------------------------------NKTVTISVD------------
Q23672_CAEEL/163-311-----------------------------------------------------------NGPISLKVS------------
A7TPY5_VANPO/228-381-----------------------------------------------------------PGKVEYTIS------------
Q759V0_ASHGO/221-368-----------------------------------------------------------PGKLDYSLS------------
Q9VGU7_DROME/180-316-----------------------------------------------------------HKPMIMDVS------------
Q6FM62_CANGA/224-379-----------------------------------------------------------PKKVEYSIS------------
A7SKJ5_NEMVE/177-307-----------------------------------------------------------SGPLSLVGH------------
Q6CGL3_YARLI/174-329-----------------------------------------------------------DHLVDVDYT------------
ARRD5_MOUSE/170-307-----------------------------------------------------------QGWVSLHVQ------------
Q17624_CAEEL/176-340-----------------------------------------------------------KSKLAAELA------------
A0D9C9_PARTE/194-337-----------------------------------------------------------LGTILFKFQ------------
A0CE97_PARTE/209-345-----------------------------------------------------------SGAVELSVR------------
Q7PYE1_ANOGA/178-310-----------------------------------------------------------SGPLSLIVH------------
Q16ZJ6_AEDAE/174-302-----------------------------------------------------------SDPMDITVE------------
A7SL06_NEMVE/167-299-----------------------------------------------------------SGSLTVTAK------------
O45782_CAEEL/179-307-----------------------------------------------------------AGSVTGEIR------------
Q17HB8_AEDAE/169-300-----------------------------------------------------------GGTVRCNVG------------
ADCB_DICDI/337-465-----------------------------------------------------------GGTIEMTIT------------
Q23FQ6_TETTS/188-318-----------------------------------------------------------SGEINYSMS------------
Q294M3_DROPS/163-297-----------------------------------------------------------SGPICSSLA------------
A8WP43_CAEBR/183-324-----------------------------------------------------------SKEVKIKVQ------------
A3LXL3_PICST/266-408-----------------------------------------------------------PEKVDYNVN------------
O17981_CAEEL/182-333-----------------------------------------------------------KGYLELRVN------------
Q16ZK3_AEDAE/167-301-----------------------------------------------------------SGMLYASVE------------
A8X383_CAEBR/164-301-----------------------------------------------------------FGCVSLNMS------------
Q20232_CAEEL/173-309-----------------------------------------------------------RGALALRII------------
A0BCE6_PARTE/199-335-----------------------------------------------------------RGMIELGIR------------
Q5AP77_CANAL/170-448-----------------------------------------------------------NDAVHYIIT------------
A0BDM3_PARTE/168-302-----------------------------------------------------------QGISKLECK------------
Q23674_CAEEL/182-339-----------------------------------------------------------NGLVRMELR------------
ARRD5_BOVIN/171-309-----------------------------------------------------------QGTICLQIQ------------
YA4C_SCHPO/180-322-----------------------------------------------------------PNKIEYTIS------------
Q294M1_DROPS/173-305-----------------------------------------------------------TGPLTVKFS------------
A0A0D1DR37_USTMA/181-316-----------------------------------------------------------QDDMRVKVL------------
A7TDW3_VANPO/229-389-----------------------------------------------------------PDKVEYSIS------------
Q6FY06_CANGA/237-406-----------------------------------------------------------PEKVEYSIS------------
A6R1F7_AJECN/559-759-----------------------------------------------------------EDQLHYDIV------------
Q9XXC4_CAEEL/159-308-----------------------------------------------------------DGLFLLKLH------------
A7TQH7_VANPO/294-447-----------------------------------------------------------PDKLQYEVS------------
Q16ID9_AEDAE/216-390-----------------------------------------------------------PNKIHLEAS------------
PALF_KLULA/263-398-----------------------------------------------------------NKTVKISVE------------
Q6CG62_YARLI/321-486-----------------------------------------------------------EDQLHYDIV------------
A0A0D1E8U6_USTMA/601-804-----------------------------------------------------------EDLLSYMVV------------
Q9XTU0_CAEEL/176-327-----------------------------------------------------------YGKVNLQIR------------
YOA5_SCHPO/223-379-----------------------------------------------------------KSATRITVS------------
Q0CQZ7_ASPTN/118-273-----------------------------------------------------------DNKVHYRIS------------
E7LU16_YEASV/179-340-----------------------------------------------------------PDKVDYSIS------------
F1QAH2_DANRE/171-293-----------------------------------------------------------SGNISMDIF------------
F6SKI7_XENTR/196-355-----------------------------------------------------------DKPLHLTAS------------
F6Y0E4_XENTR/163-285-----------------------------------------------------------SGQVLLAAS------------
G4VCF9_SCHMA/96-254-----------------------------------------------------------PGTLRLEVS------------
H2N0W5_ORYLA/194-351-----------------------------------------------------------EKPLQVKLS------------
H3CCN8_TETNG/163-285-----------------------------------------------------------TGTLMLKTR------------
H3DDA7_TETNG/203-325-----------------------------------------------------------SGGVFMHIK------------
ART5_YEAST/332-474-----------------------------------------------------------RDKLQYETS------------
Q08CX7_XENTR/182-306-----------------------------------------------------------.GHVSVTAK------------
TXNIP_MOUSE/176-299-----------------------------------------------------------DGRVSVSAR------------
Q9VI00_DROME/172-303-----------------------------------------------------------SGPVLSTLT------------

PF07070

E3E849_PAEPS/4-211-----------------------------------------------------------IGSAKVDTL------------
Q9F2L5_STRCO/29-244-----------------------------------------------------------VGGPTVDTT------------
B7VMX8_VIBTL/6-222-----------------------------------------------------------IGSAKVDSV------------
Q87KC8_VIBPA/6-222-----------------------------------------------------------IGSAKVDSI------------
D2SH36_GEOOG/3-216-----------------------------------------------------------SGGAGVETV------------
U5VQ01_9ACTN/3-218-----------------------------------------------------------VGGPSVDTV------------
A9B5Z7_HERA2/2-209-----------------------------------------------------------IGNARIETH------------
Q8CK18_STRCO/3-217-----------------------------------------------------------AGGASVETV------------
A1S9J4_SHEAM/2-218-----------------------------------------------------------IGSAKVDTR------------
F8AWR6_FRADG/3-216-----------------------------------------------------------VGNADVETV------------
D5XEE5_THEPJ/2-202-----------------------------------------------------------IGSAKVDLE------------
F6CIG7_DESK7/3-202-----------------------------------------------------------IGSARVNLE------------
E8U7T1_DEIML/4-201-----------------------------------------------------------VGGARVDAR------------
D9SYU9_MICAI/3-218-----------------------------------------------------------VGGPSVETV------------
SP0M_BACSU/4-212-----------------------------------------------------------IGAAKVDTI------------
D6Y483_THEBD/3-219-----------------------------------------------------------VGAPSVDTV------------
D7B3X5_NOCDD/3-216-----------------------------------------------------------DDGPTVDTV------------
A6W415_KINRD/4-215-----------------------------------------------------------AGAASVDTV------------
A5D298_PELTS/2-203-----------------------------------------------------------IGAASVNLE------------
Q7MGK0_VIBVY/6-223-----------------------------------------------------------IGSAKVDSI------------
I0JR17_HALH3/2-206-----------------------------------------------------------VGSAKVDTQ------------
L0A4L1_DEIPD/4-200-----------------------------------------------------------IGNATVDTQ------------
C1D0Z4_DEIDV/4-201-----------------------------------------------------------VGAARVDTR------------
Q8YPP0_NOSS1/22-229-----------------------------------------------------------IGAAKVDTR------------
R4LYD7_9ACTN/3-214-----------------------------------------------------------LGGPTVHTA------------
C6WBH8_ACTMD/3-218-----------------------------------------------------------VGGPSVDTV------------
R4SZZ1_AMYOR/2-217-----------------------------------------------------------VGGPSVDTV------------
Q3IE37_PSEHT/2-218-----------------------------------------------------------IGAAKVDTI------------
E4N440_KITSK/3-218-----------------------------------------------------------VGGPTVDTV------------
D3Q3X8_STANL/19-229-----------------------------------------------------------AG.VTVDTV------------
G2NX38_STRVO/3-217-----------------------------------------------------------VGGPVVDTV------------
E2Q1G0_STRC2/1-209-----------------------------------------------------------MGGPTVDTV------------
U5W7Z2_9ACTN/3-218-----------------------------------------------------------VGGPSVETV------------
D4GQ21_HALVD/1-207-----------------------------------------------------------IGNATVDTV------------
C4L3D6_EXISA/2-213-----------------------------------------------------------IGAAKVDTR------------
L0JQI9_NATP1/1-204-----------------------------------------------------------IGSATVETV------------
U5LEI3_9BACI/4-214-----------------------------------------------------------VGSASVDTK------------
B7GKU0_ANOFW/25-235-----------------------------------------------------------IGAAKVDTK------------
C5D3Y3_GEOSW/2-199-----------------------------------------------------------VGAAKVDLV------------
H2K613_STRHJ/3-217-----------------------------------------------------------VGGPSVDTV------------
Q9KVV0_VIBCH/21-237-----------------------------------------------------------IGSAKVDSV------------
Q2J8X7_FRASC/3-216-----------------------------------------------------------VGGAAVETV------------
D9STE5_CLOC7/4-212-----------------------------------------------------------IGGAKVDTV------------
Q81QV7_BACAN/2-213-----------------------------------------------------------IGNAKVDTV------------
X5A5U4_9BACL/4-211-----------------------------------------------------------IGSAKVDTR------------
D2B8E4_STRRD/3-215-----------------------------------------------------------AG.VEVDTI------------
F2EZY3_SOLSS/4-214-----------------------------------------------------------IGAAKVDTK------------
Q5V309_HALMA/3-209-----------------------------------------------------------IGSATVDTV------------
Q6LLI7_PHOPR/4-219-----------------------------------------------------------IGAAKVDTV------------
E4NWJ2_HALBP/1-207-----------------------------------------------------------IGNASVDTV------------
E1SSB8_FERBD/2-218-----------------------------------------------------------IGAAKVDTL------------
D7AXU0_NOCDD/3-217-----------------------------------------------------------FGGASVETT------------
F4FG08_VERMA/3-218-----------------------------------------------------------VGGPSVDTV------------
D3EJD4_GEOS4/4-211-----------------------------------------------------------IGAAQIDTH------------
I0H7C6_ACTM4/3-218-----------------------------------------------------------VGGPSVDTV------------
B1VNV5_STRGG/3-217-----------------------------------------------------------VGGPSVDTV------------
H8MVT2_CORCM/3-210-----------------------------------------------------------IGSARVDTR------------
H8GZW1_DEIGI/5-201-----------------------------------------------------------IGAARVDTR------------
Q5L337_GEOKA/2-211-----------------------------------------------------------IGAATVDTK------------
C0ZHJ0_BREBN/2-209-----------------------------------------------------------IGSAQVDAR------------
H2JK05_STRHJ/3-217-----------------------------------------------------------VGGPTVDTV------------
Q8EMA6_OCEIH/2-211-----------------------------------------------------------IGSTKLDTQ------------
F0LQ35_VIBFN/4-220-----------------------------------------------------------IGSAKVDSV------------
Q5L3I0_GEOKA/3-199-----------------------------------------------------------IGAAKVDLV------------
E1V3I8_HALED/2-214-----------------------------------------------------------IGNARVDTM------------
R4SRA3_AMYOR/2-218-----------------------------------------------------------SGGAKIDAR------------
G2NQ97_STREK/3-217-----------------------------------------------------------VGAPTVDTV------------
C7MVV3_SACVD/2-217-----------------------------------------------------------VGGPSVDTV------------
Q47QI1_THEFY/3-218-----------------------------------------------------------VGGPSVDTV------------
B1YLT3_EXIS2/2-212-----------------------------------------------------------IGAATVDTR------------
D2RPW6_HALTV/1-204-----------------------------------------------------------IGAATVDTI------------
D1A596_THECD/3-218-----------------------------------------------------------VGGPSVDTV------------
D2ASM7_STRRD/3-218-----------------------------------------------------------VGGPSVDTV------------
N0B2E1_9BACI/13-223-----------------------------------------------------------MGSATVNTK------------
H6NE63_9BACL/4-211-----------------------------------------------------------IGSAKVDTQ------------
K0K0P9_SACES/2-217-----------------------------------------------------------VGGPSVDTV------------
Q5E1Q2_VIBF1/4-219-----------------------------------------------------------IGSANVDTI------------
I7BQH2_NATSJ/1-201-----------------------------------------------------------IGAATVDTV------------
K0JWS7_SACES/3-218-----------------------------------------------------------VGGPSVDTV------------
V6K362_STRNV/3-217-----------------------------------------------------------VGGPTVETV------------
A4FGU2_SACEN/3-218-----------------------------------------------------------IGGPSVDTV------------
Q5YZ34_NOCFA/2-216-----------------------------------------------------------VGGAEVETQ------------
D9T8R1_MICAI/3-218-----------------------------------------------------------VGGPSVDTV------------
C6CSI9_PAESJ/5-212-----------------------------------------------------------IGSAKIDTL------------
D1A1F2_THECD/3-218-----------------------------------------------------------VGGPSVETV------------
G0G8W7_AMYMS/2-215-----------------------------------------------------------SGGARIDAR------------
U5W8Q8_9ACTN/3-214-----------------------------------------------------------VGGPTVDTI------------

PF04425

A3GGA7_PICST/92-585DSEHTHTSSDAESDHADEHTHNENVA....VTMD..RYGHSPLDNIDRLPKLT......NSPIDIAIY------------
A5DRA9_PICGU/36-464....................RVIVAD....ENTN..DWQNTLLDNIHQLKNLTFSNNKYAKSLNVSVH------------
Q6BJG5_DEBHA/93-577...................NTPVATN....DTYG.....ETVLDNIDKLPKLN......NSPIDIQVY------------
A5DPQ0_PICGU/115-602........QPGPASSTPRYRGINEPT....DTYG.....HTVLDNIDRLPKSH......SSPIDVQIY------------
Q6BSG0_DEBHA/5-422...............................NFW..E..NTILANAHKLPNLNRSDNKICQDLEIDMK------------
Q6BVD1_DEBHA/28-455...............................DTN..SWRETILDNVHKLTNLTYFNKEVSNAVKISIQ------------
Q5ABB5_CANAL/19-455................................QDGEQDDETILENAHKLKRLTSTNKEISKSLEVKIR------------
Q75E04_ASHGO/51-474....................HDEPIE....DDLANQDDDNINIEKLYSLPKMV......T.PVEIDIR------------
BUL1_YEAST/108-543...............DEDSLDIPPIL....DDLN..DTDNIFIDKLYTLPKMS......T.PIEITIK------------
A5E3Q9_LODEL/66-535...........TSTADANSQVHNENLAITSDSYG.....HSPLDNIDRLQKAT......KSPFDIQIF------------
A3LX53_PICST/9-457................................DLEGESNETILENAHKLKRISASNKEISKALHIHIF------------
Q6FUH4_CANGA/102-545..............SRSSVDLINPIQ....DDLN..DAKCVFVDKLYTLPKLS......T.PVEISIK------------
Q6CSE2_KLULA/69-505...................TRYEAII....DDLD..DSDNIKIEKLYSLPKVS......T.PIDVNIR------------
Q6FP46_CANGA/103-568............VSGSTAVNDNTNIE....DDVN..DADNIAIDKLYSLPKFS......T.PLEIDIR------------
Q5AN22_CANAL/97-598...........VGSSVNANVHNQNIEVTQDDTYG.....HSPLDNIDKLHKLP......HSPIDIQIY------------
A7TIV7_VANPO/87-537................AAIDNNIPIE....DDLN..GSDNIFIDKLYTLPKLT......T.PVEVDIR------------
E7KSA7_YEASL/88-524............HSSSDTNISQIPFE....DDLN..DSDNIFIDKLYTLPKLS......T.PIEIDIR------------
G0VB73_NAUCC/105-559............RASLTMHDLNMQIE....DDLN..DSDSIIIDRLYTLPKLA......T.PVDVEIR------------
G0VC27_NAUCC/80-515....................FITNTD....DDLN..ESDNIFVDDIYTLPKVA......S.PIQISIK------------
G0VC28_NAUCC/152-590................SVDHIDTPFQ....DDLN..ESDNLFIDKLYTLPKID......T.PVEIEIK------------

PF03643

VPS26_DICDI/8-284TIEVTQD......KGKTEKLFVFIG-----------------N--EPVSGKVSI--------NIKEKTKK-IE-------
VP26A_HUMAN/8-283MAEMKTE......DGKVEKHYLFYD-----------------G--ESVSGKVNL--------AFKQPGKR-LE-------
PEP8_YEAST/5-364HVDIATRSSNSSYKSMKESLPVYED-----------------G--ESLGGIVTL--------RVRD.SKK-VD-------
VP26A_ARATH/8-283QVPTKKD......NGQIVMNPLFQS-----------------Q--ETIAGKINI--------EPYQ.GKK-VE-------
VPS26_SCHPO/5-279FVDYEFE......QGRKDKAPIYES-----------------D--ETVKGTVMI--------RLKD.GRK-LD-------
VPS26_DROME/6-280TAEVKGE......DGKVEKMLLFYD-----------------G--ETVSGKVNV--------TLKKPGSK-LE-------
VPS26_CAEEL/7-282IVKARGD......DGNMHDHFLYYD-----------------G--ESVTGTVHV--------NLKKANHK-FE-------
DSCR3_MOUSE/1-283..................ANKVYHA-----------------G--EMLSGVVVI--------SSKD...S-VQ-------

PF00339

B4LEM0_DROVI/17-172-------------....RRDFIDHL-----------------DYCDPVDGVIVV.-------EPEY---L-KN-------
ARRS_BOVIN/22-180-------------....KRDYIDHV-----------------ERVEPVDGVVLV.-------DPEL---V-KG-------
O76685_CAEEL/6-159-------------....QPDEVFHP-----------------G..KPISGRVVLS-------TTKE---K-YK-------
Q9I7L0_DROME/5-150-------------...NNPHGTYFG-----------------G..EVLTGRVTL.-------KLDK---M-KL-------
H2N0W5_ORYLA/17-173-------------....KRDFVDHC-----------------DFVDPVDGVVVI.-------DPTQ---L-KG-------
Q23674_CAEEL/4-159-------------....KSPPVFSP-----------------G..EKVTGNVKMT-------IPDD---E-FK-------
O45782_CAEEL/7-155-------------....NPEQAYFA-----------------G..QEISGKVII.-------ENKE---P-KK-------
H2RRP6_TAKRU/18-174-------------....KRDFVDHL-----------------DHVDPVDGVILV.-------DPEY---L-KD-------
Q9VGU7_DROME/5-155-------------...SNPLGLYQA-----------------G..QLISGTAEL.-------ITER---P-KT-------
Q20577_CAEEL/7-158-------------....SPRG.YAP-----------------G..QTVTGQVVL.-------RSNE---P-IT-------
P91469_CAEEL/7-159-------------....QPDEVFLP-----------------G..QPISGRVVL.-------TTKK---K-LS-------
Q9VI00_DROME/5-148-------------....RREPIYYS-----------------G..ETVNGRAIL.-------TTTS---E-KS-------
Q20232_CAEEL/7-150-------------......KDVYYA-----------------G..ETISGSVLL.-------ENTE---N-IK-------
ARRD4_MOUSE/18-166-------------....ESKGCYSS-----------------G..ETVAGHVLL.-------EAAE---P-VA-------
O17983_CAEEL/6-146-------------....FEKEVYFP-----------------G..DEVKGRAWV.-------STTK---N-LK-------
PALF_YEAST/39-201-------------....EPHRVWKP-----------------N..ESITGEAVI.-------DIKR---D-IT-------
ARRB1_BOVIN/18-174-------------....KRDFVDHI-----------------DLVEPVDGVVLV.-------DPEY---L-KE-------
Q8SYU5_DROME/5-157-------------...QNEHGTYFT-----------------G..QVITGKVIV.-------NLNK---T-KK-------
O17981_CAEEL/6-159-------------....QPNEVFFP-----------------G..QPISGRVVLS-------TTEE---K-YK-------
Q9XXI4_CAEEL/4-156-------------....APNDVYFP-----------------G..QAVTGKVII.-------QNRE---W-IK-------
O17984_CAEEL/4-157-------------....KPNAVYAA-----------------G..QKISGRVVF.-------STAS---Q-QN-------
F6SKI7_XENTR/21-176-------------....KRDYVDHV-----------------ESVDPVDGVVLV.-------DPDL---L-KG-------
Q9VI53_DROME/6-155-------------....NPWNTYYA-----------------G..QTVNGQVKF.-------TFDS---P-KK-------
H2L9D1_ORYLA/14-171-------------....KRDYVDHV-----------------SSVEKLDGVVKV.-------DTTD---F-GD-------
ARRB_CAEEL/22-186-------------....KRDFIDRG-----------------DYVDLIDGMVLI.-------DEEY---I-KD-------
Q9XXI0_CAEEL/6-159-------------....HPAAVYSP-----------------G..QNVAGKLTI.-------RNRN---A-LN-------
Q23672_CAEEL/8-142-------------....KQSEPYYP-----------------G..DTVKGTVVL.-------TNKT---P-LD-------
ARRD2_MOUSE/9-158-------------GARTGTEPVFHG-----------------G..QAVAGRVLL.-------ELAG---A-AR-------

PF13002

A7TSP7_VANPO/130-321-----------------QIVHFHKT-----------FVPDTQAIQTCKNCTTKTT-------KIKNWDIQ-KN-------
C5GL98_AJEDR/142-318-----------------RKVSTKKP-----------......VSRDCSACKYQTE-------ELTSWEFL-TE-------
YNSK_SCHPO/63-242-----------------KRITVLHP-----------......AISHCSACAGSKE-------VLQTWDLA-AN-------
C5DVA9_ZYGRC/141-332-----------------QKVHFHKP-----------FMADLHSIQTCMNCQSKTT-------DIRSWDIQ-KN-------
E7KUR3_YEASL/144-346-----------------QKIHFHKP-----------FVPNISSMQTCMNCKTKIT-------NMKSWEIQ-SN-------

PF02752

Q7PUI7_ANOGA/236-407-----------------LNKAAYVH-----------------G--ENVTVTLDIK.......N.DS---R.KI.......
Q9TYQ0_CAEEL/174-315-----------------VDEIGVMP-----------------G--MTSKISLTVE.......N.KT---K.KRKKWMRKK
Q7PUR5_ANOGA/187-319-----------------TPRTGYAP-----------------G--EVIEVTVHVN.......N.QS---S.VD.......
Q7PYD9_ANOGA/175-306-----------------VPFTGYVP-----------------G--QAIPLTIDLH.......N.LS---S.RI.......
Q380N5_ANOGA/183-323-----------------TPKSGYAP-----------------G--ETIELEVFVQ.......N.SS---K.VT.......
CRED_ASPOR/181-332-----------------TPTKAVIF-----------------G--TSIRVDFKLI......PL.LK---G.LT.......
Q752Z4_ASHGO/228-382-----------------VPSRAIAV-----------------G--AQTALQLRLF......PF.QK---G.YR.......
ARRD5_HUMAN/184-321-----------------MERNTFTP-----------------G--EKVVFTTEIN.......N.QT---S.KC.......
ARRD4_HUMAN/191-318-----------------IERKGYCN-----------------G--EAIPIYAEIE.......N.CS---S.RL.......
Q294M9_DROPS/171-302-----------------LPQAGYVP-----------------G--QKIPVTVVVV.......N.NS---S.VA.......
Q6BI98_DEBHA/278-420-----------------LKRKGIAI-----------------G--STITVKLMVI......PI.AK---G.LK.......
Q294M7_DROPS/174-306-----------------LPQGGFVP-----------------G--QTIPIGVLVS.......N.DS---S.IQ.......
Q6BIN4_DEBHA/247-390-----------------VPSKAIAI-----------------G--SNIPISFMLV......PL.LK---G.LR.......
Q293Z7_DROPS/175-308-----------------LPEDFAVR-----------------G--EPLRICVTVM.......N.NS---T.TN.......
Q9I7K7_DROME/179-320-----------------IPRQGYSP-----------------G--AGISVHLKLH.......N.PE---K.LT.......
A5DM18_PICGU/246-387-----------------MPRRGLAV-----------------G--SSVPIRLVIL......PL.AK---G.LK.......
Q294M5_DROPS/171-304-----------------IPFGGYAP-----------------G--QKIHYTLEID.......N.KS---GAYD.......
Q16ZK0_AEDAE/170-299-----------------IPASGYVP-----------------G--QKIPITNTLN.......N.AS---S.VA.......
A0BIT0_PARTE/173-314-----------------LNKPYYTF-----------------G--ENIDIILQVD.......NSQS---S.SA.......
Q4V467_DROME/125-256-----------------LPQTGFVP-----------------G--QTVPANVLIG.......N.ES---K.IR.......
Q7SC90_NEUCR/193-351-----------------LPKWSYGP-----------------L--DPITVFIKLAPNPDMMNK.AK---K.VT.......
Q66L50_DANRE/187-314-----------------IERKGYTP-----------------G--ETIQIFAEIE.......N.CS---S.RV.......
Q95NF3_ANOGA/193-351-----------------LDKQLYLH-----------------G--ERIGVNICIR.......N.NS---N.KM.......
Q6C993_YARLI/185-326-----------------LPSKAVAV-----------------G--SSTPVHLSMT......PL.LK---G.LK.......
O44847_CAEEL/147-273-----------------MPKFTLYP-----------------G--ETTEFKLEVE.......N.HS---S.ST.......
A0CWE9_PARTE/173-316-----------------LNKAQYVF-----------------G--DSIQLNISVD.......NSQS---N.VA.......
Q23QU8_TETTS/188-318-----------------TNGRSFAP-----------------N--ENIQIKLDVD......FS.QY---G.KK.......
Q6ZM71_DANRE/162-286-----------------TDMRGYIA-----------------G--QIIKVSAGIE.......N.KS---D.KT.......
A8WP41_CAEBR/178-317-----------------LPKRGYVA-----------------G--EILPITINIE.......N.NS---K.SP.......
Q0E8K8_DROME/169-299-----------------LDRGGYVP-----------------G--ENILVTAFIS.......N.YS---N.VS.......
A0C0J3_PARTE/194-337-----------------FDKSAYQP-----------------G--EVAKLQVEID......NT.QS---K.VG.......
Q16ZJ7_AEDAE/171-300-----------------IPVSGYVP-----------------G--QKIPITVALN.......N.TS---S.TT.......
Q23YG0_TETTS/188-318-----------------TNSRSYSP-----------------N--EIISMKIDID......FN.QF---N.KN.......
Q9W7R1_ORYLA/193-351-----------------LDKELYYH-----------------G--EPIKVHVNVT.......N.NS---N.KN.......
ARRB_CAEEL/205-363-----------------LDKEMYYH-----------------G--ESISVNVHIQ.......N.NS---N.KT.......
Q7RZE0_NEUCR/198-350-----------------IPKKAVVF-----------------G--STIPLQTRFT......PL.LK---G.LE.......
ALY2_SCHPO/345-506-----------------VSGKSFRL-----------------G--EVVPITFRFL.......L.LD---K.VR.......
Q5AM66_CANAL/305-457-----------------CPTKAIAI-----------------G--SSTPITMTLV......PL.LK---G.LQ.......
ARRB2_MOUSE/195-350-----------------LDKELYYH-----------------G--EPLNVNVHVT.......N.NS---A.KT.......
A2BIP7_DANRE/186-313-----------------TEKMAYYL-----------------G--EGLKVLAEIH.......N.GS---S.RI.......
ARRD1_HUMAN/162-286-----------------TDLRGYVV-----------------G--QALQLHADVE.......N.QS---G.KD.......
A2QR01_ASPNC/439-613-----------------ISGKSFPL-----------------G--SQVPIAFKLT.......P.LA---K.VE.......
Q380P6_ANOGA/182-314-----------------IARCGYIP-----------------G--QTIVMKIDAV.......N.RS---R.TT.......
YC9F_SCHPO/183-325-----------------IPSKVYAI-----------------G--SEIPVNITLY......PL.LK---G.LD.......
Q16H74_AEDAE/171-301-----------------IPMTGYVP-----------------G--QLISVVVDVM.......N.KS---T.KD.......
Q6DH07_DANRE/192-355-----------------LEKEIYYH-----------------G--DPIPVNIKIK.......N.ET---N.KV.......
A8X4Z9_CAEBR/175-315-----------------IPKQAVAS-----------------G--EALPITIDID.......N.CS---K.RA.......
ART1_SCHPO/287-428-----------------IPKLCIGP-----------------S--DLVSVFVSIMP.....NN.GS---K.IR.......
ARRD2_HUMAN/180-307-----------------IDRKGYTP-----------------G--EVIPVFAEID.......N.GS---T.RP.......
Q294M6_DROPS/179-311-----------------LQQQGYVP-----------------G--QFMLIHAQVR.......N.DS---S.SD.......
ADCC_DICDI/344-478-----------------SVKNSFYP-----------------G--EEIELEVEVN.......N.SS---K.KK.......
Q6CS19_KLULA/219-373-----------------VPSKAIAI-----------------G--SSTPINIMVV......PL.LK---G.LK.......
Q2UDU8_ASPOR/60-215-----------------IPDVNIPF-----------------G--ATFPMKLRFA......PL.SK---G.IK.......
Q22NR4_TETTS/187-325-----------------IKRSEFNP-----------------G--ETIPIQLSFE.......N.KG---S.KP.......
ROD1_YEAST/232-395-----------------IPTKAIAI-----------------G--SSTMINILIV......PI.LK---G.LK.......
A0CL31_PARTE/172-315-----------------VEKNIYFP-----------------T--EFLNFSYDID......NS.NC---K.LD.......
APYA_EMENI/180-326-----------------IQNRTVAL-----------------G--TRIDVDYVFA......PL.LR---D.MK.......
Q296V0_DROPS/178-310-----------------VPQTGYVS-----------------G--QILPITCEVD.......N.TS---N.VN.......
Q6CW08_KLULA/282-443-----------------IPSKAIPI-----------------G--GATPLTVKLY......PF.QK---G.YK.......
A8WP33_CAEBR/159-305-----------------TPSQVFKA-----------------G--QTFDTEVTLN.......N.TS---G.NA.......
A0DYQ7_PARTE/173-314-----------------LNKPQYLF-----------------G--ENIDIVMQVD.......NSSS---N.YH.......
A0D2Y0_PARTE/206-342-----------------LNKSNFTP-----------------G--ELAIIQYHLD.......NTFS---S.KP.......
A7TQI8_VANPO/357-526-----------------IASKDIIL-----------------D--AFLPIAFRFS.......P.ID---K.VT.......
Q17EA7_AEDAE/182-314-----------------TPRSGYVP-----------------G--DVIELTMHVN.......N.QS---S.VD.......
Q9W2V2_DROME/420-633-----------------LDKGWYTH-----------------G--EDVQVTVNIR.......N.DS---R.KT.......
Q240M9_TETTS/188-318-----------------TSSRCFSP-----------------Q--ETINLNMDID......FS.QY---S.KQ.......
A5DUN4_LODEL/264-404-----------------CPTRALAI-----------------G--SGTPISIMLV......PL.LK---G.LT.......
A0NDX6_ANOGA/173-303-----------------LPMTGYVP-----------------G--QFILVTVDIS.......N.RS---N.KC.......
Q16ZJ5_AEDAE/174-305-----------------TPISGYVP-----------------G--QTIAVHIEVD.......N.QS---N.KN.......
Q7QCL7_ANOGA/170-301-----------------LDRGGYVP-----------------G--ESIMITATVT.......N.AS---S.VT.......
A2QTZ8_ASPNC/184-328-----------------LPSQAYTF-----------------G--SAIPIKFEFI......PL.CK---G.LE.......
O17983_CAEEL/173-318-----------------SPKCGYVA-----------------G--ENVIVSGQIE.......N.GT---S.KP.......
Q9V393_DROME/233-393-----------------LDKELYHH-----------------G--EKISVNVHVA.......N.NS---N.RT.......
A0BMC5_PARTE/210-346-----------------LNKNNFIP-----------------G--EQMQIEYTLD.......NTRS---Q.RS.......
A1C8U8_ASPCL/140-283-----------------MPSQAFPF-----------------G--SEVPLNFQFI......PL.RK---G.LE.......
A0D004_PARTE/178-324-----------------TDRNVYRI-----------------G--EAIRILIEVI......DE.ER---Y.QK.......
Q16ZK1_AEDAE/136-269-----------------VPATGFVA-----------------G--QRIPVVLEVS.......N.RS---G.CK.......
Q17EA8_AEDAE/183-323-----------------VPKSLYTP-----------------G--ESLEVLLEVH.......N.LS---K.ED.......
Q16ZJ8_AEDAE/186-315-----------------LPVSGYVS-----------------G--QKIPITVNLN.......N.AS---N.IP.......
PALF_ASHGO/233-368-----------------LPESGYVI-----------------G--DTIRIKVHIQ......HY.KE---Y.RN.......
ARRS_MOUSE/200-361-----------------LSKEIYFH-----------------G--EPIPVTVTVT.......N.NT---D.KV.......
A8WP37_CAEBR/170-319-----------------FQKRSFMP-----------------G--ESVEVIVTME.......N.NS---S.KP.......
Q9GYT5_CAEEL/181-328-----------------IPKTGFVP-----------------G--ETVPLNVHLI.......N.HS---S.TS.......
MU170_SCHPO/266-426-----------------TDRSLFFS-----------------G--QIIDFTICYT.......H.NH---H.RR.......
A5DW17_LODEL/261-403-----------------MPRKAIAI-----------------G--TTVPIHLTIV......PI.AK---G.LS.......
A0D012_PARTE/172-315-----------------VEKNLYFP-----------------G--EFVQITYDID......NS.DC---K.LN.......
ADCA_DICDI/313-441-----------------LNKNAYFP-----------------G--ETLVAKMKAN.......N.TS---I.KP.......
Q9I7L0_DROME/174-307-----------------VPQTGFVP-----------------G--QNVPLSVLVT.......N.DS---H.IP.......
A7SF55_NEMVE/129-256-----------------TDRSAYCP-----------------G--ERLTLTTEIR.......N.LP---L.RE.......
Q16ZK2_AEDAE/273-408-----------------IPTNGFVP-----------------G--QIIPALIQVS.......S.RR---H.VT.......
A8XYD8_CAEBR/172-316-----------------SPKLGYVS-----------------G--ETVIINGRIH.......N.KT---S.KP.......
A0E996_PARTE/174-317-----------------INKQGFAI-----------------G--DVIEANLEVD......NT.KT---D.LN.......
Q0U5A6_PHANO/182-337-----------------VPQKNYIV-----------------G--TQITADFVLI......PL.RK---G.VE.......
PALF_YEAST/259-394-----------------IPQAGFMI-----------------G--EIIPIDVKID......HY.KP---F.YA.......
Q23672_CAEEL/163-311-----------------VPTLVFRQ-----------------G--QTAEFHFEVK.......N.HS---S.ST.......
A7TPY5_VANPO/228-381-----------------APSKAVAI-----------------G--SSTPINMLLV......PL.LK---G.LK.......
Q759V0_ASHGO/221-368-----------------IPSRAVAI-----------------G--TNVPLDMILV......PY.VK---G.LK.......
Q9VGU7_DROME/180-316-----------------TSYSAYVP-----------------G--QKIHFHLVLD.......N.QS---D.VQ.......
Q6FM62_CANGA/224-379-----------------VPTKAVAI-----------------G--STTPVNILLV......PL.LK---G.LK.......
A7SKJ5_NEMVE/177-307-----------------TDRGGYCP-----------------G--ESISVSVYIN.......N.RT---S.TN.......
Q6CGL3_YARLI/174-329-----------------YPVSSFGP-----------------L--DPIQVYIKVAANPDIGS..KS---KRVK.......
ARRD5_MOUSE/170-307-----------------MSKNTYVP-----------------G--EKVTFTSEIR.......N.HT---G.KY.......
Q17624_CAEEL/176-340-----------------LSKTGYLP-----------------G--EAIYGNLKIG.......SKHP---K.DI.......
A0D9C9_PARTE/194-337-----------------FDKTAYQP-----------------G--EIAQLQVEID......NS.QS---K.VG.......
A0CE97_PARTE/209-345-----------------LKTNKFFP-----------------G--DKISVDYSVD.......NTRS---Q.RP.......
Q7PYE1_ANOGA/178-310-----------------VPVTGFVS-----------------G--QSVPVTIECD.......N.AS---N.VG.......
Q16ZJ6_AEDAE/174-302-----------------IPGTGYVS-----------------G--QSIPVAVRWK.......NNNG---A..........
A7SL06_NEMVE/167-299-----------------IDRAGFYI-----------------G--DEAQVTVFLD.......N.QS---T.RD.......
O45782_CAEEL/179-307-----------------ISKCGYTP-----------------G--EKIDVSFKVIN.....LS.SK---...........
Q17HB8_AEDAE/169-300-----------------LDKRAYIP-----------------G--ENILVTGEIY.......N.QS---N.VT.......
ADCB_DICDI/337-465-----------------APKNSYYP-----------------G--EDIELQVHVN.......N.SS---K.KK.......
Q23FQ6_TETTS/188-318-----------------LNSRCFIP-----------------N--EIINIKINAD......LG.QN---G.NK.......
Q294M3_DROPS/163-297-----------------LPASGFTP-----------------L--QEVPFRLEVD.......N.QS---PHYD.......
A8WP43_CAEBR/183-324-----------------LPKSGFIP-----------------G--EFIPIAISIH.......N.HT---K.KP.......
A3LXL3_PICST/266-408-----------------IAKKGLAI-----------------G--SSIPINIIIV......PI.AK---G.LS.......
O17981_CAEEL/182-333-----------------IPKTGFVP-----------------G--ETVPMNIHIL.......N.HS---S.VP.......
Q16ZK3_AEDAE/167-301-----------------LSTSGFVP-----------------G--QFIPVVIQVN.......N.KG---N.NK.......
A8X383_CAEBR/164-301-----------------LTRTAFQI-----------------G--ESIEAVVTIN.......N.RT---R.KG.......
Q20232_CAEEL/173-309-----------------LERTAYVC-----------------G--ENIRVRAQIE.......NRQS---T..........
A0BCE6_PARTE/199-335-----------------TAKNLYKP-----------------G--EVLELEYTLN.......TTRS---Q.RS.......
Q5AP77_CANAL/170-448-----------------FPRKYVTL-----------------G--CEHMINVKLS......PM.VK---D.VV.......
A0BDM3_PARTE/168-302-----------------YSGEEFSF-----------------G--DQINLEISID......LR.ES---K.QY.......
Q23674_CAEEL/182-339-----------------LPKQGFVC-----------------G--ENIPVTMIVD.......N.KT---S.KS.......
ARRD5_BOVIN/171-309-----------------MEKNTFTP-----------------G--ERDIFTTEIN.......N.QT---S.KC.......
YA4C_SCHPO/180-322-----------------VPTKAYAI-----------------G--SYIPIHFVLV......PL.LK---R.LT.......
Q294M1_DROPS/173-305-----------------TPYCGYAP-----------------G--QKIHFVLYIN.......N.ES---S.ID.......
A0A0D1DR37_USTMA/181-316-----------------RDRSCFGP-----------------G--DNITLRIILSS.....DR.IS---P.IK.......
A7TDW3_VANPO/229-389-----------------VPARAIAI-----------------G--STTKIHMHLI......PL.IK---G.LQ.......
Q6FY06_CANGA/237-406-----------------IPSKAVPI-----------------G--SSSPIDISIT......PL.MK---G.LK.......
A6R1F7_AJECN/559-759-----------------ISGKSFPL-----------------G--GQVPIAFKLT.......P.LA---K.VS.......
Q9XXC4_CAEEL/159-308-----------------FSKRAFLA-----------------G--ETIRALAIME.......N.HS---T.KP.......
A7TQH7_VANPO/294-447-----------------IPSRAIPV-----------------G--GITPISIKIF......PF.QK---H.YI.......
Q16ID9_AEDAE/216-390-----------------LDKELYHH-----------------G--ESLSVNVHIA.......N.NS---S.KT.......
PALF_KLULA/263-398-----------------IPCLGYTI-----------------G--EEIPVKVHVT......HY.KQ---Y.FH.......
Q6CG62_YARLI/321-486-----------------IGGKSIPI-----------------G--TKMQVAFKLT.......P.LA---K.VR.......
A0A0D1E8U6_USTMA/601-804-----------------FSGKSFPI-----------------G--QQIPLWLKFV.......P.LG---K.VK.......
Q9XTU0_CAEEL/176-327-----------------IPKKGYVP-----------------G--ETISIETNID.......N.MS---S.RP.......
YOA5_SCHPO/223-379-----------------LPRTDWLA-----------------G--ESVVSKIKIE.......N.HS---K.SS.......
Q0CQZ7_ASPTN/118-273-----------------IPETNIPF-----------------G--STFPVQFFLA......PL.SK---D.LR.......
E7LU16_YEASV/179-340-----------------VPNKAVAI-----------------G--SATPINISIV......PL.SK---G.LK.......
F1QAH2_DANRE/171-293-----------------LPKTGYQQ-----------------G--EGLIVNGEIV.......N.SS---T.RK.......
F6SKI7_XENTR/196-355-----------------LPKEVFYH-----------------G--EPISVSVSVT.......N.NS---D.KT.......
F6Y0E4_XENTR/163-285-----------------SDLRGYVV-----------------G--QAIQIHTELE.......N.KS---G.RD.......
G4VCF9_SCHMA/96-254-----------------LNKEKYYH-----------------G--ESIDINVLVD.......N.NS---N.KT.......
H2N0W5_ORYLA/194-351-----------------LPKETFYH-----------------G--EPLKANVEIT.......N.SS---S.RN.......
H3CCN8_TETNG/163-285-----------------SDLRGYIP-----------------G--QVIRLATEIH.......N.KS---G.KD.......
H3DDA7_TETNG/203-325-----------------TDRMGYMQ-----------------G--ETIQVTLEIT.......N.CS---C.RS.......
ART5_YEAST/332-474-----------------IPSRAVPI-----------------G--STTPVKIKIF......PF.EK---N.IR.......
Q08CX7_XENTR/182-306-----------------IDRKGYTP-----------------G--EVIPIFAEID.......N.CT---T.RA.......
TXNIP_MOUSE/176-299-----------------IDRKGFCE-----------------G--DDISIHADFE.......N.TC---S.RI.......
Q9VI00_DROME/172-303-----------------IPFGGYAP-----------------G--QKIRFTLEID.......NQSS---G.YD.......

PF07070

E3E849_PAEPS/4-211-----------------VDQTVYVP-----------------G--EELSGIIRIK-------GGKI---D-QE-------
Q9F2L5_STRCO/29-244-----------------LAPGAARP-----------------G--GTLSGRVRLV-------GGTV---G-HD-------
B7VMX8_VIBTL/6-222-----------------LQQEVLYP-----------------G--KKASIIVHVY-------GGAQ---P-QE-------
Q87KC8_VIBPA/6-222-----------------LNQDVLYP-----------------G--QSVDVSIHVY-------GGAT---E-QA-------
D2SH36_GEOOG/3-216-----------------LDRPETTP-----------------G--GSVTGTVHVT-------GGSV---P-QD-------
U5VQ01_9ACTN/3-218-----------------LTDPTTRP-----------------G--ASLAGQVNLV-------GGNH---D-VE-------
A9B5Z7_HERA2/2-209-----------------LHNNTTAP-----------------G--GTITGEVHIM-------GGDV---E-QD-------
Q8CK18_STRCO/3-217-----------------LSESNVVP-----------------G--GVVQGEVRIQ-------GGSV---D-QE-------
A1S9J4_SHEAM/2-218-----------------LHQSQLLP-----------------G--QTFSATIVVQ-------GGDV---A-QK-------
F8AWR6_FRADG/3-216-----------------LDRPEVLP-----------------G--GLVTGTVTIK-------GGKV---D-QE-------
D5XEE5_THEPJ/2-202-----------------IPNPQVEL-----------------G--GILEGVVKIK-------GGSV---E-QE-------
F6CIG7_DESK7/3-202-----------------VAGTAVPL-----------------G--GILNGTIRIQ-------GGNV---E-QQ-------
E8U7T1_DEIML/4-201-----------------LERDAVRL-----------------G--EDLRGVVLLS-------GGAV---E-QN-------
D9SYU9_MICAI/3-218-----------------LANPNCRP-----------------G--GELAGRIQVV-------GGDH---P-VD-------
SP0M_BACSU/4-212-----------------LEKDAYFP-----------------G--EEVQGTVHVK-------GGKI---A-QD-------
D6Y483_THEBD/3-219-----------------LANPRVQP-----------------G--GTLTGEVRLK-------GGDF---D-AE-------
D7B3X5_NOCDD/3-216-----------------LPHPHTRP-----------------G--DLLEGSVELT-------GGGS---R-TE-------
A6W415_KINRD/4-215-----------------LDRDVAQP-----------------G--GPVSGRVVVV-------GGSV---A-QD-------
A5D298_PELTS/2-203-----------------IPQPRVPI-----------------G--GTVSGTVKVR-------GGSV---D-QK-------
Q7MGK0_VIBVY/6-223-----------------LQQEVLYP-----------------G--QAANIKVHVY-------GGSS---E-QE-------
I0JR17_HALH3/2-206-----------------LEKAQFVP-----------------G--EDVHGKVVIK-------GGDV---E-QP-------
L0A4L1_DEIPD/4-200-----------------LAQVSVRL-----------------G--EQVEGKVVVR-------GDQA---P-QA-------
C1D0Z4_DEIDV/4-201-----------------LSSAEVRV-----------------G--EELRGTVHVQ-------GGQV---E-QQ-------
Q8YPP0_NOSS1/22-229-----------------LFNNSVIP-----------------G--GILEGEVYIR-------GGDV---A-QD-------
R4LYD7_9ACTN/3-214-----------------LATPDTCP-----------------G--NPLMGAVRVR-------GGDY---D-VA-------
C6WBH8_ACTMD/3-218-----------------LSNPNVRP-----------------G--DVLTGEVRIS-------GGDH---Q-AE-------
R4SZZ1_AMYOR/2-217-----------------LDSPHAVP-----------------G--EVITGQVRIQ-------GGSS---D-AQ-------
Q3IE37_PSEHT/2-218-----------------LETEHLQP-----------------G--QLFNAQIVIT-------AGDV---S-QE-------
E4N440_KITSK/3-218-----------------LSTPTVYP-----------------G--GTVHGQVNLV-------GGDR---D-AE-------
D3Q3X8_STANL/19-229-----------------LTDSHVTP-----------------G--GVLRGEVLFN-------GGER---D-CE-------
G2NX38_STRVO/3-217-----------------LDRRPVRP-----------------G--GVVRGHVRLR-------GGGR---A-CD-------
E2Q1G0_STRC2/1-209-----------------LDPGPAAP-----------------G--SSLTGQVHLK-------GGST---D-FT-------
U5W7Z2_9ACTN/3-218-----------------LANPNCRP-----------------G--GFLEGQVHVM-------GGDH---A-VD-------
D4GQ21_HALVD/1-207-----------------LPSDTVRP-----------------G--ETVDAEVRIE-------GGSA---E-QE-------
C4L3D6_EXISA/2-213-----------------LNESHCTP-----------------G--GELTGVVHIE-------GGSV---E-QS-------
L0JQI9_NATP1/1-204-----------------LP.PTLTA-----------------G--ESVDARVDVT-------GGND---S-QD-------
U5LEI3_9BACI/4-214-----------------LERDSFYP-----------------G--EVAKGVIEIR-------GGKT---E-QK-------
B7GKU0_ANOFW/25-235-----------------LHESHLLL-----------------G--ESVTGVVEVT-------GGNI---E-QQ-------
C5D3Y3_GEOSW/2-199-----------------LHHPHVRL-----------------G--EKLEGEFFIE-------GGTV---E-QR-------
H2K613_STRHJ/3-217-----------------LDGGAALP-----------------G--GTLAGRVLLR-------GGAT---A-VE-------
Q9KVV0_VIBCH/21-237-----------------LQQEVLYP-----------------G--QSVKVIIHVY-------GGAT---A-QV-------
Q2J8X7_FRASC/3-216-----------------LDRPETLP-----------------G--QVVTGLTTVT-------GGKV---E-QK-------
D9STE5_CLOC7/4-212-----------------LSQKSVRI-----------------G--EDLEGVVNIV-------GGNV---E-QT-------
Q81QV7_BACAN/2-213-----------------LEKDEYIV-----------------G--EEILGKVHIT-------GGSV---S-QQ-------
X5A5U4_9BACL/4-211-----------------LEEAQIVA-----------------G--GTLRGVVSVR-------GGQV---E-QQ-------
D2B8E4_STRRD/3-215-----------------LQNSNVRP-----------------G--EVLRGQVNFR-------GGGS---D-YK-------
F2EZY3_SOLSS/4-214-----------------LHKSTYTL-----------------N--ENISGVVEII-------GGST---E-QQ-------
Q5V309_HALMA/3-209-----------------LPTDSVRA-----------------G--ESVRAEVHVE-------GGST---D-QN-------
Q6LLI7_PHOPR/4-219-----------------LKHDVLIP-----------------G--ENLPVVIHVQ-------GGAT---E-QQ-------
E4NWJ2_HALBP/1-207-----------------LPSTTVSP-----------------G--ETVDAEVRVS-------GGDA---E-QS-------
E1SSB8_FERBD/2-218-----------------ILSETLVP-----------------G--ETMLIEIVIE-------GGDV---P-QT-------
D7AXU0_NOCDD/3-217-----------------LHSSVATP-----------------G--GTLRGTVVIE-------GGNV---E-QQ-------
F4FG08_VERMA/3-218-----------------LANPHTRP-----------------G--QTLDGQVNLI-------GGDA---P-AN-------
D3EJD4_GEOS4/4-211-----------------LEKSSYYP-----------------G--EEVRGIIHIK-------GGNV---E-QT-------
I0H7C6_ACTM4/3-218-----------------LSNPSTYP-----------------G--APLTGQVNVV-------GGTQ---D-AD-------
B1VNV5_STRGG/3-217-----------------LEPGPALP-----------------G--AVLTGEVRLR-------GGGS---D-VT-------
H8MVT2_CORCM/3-210-----------------LEHDTVRA-----------------G--GDLRGLVHVQ-------GGHT---P-QR-------
H8GZW1_DEIGI/5-201-----------------LSRPEARV-----------------G--ERLSGVVAVQ-------GGRV---E-QR-------
Q5L337_GEOKA/2-211-----------------LAKAQYVQ-----------------G--ETVEGIVDIR-------GGSI---E-QH-------
C0ZHJ0_BREBN/2-209-----------------LEQDSLIP-----------------G--DMVRGEVHIK-------GGDV---A-QE-------
H2JK05_STRHJ/3-217-----------------LDPGAALP-----------------G--GALSGQVHLK-------GGNA---D-FD-------
Q8EMA6_OCEIH/2-211-----------------LDKEIYMA-----------------G--ETVTGKILVT-------GGKV---E-QE-------
F0LQ35_VIBFN/4-220-----------------LQQEALIP-----------------G--QTVKVTIHVY-------GGAT---A-QA-------
Q5L3I0_GEOKA/3-199-----------------LHRPHVRL-----------------G--ETLEGEFLLE-------GGSV---A-QH-------
E1V3I8_HALED/2-214-----------------LDSDTAEA-----------------G--GVLKGEIHIH-------GGEV---S-QD-------
R4SRA3_AMYOR/2-218-----------------LLDRTVSP-----------------G--RPLRGEVLLL-------GGEV---D-QE-------
G2NQ97_STREK/3-217-----------------LAGGAAVP-----------------G--GSLSGQVRLR-------GGSA---D-FT-------
C7MVV3_SACVD/2-217-----------------LDNPHVLP-----------------G--QVITGQVRIQ-------GGSY---D-AE-------
Q47QI1_THEFY/3-218-----------------LRSPHTRP-----------------G--EFLEGTVELV-------GGES---E-VL-------
B1YLT3_EXIS2/2-212-----------------LEQEHCEP-----------------G--GTIQGVVHIK-------GGNV---D-QE-------
D2RPW6_HALTV/1-204-----------------LP.TTLTA-----------------G--ETVDARVDVT-------GGND---A-QE-------
D1A596_THECD/3-218-----------------LASTHCRP-----------------G--EYLSGEVRIK-------AADY---D-VE-------
D2ASM7_STRRD/3-218-----------------LAVSRVSP-----------------G--GSLTGEVRIK-------GGDF---E-AE-------
N0B2E1_9BACI/13-223-----------------LESDKLVP-----------------G--QEVKGIVEIK-------GGSI---D-QK-------
H6NE63_9BACL/4-211-----------------LHNAQVTV-----------------G--GELSGVVVIQ-------GGQT---E-QQ-------
K0K0P9_SACES/2-217-----------------LDSPHATP-----------------G--QVITGQVRIQ-------GGSG---D-AN-------
Q5E1Q2_VIBF1/4-219-----------------IHHEVLIP-----------------G--QKAQVTIEVT-------GGAT---A-QD-------
I7BQH2_NATSJ/1-201-----------------LP.TTLTA-----------------G--ESVDARVDIT-------GGND---T-QE-------
K0JWS7_SACES/3-218-----------------LTNPNVRP-----------------G--ELLTGEVRIA-------GGDH---P-AD-------
V6K362_STRNV/3-217-----------------LEGGAVLP-----------------G--GTLRGEVRLA-------GGSS---A-YD-------
A4FGU2_SACEN/3-218-----------------LHHPGTRP-----------------G--EVLTGEVRIT-------GGSQ---A-VT-------
Q5YZ34_NOCFA/2-216-----------------LFTPGVQP-----------------G--GVVDGVIRLR-------GGQV---A-QD-------
D9T8R1_MICAI/3-218-----------------LSNPSTRP-----------------G--LMLGGQVNLT-------GGSH---D-VE-------
C6CSI9_PAESJ/5-212-----------------LEKSQYVP-----------------G--EEVRGVVNIR-------GGNA---P-QN-------
D1A1F2_THECD/3-218-----------------LHNPNTTP-----------------G--GTISGDVHLM-------GGEH---D-SD-------
G0G8W7_AMYMS/2-215-----------------LLDSTAAP-----------------G--RPLRGEVLLL-------GGEV---D-QE-------
U5W8Q8_9ACTN/3-214-----------------LPNPATHP-----------------G--GTLTGEVRIA-------GGEY---D-VV-------

PF04425

A3GGA7_PICST/92-585-----------------VTKSVPQP.HH.KNELETRLKEYTSG--DMVNGYIIIT-------NNSN---KPVD-------
A5DRA9_PICGU/36-464-----------------FTKEVGKL.GKKPTYIDPSVYEYKQG--DTVNGHILIE-------NTSD---EKIR-------
Q6BJG5_DEBHA/93-577-----------------VTKRVPQP.NL.PNDLETRLKMYSSG--DLVNGYIIIT-------NTSD---EPVD-------
A5DPQ0_PICGU/115-602-----------------VTKKVPSP.NQ.KNELETRLKEYSSG--DVVNGYIIIT-------NTSD---SVVN-------
Q6BSG0_DEBHA/5-422-----------------VTEKVCQK.GVKPTIIDPSEYEFKQG--DYIHGYVTMK-------NKSP---VPIS-------
Q6BVD1_DEBHA/28-455-----------------FTKEVGEL.GKEPILIDSRLHEYKQG--DLINGFVLIT-------NESN---EPIP-------
Q5ABB5_CANAL/19-455-----------------LTEHIGKV.GEPYTLVDPLTLELKQG--DYIYGFVLIT-------NKTS---NVIP-------
Q75E04_ASHGO/51-474-----------------ITKHPVKP.HK.KPEEESILREYTSG--DIINGYVVIK-------NRSA---QPLK-------
BUL1_YEAST/108-543-----------------TTKHAPIP.HV.KPEEESILKEYTSG--DLIHGFITIE-------NKSQ---ANLK-------
A5E3Q9_LODEL/66-535-----------------VTKDVPRP.NQ.ENELETKLKEYTNG--DHVNGYVIVT-------NTSS---KPVK-------
A3LX53_PICST/9-457-----------------MTETVGKV.GVKPKIIDPLSIEIKQG--DYLYGFVLVT-------NKTK---YDVP-------
Q6FUH4_CANGA/102-545-----------------ITKHAPSP.NQ.KPEEESILKEYTSG--DLVHGYCTIE-------NKSS---QPLQ-------
Q6CSE2_KLULA/69-505-----------------ILKKATKPCEE.KPEEESILKEYTSG--DIINGFVVIE-------NRSQ---HPLR-------
Q6FP46_CANGA/103-568-----------------ITKHVPKP.HE.KPEEESVLKEFTSG--DIIHGYCVIE-------NRST---QPLK-------
Q5AN22_CANAL/97-598-----------------VTKQIPQP.NV.NNDLETRLKEYTSG--DFVNGYITVI-------NNSH---EPIE-------
A7TIV7_VANPO/87-537-----------------ITKHAPQP.HE.KPEEESILKEYTSG--DVIHGYCIIE-------NRSS---QPLK-------
E7KSA7_YEASL/88-524-----------------ITKTASIP.HE.RPEEQSILKEYTSG--DIIHGYCLIE-------NRSS---QPLK-------
G0VB73_NAUCC/105-559-----------------VTKDVSKP.HA.KNEEESILKEYTSG--DIIHGYCTIE-------NRSS---KRLK-------
G0VC27_NAUCC/80-515-----------------LTKQPCVP.HV.KPEEESILKEFTSG--EIIYGYFLVT-------NKSL---EPLP-------
G0VC28_NAUCC/152-590-----------------ITKHAGSP.HT.KPEEESILKEYTSG--DIIHGYCIIE-------NKSS---KALP-------

PF03643

VPS26_DICDI/8-284--HTGIRVEF............VGQIELF---YDRG----------------------------................
VP26A_HUMAN/8-283--HQGIRIEF............VGQIELF---NDKS----------------------------................
PEP8_YEAST/5-364--HLGIKVSV............IGSIDML---KSHG----------------------------SGNSSSKKVTSSTSSS
VP26A_ARATH/8-283--HNGVKVEL............LGQIEMY---FDRG----------------------------................
VPS26_SCHPO/5-279--HDGVKIEF............IGQIENT---YDKG----------------------------................
VPS26_DROME/6-280--HQGIKIEF............IGQIELY---YDRG----------------------------................
VPS26_CAEEL/7-282--HQGIRIEF............IGQIEVY---YDRG----------------------------................
DSCR3_MOUSE/1-283--HQGVSLTMEGTVNLQLSAKSVGVFEAF---YNSV----------------------------................

PF00339

B4LEM0_DROVI/17-172--.RKVFGQL------------ATIYRYG---REED--------------------------------------------
ARRS_BOVIN/22-180--.KRVYVSL------------TCAFRYG---QEDI--------------------------------------------
O76685_CAEEL/6-159--ARAVNIKI------------LGLAHTS---WTDT--------------------------------------------
Q9I7L0_DROME/5-150--VKAITLNI------------TGYAETR---WIER--------------------------------------------
H2N0W5_ORYLA/17-173--.RKVYVML------------SCTFRYG---RQDM--------------------------------------------
Q23674_CAEEL/4-159--ARKVRMEM------------IGKAYTY---WEGN--------------------------------------------
O45782_CAEEL/7-155--VNEILLEL------------KGRARTY---WTKH--------------------------------------------
H2RRP6_TAKRU/18-174--.RKVFVTL------------TCAFRYG---REDL--------------------------------------------
Q9VGU7_DROME/5-155--IRSIFITI------------NGYGETR---WQES--------------------------------------------
Q20577_CAEEL/7-158--ARFLKICI------------HGAAHTK---WSEG--------------------------------------------
P91469_CAEEL/7-159--ARAVNIKI------------VGLAHTS---WKNY--------------------------------------------
Q9VI00_DROME/5-148--VNEVYILF------------EGEAKVR---WDER--------------------------------------------
Q20232_CAEEL/7-150--IRGIRVLL------------RGKVHAT---LK..--------------------------------------------
ARRD4_MOUSE/18-166--LRGLRLEA------------QGRATSA---WGPS--------------------------------------------
O17983_CAEEL/6-146--ATSVEITF------------SGKTITA---HN..--------------------------------------------
PALF_YEAST/39-201--NVAIKLSL------------VCEVRVK---TGNS--------------------------------------------
ARRB1_BOVIN/18-174--.RRVYVTL------------TCAFRYG---REDL--------------------------------------------
Q8SYU5_DROME/5-157--LRGIKLQI------------SGYAQAQ---WRIR--------------------------------------------
O17981_CAEEL/6-159--ARAVNIKI------------LGLAHTS---WTDY--------------------------------------------
Q9XXI4_CAEEL/4-156--ARFLKICI------------HGGAHTH---WSES--------------------------------------------
O17984_CAEEL/4-157--PRWIDVQL------------HGRSHTF---FTRQ--------------------------------------------
F6SKI7_XENTR/21-176--.KKVYVTL------------TCAFRYG---QEDI--------------------------------------------
Q9VI53_DROME/6-155--VRGIIIRF------------LGEANTE---WSEE--------------------------------------------
H2L9D1_ORYLA/14-171--.RKAFVQM------------ACAFRYG---SDDL--------------------------------------------
ARRB_CAEEL/22-186--NRKVTAHL------------LAAFRYG---REDL--------------------------------------------
Q9XXI0_CAEEL/6-159--ALALKICI------------HGDIETL---WRKF--------------------------------------------
Q23672_CAEEL/8-142--ARCVTIKC------------RGKSETY---LINW--------------------------------------------
ARRD2_MOUSE/9-158--VGALRLRA------------RGRARAH---WTES--------------------------------------------

PF13002

A7TSP7_VANPO/130-321--TVEMS---------------VGSYVFP---FSCL--------------------------------------------
C5GL98_AJEDR/142-318--PAHLK---------------SGIHDYP---FSYL--------------------------------------------
YNSK_SCHPO/63-242--TT.YR---------------PGTQHWP---FSWL--------------------------------------------
C5DVA9_ZYGRC/141-332--AKDLP---------------VGNYSFP---FSCL--------------------------------------------
E7KUR3_YEASL/144-346--TQDLS---------------VGSHSYP---FSYL--------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407..VRKIRLVA------------VQHVDVC---MF..............................................
Q9TYQ0_CAEEL/174-315DNHECVLLSL------------CQQLDFV---AVNR.NDPM.......................................
Q7PUR5_ANOGA/187-319..VRSITVKF------------QRVDTFL---SQVP.VV.........................................
Q7PYD9_ANOGA/175-306..IEGVNMKL------------LQEITYH---AEYP.AS.........................................
Q380N5_ANOGA/183-323..VSVIEIRW------------QKILKFT---SQTR.VIGQTQ.....................................
CRED_ASPOR/181-332..IGQIVSQL------------IESHDLT---LNPEDPD.........................................
Q752Z4_ASHGO/228-382..LASFSASL------------VQYYAFT---DDAG............................................
ARRD5_HUMAN/184-321..IKTVVFAL------------YAHIQYE---GFTP.SAE........................................
ARRD4_HUMAN/191-318..IVP.KAAI------------FQTQTYL---ASG.............................................
Q294M9_DROPS/171-302..VSELRLSL------------VMLVRYF---SLSP............................................
Q6BI98_DEBHA/278-420..LKGMSGVI------------VQRSHTA---HSHG............................................
Q294M7_DROPS/174-306..VEEITARL------------TMVVIYY---SRPP.CP.........................................
Q6BIN4_DEBHA/247-390..LGDIKIQL------------VEYSSCV---GYLP............................................
Q293Z7_DROPS/175-308..VEKLRFSV------------LQYVTYY---SHVP.LR.........................................
Q9I7K7_DROME/179-320..LREAVYSL------------VQISTYV---AHLK.NKPK.......................................
A5DM18_PICGU/246-387..LKSLNGCI------------VQHSHVE---HSWG............................................
Q294M5_DROPS/171-304..LDGIELQL------------KQVCLLK---AETP.HH.........................................
Q16ZK0_AEDAE/170-299..MHGVQSSL------------DRTECYR---SETP.CE.........................................
A0BIT0_PARTE/173-314..IQNFKFQI------------TSQLVIL---YKQQ.KR.........................................
Q4V467_DROME/125-256..VHEVKVGL------------SMMITYY---SDLS..S.........................................
Q7SC90_NEUCR/193-351..INKITLAI------------EEEITFN---PEGD............................................
Q66L50_DANRE/187-314..VVP.KAAL------------YQTQTFF---AKG.............................................
Q95NF3_ANOGA/193-351..VKKIKAMV------------QQGVDVV---LF..............................................
Q6C993_YARLI/185-326..LGSIKMTL------------VEISVLT---TPFG............................................
O44847_CAEEL/147-273..VKKIYAEL------------EAEPFPL---YH..............................................
A0CWE9_PARTE/173-316..VQKFELKI------------SSQLVVL---YRQQ.KR.........................................
Q23QU8_TETTS/188-318..VNNLNVKL------------LGQLIMK---AS..............................................
Q6ZM71_DANRE/162-286..TGHVVASL------------MQKVTYN---TKKP.T..........................................
A8WP41_CAEBR/178-317..VVAVRSKM------------TQLSHFH---ASHG.SAMNV......................................
Q0E8K8_DROME/169-299..IKRTKASL------------TETIEYL---ARGK............................................
A0C0J3_PARTE/194-337..IPIIKGSV------------TSKLRVI---SKQG............................................
Q16ZJ7_AEDAE/171-300..IVGIKSSL------------ERKVTYI---SQYP.RE.........................................
Q23YG0_TETTS/188-318..IKCLNIKL------------IGLLSMK---AS..............................................
Q9W7R1_ORYLA/193-351..IKNIIVSV------------DQVATVV---LF..............................................
ARRB_CAEEL/205-363..VKKLKIYI------------IQVADIC---LF..............................................
Q7RZE0_NEUCR/198-350..LGEITIRL------------LEVHEFI---LQSHSGYG........................................
ALY2_SCHPO/345-506..LYKLSISV------------VESSEYW---CRSR.KFHRVDP....................................
Q5AM66_CANAL/305-457..LGDIKIEL------------IEMYSFV---GSYP............................................
ARRB2_MOUSE/195-350..VKKIRVSV------------RQYADIC---LF..............................................
A2BIP7_DANRE/186-313..IKP.KYCL------------YEKYSFF---AKGR............................................
ARRD1_HUMAN/162-286..TSPVVASL------------LQKVSYK---AKRW.I..........................................
A2QR01_ASPNC/439-613..CHRIKVYV------------TENIQHW---TADK.SVHRFQP....................................
Q380P6_ANOGA/182-314..VTEFRVKL------------VQKLCYS---SQQP.AV.........................................
YC9F_SCHPO/183-325..VGKVTLVL------------KEYCTLF---ITSK.AYS........................................
Q16H74_AEDAE/171-301..ISELKIKL------------RRQVKYF---SHST.SG.........................................
Q6DH07_DANRE/192-355..VKRIRVTV------------DQTTDVV---LY..............................................
A8X4Z9_CAEBR/175-315..AYCVRAEL------------KQNSHYN---ASRN.SLFSHS.....................................
ART1_SCHPO/287-428..VQQLSLSL------------VEYITFI---HPSS............................................
ARRD2_HUMAN/180-307..VLP.RAAV------------VQTQTFM---ARG.............................................
Q294M6_DROPS/179-311..CKKLLIMI------------HLRSTYT---ADQP.SL.........................................
ADCC_DICDI/344-478..IKNVDIQL------------.NKVEYD---GTDV.T..........................................
Q6CS19_KLULA/219-373..LGPIKISL------------VEYSSYS---APYS............................................
Q2UDU8_ASPOR/60-215..LHALTIDV------------IEQHEVK---ISAP.AAYSAQF....................................
Q22NR4_TETTS/187-325..LKSVNVKL------------IREQNFI---KPESGGR.........................................
ROD1_YEAST/232-395..LGPVRISL------------VENSQYC---GSYG............................................
A0CL31_PARTE/172-315..VDKVDSVL------------VNRLRLR---SNSD.SEHI.......................................
APYA_EMENI/180-326..IAFIESQL------------LEVRDLS---VEPN.DGG........................................
Q296V0_DROPS/178-310..LSAVKFEL------------RKLVTFH---TSQP.RS.........................................
Q6CW08_KLULA/282-443..LKKIVVSL------------LQYYAFK---DSAG............................................
A8WP33_CAEBR/159-305..IKSVQYTL------------FRHTHFH---KKWQ.PTPCSNS....................................
A0DYQ7_PARTE/173-314..IQKFKFSI------------SAQLVVL---YKQQ.KR.........................................
A0D2Y0_PARTE/206-342..VTRVEIRL------------INKLIFI---DDDQ............................................
A7TQI8_VANPO/357-526..LHRIRIYL------------TETIDYY---CKGK.KVHRVEPTKKF................................
Q17EA7_AEDAE/182-314..VKCITVKL------------QRVDTFI---SQLP.RV.........................................
Q9W2V2_DROME/420-633..VRKVRVCA------------IQHVDVC---MF..............................................
Q240M9_TETTS/188-318..VNKLTVKL------------LGQLTMK---AN..............................................
A5DUN4_LODEL/264-404..LGDIKIQL------------IEFYSYM---GNVP............................................
A0NDX6_ANOGA/173-303..IAEVKLKL------------RRQVRYS---SQTP.YK.........................................
Q16ZJ5_AEDAE/174-305..LDEISTKL------------MRVVSFV---SQTP.YT.........................................
Q7QCL7_ANOGA/170-301..IKSTKAAL------------TETIQYF---ARDK............................................
A2QTZ8_ASPNC/184-328..IATIHTEV------------KETHKVL---QF..............................................
O17983_CAEEL/173-318..MKIITAKL------------TRRITYR---EELK.AKANAKKK...................................
Q9V393_DROME/233-393..VKKIKVCV------------RQFADIC---LF..............................................
A0BMC5_PARTE/210-346..ISRVEARL------------INKLTFI---DDDE............................................
A1C8U8_ASPCL/140-283..LESINCQL------------VEIEERK---CPL.............................................
A0D004_PARTE/178-324..PEKIIIQL------------ENITQYK---YKNN.IET........................................
Q16ZK1_AEDAE/136-269..IHLIQLKL------------VMVVAYT---SDTP.RV.........................................
Q17EA8_AEDAE/183-323..VSEIIVKF------------QKVVKFL---SQVQ.VIDST......................................
Q16ZJ8_AEDAE/186-315..IHAIRSKL------------VRKVCFI---SQTP.TR.........................................
PALF_ASHGO/233-368..SAGLIATL------------VRICRVH---ST..............................................
ARRS_MOUSE/200-361..VKKIKVSV------------EQIANVV---LY..............................................
A8WP37_CAEBR/170-319..IKSMQFEL------------IRQSHFH---SQHQ.KDFCSLNNCL.................................
Q9GYT5_CAEEL/181-328..VNNIKAQM------------LQQCKFT---GYKSGATYNYGGDFER................................
MU170_SCHPO/266-426..IHNIKARL------------LETHIFH---PNTQ.NHYGGYCMNQAEETFA...........................
A5DW17_LODEL/261-403..LKAMNACI------------VEHYHIE---VDNI............................................
A0D012_PARTE/172-315..IENVDVII------------VNRLNIK---SNSG.SQCH.......................................
ADCA_DICDI/313-441..TRKISLVV------------HHTMQLK---TRL.............................................
Q9I7L0_DROME/174-307..VEQLLISF------------VMLVTYH---SKPPSMP.........................................
A7SF55_NEMVE/129-256..PYETCVYL------------VQSITYK---SSCG.RTR........................................
Q16ZK2_AEDAE/273-408..IRKVTTVL------------IQQTTFS---ARWP.KA.........................................
A8XYD8_CAEBR/172-316..IRIIQAKL------------NRLVTYR---EELQ.GKNKKRNP...................................
A0E996_PARTE/174-317..LLNLTFSV------------QSQLIIL---YPVL.KL.........................................
Q0U5A6_PHANO/182-337..IATIKMEL------------IESRQLF---ADYA.GRR........................................
PALF_YEAST/259-394..PAGLTTTL------------VRICRVG---GA..............................................
Q23672_CAEEL/163-311..INEIFIKF------------GKQVHYH---SRNQ.LTPCRKFDS..................................
A7TPY5_VANPO/228-381..LGPIKIAL------------VESSQFC---GNFG............................................
Q759V0_ASHGO/221-368..LGTVKASI------------VENLTFA---TPYG............................................
Q9VGU7_DROME/180-316..CMDVKVRL------------IKNVSYR---ANSS.GAK........................................
Q6FM62_CANGA/224-379..LGSIRMTL------------IEKYSYG---SKSD............................................
A7SKJ5_NEMVE/177-307..LPGIDLVL------------RQITVYI---ASCG............................................
Q6CGL3_YARLI/174-329..LVKVSIQV------------VEVITYN---PEGD............................................
ARRD5_MOUSE/170-307..IKTVVFAL------------YAHVQYE---GFTP.SAE........................................
Q17624_CAEEL/176-340..LNHMEARL------------VDRVRRV---GAPEISA.........................................
A0D9C9_PARTE/194-337..IPTITGRL------------TNTLRIV---SKQG............................................
A0CE97_PARTE/209-345..VNRIEVRV------------IHKLIFI---DNDE............................................
Q7PYE1_ANOGA/178-310..VEKITINL------------RKLLAFH---VHTP.RR.........................................
Q16ZJ6_AEDAE/174-302..IRGIRIKL------------FKHETYS---ATEP.YE.........................................
A7SL06_NEMVE/167-299..VTDVEICL------------FQFTTYI---YGTD.EN.........................................
O45782_CAEEL/179-307..TRTTALRF------------VQQTTYK---AKTF.AGH........................................
Q17HB8_AEDAE/169-300..IKAVKYAL------------METIQYY---AHGK............................................
ADCB_DICDI/337-465..VKKIELEL------------QRTISIQ---HEK.............................................
Q23FQ6_TETTS/188-318..VKNFSIKI------------IGLLEMK---AC..............................................
Q294M3_DROPS/163-297..IIGVEVSI------------RQHFVFL---SRKP............................................
A8WP43_CAEBR/183-324..LYYLKAQL------------IQHVHYQ---AQQE.NSHFNSDE...................................
A3LXL3_PICST/266-408..IRKIHGCI------------VQHYHVM---YEEG............................................
O17981_CAEEL/182-333..VTEVKAKI------------IQQCKFI---AYRNGTIFRFDGGSD.................................
Q16ZK3_AEDAE/167-301..MTRIVTML------------VQKAIYS---AKRP.FV.........................................
A8X383_CAEBR/164-301..LKEVALQL------------IMKTQFE---ARSR.YEH........................................
Q20232_CAEEL/173-309..AQSLVIRL------------VQHVEVF---VEKGLLG.........................................
A0BCE6_PARTE/199-335..ITKVEVKL------------NHFLSFT---DDDE............................................
Q5AP77_CANAL/170-448..IKRIKFNV------------LERITYV---SKNL.SREYDYDSEDPYCIHPVSKENKVRERVVSLYELKTKAKQSSGG
A0BDM3_PARTE/168-302..IQEIVMSL------------NKRTTIM---AK..............................................
Q23674_CAEEL/182-339..FKKISLRL------------VQRVTYT---GFRDGFVNSHSQPCIGNE..............................
ARRD5_BOVIN/171-309..IKTVIFAL------------YAHVHYE---GFTP.NAE........................................
YA4C_SCHPO/180-322..IGKISITL------------KEYITLH---VAHG.YNG........................................
Q294M1_DROPS/173-305..ITECEVKL------------KQEVSYE---SHDP.HH.........................................
A0A0D1DR37_USTMA/181-316..VKSISFSI------------RETITFK---GSAK.KTFGSN.....................................
A7TDW3_VANPO/229-389..LGPIKINL------------IENSQYC---GSYS............................................
Q6FY06_CANGA/237-406..LGPVKVQL------------VEVGQLC---SATG............................................
A6R1F7_AJECN/559-759..LHRIKVIV------------SENTQVV---ANNR.TYHRVDG....................................
Q9XXC4_CAEEL/159-308..IINLRFEL------------IQQSHYH---SRPQ.KSLCSLNDCH.................................
A7TQH7_VANPO/294-447..LEKIGVTL------------IQFYSMK---DSSG............................................
Q16ID9_AEDAE/216-390..VKKIKVSV------------RQFADIC---LF..............................................
PALF_KLULA/263-398..PAGLIATL------------VRISRVS---NP..............................................
Q6CG62_YARLI/321-486..CHRIRIYI------------SENIDYY---CRKM.KIHRVEP....................................
A0A0D1E8U6_USTMA/601-804..IYRILATL------------EERTDYF---AKGR.RVARHEVPR..................................
Q9XTU0_CAEEL/176-327..ILKTECYL------------IQQCRFL---AYRYGISGPTDGRRAS................................
YOA5_SCHPO/223-379..IKTLKLCL------------YRRIIGF---DPPS.WKTQQMM....................................
Q0CQZ7_ASPTN/118-273..LGAVTIQV------------VEKHELK---IRAS.AAYSVQY....................................
E7LU16_YEASV/179-340..LGSIKVVL------------FENYQYC---DPFP............................................
F1QAH2_DANRE/171-293..IVP.KYII------------YQKQSFF---AGGQ............................................
F6SKI7_XENTR/196-355..VKKISASV------------EQVSNVV---LY..............................................
F6Y0E4_XENTR/163-285..TGSIVAAL------------VQKIAYK---SK..............................................
G4VCF9_SCHMA/96-254..VKKIKLSV------------RQYTQLC---LH..............................................
H2N0W5_ORYLA/194-351..IKDISLSV------------EQVTNVV---LY..............................................
H3CCN8_TETNG/163-285..TGCVLASL------------IQKVSYK---TR..............................................
H3DDA7_TETNG/203-325..VKP.TFAL------------YERQSFF---AQG.............................................
ART5_YEAST/332-474..LDRIEMAL------------IQYYAMK---DSSA............................................
Q08CX7_XENTR/182-306..VIP.KAAI------------IQSQAFV---ARG.............................................
TXNIP_MOUSE/176-299..VVP.KAAI------------VARHTYL---ANG.............................................
Q9VI00_DROME/172-303..LNGIELKL------------KQIYKFQ---AQTP.HH.........................................

PF07070

E3E849_PAEPS/4-211--IGKIDIEL------------KTEYIVE...HDDK--------------------------------------------
Q9F2L5_STRCO/29-244--VEHVALEL------------VARVETG..DGEHG--------------------------------------------
B7VMX8_VIBTL/6-222--IDNIDLNL------------CCRYVKE...VTAN--------------------------------------------
Q87KC8_VIBPA/6-222--IDNIDMKL------------CCRYIAE...APDD--------------------------------------------
D2SH36_GEOOG/3-216--VTAVRVAL------------QATVEVE...SGDS--------------------------------------------
U5VQ01_9ACTN/3-218--IEHITLGL------------VTRVEVE...GGQG--------------------------------------------
A9B5Z7_HERA2/2-209--IEALYLFL------------VARYTRE...YDDS--------------------------------------------
Q8CK18_STRCO/3-217--IEGLSVGL------------QAKVEVE...SGDQ--------------------------------------------
A1S9J4_SHEAM/2-218--IDGIDLAL------------MTRAKVS...TDNG--------------------------------------------
F8AWR6_FRADG/3-216--VNEIRVAL------------EATVEVE...TDDS--------------------------------------------
D5XEE5_THEPJ/2-202--IEKIYINL------------VLNSKYG...SGDE--------------------------------------------
F6CIG7_DESK7/3-202--VDKIYINL------------ILSSAYK...AGDQ--------------------------------------------
E8U7T1_DEIML/4-201--IERLNFSL------------MTLARHD...DT..--------------------------------------------
D9SYU9_MICAI/3-218--VSYIALGL------------VTRVEVE...SSDS--------------------------------------------
SP0M_BACSU/4-212--IRYIDLQL------------STRYVIV...KDDE--------------------------------------------
D6Y483_THEBD/3-219--IEHITLSL------------VAQVEIE...HGDR--------------------------------------------
D7B3X5_NOCDD/3-216--IAEIVLVL------------VARTEDE...EGEA--------------------------------------------
A6W415_KINRD/4-215--VEEVVVAL------------QARVEVE...SGDS--------------------------------------------
A5D298_PELTS/2-203--IEQIYITL------------VLDSSYK...HDDE--------------------------------------------
Q7MGK0_VIBVY/6-223--IDNIHLKL------------CCRYIAE...VKED--------------------------------------------
I0JR17_HALH3/2-206--IDSIHIFL------------MTEALRE...SGDK--------------------------------------------
L0A4L1_DEIPD/4-200--IEHIELFV------------LAGNSDQ.......--------------------------------------------
C1D0Z4_DEIDV/4-201--VERINVGL------------ATRYKHD...DS..--------------------------------------------
Q8YPP0_NOSS1/22-229--IQDIYLKL------------ATEYQRE...VDDS--------------------------------------------
R4LYD7_9ACTN/3-214--VETIAVGL------------VTRAEAE...DGD.--------------------------------------------
C6WBH8_ACTMD/3-218--IDRVKLTL------------VTRVEVE...RGDE--------------------------------------------
R4SZZ1_AMYOR/2-217--IEEILLSL------------VTRVEVE...HGDH--------------------------------------------
Q3IE37_PSEHT/2-218--IAGLDLLL------------MTRVKAS...NEDG--------------------------------------------
E4N440_KITSK/3-218--INGITLCL------------VARVEVE...YEDG--------------------------------------------
D3Q3X8_STANL/19-229--VEGIALDF------------TAVVEAE...DEGD--------------------------------------------
G2NX38_STRVO/3-217--IEHLALEL------------VARVEAG...DGGE--------------------------------------------
E2Q1G0_STRC2/1-209--VEHITLEL------------VARVETESFDHGEG--------------------------------------------
U5W7Z2_9ACTN/3-218--IEYVAVGL------------MTRVEVE...SGDS--------------------------------------------
D4GQ21_HALVD/1-207--IGKVRFEL------------ETRYRTD...DG..--------------------------------------------
C4L3D6_EXISA/2-213--VDSIYLFF------------NTLYKHE...VNDK--------------------------------------------
L0JQI9_NATP1/1-204--VESISVAL------------VTRYETD...ES..--------------------------------------------
U5LEI3_9BACI/4-214--IDQIYLAL------------NTTYIRE...SDDK--------------------------------------------
B7GKU0_ANOFW/25-235--IDDIYLSL------------CTMYTKE...VDDR--------------------------------------------
C5D3Y3_GEOSW/2-199--IRKLEVEL------------QLIVQTN...GK..--------------------------------------------
H2K613_STRHJ/3-217--VEHIGLEL------------IARVEAE...HADG--------------------------------------------
Q9KVV0_VIBCH/21-237--IDNIELKL------------CCCYIAE...VADE--------------------------------------------
Q2J8X7_FRASC/3-216--IEKVLVAL------------EATVEVE...TDDS--------------------------------------------
D9STE5_CLOC7/4-212--ISRIEVEL------------KTEYLKE...IDDS--------------------------------------------
Q81QV7_BACAN/2-213--IESIYLTL------------STSYIRE...VDDK--------------------------------------------
X5A5U4_9BACL/4-211--IDKIYIYV------------KTQYEKE...DNDR--------------------------------------------
D2B8E4_STRRD/3-215--VEGIFIDF------------TAVVEVE...SGDN--------------------------------------------
F2EZY3_SOLSS/4-214--IDAIYLTL------------HTNFIRE...IDDK--------------------------------------------
Q5V309_HALMA/3-209--IDSVYFAL------------ETEYKSD...EG..--------------------------------------------
Q6LLI7_PHOPR/4-219--IDNINVQL------------CCRYIDE...VPVS--------------------------------------------
E4NWJ2_HALBP/1-207--ISAIDLEV------------ETRYRTE...EG..--------------------------------------------
E1SSB8_FERBD/2-218--INGLELSL------------MTMAEVE...HEGG--------------------------------------------
D7AXU0_NOCDD/3-217--VERLTVGL------------QARVEVE...SGDH--------------------------------------------
F4FG08_VERMA/3-218--IEHLAVGL------------VTRVEIE...SGDS--------------------------------------------
D3EJD4_GEOS4/4-211--VDRIYLKL------------MTEYTRE...SDDK--------------------------------------------
I0H7C6_ACTM4/3-218--IEHITLGL------------VTRMEVE...GGGG--------------------------------------------
B1VNV5_STRGG/3-217--VDRISLLL------------VARVERE...DQDE--------------------------------------------
H8MVT2_CORCM/3-210--IDRIDLHL------------MAQYLQR...DNDR--------------------------------------------
H8GZW1_DEIGI/5-201--IERVNLGL------------ATRYRSD...DS..--------------------------------------------
Q5L337_GEOKA/2-211--IDEIYLAL------------VTTYLRE...IDDK--------------------------------------------
C0ZHJ0_BREBN/2-209--IDEIYMYV------------VTHYEKE...SNDS--------------------------------------------
H2JK05_STRHJ/3-217--IDHITLEL------------VARVEAE...HEHG--------------------------------------------
Q8EMA6_OCEIH/2-211--IDQIYLSV------------NTKYIKE...SDDD--------------------------------------------
F0LQ35_VIBFN/4-220--IDNIELKL------------CCRYIAE...VTMA--------------------------------------------
Q5L3I0_GEOKA/3-199--IRNLDVVL------------QLEVHAE...GK..--------------------------------------------
E1V3I8_HALED/2-214--LDALVLDL------------ASEAIKE...VDDK--------------------------------------------
R4SRA3_AMYOR/2-218--INGLSVKL------------LARVTLP...DERR--------------------------------------------
G2NQ97_STREK/3-217--VESITLEL------------VARVEAE...HEEG--------------------------------------------
C7MVV3_SACVD/2-217--IGEVALSL------------VTRVEME...TGDH--------------------------------------------
Q47QI1_THEFY/3-218--IEEISVCL------------ASAVEVE...AGDT--------------------------------------------
B1YLT3_EXIS2/2-212--IARIYLAF------------NTQYKQE...VGDS--------------------------------------------
D2RPW6_HALTV/1-204--VDGIYFAL------------ETRYETD...ES..--------------------------------------------
D1A596_THECD/3-218--IQRITLAL------------VTRVEVE...VGDH--------------------------------------------
D2ASM7_STRRD/3-218--IEHITLGL------------VTRIETE...HSEG--------------------------------------------
N0B2E1_9BACI/13-223--INEIYLSL------------YTTYIKE...ADEK--------------------------------------------
H6NE63_9BACL/4-211--VDSIYIYI------------KTQYIKE...ENDQ--------------------------------------------
K0K0P9_SACES/2-217--IDQIVLSL------------VTRVEVE...HGDH--------------------------------------------
Q5E1Q2_VIBF1/4-219--IDNIDLKL------------CCQYKKE...VHRK--------------------------------------------
I7BQH2_NATSJ/1-201--IDDIYFAL------------ATRYETD...ES..--------------------------------------------
K0JWS7_SACES/3-218--IDEVKLAL------------VTRVEVE...SGDN--------------------------------------------
V6K362_STRNV/3-217--IDRVTLEL------------VARVEAE...HEEG--------------------------------------------
A4FGU2_SACEN/3-218--IEHVALGL------------VTRIETE...HGGH--------------------------------------------
Q5YZ34_NOCFA/2-216--ISQIAVEF------------VTRAEVE...YDDH--------------------------------------------
D9T8R1_MICAI/3-218--IDHITVGL------------VTRVEID...GAEE--------------------------------------------
C6CSI9_PAESJ/5-212--IDTIQMSV------------MTEYIRE...SNDN--------------------------------------------
D1A1F2_THECD/3-218--IRYVSVAL------------RTRVEVE...SGDS--------------------------------------------
G0G8W7_AMYMS/2-215--IKGLAVTL------------LARVGVP...GDR.--------------------------------------------
U5W8Q8_9ACTN/3-214--IDNIVLSL------------VTRVEAE...DGD.--------------------------------------------

PF04425

A3GGA7_PICST/92-585--FGLFTVSL------------EGTIKAT---ERNT--------------------------------------------
A5DRA9_PICGU/36-464--FDMMYVVF------------EGSFLVA---NA..--------------------------------------------
Q6BJG5_DEBHA/93-577--FGLFVVTL------------DGTIKTT---HSNP--------------------------------------------
A5DPQ0_PICGU/115-602--FGLFTVSL------------EGTIKAT---ERMD--------------------------------------------
Q6BSG0_DEBHA/5-422--FDMVYVVF------------EGMLVVL---ENN.--------------------------------------------
Q6BVD1_DEBHA/28-455--FDMFYVLF------------EGNLTVA---NT..--------------------------------------------
Q5ABB5_CANAL/19-455--FDMFSVQL------------EGCAIFG---K.T.--------------------------------------------
Q75E04_ASHGO/51-474--FEMFYVTL------------EGYATVI---DR..--------------------------------------------
BUL1_YEAST/108-543--FEMFYVTL------------ESYISII---DK..--------------------------------------------
A5E3Q9_LODEL/66-535--FGLFTVSL------------EGTIKSL---ERSA--------------------------------------------
A3LX53_PICST/9-457--FDMFSTVL------------EGCATFG---SNG.--------------------------------------------
Q6FUH4_CANGA/102-545--FEMFYVTL------------EAYTSVI---DK..--------------------------------------------
Q6CSE2_KLULA/69-505--FEMFYVTL------------EGCACVI---DK..--------------------------------------------
Q6FP46_CANGA/103-568--FEMFYVTL------------EAYISIV---DK..--------------------------------------------
Q5AN22_CANAL/97-598--FGLFTVSL------------EGTIKSV---ERNP--------------------------------------------
A7TIV7_VANPO/87-537--FEMFYVTL------------EAYTSVI---DR..--------------------------------------------
E7KSA7_YEASL/88-524--FEMFYVTL------------EAYISVI---DR..--------------------------------------------
G0VB73_NAUCC/105-559--FEMFYVTL------------EAYISII---DR..--------------------------------------------
G0VC27_NAUCC/80-515--FEMFYVTL------------EAYTSIV---DK..--------------------------------------------
G0VC28_NAUCC/152-590--FEMFYVTL------------EAYTSVI---DK..--------------------------------------------

PF03643

VPS26_DICDI/8-284..........NHYE.FTSLVRELAPAGE-----------L-TENK-T.FSYDFSNVEKQ....YESYNGT-NVR------
VP26A_HUMAN/8-283..........NTHE.FVNLVKELALPGE-----------L-TQSR-S.YDFEFMQVEKP....YESYIGA-NVR------
PEP8_YEAST/5-364SSNGSVDVRKNSVDQFLCQSYDLCPAGE-----------L-QHSQ-S.FPFLFRDLSKR....YESYKGK-NVD------
VP26A_ARATH/8-283..........NFYD.FTSLVREIDVPGE-----------I-YERK-T.YPFEFSSVEMP....YETYNGV-NVR------
VPS26_SCHPO/5-279..........NIHE.FTRSVQELASPGE-----------M-RHAQ-M.FEFEFKHVDKP....YESYIGK-NVK------
VPS26_DROME/6-280..........NHHE.FKCLAKALARPGD-----------L-IQNN-S.YPFDFPKVEKQ....FEVYAGS-NVR------
VPS26_CAEEL/7-282..........NQQD.FISLTRELARPGD-----------L-TQNA-Q.FPFEFNNVEKP....FETYMGT-NVK------
DSCR3_MOUSE/1-283..........KPIQ.IINSTIDVLKPGK-----------I-PSGK-TEVPFEFPLLVKGSKVLYETYHGV-FVN------

PF00339

B4LEM0_DROVI/17-172-------------EVM..........GV-----------K-FSKE-L-I--------------LCR..EQ-IVP------
ARRS_BOVIN/22-180-------------DVM..........GL-----------S-FRRD-L-Y--------------FSQV.QV-FPP------
O76685_CAEEL/6-159-------------ERVRKVNAEGK..EA-----------Y-ETKI-V-N--------------YSAN.VN-YLD------
Q9I7L0_DROME/5-150-------------VT...........TN-----------R-RRRR-R-T--------------FCGR.ED-YIA------
H2N0W5_ORYLA/17-173-------------DVM..........GV-----------A-FRRD-L-F--------------LVTR.QV-YPE------
Q23674_CAEEL/4-159-------------VRNNHTKIKNGDIAR-----------V-RHNC-A-D--------------HKGK.IV-YCR------
O45782_CAEEL/7-155-------------SGKSR........KH-----------C-SHSE-P-Y--------------FL...EQ-FNP------
H2RRP6_TAKRU/18-174-------------DVL..........GL-----------S-FRKD-L-Y--------------ISTF.QA-FPP------
Q9VGU7_DROME/5-155-------------EERVGED......GK-----------T-TKSL-V-T--------------HTTT.EV-YYS------
Q20577_CAEEL/7-158-------------ERRYRTNCEGK..EE-----------S-YTEI-V-H--------------YSAE.VD-YVS------
P91469_CAEEL/7-159-------------ENSCKLSFHRI..VS-----------Y-RPHG-V-Y--------------YSAN.VK-YLD------
Q9VI00_DROME/5-148-------------RTRTRG.......GK-----------T-EHYT-E-Y--------------FRGK.QQ-YLY------
Q20232_CAEEL/7-150-------------.............VV-----------K-SGER-R-T--------------LKDD.QY-VLD------
ARRD4_MOUSE/18-166-------------AGA..........RV-----------C-IGGG-S-P--------------AASSEVE-YLN------
O17983_CAEEL/6-146-------------.............GK-----------K-IIKD-K-K--------------CKKGEET-YVE------
PALF_YEAST/39-201-------------PTSKNKRIEKTLEKS-----------T-FLYG-Q-D--------------YVKT..A-FSA------
ARRB1_BOVIN/18-174-------------DVL..........GL-----------T-FRKD-L-F--------------VANV.QS-FPP------
Q8SYU5_DROME/5-157-------------RHGKAVAIQ....NP-----------K-KRSK-H-Q--------------YSGR.ED-YIA------
O17981_CAEEL/6-159-------------DSVRRVDNDGN..VR-----------Y-DSES-V-H--------------YSSN.VH-YLD------
Q9XXI4_CAEEL/4-156-------------RSTYRTNTRGE..RE-----------R-FTEN-V-N--------------YNAT.IN-YLT------
O17984_CAEEL/4-157-------------ESETKTNSKGE..SE-----------T-KTHT-V-H--------------YTAT.AK-HLD------
F6SKI7_XENTR/21-176-------------DVI..........GL-----------T-FRKD-L-Y--------------FART.QI-YPP------
Q9VI53_DROME/6-155-------------KSVTTSE......GK-----------T-ENEV-T-Q--------------LKGH.EE-YFK------
H2L9D1_ORYLA/14-171-------------DVM..........GL-----------C-FRKD-I-W--------------IQQI.QI-YPE------
ARRB_CAEEL/22-186-------------DVL..........GL-----------T-FRKD-L-I--------------SETF.QV-YPQ------
Q9XXI0_CAEEL/6-159-------------ENKGRYDRHGR..WY-----------R-SSEH-I-N--------------YTSK.IN-VLE------
Q23672_CAEEL/8-142-------------T............DL-----------Y-CKKD-L-F--------------RKSE...-...------
ARRD2_MOUSE/9-158-------------RSA..........GS-----------S-TAYT-Q-S--------------YSER.VE-VVN------

PF13002

A7TSP7_VANPO/130-321---------------IPGSVPATTTLGS-----------T-AETE-IKY--------------ELIATVK-YKDPR....
C5GL98_AJEDR/142-318---------------FAGNLQPTTQ...-----------G-SLGA-VSY--------------NLTACAV-T........
YNSK_SCHPO/63-242---------------FPGSLPASVS...-----------N-RYIK-LEY--------------YLEATLC-Y..G.....
C5DVA9_ZYGRC/141-332---------------ISGSFPAKSALGS-----------N-SETQ-IKY--------------ELCAVVT-YKD......
E7KUR3_YEASL/144-346---------------IPGSVPCSSSLGA-----------T-AETQ-VKY--------------ELIAVVT-YIDPHRNSF

PF02752

Q7PUI7_ANOGA/236-407..........................SN-----------G.KFKN-I----------------VAE.VDV-SKHI.....
Q9TYQ0_CAEEL/174-315........................MIDR-----------K.SITI-A----------------VES..HG-TCKT.....
Q7PUR5_ANOGA/187-319..........................QQ-----------H.LEHT-V----------------LEE..RT-IGRV.....
Q7PYD9_ANOGA/175-306..........................KT-----------R.RETH-T----------------IVK..HI-GDGV.....
Q380N5_ANOGA/183-323......................IPKEES-----------N.VQYE-V----------------LEV..RK-IPSI.....
CRED_ASPOR/181-332..........................SI-----------R.NTYK-N----------------TRT..IL-NDEFELDHD
Q752Z4_ASHGO/228-382..........................QV-----------Y.DDEA-V----------------AHR..AA-MEHFTDVAG
ARRD5_HUMAN/184-321........................RRSR-----------L.DSSE-L----------------LRQ..EA-NTPV.....
ARRD4_HUMAN/191-318..........................KT-----------K.TIRH-M----------------VAN..VR-GNHI.....
Q294M9_DROPS/171-302..........................EH-----------A.RVER-I----------------IIS.RAK-GDAV.....
Q6BI98_DEBHA/278-420..........................VS-----------G.DFEE-L----------------IGK.QTM-SIPD.....
Q294M7_DROPS/174-306..........................DT-----------N.KDRF-V----------------VAE..KA-GEGV.....
Q6BIN4_DEBHA/247-390..........................PA-----------H.SEER-V----------------VVS.KTI-SQPNE....
Q293Z7_DROPS/175-308..........................VQ-----------K.VECI-A----------------IAN..KE-TGSV.....
Q9I7K7_DROME/179-320........................RLET-----------K.VERQ-T----------------VLSSRHE-LHNL.....
A5DM18_PICGU/246-387..........................RS-----------P.EYEE-I----------------IGK.QDL-KINP.....
Q294M5_DROPS/171-304..........................KT-----------R.DIEK-K----------------LHG.CCQ-GERV.....
Q16ZK0_AEDAE/170-299..........................KT-----------K.VISK-T----------------FAS...V-STAI.....
A0BIT0_PARTE/173-314..........................KL-----------S.NYFD-L----------------FDQ..EL-NF.......
Q4V467_DROME/125-256..........................GS-----------K.CERK-S----------------VAK..LK-ADGV.....
Q7SC90_NEUCR/193-351..........................EP-----------T.KKVN-K----------------IAK.HTQ-PVGV.....
Q66L50_DANRE/187-314..........................KV-----------K.EIKQ-L----------------IAN..LR-GDPL.....
Q95NF3_ANOGA/193-351..........................QN-----------G.SYRN-T----------------VAS..LE-TSEGC....
Q6C993_YARLI/185-326..........................HN-----------K.QVEK-V----------------VAN.KTI-EATA.....
O44847_CAEEL/147-273............................-----------..IYGN-T----------------KAK.GKM-HVLV.....
A0CWE9_PARTE/173-316..........................KL-----------S.NYFD-I----------------YLQ..EL-NEQI.....
Q23QU8_TETTS/188-318..........................NT-----------Q.RTKY-I----------------NIF..EK-MVNV.....
Q6ZM71_DANRE/162-286............................-----------..YDLR-S----------------VAE..VE-GPGV.....
A8WP41_CAEBR/178-317......................THHTHH-----------K.NDEK-C----------------VAE.SRR-NFDV.....
Q0E8K8_DROME/169-299..........................VV-----------Q.TEKR-E----------------LAV..LV-RGKI.....
A0C0J3_PARTE/194-337..........................HA-----------R.VLYR-V----------------CAS..SS-IQGI.....
Q16ZJ7_AEDAE/171-300..........................KS-----------R.VVGK-C----------------LAS...V-WTTV.....
Q23YG0_TETTS/188-318..........................NT-----------Q.REKH-V----------------VIY..EQ-PMSV.....
Q9W7R1_ORYLA/193-351..........................SN-----------D.SYTK-C----------------VDY..ED-NGDS.....
ARRB_CAEEL/205-363..........................TT-----------A.SYSC-E----------------VAR..IE-SNEGF....
Q7RZE0_NEUCR/198-350.........................VRE-----------H.KKER-E----------------ISV.WKI-PIEREKHW.
ALY2_SCHPO/345-506....................KRRVLLAE-----------R.SAKH-Q----------------NTD.NLF-ETPD.....
Q5AM66_CANAL/305-457..........................PM-----------K.TDER-I----------------IAK.KKI-PKRKKNNNG
ARRB2_MOUSE/195-350..........................ST-----------A.QYKC-P----------------VAQ..LE-QDDQ.....
A2BIP7_DANRE/186-313...........................R-----------K.IHTH-D----------------LLK..EV-GESV.....
ARRD1_HUMAN/162-286............................-----------..HDVR-T----------------IAE..VE-GAGV.....
A2QR01_ASPNC/439-613....................AKKVLLFE-----------K.RADS-A----------------STS.EEI-VDRNRTNL.
Q380P6_ANOGA/182-314..........................ET-----------R.TDAL-V----------------VAE..SR-CSGV.....
YC9F_SCHPO/183-325........................STCR-----------K.EFKR-A----------------LVK.KTI-PGL......
Q16H74_AEDAE/171-301..........................KS-----------K.SVLS-T----------------LVK..YQ-CGGV.....
Q6DH07_DANRE/192-355..........................SA-----------D.KYTK-N----------------VLT..EE-FGET.....
A8X4Z9_CAEBR/175-315......................SCHDHH-----------K.DDSK-R----------------VAE.TRK-NIKI.....
ART1_SCHPO/287-428..........................SS-----------PIVRKK-K----------------VLR.YEE-DLDD.....
ARRD2_HUMAN/180-307..........................AR-----------K.QKRA-V----------------VAS..LA-GEPV.....
Q294M6_DROPS/179-311..........................RT-----------T.SEKI-M----------------LVK..RE-CGPV.....
ADCC_DICDI/344-478..........................GT-----------S.YQLL-T----------------MTK..KF-YPKI.....
Q6CS19_KLULA/219-373..........................NP-----------N.GADR-T----------------ILK.VKI-QDPLHHINN
Q2UDU8_ASPOR/60-215.....................NVHFLSS-----------K.REHI-I----------------FNE..RH-NLDDCI...
Q22NR4_TETTS/187-325..........................EN-----------K.QKKL-T----------------ISD..IN-LIQI.....
ROD1_YEAST/232-395..........................GV-----------I.NQER-M----------------VAK.LKL-KDPLKHVAQ
A0CL31_PARTE/172-315........................LEFQ-----------L.NYQH-H----------------KGP..QK-GNKI.....
APYA_EMENI/180-326........................SAHA-----------A.RTET-I----------------VCS.DRY-TLGEE....
Q296V0_DROPS/178-310..........................EK-----------R.ESKV-I----------------ISN..LS-IGPV.....
Q6CW08_KLULA/282-443..........................EV-----------Y.DDEN-V----------------IQK..QM-LARFDDLPG
A8WP33_CAEBR/159-305.....................YKCHLHN-----------S.EQFF-T----------------YGR.YGK-GEKHKT...
A0DYQ7_PARTE/173-314..........................KL-----------S.NYFD-I----------------FDQ..EL-IF.......
A0D2Y0_PARTE/206-342..........................ID-----------RVILNQ-V----------------VFS..KI-LPGA.....
A7TQI8_VANPO/357-526.................LLAEHNGPKLE-----------NLGENN-N----------------SSK.AKY-LGNLLV...
Q17EA7_AEDAE/182-314..........................EQ-----------R.QEFT-V----------------LEE..RI-TGKI.....
Q9W2V2_DROME/420-633..........................NN-----------G.KFKN-V----------------VAD..SD-NVTPPV...
Q240M9_TETTS/188-318..........................TA-----------D.KTKV-L----------------NIA..EK-SIEV.....
A5DUN4_LODEL/264-404..........................PM-----------H.SAER-V----------------IAS.KKI-PKKD.....
A0NDX6_ANOGA/173-303..........................QV-----------R.TVYN-T----------------LAK..FQ-CSGV.....
Q16ZJ5_AEDAE/174-305..........................RV-----------K.NLST-I----------------VAQ..VR-CAGV.....
Q7QCL7_ANOGA/170-301..........................VM-----------Q.TEKR-E----------------LAV..IA-RGKI.....
A2QTZ8_ASPNC/184-328..........................TL-----------S.RRAR-V----------------IAE.DDF-YPRDWNED.
O17983_CAEEL/173-318...................ADGADGFKS-----------K.LEEQ-I----------------LET.KIE-RCNV.....
Q9V393_DROME/233-393..........................ST-----------A.QYKS-V----------------VAE..IE-SEDGC....
A0BMC5_PARTE/210-346..........................IE-----------RVVENV-K----------------VFQ..QN-LGGV.....
A1C8U8_ASPCL/140-283..........................QA-----------I.RSRD-I----------------LTD.NYT-AAGWGD...
A0D004_PARTE/178-324........................RSKI-----------I.AEEQ-I----------------STT.TKK-LGSY.....
Q16ZK1_AEDAE/136-269..........................KV-----------K.TNRQ-D----------------VTG..AE-LDQV.....
Q17EA8_AEDAE/183-323......................QLYAEN-----------KLIKYE-T----------------IEM..QR-TSAV.....
Q16ZJ8_AEDAE/186-315..........................KA-----------R.NEAK-T----------------VAK...M-VTTV.....
PALF_ASHGO/233-368..........................GT-----------D.DPME-T----------------FRK..DI-CQCVAP...
ARRS_MOUSE/200-361..........................SS-----------D.YYVK-P----------------VAS..EE-TQEK.....
A8WP37_CAEBR/170-319..................KDCPVPPVYT-----------R.NCEK-V----------------LNS.RVY-PCNV.....
Q9GYT5_CAEEL/181-328.................NEKMSDKIQRI-----------K.FDTK-K----------------VVK.VCQ-KLEV.....
MU170_SCHPO/266-426...........SCGYLKRYQKTKTKTRA-----------K.STWK-I----------------ANK..SV-YSNL.....
A5DW17_LODEL/261-403..........................RS-----------P.EFER-L----------------CGK.QQL-HFPD.....
A0D012_PARTE/172-315........................LEFQ-----------L.SALS-Q----------------NGL..QK-GLKI.....
ADCA_DICDI/313-441..........................YH-----------R.CITN-A----------------IYK..QQ-YDGF.....
Q9I7L0_DROME/174-307..........................NT-----------T.SERL-V----------------VNT..FK-GDAV.....
A7SF55_NEMVE/129-256.........................SVN-----------K.QVKV-L----------------QRS..SM-SLEL.....
Q16ZK2_AEDAE/273-408..........................RQ-----------R.IESV-V----------------VSK..NV-SPGI.....
A8XYD8_CAEBR/172-316....................ANAKGFKS-----------Q.AEKT-V----------------LET.KIE-RCQI.....
A0E996_PARTE/174-317..........................RI-----------S.NYFG-L----------------SKQ..AH-NIVV.....
Q0U5A6_PHANO/182-337........................ISHQ-----------T.DVQV-A----------------VTE.GDM-PPNSANRVP
PALF_YEAST/259-394..........................GK-----------D.DPME-T----------------FRK..DI-CQSISP...
Q23672_CAEEL/163-311..................HSCPLSVYHQ-----------T.NSSN-C----------------IGE..AT-ALKVN....
A7TPY5_VANPO/228-381..........................TI-----------I.NQER-I----------------VTK.MKV-KDPLNYASE
Q759V0_ASHGO/221-368..........................GS-----------K.AEER-T----------------VSK.IKL-SDPLGHL..
Q9VGU7_DROME/180-316.........................EQL-----------K.VTES-R----------------VAD..KH-CGEV.....
Q6FM62_CANGA/224-379..........................PK-----------QVEKER-K----------------VTQ.MKI-RNPLKELAR
A7SKJ5_NEMVE/177-307..........................KQ-----------R.RRTN-E----------------ILR..HN-HPGV.....
Q6CGL3_YARLI/174-329..........................EP-----------V.EKRR-K----------------VVK.NTK-QVDQ.....
ARRD5_MOUSE/170-307........................RRRR-----------A.DSSE-L----------------LRQ..MA-NARI.....
Q17624_CAEEL/176-340..........................AS-----------P.WRTL-L----------------VRK.LES-NQET.....
A0D9C9_PARTE/194-337..........................HS-----------K.LIHR-S----------------CGT..SM-IPGL.....
A0CE97_PARTE/209-345..........................VE-----------RVIEDQ-V----------------VVS..QN-WDGL.....
Q7PYE1_ANOGA/178-310..........................ET-----------K.RKKE-L----------------VTT..IS-MGPV.....
Q16ZJ6_AEDAE/174-302..........................KS-----------R.TDSQ-N----------------AVK..IE-NRDH.....
A7SL06_NEMVE/167-299..........................EY-----------Q.VKDR-L----------------IDS..VK-REGV.....
O45782_CAEEL/179-307.........................EHI-----------K.NVVR-V----------------ISK..ID-KGEV.....
Q17HB8_AEDAE/169-300..........................LL-----------H.QERR-E----------------LAA..IV-RDRI.....
ADCB_DICDI/337-465..........................GV-----------P.TQVL-K----------------VSK..NF-FPKI.....
Q23FQ6_TETTS/188-318..........................RR-----------Y.RDQV-V----------------TQF..EK-STTF.....
Q294M3_DROPS/163-297..........................VK-----------RNFYTK-T----------------LTK.ELI-TDRT.....
A8WP43_CAEBR/183-324....................HCHKHCDH-----------K.TAET-K----------------MSE.VEK-SFEV.....
A3LXL3_PICST/266-408..........................TS-----------P.EYEQ-L----------------HGK.QNM-PIPD.....
O17981_CAEEL/182-333..................TLMSGSSQQT-----------K.YDTK-P----------------VIT.QTQ-PMTV.....
Q16ZK3_AEDAE/167-301..........................YQ-----------K.VDRT-I----------------VCK..NV-TPGI.....
A8X383_CAEBR/164-301........................VNEK-----------K.LAEQ-L----------------IEM..VP-LGAV.....
Q20232_CAEEL/173-309..........................EN-----------K.MMSC-V----------------VFE..HK-SPAI.....
A0BCE6_PARTE/199-335..........................NE-----------RVIENK-T----------------LYS..NV-LPGL.....
Q5AP77_CANAL/170-448HLEAYKQEVMKCPENNLLFSCYEVENDN-----------N.NGNG-N----------------GNG..NG-NKNVKQK..
A0BDM3_PARTE/168-302..........................EP-----------K.VIVE-Q----------------ISK..LS-LPGV.....
Q23674_CAEEL/182-339..............KEKITYATRLNAQT-----------R.VEER-Q----------------ISE.TNI-DIKI.....
ARRD5_BOVIN/171-309........................RRSR-----------V.DSSE-L----------------LRQ..EA-NTHI.....
YA4C_SCHPO/180-322........................LPAS-----------K.DEVR-T----------------VRS.LQT-EEL......
Q294M1_DROPS/173-305..........................EY-----------R.YDKH-L----------------IAR..KQ-FGNV.....
A0A0D1DR37_USTMA/181-316......................KAASQK-----------T.ETLS-S----------------KSK..SF-GKKV.....
A7TDW3_VANPO/229-389..........................PV-----------T.YQER-L----------------ITK.LKI-KDPLGHVEL
Q6FY06_CANGA/237-406..........................VS-----------S.LDDR-L----------------VSK.TKI-KDPFGHLAK
A6R1F7_AJECN/559-759....................SKKVLLFE-----------K.RADS-Q----------------STS..AF-PGSVCRVTA
Q9XXC4_CAEEL/159-308..................SDCPIESKYR-----------R.DGET-V----------------LRG.ANY-SCDV.....
A7TQH7_VANPO/294-447..........................QL-----------Y.NDEV-V----------------ALK..QS-MTDFEGFI.
Q16ID9_AEDAE/216-390..........................ST-----------A.QYKC-T----------------VAE..VE-SEQATV...
PALF_KLULA/263-398..........................RN-----------T.EQIE-T----------------FRK..DI-CQGVAP...
Q6CG62_YARLI/321-486....................ARKYLVFE-----------H.KPDG-G----------------IQD..SL-LPNLDG...
A0A0D1E8U6_USTMA/601-804..................KWTLMKVAHA-----------S.ATEP-I----------------LPI.LSD-SADALDNSP
Q9XTU0_CAEEL/176-327.................SLSENDRYLSR-----------K.RDEI-K----------------IVS.VIH-EMHI.....
YOA5_SCHPO/223-379....................SHLNLSRK-----------N.SEVS-K----------------TCK.CLQ-KETIRCNKK
Q0CQZ7_ASPTN/118-273.....................NVHFLTS-----------T.REHL-V----------------LSE..RY-DSSDDY...
E7LU16_YEASV/179-340..........................PV-----------I.SENR-Q----------------VTE.LNL-EDPLNESSE
F1QAH2_DANRE/171-293..........................RA-----------V.HTTE-I----------------LKE..KG-EPLV.....
F6SKI7_XENTR/196-355..........................SS-----------D.YYIK-T----------------VAL..ED-SQDK.....
F6Y0E4_XENTR/163-285..........................RV-----------V.YDLR-T----------------IAE..VE-GAPV.....
G4VCF9_SCHMA/96-254..........................NN-----------N.RYNC-V----------------VDE..LE-TDESF....
H2N0W5_ORYLA/194-351..........................SN-----------D.KYVK-S----------------VAK..EE-TDDS.....
H3CCN8_TETNG/163-285..........................RP-----------L.FDLR-T----------------IAE..VE-GAGV.....
H3DDA7_TETNG/203-325..........................KR-----------T.VHAR-N----------------ILK..VM-AEAI.....
ART5_YEAST/332-474..........................QI-----------Y.DDEI-A----------------VMK.ITH-LADF.....
Q08CX7_XENTR/182-306..........................TM-----------K.QKKS-V----------------VAT..LA-GDAV.....
TXNIP_MOUSE/176-299..........................QT-----------K.VFTQ-K----------------LSS..VR-GNHI.....
Q9VI00_DROME/172-303..........................KT-----------R.EKEH-S----------------LNK.SCQ-QERV.....

PF07070

E3E849_PAEPS/4-211--------------------------KT...........V-TTCC.I----------------ARIKVSD.GFHL-----
Q9F2L5_STRCO/29-244--------------------------DG...........E-GVVV.F----------------GRHTVGG.PFRL-----
B7VMX8_VIBTL/6-222--------------------------SQGQEGG.HKRRMH-QTYS.L----------------AKWSLPY.AFVI-----
Q87KC8_VIBPA/6-222--------------------------RGAREGH.SMRRVP-QTHV.L----------------AKWNLPY.AFTI-----
D2SH36_GEOOG/3-216--------------------------SW...........R-EEVT.F----------------GTVAVAG.AARV-----
U5VQ01_9ACTN/3-218--------------------------EY...........G-ATGE.F----------------HRVGVSG.PLRL-----
A9B5Z7_HERA2/2-209--------------------------KI...........T-QDHT.I----------------GQYPLTQ.RFQL-----
Q8CK18_STRCO/3-217--------------------------EY...........K-QDVE.F----------------TKVRLGG.AFQL-----
A1S9J4_SHEAM/2-218--------------------------DY...........F-KNHC.L----------------ARWRVAE.RFEI-----
F8AWR6_FRADG/3-216--------------------------TW...........Y-ENVS.F----------------GTRSIGG.KFTI-----
D5XEE5_THEPJ/2-202--------------------------TK...........P-VSRT.V----------------GTVKVTD.KLTL-----
F6CIG7_DESK7/3-202--------------------------TR...........N-IRRI.I----------------GTVTVGE.KMVV-----
E8U7T1_DEIML/4-201--------------------------.............T-SAHA.V----------------ARVTLGE.RVTL-----
D9SYU9_MICAI/3-218--------------------------EY...........D-VNQE.F----------------GRAQVTG.AFRL-----
SP0M_BACSU/4-212--------------------------EH...........R-KYAT.I----------------HSFRVTG.SFTI-----
D6Y483_THEBD/3-219--------------------------ER...........R-GVGE.F----------------YRYQVSG.PTVL-----
D7B3X5_NOCDD/3-216--------------------------.............T-GGAE.C----------------TRVPVAA.GVSL-----
A6W415_KINRD/4-215--------------------------EW...........R-EDVV.F----------------GSARVGA.GFTT-----
A5D298_PELTS/2-203--------------------------TR...........H-LRQE.I----------------GTVKVSD.GMLV-----
Q7MGK0_VIBVY/6-223--------------------------RGSSSQGQQTRRVP-QSHV.L----------------ASWSLPY.AFVI-----
I0JR17_HALH3/2-206--------------------------KI...........K-EKVA.I----------------QKYPIAH.QETI-----
L0A4L1_DEIPD/4-200--------------------------.............V-NMHE.V----------------QRARVCG.PLEI-----
C1D0Z4_DEIDV/4-201--------------------------.............Y-VNHT.L----------------QSEVVVP.AFTI-----
Q8YPP0_NOSS1/22-229--------------------------TV...........T-EECV.M----------------VNYRLLE.HLTI-----
R4LYD7_9ACTN/3-214--------------------------..............-ALLE.F----------------HRAWVAA.GFTL-----
C6WBH8_ACTMD/3-218--------------------------EH...........V-RNVE.F----------------AGVVVAE.KVVV-----
R4SZZ1_AMYOR/2-217--------------------------ER...........A-GTAE.F----------------LRVSAGR.KVRV-----
Q3IE37_PSEHT/2-218--------------------------DY...........F-TNHV.I----------------EQWRITD.IGTV-----
E4N440_KITSK/3-218--------------------------EA...........H-RTQE.F----------------APLRVSG.PLRL-----
D3Q3X8_STANL/19-229--------------------------E............Q-VEYD.F----------------HGADVCE.PFLL-----
G2NX38_STRVO/3-217--------------------------EG...........A-GGVV.F----------------DRLRLSG.GFRL-----
E2Q1G0_STRC2/1-209--------------------------EG...........E-GVVV.F----------------DRFTVAE.GIRL-----
U5W7Z2_9ACTN/3-218--------------------------EY...........N-TDQE.F----------------HRQRLTG.SFKL-----
D4GQ21_HALVD/1-207--------------------------.............Y-REVD.I----------------AQYTLAE.SLTV-----
C4L3D6_EXISA/2-213--------------------------ST...........Y-STFT.I----------------EKILLNEAPFMI-----
L0JQI9_NATP1/1-204--------------------------.............Y-GTAK.F----------------EADALTN.SFTI-----
U5LEI3_9BACI/4-214--------------------------KY...........T-AAGV.I----------------DKYRIAE.TLVI-----
B7GKU0_ANOFW/25-235--------------------------KV...........M-KQAV.I----------------EKWKIAQ.SFVI-----
C5D3Y3_GEOSW/2-199--------------------------.............A-YRRT.V----------------AVIPVSP.SFTI-----
H2K613_STRHJ/3-217--------------------------ES...........E-GTVA.F----------------ERFTVGG.GFRL-----
Q9KVV0_VIBCH/21-237--------------------------RGQQQGQ.PMRRVP-HTYT.L----------------ANWSLPY.AFTI-----
Q2J8X7_FRASC/3-216--------------------------TW...........H-EQVT.F----------------GTQQIGG.GFTI-----
D9STE5_CLOC7/4-212--------------------------KV...........R-CTAN.L----------------LRLVVAR.DLVI-----
Q81QV7_BACAN/2-213--------------------------KI...........T-TTTYDL----------------ERVRLTE.PFSV-----
X5A5U4_9BACL/4-211--------------------------KV...........T-HEVE.I----------------ARILITE.GLLL-----
D2B8E4_STRRD/3-215--------------------------EH...........K-STYS.F----------------LRKQITG.PFHL-----
F2EZY3_SOLSS/4-214--------------------------KI...........K-DEAV.L----------------HKYKLNE.PFTI-----
Q5V309_HALMA/3-209--------------------------.............Y-KDAI.I----------------DQWQLTE.PFTI-----
Q6LLI7_PHOPR/4-219--------------------------RGDSEH..RKEKRP-QTCV.L----------------ATWSLPE.SFVI-----
E4NWJ2_HALBP/1-207--------------------------.............Y-RDTT.V----------------GRMRLSE.SFDI-----
E1SSB8_FERBD/2-218--------------------------ES...........R-QPVR.L----------------HHWHLDD.RFTV-----
D7AXU0_NOCDD/3-217--------------------------ES...........T-RDLE.F----------------HRVQIGG.GVTL-----
F4FG08_VERMA/3-218--------------------------EY...........A-GVME.F----------------HRHPISG.AFQL-----
D3EJD4_GEOS4/4-211--------------------------KY...........I-ESYT.I----------------AKVNVSS.RLTL-----
I0H7C6_ACTM4/3-218--------------------------DY...........S-AVAD.F----------------HRLTVSG.PMRL-----
B1VNV5_STRGG/3-217--------------------------EH...........E-GTVV.L----------------ERFTVGG.GFRL-----
H8MVT2_CORCM/3-210--------------------------RS...........A-LNAV.V----------------RTWRVAN.PFTL-----
H8GZW1_DEIGI/5-201--------------------------.............T-VTHT.L----------------FSQPVVP.GFTI-----
Q5L337_GEOKA/2-211--------------------------KH...........E-EKAV.L----------------ARYKVSG.SLTI-----
C0ZHJ0_BREBN/2-209--------------------------KT...........K-EECT.L----------------VKYRLSE.RVQL-----
H2JK05_STRHJ/3-217--------------------------ES...........E-GAVV.F----------------ERFTVGG.GFRL-----
Q8EMA6_OCEIH/2-211--------------------------KR...........Y-HVNLII----------------DKFKIAE.SFTI-----
F0LQ35_VIBFN/4-220--------------------------RGREEGG.STRRMP-QAHT.L----------------ASWSLPY.AFTI-----
Q5L3I0_GEOKA/3-199--------------------------.............A-YRRT.A----------------AVIPVAS.SFTI-----
E1V3I8_HALED/2-214--------------------------KV...........H-LPHS.W----------------ATLRLSE.AMTI-----
R4SRA3_AMYOR/2-218--------------------------PG...........V-EDLE.F----------------GSQQLAG.NERI-----
G2NQ97_STREK/3-217--------------------------ES...........E-GTVS.F----------------GRFTVSG.GFVL-----
C7MVV3_SACVD/2-217--------------------------EF...........T-GTAE.F----------------FRVVAQQ.GVWV-----
Q47QI1_THEFY/3-218--------------------------EG...........V-SRVE.F----------------ARFPVTG.AFPL-----
B1YLT3_EXIS2/2-212--------------------------KT...........F-TTFT.L----------------DRFVLNEAPFTI-----
D2RPW6_HALTV/1-204--------------------------.............A-RTGT.I----------------DSFRIAD.PFTI-----
D1A596_THECD/3-218--------------------------EG...........A-GGME.F----------------HRVDVSG.PFRL-----
D2ASM7_STRRD/3-218--------------------------EH...........T-GLGE.F----------------FRTEVSG.PFKL-----
N0B2E1_9BACI/13-223--------------------------KY...........T-NNAL.I----------------DQVRIND.PFVI-----
H6NE63_9BACL/4-211--------------------------KV...........R-KTAE.V----------------AKIRVTE.GFLV-----
K0K0P9_SACES/2-217--------------------------EF...........A-GVSE.F----------------LRIPVAQ.GVRV-----
Q5E1Q2_VIBF1/4-219--------------------------SENGSQ...TQMIK-QTHV.L----------------ADWSLPY.AFTI-----
I7BQH2_NATSJ/1-201--------------------------.............T-RTAK.I----------------ETVRVGD.SFTI-----
K0JWS7_SACES/3-218--------------------------EH...........N-RNVE.F----------------ARAVVAR.NVQV-----
V6K362_STRNV/3-217--------------------------ES...........E-GFVG.F----------------ARYEVGG.GFRL-----
A4FGU2_SACEN/3-218--------------------------DG...........D-AFVE.F----------------HRVVVAG.RFEL-----
Q5YZ34_NOCFA/2-216--------------------------EG...........V-REIG.F----------------GRVGVTG.PLHL-----
D9T8R1_MICAI/3-218--------------------------EY...........D-ALVE.F----------------HRVQVAG.GLHL-----
C6CSI9_PAESJ/5-212--------------------------RF...........R-QHGE.I----------------GRYDVST.PFTL-----
D1A1F2_THECD/3-218--------------------------EY...........N-TNME.Y----------------AKVQLTG.PFQL-----
G0G8W7_AMYMS/2-215--------------------------.............T-EDLP.F----------------ETRQLVG.GEVI-----
U5W8Q8_9ACTN/3-214--------------------------..............-ALIE.F----------------HRVSVAG.HFTL-----

PF04425

A3GGA7_PICST/92-585-----------------HAEANEAHKYN-----------K-ILMK-K----------------FLKMYDF-NASYGYTDV
A5DRA9_PICGU/36-464-----------------....KNKKDRV-----------P-VKVK-Q----------------FLQMFDF-TASWNHGNI
Q6BJG5_DEBHA/93-577-----------------NANPADIHKYD-----------K-VLIK-K----------------FLKMYDL-NASYGYTQI
A5DPQ0_PICGU/115-602-----------------NDGTQSPHRYK-----------K-VLMK-K----------------FLKMYDL-NASYGYTHI
Q6BSG0_DEBHA/5-422-----------------...RGLMDVKK-----------P-SKVH-K----------------FLTMLDL-FASWSYANI
Q6BVD1_DEBHA/28-455-----------------....LDVNDRK-----------P-SKVE-R----------------FLQMFDF-SASWNHAYI
Q5ABB5_CANAL/19-455-----------------...NNSTLVEQ-----------P-SHID-R----------------FLNMFDF-NASWNDAFL
Q75E04_ASHGO/51-474-----------------........MKG-----------K-RTVK-R----------------FLRMVDI-SASWSYSSV
BUL1_YEAST/108-543-----------------........VKS-----------K-RTIK-R----------------FLRMVDL-SASWSYSKI
A5E3Q9_LODEL/66-535-----------------..NP.LQQRYR-----------K-ILMK-K----------------ILKMYDL-CAGYSYGYV
A3LX53_PICST/9-457-----------------..NLQSSVVRP-----------P-TTVV-R----------------FLTMFDF-NASWNDAAL
Q6FUH4_CANGA/102-545-----------------........QKG-----------K-RTLK-R----------------FLRMVDL-SASWSYSSI
Q6CSE2_KLULA/69-505-----------------........KQG-----------K-RTVK-R----------------FLRMVDL-SASWSYSNI
Q6FP46_CANGA/103-568-----------------........QKG-----------K-RTIK-R----------------FLRMVDM-SASWSYSSM
Q5AN22_CANAL/97-598-----------------.HAMGLTHKFS-----------K-ILMK-K----------------FLKMYDL-NASYGYVQV
A7TIV7_VANPO/87-537-----------------........QKG-----------K-RTVK-R----------------FLRMVDL-SASWSYTNM
E7KSA7_YEASL/88-524-----------------........QKG-----------K-RTLK-R----------------FLRMVDL-SASWSYTNI
G0VB73_NAUCC/105-559-----------------........KKG-----------K-RVVK-R----------------FLRMVDL-SASWSYTTI
G0VC27_NAUCC/80-515-----------------........QRR-----------K-RTLK-R----------------FLRMVDM-SASWSYTNI
G0VC28_NAUCC/152-590-----------------........TKG-----------K-RTVK-R----------------FLRMVDL-SASWSYTNI

PF03643

VPS26_DICDI/8-284--------------LRYFVRLTIGRSF.ASN----IVK---EYDIWVI.............NF...VKPP..........
VP26A_HUMAN/8-283--------------LRYFLKVTIVRRL..TD----LVK---EYDLIVH.............QL...ATYP..........
PEP8_YEAST/5-364--------------VAYYVKVTVMRKS..TD----ISK---IKRFWVY.............LYNSVTTAPNTLSANETKA
VP26A_ARATH/8-283--------------LRYVLKVTVTRGY.AGS----IVE---YQDFVVR.............NY...VPLP..........
VPS26_SCHPO/5-279--------------LRYICRVTVSRKM..KD----VIR---EKDLWVY.............RF...ENEP..........
VPS26_DROME/6-280--------------LRYFLRATIVRRI..SD----ITK---EVDIAVH.............TL...CSYP..........
VPS26_CAEEL/7-282--------------LRYFLRVTVIRRL..TD----LTK---ELDLVVH.............AL...SSYP..........
DSCR3_MOUSE/1-283--------------IQYTLRCDMRRSLLAKD----LTK---TCEFIVHSAPQKGKLTPSPVDF...TITP..........

PF00339

B4LEM0_DROVI/17-172--------------MTNPNMEM.TPMQ--EK....IVRK-LGSHAHPF-------------TF---HFPP----------
ARRS_BOVIN/22-180--------------VGAS..GATTRLQ--ES....LIKK-LGANTYPF-------------LL---TFPD----------
O76685_CAEEL/6-159--------------YSLLLWAS.SDGS--NE....LAA.-.GEYAWPF-------------SY---NLPI----------
Q9I7L0_DROME/5-150--------------SKTFLVGSNLSSQ--VS....IEA.-.GIHTYNF-------------VC---LIPT----------
H2N0W5_ORYLA/17-173--------------LQDKEKLTHTKIQ--QK....LLRK-LGDNAFPF-------------FF---EFPD----------
Q23674_CAEEL/4-159--------------FETIVWKS.DGAK--ND....MPS.-.GPHIFPF-------------SF---QLPH----------
O45782_CAEEL/7-155--------------GYTHKFTVVKDGK--EK.ERILPA.-.GIHQVPF-------------SY---TLPK----------
H2RRP6_TAKRU/18-174--------------VPEER.KPNSRLQ--ER....LLKK-LGQHAHPF-------------YF---TIPQ----------
Q9VGU7_DROME/5-155--------------TDQPVYGQAGGSQ--LE....LPT.-.GKYVFPF-------------RA---TIPP----------
Q20577_CAEEL/7-158--------------GETIAWSA.RNGT--EK....LPS.-.GHHVFPF-------------AF---PLPI----------
P91469_CAEEL/7-159--------------YTQLLWTC.GEGP--KE....LNA.-.GEYAWPF-------------SY---TLPL----------
Q9VI00_DROME/5-148--------------TRTSVFGS.....--GN....LPP.-.GTHTYNF-------------CI---PLPL----------
Q20232_CAEEL/7-150--------------EKQLLWGKDKSDE--SDSVPILAR.-.GVHQFSF-------------NF---DLPQ----------
ARRD4_MOUSE/18-166--------------LRLSLLEAPAGEG--VT....LLQP-.GKHEFPF-------------RF---QLPS----------
O17983_CAEEL/6-146--------------MKHEVWTP.EDTE--NT....FPS.-.GDYEWNF-------------SF---ELPK----------
PALF_YEAST/39-201--------------KEKKPHVDKTTIL--NG....LSK.-.GEHRFPF-------------RI---RIPR----------
ARRB1_BOVIN/18-174--------------APEDK.KPLTRLQ--ER....LIKK-LGEHAYPF-------------TF---EIPP----------
Q8SYU5_DROME/5-157--------------STTYLMGSEQGSN--FN....MDA.-.GTYTYTF-------------AC---PIPS----------
O17981_CAEEL/6-159--------------QALLLWAC.KDGS--NE....LSA.-.GDYVWPF-------------SY---TLPL----------
Q9XXI4_CAEEL/4-156--------------GESIAWQS.RDGT--DR....LPA.-.GTNVFPF-------------AF---NLPI----------
O17984_CAEEL/4-157--------------TAVPLWRK.TDKA--AR....LLP.-.GKYEWQF-------------WF---QLPC----------
F6SKI7_XENTR/21-176--------------VEDP..KALTKVQ--ER....LMKK-LGNNAYPF-------------LL---QFPD----------
Q9VI53_DROME/6-155--------------IQYYLLGGKNSSE--TE....LPP.-.GTHTYPF-------------TC---ALPP----------
H2L9D1_ORYLA/14-171--------------SSKPALSA...MH--DT....LLKK-AGDNSYPF-------------SF---EIPT----------
ARRB_CAEEL/22-186--------------TDKSISRPLSRLQ--ER....LKRK-LGANAFPF-------------WF---EVAP----------
Q9XXI0_CAEEL/6-159--------------GIAQPWSSIENAN--NK....IPG.-.GVNIFPF-------------LF---QLPA----------
Q23672_CAEEL/8-142--------------...MVWVS.KDGQ--NK....MPE.-.GGYIWTF-------------EI---KLPI----------
ARRD2_MOUSE/9-158--------------HRATLLAPDSGDI--AT....LPA.-.GRHEFPF-------------SF---QLPI----------

PF13002

A7TSP7_VANPO/130-321...RDLPT....F.GKVQSLKLSMPIAVTRS----ILR---GPDKNSL-------------RV----FPP----------
C5GL98_AJEDR/142-318...........TS.GKEL..CLNRPIKIKRA----VMP---GPDKYSM-------------RI----FPP----------
YNSK_SCHPO/63-242.....TPEGGISP.SKPEVLKF..PLQLKRA----AIP---SPDTIHK-------------RI----FPP----------
C5DVA9_ZYGRC/141-332......PRRGASPHQKDQLLQLVMPVPVTRS----LPR---GPDKNSL-------------RV----FPP----------
E7KUR3_YEASL/144-346SSGHSTPRKEGSS.SKKRLLQLAMPIAVTRS----IPR---GPDKNSL-------------RV----FPP----------

PF02752

Q7PUI7_ANOGA/236-407...............................----..G---PGDTLHASYSL...........---.LPVRGTTKNWIAV
Q9TYQ0_CAEEL/174-315...............................----.KA---GVGPQTKEIEF...........---SVP...........
Q7PUR5_ANOGA/187-319...............................----AGR---NDAVFE..ENI...........---LIG...........
Q7PYD9_ANOGA/175-306...............................----APE---SQKQYE..QRL...........---VVP...........
Q380N5_ANOGA/183-323...............................----EGE---NDARFV..ESF...........---VVG...........
CRED_ASPOR/181-332..........................NALEI----IDE---AAEGYQFSRYL...........---DLP...........
Q752Z4_ASHGO/228-382..........................CDPAR----GNL---LVDAVRLQLPF...........---SVP...........
ARRD5_HUMAN/184-321...............................----TRF---NTTKVV..STF...........---NLP...........
ARRD4_HUMAN/191-318...............................----ASG---STDTWN.GKTL...........---KIP...........
Q294M9_DROPS/171-302...............................----LKQ---CTRSLT..IGL...........---PVP...........
Q6BI98_DEBHA/278-420..............................S----NSL---SADRWDVKSTF...........---KVPS..........
Q294M7_DROPS/174-306...............................----SKN---SRKQFT..FDL...........---KVP...........
Q6BIN4_DEBHA/247-390.............................ND----PEF---QMDKWEVDNYL...........---KVP...........
Q293Z7_DROPS/175-308...............................----QKK---SERSFA..HEL...........---LMP...........
Q9I7K7_DROME/179-320...............................----PRG---ELQNFQHLHML...........---QVP...........
A5DM18_PICGU/246-387...............................----GHA---EEDYWDIRTQF...........---HLP...........
Q294M5_DROPS/171-304...............................----LRF---SKRIIK..GSL...........---LIP...........
Q16ZK0_AEDAE/170-299...............................----NND---VFSRLQ..QQL...........---DIP...........
A0BIT0_PARTE/173-314...............................----AAG---EQKEVK..TIL...........---SLPNGK........
Q4V467_DROME/125-256...............................----LRN---SRKMYD..FQL...........---MIP...........
Q7SC90_NEUCR/193-351...............................----.KL---TETGYVTNLGL...........---VFPARDLRDP....
Q66L50_DANRE/187-314...............................----HSG---KTETWDG.KML...........---KIP...........
Q95NF3_ANOGA/193-351..............................P----IQP---GSS.LQKVMYL...........---.TPLLSSNKQRRG.
Q6C993_YARLI/185-326..............................D----GYE---GHDLWEVDDFF...........---PIP...........
O44847_CAEEL/147-273...............................----APY---STQKFT..IPF...........---TIP...........
A0CWE9_PARTE/173-316...............................----QAH---SQKQIA..TKI...........---HLPTGK........
Q23QU8_TETTS/188-318...............................----KVE---KT.HINENVQL...........---QVP...........
Q6ZM71_DANRE/162-286...............................----KGG---NKSEWN..QQI...........---IVP...........
A8WP41_CAEBR/178-317...............................----APH---SRGQVV..LSM...........---KIP...........
Q0E8K8_DROME/169-299...............................----RPG---AKDEWH..NEL...........---YVP...........
A0C0J3_PARTE/194-337...............................----ESG---QSALNEHKKDM...........---NLPLVD........
Q16ZJ7_AEDAE/171-300...............................----TTD---KSATYS..QNL...........---EIP...........
Q23YG0_TETTS/188-318...............................----KVE---KS.QIKQEVQI...........---QIP...........
Q9W7R1_ORYLA/193-351...............................----VSA---GAT.LKKVYTL...........---.LPLLANNRERRG.
ARRB_CAEEL/205-363..............................P----VGP---GGT.LSKVFAV...........---.CPLLSNNKDKRG.
Q7RZE0_NEUCR/198-350...........................QDVI----EDT---GQEGWVMNTGL...........---DLP...........
ALY2_SCHPO/345-506...............................----EGD---GLSSAVFNFNV...........---ALP...........
Q5AM66_CANAL/305-457D........................EEEEEE----EVD---MFDQWQIDTII...........---NIP...........
ARRB2_MOUSE/195-350...............................----VSP---SST.FCKVYTI...........---.TPLLSDNREKRG.
A2BIP7_DANRE/186-313...............................----EPN---SKKTIT..TVL...........---TIP...........
ARRD1_HUMAN/162-286...............................----KAW---RRAQWH..EQI...........---LVP...........
A2QR01_ASPNC/439-613..........................LGNLS----SDA---GVGPTEMEFNV...........---QLPS..........
Q380P6_ANOGA/182-314...............................----TSG---EVVKHQ..QNL...........---LIP...........
YC9F_SCHPO/183-325...............................----.PM---VDDYWQDQIMV...........---KIP...........
Q16H74_AEDAE/171-301...............................----DRN---KSAGYE..RRL...........---LVP...........
Q6DH07_DANRE/192-355...............................----VEA---NSS.FEKSLDI...........---.TPLLANNKEKRG.
A8X4Z9_CAEBR/175-315...............................----TAR---THGREQ..LMM...........---KIP...........
ART1_SCHPO/287-428...............................----MKL---TSEGLSKSLSK...........---PFPDI.........
ARRD2_HUMAN/180-307...............................----GPG---QRALWQG.RAL...........---RIP...........
Q294M6_DROPS/179-311...............................----AHH---AQKIYT..ETL...........---RIP...........
ADCC_DICDI/344-478...............................----KQN---TACKQM..VVI...........---ELP...........
Q6CS19_KLULA/219-373GE......................YDATNTT----EFD---FQDKWEINTSV...........---RIP...........
Q2UDU8_ASPOR/60-215............................APE----SEE---PDLEWCITKTI...........---SLP...........
Q22NR4_TETTS/187-325...............................----VPP---KSVKENVGIHF...........---KIPD..........
ROD1_YEAST/232-395IKKKRS.............LNEAADEGVDTD----TGE---FQDKWEVRALL...........---NIP...........
A0CL31_PARTE/172-315...............................----QPI---QKQDYQ..LQLIN.......LK---NPP...........
APYA_EMENI/180-326..............................Y----SSK---ALESYQFSRTL...........---QLP...........
Q296V0_DROPS/178-310...............................----NGG---ESRTFT..QQL...........---EIP...........
Q6CW08_KLULA/282-443..........................CDPTQ----DNL---LIDQIKLNSVL...........---QFP...........
A8WP33_CAEBR/159-305.............................PV----APY---TEGKFK..IPF...........---TIP...........
A0DYQ7_PARTE/173-314...............................----EAG---DEKEIK..TTF...........---KLPQGK........
A0D2Y0_PARTE/206-342...............................----NQG---ERLEAQI.AKF...........---EIP...........
A7TQI8_VANPO/357-526.............................DD----STG---DLVNKEFEYQV...........---FVP...........
Q17EA7_AEDAE/182-314...............................----AKR---QDAKLE..ENI...........---LIG...........
Q9W2V2_DROME/420-633.............................DR----TVA---AGASLNTTVTL...........---.RPQRGPTKNWIA.
Q240M9_TETTS/188-318...............................----KVE---QS.KMKQEVQF...........---QVP...........
A5DUN4_LODEL/264-404..............................P----SEL---EFDKWEFETFM...........---RLP...........
A0NDX6_ANOGA/173-303...............................----DAK---GSAGYE..RRF...........---LVP...........
Q16ZJ5_AEDAE/174-305...............................----QRR---NKGSYV..QHL...........---LVP...........
Q7QCL7_ANOGA/170-301...............................----RAG---HRDEWQN.ESL...........---YVP...........
A2QTZ8_ASPNC/184-328..........................EFRIT----SDN---EGCWHSLTRFL...........---RLP...........
O17983_CAEEL/173-318...............................----PAR---SSKDFA..FSF...........---DIP...........
Q9V393_DROME/233-393..............................Q----VAP---GFT.LSKVFEL...........---.CPLLANNKDKWG.
A0BMC5_PARTE/210-346...............................----NSG---QKLERQN.ASL...........---EIP...........
A1C8U8_ASPCL/140-283............................VIP----SSD---GADWYHIIRRL...........---QLP...........
A0D004_PARTE/178-324...............................----KVL---NQQEVVLFAQLKNHNNNDQYNM---IQP...........
Q16ZK1_AEDAE/136-269...............................----DDP---DVVRYE..ESI...........---LVP...........
Q17EA8_AEDAE/183-323...............................----ARQ---TNANFE..KHF...........---LVG...........
Q16ZJ8_AEDAE/186-315...............................----TRD---KSDQYT..QDL...........---VIP...........
PALF_ASHGO/233-368.............................LY----VEP---ETHTCSVGMNL...........---NVP...........
ARRS_MOUSE/200-361...............................----VQP---NST.LTKTLVL...........---.VPLLANNRERRG.
A8WP37_CAEBR/170-319...............................----PPG---ETEQVM..VAV...........---DLP...........
Q9GYT5_CAEEL/181-328...............................----PAK---NEHKFV..LEL...........---RIP...........
MU170_SCHPO/266-426...............................----APT---LKNTIH..AQI...........---KIP...........
A5DW17_LODEL/261-403..............................T----STL---PYDKWVIKTHF...........---KVP...........
A0D012_PARTE/172-315...............................----QPA---SQIGCS..LQLV........NT---KQP...........
ADCA_DICDI/313-441...............................----QPC---FYGKRY..LPF...........---SIP...........
Q9I7L0_DROME/174-307...............................----QRN---CKKLFS..YEI...........---RVP...........
A7SF55_NEMVE/129-256...............................----...---........DEF...........---EVP...........
Q16ZK2_AEDAE/273-408...............................----RLP---DGGVLAE.DNL...........---QVP...........
A8XYD8_CAEBR/172-316...............................----QPD---EIMPFE..FSF...........---VIP...........
A0E996_PARTE/174-317...............................----KGG---QKRQLEYKLKLEQ.......DS---NDP...........
Q0U5A6_PHANO/182-337.........................EGVEEA----DEM---FDESHRFSMTL...........---DLP...........
PALF_YEAST/259-394.............................IY----INP---ETLQFQSRVYL...........---KVP...........
Q23672_CAEEL/163-311..............................V----APY---STKSII..LPF...........---TIP...........
A7TPY5_VANPO/228-381N.......................INPSNEE----DSE---FKDRWELDLNL...........---PIP...........
Q759V0_ASHGO/221-368...........................SGEP----DSH---AEDRWDLSMTI...........---AVP...........
Q9VGU7_DROME/180-316...............................----LKH---NKAKFD..EFL...........---TVP...........
Q6FM62_CANGA/224-379NV......................NFQDDED----NSE---FKDSWDLQAYL...........---KIP...........
A7SKJ5_NEMVE/177-307...............................----RPH---SEQHLPG.LLV...........---QIP...........
Q6CGL3_YARLI/174-329...............................----..K---LARDFKFELSM...........---DYPQYEPKDK....
ARRD5_MOUSE/170-307...............................----PAF---NSTTVV..SAF...........---NLP...........
Q17624_CAEEL/176-340...............................----PAK---TKGAIEQSGLFL.........L---TVPPVCPSTKGDYE
A0D9C9_PARTE/194-337...............................----QAG---QSALNEQRKNM...........---TLSLVD........
A0CE97_PARTE/209-345...............................----LAG---QSKDRIV.SLL...........---ELP...........
Q7PYE1_ANOGA/178-310...............................----EAG---NSQTWQ..QFL...........---QIP...........
Q16ZJ6_AEDAE/174-302...............................----QQD---VEGKFE..RNL...........---LIP...........
A7SL06_NEMVE/167-299...............................----.AR---GKEVIIDDVTI...........---TIP...........
O45782_CAEEL/179-307...............................----PGG---STTEWQE.ESI...........---TIP...........
Q17HB8_AEDAE/169-300...............................----KSG---IRDVLQN.GHL...........---TVP...........
ADCB_DICDI/337-465...............................----QQN---QQSTQI..VVM...........---ETP...........
Q23FQ6_TETTS/188-318...............................----KIN---SK.QVSQEIQL...........---QIP...........
Q294M3_DROPS/163-297...............................----LRL---SKRQYE..SSI...........---CVP...........
A8WP43_CAEBR/183-324...............................----NCC---SEGIIQ..VAL...........---VLP...........
A3LXL3_PICST/266-408..............................Q----ETL---PDDKWTISTHY...........---KVP...........
O17981_CAEEL/182-333...............................----TPG---NEHKFV..LEF...........---RLP...........
Q16ZK3_AEDAE/167-301...............................----RLP---EGGVLAA.ENL...........---QVP...........
A8X383_CAEBR/164-301...............................----RSR---CRMEFEK.CLL...........---RIP...........
Q20232_CAEEL/173-309...............................----AAN---SQGKYDSTLEQP.........I---RLP...........
A0BCE6_PARTE/199-335...............................----SAG---KRSEGLK.SSI...........---TLP...........
Q5AP77_CANAL/170-448............................NKD----QPM---IATPLD..INV...........---SLPFLTTMSDSLIM
A0BDM3_PARTE/168-302...............................----IQG---IVQTIKKSILL...........---...FDF........
Q23674_CAEEL/182-339...............................----DKN---EKQEVE..KPI...........---PLP...........
ARRD5_BOVIN/171-309...............................----TAF---NTTKIV..STF...........---HLP...........
YA4C_SCHPO/180-322...............................----.EE---FSDHYELTKNL...........---ELP...........
Q294M1_DROPS/173-305...............................----LRW---SRKVYR..GYL...........---DLP...........
A0A0D1DR37_USTMA/181-316...............................----YKG---DVHTFD..LVC...........---QIP...........
A7TDW3_VANPO/229-389FSNKL................KGRNIPNSVP----PMD---YQDAWDITAEF...........---QIP...........
Q6FY06_CANGA/237-406LRKKKYTAK.......SLTDPNFNTGSDDDS----DMD---FQDKWDINTTI...........---EIP...........
A6R1F7_AJECN/559-759GGGVAYDARREAAEGIEYVNPRNTNLLGDLE----ESF---EVGPTEMEFNV...........---QLPT..........
Q9XXC4_CAEEL/159-308...............................----APG---EVKYIN..VEI...........---DLP...........
A7TQH7_VANPO/294-447..........................KINER----TGS---LIDKVEIDSMI...........---KMP...........
Q16ID9_AEDAE/216-390............................RIQ----TSK---ATTNQEPVVEL...........---.QPRIRSLTLMDVI
PALF_KLULA/263-398.............................LY----TDP---ETHEAVIMLKL...........---KVP...........
Q6CG62_YARLI/321-486.............................VQ----ELM---AGGATELEFDV...........---VIP...........
A0A0D1E8U6_USTMA/601-804LAPMARA...........AAGEDQDSDALPS----ILD---PTGPWELATEL...........---SIP...........
Q9XTU0_CAEEL/176-327...............................----EPR---TEHKAK..MRL...........---KIP...........
YOA5_SCHPO/223-379S........................NCYNWN----GIA---ALETYTTECHI...........---QIP...........
Q0CQZ7_ASPTN/118-273............................ATR----EGA---FEIEWTAEKQV...........---CLP...........
E7LU16_YEASV/179-340EFNGN...............SCFVNNPFFQP----DHS---FQDKWEIDTIL...........---QIP...........
F1QAH2_DANRE/171-293...............................----.SS---TRENLY..KVL...........---PLP...........
F6SKI7_XENTR/196-355...............................----.VP---SKASYNHTFTL...........---.LPLLAYNREKRE.
F6Y0E4_XENTR/163-285...............................----KAW---KRAVWD..EQI...........---LVP...........
G4VCF9_SCHMA/96-254..............................P----ILP---SQTGWCKVYKL...........---.RPLLANNRHKRG.
H2N0W5_ORYLA/194-351...............................----.VP---SGTTLKKEYTL...........---.HPLLAYNKDRRG.
H3CCN8_TETNG/163-285...............................----KAG---KHAEWR..EQI...........---IVP...........
H3DDA7_TETNG/203-325...............................----EGG---KKKAVT..QLI...........---NLP...........
ART5_YEAST/332-474...............................----.GP---LTDKLDVDCPF...........---TIP...........
Q08CX7_XENTR/182-306...............................----PAG---KRETWH.GRAL...........---KIP...........
TXNIP_MOUSE/176-299...............................----ISG---TCASWR.GKSL...........---RVQ...........
Q9VI00_DROME/172-303...............................----LRL---SKKKIE..GTL...........---AIP...........

PF07070

E3E849_PAEPS/4-211-----------------------------------KQGQ.ELETPFSFRLPL--------------ETP-----------
Q9F2L5_STRCO/29-244-----------------------------------AAGE.ETSIPFTVTLPW--------------ETP-----------
B7VMX8_VIBTL/6-222-----------------------------------QPGE.TRDFECEFDVPL--------------NTP-----------
Q87KC8_VIBPA/6-222-----------------------------------HPGE.ERTFDVKLDVPW--------------NTP-----------
D2SH36_GEOOG/3-216-----------------------------------EPGA.RHALPFSLPVPW--------------QCP-----------
U5VQ01_9ACTN/3-218-----------------------------------AEKQ.QLSLPFEFVVPW--------------ETP-----------
A9B5Z7_HERA2/2-209-----------------------------------QPGA.QQRIPFSINLPL--------------DTP-----------
Q8CK18_STRCO/3-217-----------------------------------KAGV.VHAVPFGLEIPW--------------ETP-----------
A1S9J4_SHEAM/2-218-----------------------------------QPGE.VREIPFSGQLHP--------------ETP-----------
F8AWR6_FRADG/3-216-----------------------------------AANQ.ETSGRFELPVPW--------------QTP-----------
D5XEE5_THEPJ/2-202-----------------------------------APGQ.EKTIPVNFEIPL--------------DIP-----------
F6CIG7_DESK7/3-202-----------------------------------RPGE.EKVYPVSFQIPF--------------GLP-----------
E8U7T1_DEIML/4-201-----------------------------------RAGE.TRELPFHLTVPY--------------HAP-----------
D9SYU9_MICAI/3-218-----------------------------------EPGQ.RHDVPFRFQVPW--------------ETP-----------
SP0M_BACSU/4-212-----------------------------------QPGE.EHQFPFTFTLPL--------------DTP-----------
D6Y483_THEBD/3-219-----------------------------------RKGE.NRVLPFQMSVPW--------------ETP-----------
D7B3X5_NOCDD/3-216-----------------------------------DAGE.HLSIPFSHPVPW--------------QAP-----------
A6W415_KINRD/4-215-----------------------------------VPGQ.RTELPFALALPW--------------QTP-----------
A5D298_PELTS/2-203-----------------------------------KANSPEVSIPVQLRLPY--------------SIP-----------
Q7MGK0_VIBVY/6-223-----------------------------------KPSE.ERVFDVALDIPF--------------NTP-----------
I0JR17_HALH3/2-206-----------------------------------KEGE.TKEIPFSIQLPY--------------HTP-----------
L0A4L1_DEIPD/4-200-----------------------------------APGE.ERVLPFEFVLSY--------------HTP-----------
C1D0Z4_DEIDV/4-201-----------------------------------RPGE.TREFPFTLRVGP--------------GTP-----------
Q8YPP0_NOSS1/22-229-----------------------------------QPKE.EVVIPFSLNLPD--------------EMP-----------
R4LYD7_9ACTN/3-214-----------------------------------APGE.HQDIPFTITPPW--------------ETP-----------
C6WBH8_ACTMD/3-218-----------------------------------GAGQ.QYSLPFQFQIPL--------------ETP-----------
R4SZZ1_AMYOR/2-217-----------------------------------TAGQ.LTTVPFQLALPW--------------ETP-----------
Q3IE37_PSEHT/2-218-----------------------------------EPGE.VKTIPFQARLHS--------------ETP-----------
E4N440_KITSK/3-218-----------------------------------AAGE.RRAVPFALPVPW--------------EAP-----------
D3Q3X8_STANL/19-229-----------------------------------EAGV.EYAVEFDVEVPW--------------ETP-----------
G2NX38_STRVO/3-217-----------------------------------DTRE.HRDVPFTLHIPW--------------ETP-----------
E2Q1G0_STRC2/1-209-----------------------------------AAGE.QRAVPFGVPLPW--------------ETP-----------
U5W7Z2_9ACTN/3-218-----------------------------------DAHA.RHDIPFRFDVPW--------------ETP-----------
D4GQ21_HALVD/1-207-----------------------------------QPDE.QETRDVSLDIPH--------------GTP-----------
C4L3D6_EXISA/2-213-----------------------------------GPGE.VKEIPFTVNVPF--------------NTP-----------
L0JQI9_NATP1/1-204-----------------------------------DPDE.ERSFTVSIDIPY--------------HTP-----------
U5LEI3_9BACI/4-214-----------------------------------QPNE.TREIPFSIQIPE--------------DSP-----------
B7GKU0_ANOFW/25-235-----------------------------------RAGE.KKQITFSFALPL--------------DTP-----------
C5D3Y3_GEOSW/2-199-----------------------------------QPGE.RKVLPFSYVLPL--------------HLP-----------
H2K613_STRHJ/3-217-----------------------------------GEQE.ERELAFSVPLPW--------------ETP-----------
Q9KVV0_VIBCH/21-237-----------------------------------EAGE.TRNFDIELSIPW--------------NTP-----------
Q2J8X7_FRASC/3-216-----------------------------------HPEQ.QISGRFELPVPW--------------QTP-----------
D9STE5_CLOC7/4-212-----------------------------------APNE.RKQIPFGFTVPK--------------HTP-----------
Q81QV7_BACAN/2-213-----------------------------------EPNE.KREIPFSFKMPV--------------ETP-----------
X5A5U4_9BACL/4-211-----------------------------------QAGE.TREIPFEMTVPE--------------RAP-----------
D2B8E4_STRRD/3-215-----------------------------------AAGA.PQSAPFEIPVPW--------------ETP-----------
F2EZY3_SOLSS/4-214-----------------------------------QADE.KRQIPFSFSLPP--------------VVP-----------
Q5V309_HALMA/3-209-----------------------------------EAGE.KRRFETTIDIPR--------------ETP-----------
Q6LLI7_PHOPR/4-219-----------------------------------GVNE.AREFDVNLELPF--------------NTP-----------
E4NWJ2_HALBP/1-207-----------------------------------EPGE.ETTYDAEITIPW--------------ETP-----------
E1SSB8_FERBD/2-218-----------------------------------AANE.RRSERFELTLPL--------------ETP-----------
D7AXU0_NOCDD/3-217-----------------------------------APGQ.RFEVPFELFVPW--------------ETP-----------
F4FG08_VERMA/3-218-----------------------------------APKQ.QLSIPFQLVVPW--------------ETP-----------
D3EJD4_GEOS4/4-211-----------------------------------KPGD.QQEIPFAFPLPL--------------ETP-----------
I0H7C6_ACTM4/3-218-----------------------------------AAGQ.QLSIPFQIDMPW--------------ETP-----------
B1VNV5_STRGG/3-217-----------------------------------AEEA.EHAVPFSVTLPW--------------ETP-----------
H8MVT2_CORCM/3-210-----------------------------------QPRE.EREIPFSLRIPA--------------HAP-----------
H8GZW1_DEIGI/5-201-----------------------------------RPGE.TREFPFELPVPH--------------GTP-----------
Q5L337_GEOKA/2-211-----------------------------------GPNE.TKTIPFQFALPY--------------DVP-----------
C0ZHJ0_BREBN/2-209-----------------------------------KPKE.EVVLPFAFQLPY--------------ETP-----------
H2JK05_STRHJ/3-217-----------------------------------GEGE.HRSVPFRISLPW--------------ETP-----------
Q8EMA6_OCEIH/2-211-----------------------------------QPGE.AKEIPFNFDLSP--------------QTP-----------
F0LQ35_VIBFN/4-220-----------------------------------AAGE.TRDFDVELAVPW--------------NTP-----------
Q5L3I0_GEOKA/3-199-----------------------------------QPGE.RKVLPFSYALPL--------------HLP-----------
E1V3I8_HALED/2-214-----------------------------------EPGE.HRTLPFELPLPL--------------LSP-----------
R4SRA3_AMYOR/2-218-----------------------------------GPGQ.QVRIPFEVALPW--------------ETP-----------
G2NQ97_STREK/3-217-----------------------------------TEGA.EHSIPFDVALPW--------------ETP-----------
C7MVV3_SACVD/2-217-----------------------------------PAEQ.FVVVPFQIMVPW--------------ETP-----------
Q47QI1_THEFY/3-218-----------------------------------GPGQ.RHSIPFRYPVPW--------------QAP-----------
B1YLT3_EXIS2/2-212-----------------------------------EADV.EREIPFTLQVPF--------------NTP-----------
D2RPW6_HALTV/1-204-----------------------------------EPDE.DRSFSVSIDVPY--------------HTP-----------
D1A596_THECD/3-218-----------------------------------PKGQ.DRAVPFQLAIPW--------------ETP-----------
D2ASM7_STRRD/3-218-----------------------------------GVGE.ERTVPFQVPVPW--------------ETP-----------
N0B2E1_9BACI/13-223-----------------------------------KKQE.TKQIPFSFELPI--------------DTP-----------
H6NE63_9BACL/4-211-----------------------------------QAGE.RREIPFSFIIPD--------------YAP-----------
K0K0P9_SACES/2-217-----------------------------------AANQ.PLTVPFQLPIPW--------------ETP-----------
Q5E1Q2_VIBF1/4-219-----------------------------------EPKQ.ERKFELELDLPL--------------NTP-----------
I7BQH2_NATSJ/1-201-----------------------------------DPDE.ERTRTVSIDVPV--------------HTP-----------
K0JWS7_SACES/3-218-----------------------------------GPGQ.RLALPFQFPVPL--------------ETP-----------
V6K362_STRNV/3-217-----------------------------------GEED.SYRVPFEVTLPW--------------ETP-----------
A4FGU2_SACEN/3-218-----------------------------------AEGE.DRVIPFEFPVPL--------------EAP-----------
Q5YZ34_NOCFA/2-216-----------------------------------PAGA.VLEFRFGARAPM--------------ETP-----------
D9T8R1_MICAI/3-218-----------------------------------REGQ.QLSLPFQVAMPW--------------ETP-----------
C6CSI9_PAESJ/5-212-----------------------------------EAGE.TKEVPFSFRLPY--------------QTP-----------
D1A1F2_THECD/3-218-----------------------------------RKGA.RHSLPFTLQIPW--------------EAP-----------
G0G8W7_AMYMS/2-215-----------------------------------RAGQ.QIRVPFEVPLPW--------------ETP-----------
U5W8Q8_9ACTN/3-214-----------------------------------PAGA.REDIPFQMSVPW--------------ETP-----------

PF04425

A3GGA7_PICST/92-585PNSAGIE.....YEAFSIDASDGCVIGLPNERVLKPSTKYKKFFTFRFPNRLLDNSCI.HSILPHILPPPSMGVDSTCFY
A5DRA9_PICGU/36-464DRLITESSH.PYTCPNIVDPIDNAKLAV.KDRTIHPGNVYKRFFTFKIPAQLLDSECS.HNLSGHTHIPPSLGSSRQEQA
Q6BJG5_DEBHA/93-577PNSAGIE.....YEAFTKDLHDGCELGLPNERVLRPHTKYKKFFTFKFPHKLLDNNCI.HDVLPHILPPPSMGLDKTCFY
A5DPQ0_PICGU/115-602PSSVGVE.....YKEYTRD.NEGCILGLPNERILQPHQKYKKFFTFTFPEKLLDNNCM.HSILPHVLPPPSFGFDKSSFY
Q6BSG0_DEBHA/5-422ARLSTDDGDPHDWCYGETDPYDNTVLSIDVKRFFQPNVTYKRFFTFKIPEKLLDNTCEEHTFSIHTEIPPSIGISRTSTT
Q6BVD1_DEBHA/28-455NRLITEYAN.AYECPLITDSYDDTKMGF.SNRKLLPGVTYKRFFTFKIPENLLDSECG.HSLSDHTQIPPSLGKSRSEDY
Q5ABB5_CANAL/19-455DRLVTEHND.PTHIGTIYDPIDGTYYHLDHRKILEPGITYKKYFTFKIPEKLLDSACE.HSLIKHLQIPPTFGVCKNEVI
Q75E04_ASHGO/51-474ESANGYA.....YTQSYKD.YDNCILGLSNTRVLEPGVKYKKFFTFKFPMQLLDVSCK.HEQFSHCLVPPSFGIDKYKSN
BUL1_YEAST/108-543ALGSGVD.....FIPADVD.YDGSVFGLNNSRVLEPGVKYKKFFIFKLPLQLLDVTCK.QEHFSHCLLPPSFGIDKYRNN
A5E3Q9_LODEL/66-535PSSAGIE.....FVPFTEDSYDGCEIGLPDDRILQPHRKYKKFFTFRFPQRLLDNDCP.DAIFLHLLPPPSVGVDKTSFY
A3LX53_PICST/9-457DRLVSDNNN.PMVPTIIIDPIDGTHVQLDPRKILEPNITYKKFFAFKVPEKLLDVTCE.HGFVKHLQIPPTLGISKNEVI
Q6FUH4_CANGA/102-545EVSSGIE.....IEYGGVD.YDNSIIGLNNNRILEPGKKYKKFFMFKLPTQLLDVTCK.QEHYAHCLLPPSFGIDKYRNN
Q6CSE2_KLULA/69-505DLATGFQ.....YVPGDID.QDGCVLGLNNDRFLQPGVRYKKFFTFKFPNQLLDISCK.HEMFCHCLLPPSFGVDKYKHH
Q6FP46_CANGA/103-568QVSSGIE.....YVPGDVD.FDDSILGLSNSRTFLPKTKYKKYFMFKIPDQLLDVTCR.QEIFPHCSLPPSLGIDKWKDN
Q5AN22_CANAL/97-598PNSAGIQ.....YEPFSHDTSDGSVIGLPTDRLLQPNIKYKKFFTFKFPHRLLDNACI.NSLLPHLLPPPSMGIDRTCFY
A7TIV7_VANPO/87-537CLATGVN.....LVAGDVD.YDHSIIGLNNNRVLEPGKKYKKFFTFKLPSQLLDITCK.QEQFAHCLLPPSLGLDKYRNN
E7KSA7_YEASL/88-524TPSTGIN.....IVPGERD.FDDAIIGLSNSRELKPNTKYKKFFMFKLPTQLLDVTCK.QEQFSHCLLPPSFGIDKYKNN
G0VB73_NAUCC/105-559DLGSGIN.....VLPGQLDRYDNTIIGLENNRILEPNTKYKKFFMFKLPNQLLDVTCK.HEQYAHCLLPPSFGIDSYKNG
G0VC27_NAUCC/80-515SMGTGKK.....MPPGEID.FDKTIIGLPNSRILEPMTTYKKYFMFKLPNQLLDTTCK.QEHFSHCLLPPSLGWI.NKNG
G0VC28_NAUCC/152-590FMGTGWK.....MTPGEID.FDNAVIGLRNSRILEPGTRYKKYFMFKLPNQLLDTTCK.QEHFSHCLLPPSFGIDKYRNG

PF03643

VPS26_DICDI/8-284.............................ESN............S--NIKMEVGIEDCLH--------------------
VP26A_HUMAN/8-283.............................DVN............N--SIKMEVGIEDCLH--------------------
PEP8_YEAST/5-364TTNDIAGGNYAADNASDNTQTKSTQGEAADVNQVLPISHSNNEPK--PVRLDIGIENCLH--------------------
VP26A_ARATH/8-283.............................PIN............N--SIKMEVGIEDCLH--------------------
VPS26_SCHPO/5-279.............................ETN............S--LIRMDVGIDECLH--------------------
VPS26_DROME/6-280.............................EMN............N--PIKMEVGIEDCLH--------------------
VPS26_CAEEL/7-282.............................DND............K--SIKMEVGIEDCLH--------------------
DSCR3_MOUSE/1-283.............................ETL............Q--NVKERA.......--------------------

PF00339

B4LEM0_DROVI/17-172--------------------------------------------N..S.PSSVTLQQEGD--------------------
ARRS_BOVIN/22-180--------------------------------------------Y..L.PCSVMLQPAPQ--------------------
O76685_CAEEL/6-159--------------------------------------------N..V.PPSF.......--------------------
Q9I7L0_DROME/5-150--------------------------------------------E..C.PSSF.......--------------------
H2N0W5_ORYLA/17-173--------------------------------------------N..L.PCSVSLQPGPL--------------------
Q23674_CAEEL/4-159--------------------------------------------W..A.PPSF.......--------------------
O45782_CAEEL/7-155--------------------------------------------S..L.PSSF.......--------------------
H2RRP6_TAKRU/18-174--------------------------------------------N..L.PCSVTLQPGPE--------------------
Q9VGU7_DROME/5-155--------------------------------------------N..A.PTSF.......--------------------
Q20577_CAEEL/7-158--------------------------------------------E..C.PPSF.......--------------------
P91469_CAEEL/7-159--------------------------------------------N..I.PPSF.......--------------------
Q9VI00_DROME/5-148--------------------------------------------E..C.PSSV.......--------------------
Q20232_CAEEL/7-150--------------------------------------------S..SLPCSL.......--------------------
ARRD4_MOUSE/18-166--------------------------------------------E..PLATSF.......--------------------
O17983_CAEEL/6-146--------------------------------------------D..C.PPSF.......--------------------
PALF_YEAST/39-201--------------------------------------------GRGM.LSSI.......--------------------
ARRB1_BOVIN/18-174--------------------------------------------N..L.PCSVTLQPGPE--------------------
Q8SYU5_DROME/5-157--------------------------------------------H..C.PSSF.......--------------------
O17981_CAEEL/6-159--------------------------------------------N..V.PPSF.......--------------------
Q9XXI4_CAEEL/4-156--------------------------------------------N..C.APSF.......--------------------
O17984_CAEEL/4-157--------------------------------------------S..VLPPSF.......--------------------
F6SKI7_XENTR/21-176--------------------------------------------Y..L.PCSVSLQPAPT--------------------
Q9VI53_DROME/6-155--------------------------------------------N..L.PSSF.......--------------------
H2L9D1_ORYLA/14-171--------------------------------------------N..L.PCSVSLQPGPD--------------------
ARRB_CAEEL/22-186--------------------------------------------K..S.ASSVTLQPAPG--------------------
Q9XXI0_CAEEL/6-159--------------------------------------------N..L.PPSF.......--------------------
Q23672_CAEEL/8-142--------------------------------------------D..C.PPTH.......--------------------
ARRD2_MOUSE/9-158--------------------------------------------S..L.VTSF.......--------------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------T--ELTATAVLPNVVY--------------------
C5GL98_AJEDR/142-318--------------------------------------------T--NLVGRATLPSVVH--------------------
YNSK_SCHPO/63-242--------------------------------------------T--NLVANITLPSTLH--------------------
C5DVA9_ZYGRC/141-332--------------------------------------------T--ELTATAVLPNVVY--------------------
E7KUR3_YEASL/144-346--------------------------------------------T--ELTAAAVLPNVVY--------------------

PF02752

Q7PUI7_ANOGA/236-407EGALFSSNSA................DPSSSAYNSKLATSAPRGM--LSAPATS...AEE....................
Q9TYQ0_CAEEL/174-315.............................................--..PNLPP...TSI....................
Q7PUR5_ANOGA/187-319.............................................--..STVPS...DEE....................
Q7PYD9_ANOGA/175-306.............................................--...TVIP...TCG....................
Q380N5_ANOGA/183-323.............................................--...PVPS...TET....................
CRED_ASPOR/181-332.............................................--..KTLTRCLQDT.....................
Q752Z4_ASHGO/228-382.............................................--..PDLKRITQDCD....................
ARRD5_HUMAN/184-321.............................................--...LLLSV.SSST....................
ARRD4_HUMAN/191-318.............................................--...PVTP...SIL....................
Q294M9_DROPS/171-302.............................................--...STPP...TCV....................
Q6BI98_DEBHA/278-420.............................................--SLKELTQ...TCD....................
Q294M7_DROPS/174-306.............................................--...ATPP...TCF....................
Q6BIN4_DEBHA/247-390.............................................--..DSLSKCTQDCD....................
Q293Z7_DROPS/175-308.............................................--..EGAQP...TDD....................
Q9I7K7_DROME/179-320.............................................--...QTAA...TLT....................
A5DM18_PICGU/246-387.............................................--..ESLSKLTQSCE....................
Q294M5_DROPS/171-304.............................................--...SVPP...SSR....................
Q16ZK0_AEDAE/170-299.............................................--...SIAP...TG.....................
A0BIT0_PARTE/173-314...........................................PT--KASAIFP...QSS....................
Q4V467_DROME/125-256.............................................--...STPP...SCF....................
Q7SC90_NEUCR/193-351.......................................DGIVKR--GKPGFPMYEVTSF....................
Q66L50_DANRE/187-314.............................................--...PISP...SIL....................
Q95NF3_ANOGA/193-351....................................IALDGQIKR--QDQCLAS...TTLL...................
Q6C993_YARLI/185-326.............................................--..PSLSKVTQDAE....................
O44847_CAEEL/147-273.............................................--..TDLTA...SF.....................
A0CWE9_PARTE/173-316...........................................PD--NYTSIFP...QST....................
Q23QU8_TETTS/188-318.............................................--..GNVTL...SC.....................
Q6ZM71_DANRE/162-286.............................................--...ALPH...SSL....................
A8WP41_CAEBR/178-317.............................................--...AIVP...SF.....................
Q0E8K8_DROME/169-299.............................................--...PLPP...TNL....................
A0C0J3_PARTE/194-337...........................................AG--RHKPLDP...TT.....................
Q16ZJ7_AEDAE/171-300.............................................--...SVAP...TG.....................
Q23YG0_TETTS/188-318.............................................--..GDVTL...SS.....................
Q9W7R1_ORYLA/193-351....................................IALDGKLKH--EDTNLAS...SSVV...................
ARRB_CAEEL/205-363....................................LALDGQLKH--EDTNLAS...STIL...................
Q7RZE0_NEUCR/198-350.............................................--..RTLGKCVQDV.....................
ALY2_SCHPO/345-506.............................................--..TCLVKERDRLT....................
Q5AM66_CANAL/305-457.............................................--..SSLSKCTQDVD....................
ARRB2_MOUSE/195-350....................................LALDGQLKH--EDTNLAS...STIV...................
A2BIP7_DANRE/186-313.............................................--...PSLT...ASI....................
ARRD1_HUMAN/162-286.............................................--...ALPQ...SAL....................
A2QR01_ASPNC/439-613.............................................--.CQEMRNRDESQRL...................
Q380P6_ANOGA/182-314.............................................--...AVPP...TYT....................
YC9F_SCHPO/183-325.............................................--..DSLGECTQDC.....................
Q16H74_AEDAE/171-301.............................................--...PEPP...SR.....................
Q6DH07_DANRE/192-355....................................LALDGRLKD--EDTNLAS...TTII...................
A8X4Z9_CAEBR/175-315.............................................--...KLAP...SF.....................
ART1_SCHPO/287-428.............................................--DFEDANITGFTT.....................
ARRD2_HUMAN/180-307.............................................--...PVGP...SIL....................
Q294M6_DROPS/179-311.............................................--...ATAP...TCE....................
ADCC_DICDI/344-478.............................................--..........STTQC..................
Q6CS19_KLULA/219-373.............................................--..PNLSKCVQDCL....................
Q2UDU8_ASPOR/60-215.............................................--..QDLAA...CTQ....................
Q22NR4_TETTS/187-325.............................................--DPKLILP...SY.....................
ROD1_YEAST/232-395.............................................--..ASLTKCSQDCR....................
A0CL31_PARTE/172-315.............................................--..QHLTP...SI.....................
APYA_EMENI/180-326.............................................--..QALGHCVQDT.....................
Q296V0_DROPS/178-310.............................................--...ALPP...TNL....................
Q6CW08_KLULA/282-443.............................................--..DDLKRATQDCD....................
A8WP33_CAEBR/159-305.............................................--..AEATT...PSF....................
A0DYQ7_PARTE/173-314...........................................PR--NPTSIFP...QSS....................
A0D2Y0_PARTE/206-342.............................................--..KNLKA...SV.....................
A7TQI8_VANPO/357-526.............................................--..NTFAN...KQAL...................
Q17EA7_AEDAE/182-314.............................................--...PGIP...SDD....................
Q9W2V2_DROME/420-633....................................LEDTLQRST--EPEEITGAIAASAIRSPHFVMQNAQLLGGCGHP
Q240M9_TETTS/188-318.............................................--..SDIPL...SS.....................
A5DUN4_LODEL/264-404.............................................--..ASLSKCCQDV.....................
A0NDX6_ANOGA/173-303.............................................--...PEPP...TR.....................
Q16ZJ5_AEDAE/174-305.............................................--...PLPP...TSK....................
Q7QCL7_ANOGA/170-301.............................................--...PLPP...TNL....................
A2QTZ8_ASPNC/184-328.............................................--..NDPKECLQSL.....................
O17983_CAEEL/173-318.............................................--...AVVS...TIR....................
Q9V393_DROME/233-393....................................LALDGQLKH--EDTNLAS...STLI...................
A0BMC5_PARTE/210-346.............................................--..KSLRA...TI.....................
A1C8U8_ASPCL/140-283.............................................--..RNRRKCRQSH.....................
A0D004_PARTE/178-324.............................................--..........ST.....................
Q16ZK1_AEDAE/136-269.............................................--...QTPV...TST....................
Q17EA8_AEDAE/183-323.............................................--...PITP...TED....................
Q16ZJ8_AEDAE/186-315.............................................--...ATAP...TG.....................
PALF_ASHGO/233-368.............................................--..LDAFP...TLV....................
ARRS_MOUSE/200-361....................................IALDGKIKH--EDTNLAS...STII...................
A8WP37_CAEBR/170-319.............................................--..RGIPA...TF.....................
Q9GYT5_CAEEL/181-328.............................................--...SVTP...TIN....................
MU170_SCHPO/266-426.............................................--...EFCR...SVN....................
A5DW17_LODEL/261-403.............................................--..ENLKQITQSCE....................
A0D012_PARTE/172-315.............................................--.QIVLTP...ST.....................
ADCA_DICDI/313-441.............................................--..VDLKP...SSS....................
Q9I7L0_DROME/174-307.............................................--...ATPP...TCF....................
A7SF55_NEMVE/129-256.............................................--...DVVP...TMR....................
Q16ZK2_AEDAE/273-408.............................................--...WVQP...TSR....................
A8XYD8_CAEBR/172-316.............................................--...PVVA...TIR....................
A0E996_PARTE/174-317.............................................--..KSIFP...QST....................
Q0U5A6_PHANO/182-337.............................................--..KSLKNCRQSV.....................
PALF_YEAST/259-394.............................................--..LDAFS...TLT....................
Q23672_CAEEL/163-311.............................................--..EEAKT...PSF....................
A7TPY5_VANPO/228-381.............................................--..ASLSKCTQDCS....................
Q759V0_ASHGO/221-368.............................................--..PSLSKCCQDCT....................
Q9VGU7_DROME/180-316.............................................--...PTTP...STQ....................
Q6FM62_CANGA/224-379.............................................--..PDLMKCSPDCF....................
A7SKJ5_NEMVE/177-307.............................................--...PLPP...TMS....................
Q6CGL3_YARLI/174-329.......................................DSIVAK--ERQDVPTIAMSGF....................
ARRD5_MOUSE/170-307.............................................--...LVLSV.SSGS....................
Q17624_CAEEL/176-340...................................DPSKIEHILS--PYGKLLESPSTAT....................
A0D9C9_PARTE/194-337...........................................QG--RNQPLDP...TT.....................
A0CE97_PARTE/209-345.............................................--..KELKA...SL.....................
Q7PYE1_ANOGA/178-310.............................................--...PLPP...SNL....................
Q16ZJ6_AEDAE/174-302.............................................--...SLPP...SS.....................
A7SL06_NEMVE/167-299.............................................--...QLRP...TS.....................
O45782_CAEEL/179-307.............................................--...SLPP...KLG....................
Q17HB8_AEDAE/169-300.............................................--...PLPP...TNL....................
ADCB_DICDI/337-465.............................................--..QTLLN...SIY....................
Q23FQ6_TETTS/188-318.............................................--..SNVLL...SS.....................
Q294M3_DROPS/163-297.............................................--..MDTPR...STL....................
A8WP43_CAEBR/183-324.............................................--..NPLIP...SF.....................
A3LXL3_PICST/266-408.............................................--..ENLARITQSCV....................
O17981_CAEEL/182-333.............................................--...SVTP...TIC....................
Q16ZK3_AEDAE/167-301.............................................--...WVLP...SSC....................
A8X383_CAEBR/164-301.............................................--..DAAPP...TQNY...................
Q20232_CAEEL/173-309.............................................--...VVPP...TLV....................
A0BCE6_PARTE/199-335.............................................--..NDLAA...TV.....................
Q5AP77_CANAL/170-448TSAIEEEGSDSPHTSRRGSAVSMTDNNTTPSNNNPLSPFLGAVET--NGASI.....NEIGD..................
A0BDM3_PARTE/168-302............................................H--NRMELST..........................
Q23674_CAEEL/182-339.............................................--...PLPP...STK....................
ARRD5_BOVIN/171-309.............................................--...PVLSVSGSGS....................
YA4C_SCHPO/180-322.............................................--..SSLVECLQDC.....................
Q294M1_DROPS/173-305.............................................--...SIPP...TSV....................
A0A0D1DR37_USTMA/181-316.............................................--..RTHTL...MTI....................
A7TDW3_VANPO/229-389.............................................--..ASLSKCTQDCN....................
Q6FY06_CANGA/237-406.............................................--..PNLLACVQDCT....................
A6R1F7_AJECN/559-759.............................................--.CAELKKRDPIRSL...................
Q9XXC4_CAEEL/159-308.............................................--..NGLPP...TF.....................
A7TQH7_VANPO/294-447.............................................--..DDLKKATQDCD....................
Q16ID9_AEDAE/216-390RTEPQL.......................SGRDELATELPGRWSR--NMVDGKYRIADPS....................
PALF_KLULA/263-398.............................................--..LDTFP...SLD....................
Q6CG62_YARLI/321-486.............................................--...EKVGRDKKERL...................
A0A0D1E8U6_USTMA/601-804.............................................--.ACGTTRINLSTN....................
Q9XTU0_CAEEL/176-327.............................................--...CTCP...TF.....................
YOA5_SCHPO/223-379.............................................--...DKEA...TIT....................
Q0CQZ7_ASPTN/118-273.............................................--..GTLDT...VTQ....................
E7LU16_YEASV/179-340.............................................--..NSLSNCVQDCD....................
F1QAH2_DANRE/171-293.............................................--..PEIS....STI....................
F6SKI7_XENTR/196-355....................................IALDGKLKH--EDTNLAS...STLL...................
F6Y0E4_XENTR/163-285.............................................--...ALPQ...SIL....................
G4VCF9_SCHMA/96-254....................................LALDGKLKH--EDTNLAS...STII...................
H2N0W5_ORYLA/194-351....................................IALDGRLKH--EDTNLAS...SSIV...................
H3CCN8_TETNG/163-285.............................................--...PLPQ...SAL....................
H3DDA7_TETNG/203-325.............................................--..MELPS...SIF....................
ART5_YEAST/332-474.............................................--..DNLKQITQDCC....................
Q08CX7_XENTR/182-306.............................................--...PLGP...SIL....................
TXNIP_MOUSE/176-299.............................................--...KIRP...SIL....................
Q9VI00_DROME/172-303.............................................--...AVPP...SSR....................

PF07070

E3E849_PAEPS/4-211-------------VT......HAKQ..PVWLETALDIGMAL.DPTDRDSLKIEPHPYMST--------------------
Q9F2L5_STRCO/29-244-------------ATELYGRQL.GV..VLGVRTELAVAGAR.DSGDPDPFAVAPLPAQEA--------------------
B7VMX8_VIBTL/6-222-------------VT......IGDS..KVWLETGLDIAMAI.DPSDKDTLTVRPDPLLDG--------------------
Q87KC8_VIBPA/6-222-------------VT......IGDA..KVWLETGLDVAMAL.DPTDKDILTVRPDPLMDA--------------------
D2SH36_GEOOG/3-216-------------VTAIDGWQLRGM..RVGLRTRLDIAGSV.DPGDLDPVTVLPLPVQRT--------------------
U5VQ01_9ACTN/3-218-------------ITAVHGQHLRGM..TMGVRTEVSIARAI.DKGDLDPVSVHPLPIQER--------------------
A9B5Z7_HERA2/2-209-------------LT......MGHQ..PVFIRTGLSISGGV.DAGDVDQLQIQPHPSQAT--------------------
Q8CK18_STRCO/3-217-------------ITMIDGQALRGM..NIGVTTELEIARAV.DSGDLDAINVHPLPAQKA--------------------
A1S9J4_SHEAM/2-218-------------FTA...LPVRNNQCHVWLQTGADIDSAI.DPTDADVIDILPTPLLGH--------------------
F8AWR6_FRADG/3-216-------------ITDVGGWHLRGM..KIGVKTTVDIPGAI.DPGDLDPVSVRPLPVQEA--------------------
D5XEE5_THEPJ/2-202-------------IS......KGRT..RYYLKTGLDIEQAL.DPTDLDDIKILPNKYMKM--------------------
F6CIG7_DESK7/3-202-------------IS......RGRT..RYFLQTGLDIPQAI.DPVDHDPIQIVPNREFKM--------------------
E8U7T1_DEIML/4-201-------------IS......APGV..RLWLHTDADIAGAS.DPGDEDSVRILPNAPTQA--------------------
D9SYU9_MICAI/3-218-------------LTDLYGQHLHGM..TMGLRTELEVARAM.DKGDLDPVAVHPLPAHER--------------------
SP0M_BACSU/4-212-------------IT......VGKV..EVAVVTDLDIQGGI.DKSDHDRIFVEAHPWIEN--------------------
D6Y483_THEBD/3-219-------------ITEVDGQHLTGM..AVGVRTELAIAKAV.DKGDLDPIAVMPLPSQRA--------------------
D7B3X5_NOCDD/3-216-------------LTEAGGSPLPGV..LAGLRTEVIVDGDA.DKGDLDRVHVHPLPIQDR--------------------
A6W415_KINRD/4-215-------------ITAISGWHLRGV..HVGVATRLVIAGAV.DPGDLDGLTVAPLPVQQA--------------------
A5D298_PELTS/2-203-------------IS......KGRS..KYYFITGLDIKSAV.DPKDQDEIVVLPNTYMQM--------------------
Q7MGK0_VIBVY/6-223-------------IT......IGDA..KVWLETGLDIALAI.DPTDKDILTVRPDPMMDG--------------------
I0JR17_HALH3/2-206-------------AS......LGRL..PLWFETGLDIPMAL.DPEDRDPIKVSPHPYIEK--------------------
L0A4L1_DEIPD/4-200-------------LS......LRGT..RVGVQTGVSVRLAV.DLNDHDLLEVQPSAPVQT--------------------
C1D0Z4_DEIDV/4-201-------------LS......LPGS..DVWVFTDADIAGGV.DPGDQDPLRVLPSAGMEA--------------------
Q8YPP0_NOSS1/22-229-------------LT......FGHI..PVYVRTGLDIKSAI.NPRDRDYLEVRTHPLMQR--------------------
R4LYD7_9ACTN/3-214-------------LTHAHGKHLPGM..SLGLRTEVTTEEHV.DCGDVDIIAIHPLPLQEL--------------------
C6WBH8_ACTMD/3-218-------------LTVVHGRHLHGM..TMGLRTELDVRGAI.DPGDLDPFAVHPLPSQEH--------------------
R4SZZ1_AMYOR/2-217-------------ISAVGGRELPGM..VVGVRTELVIAGAP.DKGDLDPVLVGPLESQDR--------------------
Q3IE37_PSEHT/2-218-------------ITE...INAGYNQSYVWLETGLDIDLAL.DPSDKDHLHVYPNEAVKT--------------------
E4N440_KITSK/3-218-------------LTVVDGHHLSGM..ALGVRTDVDIAGQL.DRGDTDPLAVQPLPVQQR--------------------
D3Q3X8_STANL/19-229-------------ISTVGGLVLPGL..ELGVATALQLEGGV.DKGDLDDLRVEPLPGHVA--------------------
G2NX38_STRVO/3-217-------------LTELSGQPL.GV..VLGFRIELASAGAK.DHSDPEELIVRPLPVQEA--------------------
E2Q1G0_STRC2/1-209-------------VTELYGQAL.GI..VLGVRTEMAVAGAK.DKGDLDPLTVRPLPVQEA--------------------
U5W7Z2_9ACTN/3-218-------------ITEVYGQHLHGM..TMGLRTELEVARAV.DKGDLDAVAVHPLPAQER--------------------
D4GQ21_HALVD/1-207-------------VT......LGNV..DVWVETELDIELAV.DPEDKDYLNVQPTPRLQA--------------------
C4L3D6_EXISA/2-213-------------LS......VSQS..KSWIETGLDIAQAV.DPKDEDAITVQPNAAQQV--------------------
L0JQI9_NATP1/1-204-------------VT......SDRT..DVWLDTGLDIDWAV.DPDDRDPIEIEPDPLRET--------------------
U5LEI3_9BACI/4-214-------------LT......LGRT..KVWISTGLDIKNAV.DPGDKDYISIKPNRLMDG--------------------
B7GKU0_ANOFW/25-235-------------IT......VGRT..RVWLHTGLDIKNAV.DPTDEDYIRVQPNRMMNE--------------------
C5D3Y3_GEOSW/2-199-------------IT......RPSV..GYTFVTRLDIADGV.DAFDQDAIRILPPLSLEK--------------------
H2K613_STRHJ/3-217-------------VTELRGQPL.GI..VLGVRTEVAVAGAR.DKGDLDPLAVRPLPVQEA--------------------
Q9KVV0_VIBCH/21-237-------------VT......IGDA..KVWLETGLDIALAL.DPTDKDILTVRPEPMMDG--------------------
Q2J8X7_FRASC/3-216-------------ITDIGGWHLHGM..KIGVRTKLAIPGAV.DPGDLDAVNVHPLPVQEA--------------------
D9STE5_CLOC7/4-212-------------VS......MSRR..NVWVETELEIPLAL.DPEDRDYIDVRPSRVMDV--------------------
Q81QV7_BACAN/2-213-------------LT......LGMK..TVWIHTGLDIKRSI.DPSDRDYIQVLPNALLNS--------------------
X5A5U4_9BACL/4-211-------------VS......YRNT..PVWLMTGLDIKMAL.DPSDHDYLEVLPSDNMQV--------------------
D2B8E4_STRRD/3-215-------------ISAIGGHPLRGM..QLGVSTELALAGAL.DKGDLDPLFVNPLPAQDH--------------------
F2EZY3_SOLSS/4-214-------------VT......TGNS..RVWIQTGLDIKNAV.DPKDKDFIEIQPTRLANG--------------------
Q5V309_HALMA/3-209-------------VT......TRST..AVEIETGLDISMAV.DPGDEDYIEVEPTHRTQA--------------------
Q6LLI7_PHOPR/4-219-------------VT......IGDA..KVWLETYLDIPLAR.DPKDTDTLTVRPEPLMDG--------------------
E4NWJ2_HALBP/1-207-------------LT......LGST..EVWVETELEIDMAV.DPEDVDYLDVQPTPRMQA--------------------
E1SSB8_FERBD/2-218-------------ITA...LRCTRGFSEVWLETGLDIAQGL.DGRDHDPLRIAPTAAMSQ--------------------
D7AXU0_NOCDD/3-217-------------VTVHRGRHLHRM..NVGVNTRLHVAGAV.DPGDLDPVAVEPLPSQLA--------------------
F4FG08_VERMA/3-218-------------ITDVYGQRLRGM..TMGLRTELSIARAV.DKGDLDQVSVHPLPVHER--------------------
D3EJD4_GEOS4/4-211-------------LT......ISRQ..PVWIHTGLDIDNAI.DPKDRDFIDVEPNEDASI--------------------
I0H7C6_ACTM4/3-218-------------ITTVYGQTLRGM..VMGVRTEVAIARAV.DKGDLDAVHVHPLPIQQK--------------------
B1VNV5_STRGG/3-217-------------ITELHGQHL.GP..VLGIRTELEIAGAR.DKGDLDALAVGPLPAQEA--------------------
H8MVT2_CORCM/3-210-------------IT......ERGT..PVWIKTALDIDNAL.NPEDSDRIHVLPHPSLQT--------------------
H8GZW1_DEIGI/5-201-------------LS......LPGS..EVWLVTDADIEGAA.DPGDTDGVWIRPSEDMET--------------------
Q5L337_GEOKA/2-211-------------VT......LGSS..RVWLQTGLDIKMAL.DPQDRDHLAIEPHPLVAA--------------------
C0ZHJ0_BREBN/2-209-------------LT......MGRQ..PVYLRTGLDIKNAI.DPGDSDFIEVRPHPLMTK--------------------
H2JK05_STRHJ/3-217-------------VTELHGQPL.GI..VLGVRTELAVSGAK.DKGDLDQLAVRPLPAQEA--------------------
Q8EMA6_OCEIH/2-211-------------LT......VRDK..NVWIDTGLDIKKAV.DPGDIDYIQVNPSLIVGA--------------------
F0LQ35_VIBFN/4-220-------------VT......IGDA..KVWLETGLDIAMAI.DPADKDMLTVRPDPFMDG--------------------
Q5L3I0_GEOKA/3-199-------------IS......RPTV..RYTFVTRLDIADGA.DAYDQDAIHILPPTALEQ--------------------
E1V3I8_HALED/2-214-------------LS......VGRQHPKTWVATRADIAMAL.DPRDKDPLRILPGPVQRA--------------------
R4SRA3_AMYOR/2-218-------------ISSVFGKPLNGM..AVGLQTSLDIANSVTDPVDVDAAAIEPLPAQKR--------------------
G2NQ97_STREK/3-217-------------ITELYGQDL.GI..VLGVRTELAVAGAR.DKGDLDRLSVAPLPAQEA--------------------
C7MVV3_SACVD/2-217-------------ITAVGDRVLPGM..TVGVCTDLVIAGAP.DKGDLDPVYVHPLPSQNA--------------------
Q47QI1_THEFY/3-218-------------ITAAGGGPLPGA..RVGLRTDVAIAHAV.DKGDLDPVLIHPLPVQDR--------------------
B1YLT3_EXIS2/2-212-------------LS......VSQS..KSWIETGLDIAQAV.DPSDHDAVVVKANDYQSV--------------------
D2RPW6_HALTV/1-204-------------VT......MGKT..EVWLDTGLDIDWAV.DPDDTDPVEIEPDPLRRT--------------------
D1A596_THECD/3-218-------------ITEVYGQHLHGM..AMGVRTELAVAKAV.DKGDLDPVSIVPLPSQER--------------------
D2ASM7_STRRD/3-218-------------LTEVQGQPLNGM..AMGVRTELAIAKAV.DKGDLDPFSVAALPSQEA--------------------
N0B2E1_9BACI/13-223-------------IS......LGKT..QIWVATGLDIKNAV.DPSDKDFLKVIPDSLTQT--------------------
H6NE63_9BACL/4-211-------------IS......LRGA..NVWIETGLDIANAV.DPTDRDHIEIVPYGHMQT--------------------
K0K0P9_SACES/2-217-------------ITAVGGHPLPGM..TVGVRTELVISGAP.DKGDLDPVVVSPLPSQDR--------------------
Q5E1Q2_VIBF1/4-219-------------IT......IGDA..KVWVQTGLDISLGL.DPTDKDPITVRPDDLFDG--------------------
I7BQH2_NATSJ/1-201-------------VT......MGTT..SVWLDTGLDIDWAV.DPDDRDALEIEPDPLRRA--------------------
K0JWS7_SACES/3-218-------------LTVVHGTPLHGM..TMGLRTELEVRGAV.DPGDLDPVAVHPIRSQEH--------------------
V6K362_STRNV/3-217-------------VNQLHGEPL.GI..HLGVRTEVDVAGAK.DKGDFDPFAVRPLPVQEA--------------------
A4FGU2_SACEN/3-218-------------VTEFYGRHLHGM..TLGVRTELSVAKAV.DKGDLDPVSVHPLPAQER--------------------
Q5YZ34_NOCFA/2-216-------------ITFYNGRHLPGT..TVALRTIVEIRGAT.DAADTDPIGVGALPAQHV--------------------
D9T8R1_MICAI/3-218-------------VTDLYGQNLHDM..TMGLRTEVAIRGAI.DKGDLDPVYVHPLPVQER--------------------
C6CSI9_PAESJ/5-212-------------LT......IGRA..PVWVKTELEVRGGV.DPGDNDRIDVLPTSAINT--------------------
D1A1F2_THECD/3-218-------------LTHMYGQPLHGT..TVGVATELEVARAV.DATDLDPIAVHPLPAQER--------------------
G0G8W7_AMYMS/2-215-------------VTSVYAKPLAGM..AVGVRAELDLAAAVSDPFDADAVAIEPLPAQKR--------------------
U5W8Q8_9ACTN/3-214-------------ITHLAGKPLSGM..TMGVRTELSVAKAV.DKGDLDEVAIHPLPVQEK--------------------

PF04425

A3GGA7_PICST/92-585NRGQSIQMNKALGYGFLNIRGTPLL.............TKDYSFEDVSVSYTIEAKFIDR--------------------
A5DRA9_PICGU/36-464KYSSKQMQTMR...........................VRDLSFVDTSISYGVMTRIIGR--------------------
Q6BJG5_DEBHA/93-577NRGGTIVLNKALGYGFLNVRGTPLL.............TKDYSFDNISVSYTIEAKFIDK--------------------
A5DPQ0_PICGU/115-602HRGENVSLNKALGYGYLDIRGTPLL.............TRDYSFDDISVSYAIEAKFIDK--------------------
Q6BSG0_DEBHA/5-422PSSLLVSNNGQ...........................IKDFSILDTSISYSVNARVIGK--------------------
Q6BVD1_DEBHA/28-455VNLTYKPDATK...........................TKSLSFIDTSISYGVQARFIGR--------------------
Q5ABB5_CANAL/19-455SSLRHKWKDQQ........NGAP..EETASKKYKYASLTNDFAFNDTSISYCVSARVIGR--------------------
Q75E04_ASHGO/51-474GKYATIQTNPLLGYGHLGTKGSPIL.............TNDLVSDTVSINYAVDAKIVGK--------------------
BUL1_YEAST/108-543CKYSGIKVNRVLGCGHLGTKGSPIL.............TNDMSDDNLSINYTIDARIVGK--------------------
A5E3Q9_LODEL/66-535NRGEGIVINKALGYGSLNLRGTPIL.............TKDYSFEDMSVSYAVEAKIIDN--------------------
A3LX53_PICST/9-457TSLRQKYKESD........LESSLSEEDAHRGKCYASLTNDMFFSSASIDFSVSARIIGR--------------------
Q6FUH4_CANGA/102-545CKYSVIKVNHVLGCGHLGTKGSPIL.............TYDMVDDHLSINYTIDARIVGK--------------------
Q6CSE2_KLULA/69-505ARYSNIKLNSMLGYGHLGTKGSPIL.............TNDLCSDNLSVSYTIDARVVGK--------------------
Q6FP46_CANGA/103-568GKYSIIKVNNVLGCGHLGTKGSPIL.............TNDITDENLSINYTIDAKIVGK--------------------
Q5AN22_CANAL/97-598NRGEAIQLNKALGYGFLNVRGTPML.............TKDYSFDDLSISYTIEAKFIDR--------------------
A7TIV7_VANPO/87-537GRYSGIKVNSVLGCGHLGIKGSPIL.............TYDLIDENLSINYTIDARIVGK--------------------
E7KSA7_YEASL/88-524CKYSGIKVNSVLGCGHLGTKGSPIL.............TLDMADDNLSINYTIDAKIVGK--------------------
G0VB73_NAUCC/105-559GKYSQIKVNSVLGCGHLGVKGSPIL.............TSDLCDEDVSINYTIDARIVGK--------------------
G0VC27_NAUCC/80-515CVYSGIEVNNVLGFGHIGTKGSPIL.............TYDMAGESVSVNYSVDARIVGS--------------------
G0VC28_NAUCC/152-590CKYSGIKVNNVLGSGHLGTKGSPIL.............TYDMVDDNLSVNYTVDTRVVGK--------------------

PF03643

VPS26_DICDI/8-284-----------------------------------IEFEYNK-SKY....HLKDV.......IIGKIYFLLVR...IKIK
VP26A_HUMAN/8-283-----------------------------------IEFEYNK-SKY....HLKDV.......IVGKIYFLLVR...IKIQ
PEP8_YEAST/5-364-----------------------------------IEFEYAK-SQY....SLKEV.......IVGRIYFLLTR...LRIK
VP26A_ARATH/8-283-----------------------------------IEFEYNK-SKY....HLKDV.......ILGKIYFLLVR...IKIK
VPS26_SCHPO/5-279-----------------------------------IEFEYSK-NKY....HLKDV.......IIGKIYFILVR...IKVQ
VPS26_DROME/6-280-----------------------------------IEFEYNK-SKY....HLRDT.......IIGKIYFLLVR...IKIK
VPS26_CAEEL/7-282-----------------------------------IEFEYNK-NKY....HLQDV.......IVGKIYFLLVR...IKIK
DSCR3_MOUSE/1-283-----------------------------------.....SL-PKFFIRGHLNSTNCAITQPLTGE...LVVEHSDAAIR

PF00339

B4LEM0_DROVI/17-172-----------------------------------DLGKPLG-VEY----------------------------------
ARRS_BOVIN/22-180-----------------------------------DVGKSCG-VDF----------------------------------
O76685_CAEEL/6-159-----------------------------------.EGKYGY-LRY----------------------------------
Q9I7L0_DROME/5-150-----------------------------------.EGSHGR-VRY----------------------------------
H2N0W5_ORYLA/17-173-----------------------------------DEGKKCA-VEF----------------------------------
Q23674_CAEEL/4-159-----------------------------------.EGDLGF-IRY----------------------------------
O45782_CAEEL/7-155-----------------------------------.EGEFGH-IRY----------------------------------
H2RRP6_TAKRU/18-174-----------------------------------DTGKACG-VDF----------------------------------
Q9VGU7_DROME/5-155-----------------------------------.NGAHGQ-IKH----------------------------------
Q20577_CAEEL/7-158-----------------------------------.EGFHGH-VRY----------------------------------
P91469_CAEEL/7-159-----------------------------------.EGKYGY-LRY----------------------------------
Q9VI00_DROME/5-148-----------------------------------.VAQYGK-IFY----------------------------------
Q20232_CAEEL/7-150-----------------------------------.ESRHCT-IRY----------------------------------
ARRD4_MOUSE/18-166-----------------------------------.TGKYGS-IQY----------------------------------
O17983_CAEEL/6-146-----------------------------------.EGKYGF-IRY----------------------------------
PALF_YEAST/39-201-----------------------------------.KFERGS-ITY----------------------------------
ARRB1_BOVIN/18-174-----------------------------------DTGKACG-VDY----------------------------------
Q8SYU5_DROME/5-157-----------------------------------.EGAYGH-IRY----------------------------------
O17981_CAEEL/6-159-----------------------------------.EGKYGY-LRY----------------------------------
Q9XXI4_CAEEL/4-156-----------------------------------.EGCHGH-IRY----------------------------------
O17984_CAEEL/4-157-----------------------------------.EGNNGN-IRY----------------------------------
F6SKI7_XENTR/21-176-----------------------------------DVGKACG-VDF----------------------------------
Q9VI53_DROME/6-155-----------------------------------.EGEFGH-VRY----------------------------------
H2L9D1_ORYLA/14-171-----------------------------------DKGKACG-VDF----------------------------------
ARRB_CAEEL/22-186-----------------------------------DTGKPCG-VDY----------------------------------
Q9XXI0_CAEEL/6-159-----------------------------------.EGTHGN-VRY----------------------------------
Q23672_CAEEL/8-142-----------------------------------.EGYAGG-TNY----------------------------------
ARRD2_MOUSE/9-158-----------------------------------.EGKHGS-VRY----------------------------------

PF13002

A7TSP7_VANPO/130-321-----------------------------------PKSSF----------------------------------------
C5GL98_AJEDR/142-318-----------------------------------PIGNF----------------------------------------
YNSK_SCHPO/63-242-----------------------------------PHGAA----------------------------------------
C5DVA9_ZYGRC/141-332-----------------------------------PKSTF----------------------------------------
E7KUR3_YEASL/144-346-----------------------------------PKSTF----------------------------------------

PF02752

Q7PUI7_ANOGA/236-407...................................KNVFAIY-VSY----------------------------------
Q9TYQ0_CAEEL/174-315...................................HANRLVT-VSY----------------------------------
Q7PUR5_ANOGA/187-319....................................RCRIIM-TRY----------------------------------
Q7PYD9_ANOGA/175-306....................................DQNLIS-VAY----------------------------------
Q380N5_ANOGA/183-323...................................THSRIVA-VEY----------------------------------
CRED_ASPOR/181-332....................................DTKGIK-VRH----------------------------------
Q752Z4_ASHGO/228-382...................................VGASLIR-VRH----------------------------------
ARRD5_HUMAN/184-321...................................QDGEIMH-TRY----------------------------------
ARRD4_HUMAN/191-318....................................DCCIIR-VDY----------------------------------
Q294M9_DROPS/171-302...................................ELSNLIQ-IAY----------------------------------
Q6BI98_DEBHA/278-420...................................LKNNIIQ-VKH----------------------------------
Q294M7_DROPS/174-306...................................NLCSIIQ-IAY----------------------------------
Q6BIN4_DEBHA/247-390....................................IQNFIK-VRH----------------------------------
Q293Z7_DROPS/175-308...................................QLSGVIT-IVY----------------------------------
Q9I7K7_DROME/179-320............V......................AGCACLQ-LNY----------------------------------
A5DM18_PICGU/246-387...................................PKSGAIS-VKH----------------------------------
Q294M5_DROPS/171-304....................................TDSIIT-VSY----------------------------------
Q16ZK0_AEDAE/170-299....................................NCSVLT-IDY----------------------------------
A0BIT0_PARTE/173-314...................................LKTKRII-FQY----------------------------------
Q4V467_DROME/125-256...................................HLCRIIK-IGY----------------------------------
Q7SC90_NEUCR/193-351............T......................TSSTLYK-IEF----------------------------------
Q66L50_DANRE/187-314....................................DCSIIH-VEY----------------------------------
Q95NF3_ANOGA/193-351.........AQ.PD....................QRDAFGVI-ISY----------------------------------
Q6C993_YARLI/185-326....................................VPNLIK-VTH----------------------------------
O44847_CAEEL/147-273....................................HTCGSS-LKY----------------------------------
A0CWE9_PARTE/173-316...................................IKTKRVS-YQY----------------------------------
Q23QU8_TETTS/188-318....................................QGSLIQ-VNY----------------------------------
Q6ZM71_DANRE/162-286...................................SDGNLIQ-ICY----------------------------------
A8WP41_CAEBR/178-317....................................TCPIID-VDY----------------------------------
Q0E8K8_DROME/169-299...................................HGCHLIK-ISY----------------------------------
A0C0J3_PARTE/194-337....................................NGKIVQ-NNY----------------------------------
Q16ZJ7_AEDAE/171-300....................................KCSVLV-IDY----------------------------------
Q23YG0_TETTS/188-318....................................QGQMIQ-VQY----------------------------------
Q9W7R1_ORYLA/193-351.........KE.GV....................LKEVMGIM-VSY----------------------------------
ARRB_CAEEL/205-363.........DS.KT....................SKESLGIV-VQY----------------------------------
Q7RZE0_NEUCR/198-350....................................NAHGIK-VRH----------------------------------
ALY2_SCHPO/345-506..........F.D......................TTYKYIK-VRH----------------------------------
Q5AM66_CANAL/305-457....................................LSTNVR-VRH----------------------------------
ARRB2_MOUSE/195-350.........KE.GA....................NKEVLGIL-VSY----------------------------------
A2BIP7_DANRE/186-313...................................LNCRILK-VEY----------------------------------
ARRD1_HUMAN/162-286...................................PGCSLIH-IDY----------------------------------
A2QR01_ASPNC/439-613..........H.F.....................DTTYENIQ-INH----------------------------------
Q380P6_ANOGA/182-314...................................DGAPLFS-VNY----------------------------------
YC9F_SCHPO/183-325....................................DLNCIR-VHH----------------------------------
Q16H74_AEDAE/171-301....................................TTSIIQ-IEY----------------------------------
Q6DH07_DANRE/192-355.........RT.GM....................DKEMLGIL-VSY----------------------------------
A8X4Z9_CAEBR/175-315....................................QCPIIG-VEY----------------------------------
ART1_SCHPO/287-428....................................TSDLYS-VQY----------------------------------
ARRD2_HUMAN/180-307....................................HCRVLH-VDY----------------------------------
Q294M6_DROPS/179-311...................................HLSKVVR-VSY----------------------------------
ADCC_DICDI/344-478.........VG.LIH..................SIAETKMIR-VEY----------------------------------
Q6CS19_KLULA/219-373....................................ILTNIK-VRH----------------------------------
Q2UDU8_ASPOR/60-215............D......................VSSKMMT-IKH----------------------------------
Q22NR4_TETTS/187-325....................................NGGAFS-CRY----------------------------------
ROD1_YEAST/232-395....................................ILSNIK-VRH----------------------------------
A0CL31_PARTE/172-315....................................IGNCVN-SIY----------------------------------
APYA_EMENI/180-326....................................EDMGVR-VSH----------------------------------
Q296V0_DROPS/178-310...................................SNCGIIA-LDY----------------------------------
Q6CW08_KLULA/282-443...................................VGADLIK-VRH----------------------------------
A8WP33_CAEBR/159-305....................................ASGMMT-HGY----------------------------------
A0DYQ7_PARTE/173-314...................................VKTKRII-FQY----------------------------------
A0D2Y0_PARTE/206-342....................................KNQTIL-NQY----------------------------------
A7TQI8_VANPO/357-526..........H.P.....................DTGYEKIK-SQH----------------------------------
Q17EA7_AEDAE/182-314...................................SHCRVIQ-VKY----------------------------------
Q9W2V2_DROME/420-633LGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAIY-VSY----------------------------------
Q240M9_TETTS/188-318....................................QGELVQ-VVY----------------------------------
A5DUN4_LODEL/264-404....................................DGEHVK-VRH----------------------------------
A0NDX6_ANOGA/173-303....................................SDTIIR-LEY----------------------------------
Q16ZJ5_AEDAE/174-305....................................TCQVLT-VNY----------------------------------
Q7QCL7_ANOGA/170-301...................................RGCHLIR-IQY----------------------------------
A2QTZ8_ASPNC/184-328....................................STNFLH-VEH----------------------------------
O17983_CAEEL/173-318....................................SSRLLA-VEY----------------------------------
Q9V393_DROME/233-393.........TN.PA....................QRESLGIM-VHY----------------------------------
A0BMC5_PARTE/210-346....................................KTSVIR-NQY----------------------------------
A1C8U8_ASPCL/140-283....................................PNSTMP-IRH----------------------------------
A0D004_PARTE/178-324....................................NGEIIK-SHY----------------------------------
Q16ZK1_AEDAE/136-269............D......................DSCKIIQ-IVY----------------------------------
Q17EA8_AEDAE/183-323...................................RQSKILK-IGY----------------------------------
Q16ZJ8_AEDAE/186-315....................................KCSIIS-VEY----------------------------------
PALF_ASHGO/233-368...................................VPNQGFT-FQY----------------------------------
ARRS_MOUSE/200-361.........KE.GI....................DRTVMGIL-VSY----------------------------------
A8WP37_CAEBR/170-319....................................ESAMIS-MGY----------------------------------
Q9GYT5_CAEEL/181-328...................................QFSPVIT-VEY----------------------------------
MU170_SCHPO/266-426....................................LKDQLK-IDY----------------------------------
A5DW17_LODEL/261-403...................................IKSGMIV-VKH----------------------------------
A0D012_PARTE/172-315....................................TGNFVN-SSY----------------------------------
ADCA_DICDI/313-441....................................LGKHIT-SSY----------------------------------
Q9I7L0_DROME/174-307...................................NLCGIIQ-IAY----------------------------------
A7SF55_NEMVE/129-256....................................NCGIVS-ICY----------------------------------
Q16ZK2_AEDAE/273-408....................................CSKVIK-ISY----------------------------------
A8XYD8_CAEBR/172-316....................................NSKCIN-VEY----------------------------------
A0E996_PARTE/174-317...................................LFSDRII-YHY----------------------------------
Q0U5A6_PHANO/182-337....................................DTENIR-LTH----------------------------------
PALF_YEAST/259-394...................................TVGKFFS-FQY----------------------------------
Q23672_CAEEL/163-311....................................STGLVN-FGY----------------------------------
A7TPY5_VANPO/228-381....................................ILRNIK-VRH----------------------------------
Q759V0_ASHGO/221-368....................................ILNNIK-VRH----------------------------------
Q9VGU7_DROME/180-316...................................SEKDPIR-VSY----------------------------------
Q6FM62_CANGA/224-379....................................TLERIK-CRH----------------------------------
A7SKJ5_NEMVE/177-307....................................SCRCIQ-VTY----------------------------------
Q6CGL3_YARLI/174-329............T......................AKSSLYK-VEY----------------------------------
ARRD5_MOUSE/170-307...................................QENEIMR-TSY----------------------------------
Q17624_CAEEL/176-340..........L.R.....................FRKIPFLK-VEY----------------------------------
A0D9C9_PARTE/194-337....................................NGKVVM-NNY----------------------------------
A0CE97_PARTE/209-345....................................KTNTIK-NQY----------------------------------
Q7PYE1_ANOGA/178-310...................................VNCGIID-VDY----------------------------------
Q16ZJ6_AEDAE/174-302....................................VSPLIT-IAY----------------------------------
A7SL06_NEMVE/167-299....................................LYGIIT-TAY----------------------------------
O45782_CAEEL/179-307....................................KCKILS-VTY----------------------------------
Q17HB8_AEDAE/169-300...................................LGCHLIR-IQY----------------------------------
ADCB_DICDI/337-465....................................QSGIIK-IEY----------------------------------
Q23FQ6_TETTS/188-318....................................QGQLIQ-MNY----------------------------------
Q294M3_DROPS/163-297...................................NTNYIVF-LHY----------------------------------
A8WP43_CAEBR/183-324....................................KTNIIE-VDY----------------------------------
A3LXL3_PICST/266-408...................................LKNNIIQ-VRH----------------------------------
O17981_CAEEL/182-333...................................RFSPVIT-VEY----------------------------------
Q16ZK3_AEDAE/167-301....................................YSFVVQ-IAY----------------------------------
A8X383_CAEBR/164-301..........N.RG....................GGECSIIA-IHF----------------------------------
Q20232_CAEEL/173-309...................................GVCRLIQ-IYY----------------------------------
A0BCE6_PARTE/199-335....................................KMQFIK-NHY----------------------------------
Q5AP77_CANAL/170-448.........HT.LF...................PDSNFRHIE-IKH----------------------------------
A0BDM3_PARTE/168-302....................................TGQLIK-VDY----------------------------------
Q23674_CAEEL/182-339....................................TCEIID-VEY----------------------------------
ARRD5_BOVIN/171-309...................................QDSEIMN-TQY----------------------------------
YA4C_SCHPO/180-322....................................DLDGIK-IRH----------------------------------
Q294M1_DROPS/173-305...................................KPTCPIS-VNY----------------------------------
A0A0D1DR37_USTMA/181-316...................................QTAKHIE-VSY----------------------------------
A7TDW3_VANPO/229-389....................................VLKNIK-VRH----------------------------------
Q6FY06_CANGA/237-406....................................VLNNVK-IRH----------------------------------
A6R1F7_AJECN/559-759..........H.F.....................DTTHEQLQ-IHH----------------------------------
Q9XXC4_CAEEL/159-308....................................ESPMIS-MGY----------------------------------
A7TQH7_VANPO/294-447...................................IIGEIIR-IRH----------------------------------
Q16ID9_AEDAE/216-390............Q......................RENLGII-VQY----------------------------------
PALF_KLULA/263-398...................................LKNKFFT-FQY----------------------------------
Q6CG62_YARLI/321-486..........H.P.....................NTSFKNIK-VHH----------------------------------
A0A0D1E8U6_USTMA/601-804...................................HSKSNIA-VHH----------------------------------
Q9XTU0_CAEEL/176-327....................................DST