Sequence alignment for CL0135

PF13002

C8ZH73_YEAS8/144-346--------------------------------------------------------------------------------
A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------

PF00339

ARD15_CAEEL/38-167--------------------------------------------------------------------------------
ARRB_CALVI/17-172--------------------------------------------------------------------------------
ARRD1_MOUSE/7-139--------------------------------------------------------------------------------
O44847_CAEEL/8-127--------------------------------------------------------------------------------
O17812_CAEEL/8-141--------------------------------------------------------------------------------
O17981_CAEEL/6-159--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
O17984_CAEEL/4-157--------------------------------------------------------------------------------
O42103_ORYLA/17-174--------------------------------------------------------------------------------
O42104_ORYLA/14-171--------------------------------------------------------------------------------
O45782_CAEEL/7-155--------------------------------------------------------------------------------
O76685_CAEEL/6-159--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
ARRH_LOCMI/25-180--------------------------------------------------------------------------------
ARR1_ONCMY/19-175--------------------------------------------------------------------------------
ARRS_XENLA/21-176--------------------------------------------------------------------------------
ARRH_LIMPO/25-179--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
YC9F_SCHPO/16-169--------------------------------------------------------------------------------
Q17624_CAEEL/11-155--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
Q22321_CAEEL/16-154--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
Q9BIG9_9NEOP/17-173--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------
Q9D6S6_MOUSE/17-166--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
Q9PTE8_AMBTI/24-179--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
Q9V393_DROME/59-214--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q9VHZ9_DROME/5-140--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
Q9XXC4_CAEEL/3-136--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------------------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------------------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------------------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------------------------------------------------------------------------------
Q380N5_ANOGA/183-323--------------------------------------------------------------------------------
CRED_ASPOR/181-332--------------------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------------------------------------------------------------------------------
ARRD5_HUMAN/184-321--------------------------------------------------------------------------------
ARRD4_HUMAN/191-318--------------------------------------------------------------------------------
Q294M9_DROPS/171-302--------------------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------------------------------------------------------------------------------
Q294M7_DROPS/174-306--------------------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------------------------------------------------------------------------------
Q293Z7_DROPS/175-308--------------------------------------------------------------------------------
Q9I7K7_DROME/179-320--------------------------------------------------------------------------------
Q294M2_DROPS/166-277--------------------------------------------------------------------------------
A5DM18_PICGU/246-387--------------------------------------------------------------------------------
Q294M5_DROPS/171-304--------------------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------------------------------------------------------------------------------
A0BIT0_PARTE/173-314--------------------------------------------------------------------------------
Q4V467_DROME/125-256--------------------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------------------------------------------------------------------------------
Q66L50_DANRE/187-314--------------------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------------------------------------------------------------------------------
Q6C993_YARLI/185-326--------------------------------------------------------------------------------
O44847_CAEEL/147-273--------------------------------------------------------------------------------
A0CWE9_PARTE/173-316--------------------------------------------------------------------------------
Q23QU8_TETTS/188-318--------------------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------------------------------------------------------------------------------
A8WP41_CAEBR/178-317--------------------------------------------------------------------------------
Q0E8K8_DROME/169-299--------------------------------------------------------------------------------
A0C0J3_PARTE/194-337--------------------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------------------------------------------------------------------------------
Q8T0P7_DROME/23-156--------------------------------------------------------------------------------
Q55N22_CRYNB/182-345--------------------------------------------------------------------------------
Q23YG0_TETTS/188-318--------------------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------------------------------------------------------------------------------
ARRB_CAEEL/205-363--------------------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------------------------------------------------------------------------------
ALY2_SCHPO/345-506--------------------------------------------------------------------------------
Q5AM66_CANAL/305-457--------------------------------------------------------------------------------
Q23YG2_TETTS/174-283--------------------------------------------------------------------------------
ARRB2_MOUSE/195-350--------------------------------------------------------------------------------
ARRH_LIMPO/199-353--------------------------------------------------------------------------------
A2BIP7_DANRE/186-313--------------------------------------------------------------------------------
ARRD1_HUMAN/162-286--------------------------------------------------------------------------------
A2QR01_ASPNC/439-613--------------------------------------------------------------------------------
Q380P6_ANOGA/182-314--------------------------------------------------------------------------------
YC9F_SCHPO/183-325--------------------------------------------------------------------------------
A8E775_DROME/192-350--------------------------------------------------------------------------------
Q16H74_AEDAE/171-301--------------------------------------------------------------------------------
A4VB00_PLADU/42-172--------------------------------------------------------------------------------
Q91X82_MOUSE/175-302--------------------------------------------------------------------------------
Q6DH07_DANRE/192-355--------------------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------------------------------------------------------------------------------
ART1_SCHPO/287-428--------------------------------------------------------------------------------
ARRD2_HUMAN/180-307--------------------------------------------------------------------------------
A2ADV1_MOUSE/190-353--------------------------------------------------------------------------------
Q294M6_DROPS/179-311--------------------------------------------------------------------------------
Q963B5_LOLPE/193-352--------------------------------------------------------------------------------
ADCC_DICDI/344-478--------------------------------------------------------------------------------
Q08C63_DANRE/204-330--------------------------------------------------------------------------------
Q6CS19_KLULA/219-373--------------------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------------------------------------------------------------------------------
Q22NR4_TETTS/187-325--------------------------------------------------------------------------------
ROD1_YEAST/232-395--------------------------------------------------------------------------------
A0CL31_PARTE/172-315--------------------------------------------------------------------------------
APYA_EMENI/180-326--------------------------------------------------------------------------------
Q4PCS7_USTMA/465-633--------------------------------------------------------------------------------
Q296V0_DROPS/178-310--------------------------------------------------------------------------------
Q8LKK8_PHYSO/242-377--------------------------------------------------------------------------------
Q6CW08_KLULA/282-443--------------------------------------------------------------------------------
A8WP33_CAEBR/159-305--------------------------------------------------------------------------------
Q6PBM9_DANRE/191-353--------------------------------------------------------------------------------
Q9PTE7_AMBTI/190-353--------------------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------------------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------------------------------------------------------------------------------
Q5KC81_CRYNJ/436-587--------------------------------------------------------------------------------
A7TQI8_VANPO/357-526--------------------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------------------------------------------------------------------------------
Q9W2V2_DROME/420-633--------------------------------------------------------------------------------
Q240M9_TETTS/188-318--------------------------------------------------------------------------------
Q568E1_DANRE/170-297--------------------------------------------------------------------------------
A5DUN4_LODEL/264-404--------------------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------------------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------------------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------------------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------------------------------------------------------------------------------
O17983_CAEEL/173-318--------------------------------------------------------------------------------
Q9V393_DROME/233-393--------------------------------------------------------------------------------
A0BMC5_PARTE/210-346--------------------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------------------------------------------------------------------------------
A0D004_PARTE/178-324--------------------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------------------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------------------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------------------------------------------------------------------------------
PALF_ASHGO/233-368--------------------------------------------------------------------------------
ARRS_MOUSE/200-361--------------------------------------------------------------------------------
A8WP37_CAEBR/170-319--------------------------------------------------------------------------------
Q6GR39_XENLA/180-307--------------------------------------------------------------------------------
Q5BAI3_EMENI/174-332--------------------------------------------------------------------------------
Q5C229_SCHJA/8-167--------------------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------------------------------------------------------------------------------
MU170_SCHPO/266-426--------------------------------------------------------------------------------
Q5AI11_CANAL/271-413--------------------------------------------------------------------------------
A5DW17_LODEL/261-403--------------------------------------------------------------------------------
A0D012_PARTE/172-315--------------------------------------------------------------------------------
ADCA_DICDI/313-441--------------------------------------------------------------------------------
Q9I7L0_DROME/174-307--------------------------------------------------------------------------------
A7SF55_NEMVE/129-256--------------------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------------------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------------------------------------------------------------------------------
Q9VHZ8_DROME/164-279--------------------------------------------------------------------------------
A0E996_PARTE/174-317--------------------------------------------------------------------------------
A6S093_BOTFB/188-324--------------------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------------------------------------------------------------------------------
PALF_YEAST/259-394--------------------------------------------------------------------------------
Q23672_CAEEL/163-311--------------------------------------------------------------------------------
Q6VZJ8_CNPV/177-304--------------------------------------------------------------------------------
A7TPY5_VANPO/228-381--------------------------------------------------------------------------------
A7A259_YEAS7/232-393--------------------------------------------------------------------------------
Q759V0_ASHGO/221-368--------------------------------------------------------------------------------
Q9VGU7_DROME/180-316--------------------------------------------------------------------------------
Q6FM62_CANGA/224-379--------------------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------------------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------------------------------------------------------------------------------
A6S0J6_BOTFB/81-239--------------------------------------------------------------------------------
Q6AZP4_XENLA/162-286--------------------------------------------------------------------------------
O42103_ORYLA/193-351--------------------------------------------------------------------------------
ARRD5_MOUSE/170-307--------------------------------------------------------------------------------
Q17624_CAEEL/176-340--------------------------------------------------------------------------------
A0D9C9_PARTE/194-337--------------------------------------------------------------------------------
A6ZV52_YEAS7/332-475--------------------------------------------------------------------------------
A0CE97_PARTE/209-345--------------------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------------------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------------------------------------------------------------------------------
A7SL06_NEMVE/167-299--------------------------------------------------------------------------------
Q23DV9_TETTS/738-882--------------------------------------------------------------------------------
O45782_CAEEL/179-307--------------------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------------------------------------------------------------------------------
ADCB_DICDI/337-465--------------------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------------------------------------------------------------------------------
Q294M3_DROPS/163-297--------------------------------------------------------------------------------
A8WP43_CAEBR/183-324--------------------------------------------------------------------------------
Q6P8F1_XENTR/195-356--------------------------------------------------------------------------------
A3LXL3_PICST/266-408--------------------------------------------------------------------------------
O17981_CAEEL/182-333--------------------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------------------------------------------------------------------------------
A8X383_CAEBR/164-301--------------------------------------------------------------------------------
Q9XXI0_CAEEL/180-321--------------------------------------------------------------------------------
Q20232_CAEEL/173-309--------------------------------------------------------------------------------
A0BCE6_PARTE/199-335--------------------------------------------------------------------------------
Q5AP77_CANAL/170-448--------------------------------------------------------------------------------
A0BDM3_PARTE/168-302--------------------------------------------------------------------------------
Q23674_CAEEL/182-339--------------------------------------------------------------------------------
ARRD5_BOVIN/171-309--------------------------------------------------------------------------------
Q4T8K9_TETNG/86-210--------------------------------------------------------------------------------
YA4C_SCHPO/180-322--------------------------------------------------------------------------------
Q294M1_DROPS/173-305--------------------------------------------------------------------------------
Q4P2K3_USTMA/181-316--------------------------------------------------------------------------------
A7TDW3_VANPO/229-389--------------------------------------------------------------------------------
Q6FY06_CANGA/237-406--------------------------------------------------------------------------------
A6R1F7_AJECN/559-759--------------------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------------------------------------------------------------------------------
A7TQH7_VANPO/294-447--------------------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------------------------------------------------------------------------------
PALF_KLULA/263-398--------------------------------------------------------------------------------
Q6CG62_YARLI/321-486--------------------------------------------------------------------------------
Q4RUP5_TETNG/170-295--------------------------------------------------------------------------------
Q4PD45_USTMA/601-804--------------------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------------------------------------------------------------------------------
YOA5_SCHPO/223-379--------------------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------------------------------------------------------------------------------

PF07070

Q8DDE9_VIBVU/6-232--------------------------------------------------------------------------------
Q9F2L5_STRCO/29-249--------------------------------------------------------------------------------
SP0M_BACSU/4-221--------------------------------------------------------------------------------
Q87KC8_VIBPA/6-231--------------------------------------------------------------------------------
Q8EMA6_OCEIH/2-220--------------------------------------------------------------------------------
Q8YPP0_NOSS1/22-238--------------------------------------------------------------------------------
Q9KVV0_VIBCH/21-246--------------------------------------------------------------------------------
Q935W0_9ACTO/3-222--------------------------------------------------------------------------------
Q8CK18_STRCO/3-222--------------------------------------------------------------------------------

PF04425

Q6BVD2_DEBHA/1-335MFSKGTEREDIISRCR...QDNSNYNILPSYHMDKGIVKKKLNPGDEVYQFHHEPPAYNS....................
A3GGA7_PICST/92-585SSDSPIAPLSSVSSN....TQTEYFDVLPSFQMF.QSILKR.DDAQFSEDLQTLPPVYGDTTNSSPTP............
A5DRA9_PICGU/36-464DGGEFNEDDILRSEQA...NQAPVWSILPSYHMY.KSLYMGMNAPTE..NIHE.PPTYEDVSHTSVSH............
Q6BJG5_DEBHA/93-577SNSNETNLLSPASSN....TQTEYFDVLPSFQMF.QSILKR.DDSQFSENLSVNPPIYGDVTNSSPTPPSG........L
A5DPQ0_PICGU/115-602TDVNVNADLTTTLSG....TRTEYFHVLPSFQMF.QSILKR.DDAQFNESLSGEPPTYEDSRSASPVLSP..........
Q6BSG0_DEBHA/5-422SKEKLKEKHNERILNE...EDDLINNILPSYHMHQSTISKNLTPTNE..NFRVDPPMYEMTPVNSLST............
A5DN76_PICGU/57-484A.MEQLNLDPFVSPRH...EEVPMWNILPSYQLYEATFSKSIHPNSE..DLRYEPPAYQ.....................
Q6BVD1_DEBHA/28-455SQNYFSQKDIELTKTT...NEAPVWNILPSYHMYTTTIYKGFNVSDE..SLTE.PPSYETSSIHSAGRLS..........
Q5ABB5_CANAL/19-455TPSRQASVSSRNQGDD...EANELINILPSYQMYRSTITKNLTPSVE..DLRTAPPSYEVTPDLSTVQL...........
Q876A8_SACEX/140-571AFSRRRKNPNLIHYEN...DESLLVDVLPSFDMY.NVLHRHIPQGNVDPDRHDFPPTYEEESTHTLEP............
Q75E04_ASHGO/51-474AEEDDIDNCAGACAC....ADEEICDVLPSFQMY.NALHRHIPRGNVNADQHDLPPSYQEAYNGSVGG............
Q875N4_LACKL/72-505RGSSDTEVSSMAQEE....GNNMMIDVLPSFQLY.NTLHRHIPRGNVNADLHDYPPSYQAVQQQAPVLQ...........
BUL1_YEAST/108-543ANATPVETGRSLTDG....DINNVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEANNSTATG............
A3LRU1_PICST/29-421SCFSNSSAPDLALPTE...PE....SIIPSYNCL.VA.................PGAYLSLPSSRRSSAFS........S
A5E3Q9_LODEL/66-535NNSSATNIVATTSSN....TQTEYFDILPSFEMF.QSILKR.DDQQFQEDLTTVPPRYGDTAHSRSSRP...........
A3LX53_PICST/9-457LKLSSLSLRRKSKSNG...NDSELVNILPSYQMYRSTISKQLIPSRE..DLRTQPPSYELSPISSASS............
Q6FUH4_CANGA/102-545AASVPPNKPNLLKRN....SESRVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPTYQEIESQSSTFG...........
Q6CSE2_KLULA/69-505SGQSKLKNEDGSEVS....DTHHMIDVLPSFEMY.NALHRNIPRGNVNPDQHDLPPSYLEVESQRQTP............
Q6FP46_CANGA/103-568VAKSSTELNQMNTDSK...DPNMIIDVLPSFEFY.NVLHKHIPQGNVDPDIHDFPPTYQEVQTQRLPA............
Q875T3_NAUCA/106-548TNSKDLPVGESLDDLD...EDDIVFDVLPSFEMY.NALHRHIPQGNVNPDLHDFPPSYGEIQQGMATT............
A3LX54_PICST/5-426SQFSGISISPIVSAGE...EDELINNILPSYHMYQSTISKNLTPTDE..NFRVDPPIYEVSPVTTSNTLNSSSLFGFQTP
Q876B6_SACSE/94-510DSSFDRSGTYSSAYVD...AESLLVDVLPSFEMY.NSLHRHIPQGNVDPDRHDFPPTYNEQEESQPSA............
Q876C9_SACBA/7-447ENLLEMDCTKSTLLH....RANMLVDVLPSFEMY.NALHRHIPQGNVDPDRHDFPPSYQEVRTQRMTI............
Q5AN22_CANAL/97-598TTTTPIAELSTVSSH....SQTEYFDVLPSFQMF.QSILKR.DDRQFQEDLSSLPPGYGDVTNSSPTPPPLPPPPPARSA
A7TIV7_VANPO/87-537NVPFPGQFTKNSNSS....SSSILVDLLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEVQTQHSSILPI........H
Q875T4_NAUCA/96-560NNQSSTETSRNLKNGTHGSTDNLLVDVLPSFDMY.NVLHRHIPQGNVNPDIHDFPPTYQEVQTHRDPV............
Q875T2_NAUCA/78-518HSSNDHPTNTPVEHQA...RDDILLDILPSFEMY.NSLHRHIPQGNVNPDLHDFPPSYQEIQEGSSSSG...........

PF13002

C8ZH73_YEAS8/144-346--------------------------------------------------------------------------------
A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------

PF00339

ARD15_CAEEL/38-167--------------------------------------------------------------------------------
ARRB_CALVI/17-172--------------------------------------------------------------------------------
ARRD1_MOUSE/7-139--------------------------------------------------------------------------------
O44847_CAEEL/8-127--------------------------------------------------------------------------------
O17812_CAEEL/8-141--------------------------------------------------------------------------------
O17981_CAEEL/6-159--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
O17984_CAEEL/4-157--------------------------------------------------------------------------------
O42103_ORYLA/17-174--------------------------------------------------------------------------------
O42104_ORYLA/14-171--------------------------------------------------------------------------------
O45782_CAEEL/7-155--------------------------------------------------------------------------------
O76685_CAEEL/6-159--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
ARRH_LOCMI/25-180--------------------------------------------------------------------------------
ARR1_ONCMY/19-175--------------------------------------------------------------------------------
ARRS_XENLA/21-176--------------------------------------------------------------------------------
ARRH_LIMPO/25-179--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
YC9F_SCHPO/16-169--------------------------------------------------------------------------------
Q17624_CAEEL/11-155--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
Q22321_CAEEL/16-154--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
Q9BIG9_9NEOP/17-173--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------
Q9D6S6_MOUSE/17-166--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
Q9PTE8_AMBTI/24-179--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
Q9V393_DROME/59-214--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q9VHZ9_DROME/5-140--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
Q9XXC4_CAEEL/3-136--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------------------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------------------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------------------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------------------------------------------------------------------------------
Q380N5_ANOGA/183-323--------------------------------------------------------------------------------
CRED_ASPOR/181-332--------------------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------------------------------------------------------------------------------
ARRD5_HUMAN/184-321--------------------------------------------------------------------------------
ARRD4_HUMAN/191-318--------------------------------------------------------------------------------
Q294M9_DROPS/171-302--------------------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------------------------------------------------------------------------------
Q294M7_DROPS/174-306--------------------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------------------------------------------------------------------------------
Q293Z7_DROPS/175-308--------------------------------------------------------------------------------
Q9I7K7_DROME/179-320--------------------------------------------------------------------------------
Q294M2_DROPS/166-277--------------------------------------------------------------------------------
A5DM18_PICGU/246-387--------------------------------------------------------------------------------
Q294M5_DROPS/171-304--------------------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------------------------------------------------------------------------------
A0BIT0_PARTE/173-314--------------------------------------------------------------------------------
Q4V467_DROME/125-256--------------------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------------------------------------------------------------------------------
Q66L50_DANRE/187-314--------------------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------------------------------------------------------------------------------
Q6C993_YARLI/185-326--------------------------------------------------------------------------------
O44847_CAEEL/147-273--------------------------------------------------------------------------------
A0CWE9_PARTE/173-316--------------------------------------------------------------------------------
Q23QU8_TETTS/188-318--------------------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------------------------------------------------------------------------------
A8WP41_CAEBR/178-317--------------------------------------------------------------------------------
Q0E8K8_DROME/169-299--------------------------------------------------------------------------------
A0C0J3_PARTE/194-337--------------------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------------------------------------------------------------------------------
Q8T0P7_DROME/23-156--------------------------------------------------------------------------------
Q55N22_CRYNB/182-345--------------------------------------------------------------------------------
Q23YG0_TETTS/188-318--------------------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------------------------------------------------------------------------------
ARRB_CAEEL/205-363--------------------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------------------------------------------------------------------------------
ALY2_SCHPO/345-506--------------------------------------------------------------------------------
Q5AM66_CANAL/305-457--------------------------------------------------------------------------------
Q23YG2_TETTS/174-283--------------------------------------------------------------------------------
ARRB2_MOUSE/195-350--------------------------------------------------------------------------------
ARRH_LIMPO/199-353--------------------------------------------------------------------------------
A2BIP7_DANRE/186-313--------------------------------------------------------------------------------
ARRD1_HUMAN/162-286--------------------------------------------------------------------------------
A2QR01_ASPNC/439-613--------------------------------------------------------------------------------
Q380P6_ANOGA/182-314--------------------------------------------------------------------------------
YC9F_SCHPO/183-325--------------------------------------------------------------------------------
A8E775_DROME/192-350--------------------------------------------------------------------------------
Q16H74_AEDAE/171-301--------------------------------------------------------------------------------
A4VB00_PLADU/42-172--------------------------------------------------------------------------------
Q91X82_MOUSE/175-302--------------------------------------------------------------------------------
Q6DH07_DANRE/192-355--------------------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------------------------------------------------------------------------------
ART1_SCHPO/287-428--------------------------------------------------------------------------------
ARRD2_HUMAN/180-307--------------------------------------------------------------------------------
A2ADV1_MOUSE/190-353--------------------------------------------------------------------------------
Q294M6_DROPS/179-311--------------------------------------------------------------------------------
Q963B5_LOLPE/193-352--------------------------------------------------------------------------------
ADCC_DICDI/344-478--------------------------------------------------------------------------------
Q08C63_DANRE/204-330--------------------------------------------------------------------------------
Q6CS19_KLULA/219-373--------------------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------------------------------------------------------------------------------
Q22NR4_TETTS/187-325--------------------------------------------------------------------------------
ROD1_YEAST/232-395--------------------------------------------------------------------------------
A0CL31_PARTE/172-315--------------------------------------------------------------------------------
APYA_EMENI/180-326--------------------------------------------------------------------------------
Q4PCS7_USTMA/465-633--------------------------------------------------------------------------------
Q296V0_DROPS/178-310--------------------------------------------------------------------------------
Q8LKK8_PHYSO/242-377--------------------------------------------------------------------------------
Q6CW08_KLULA/282-443--------------------------------------------------------------------------------
A8WP33_CAEBR/159-305--------------------------------------------------------------------------------
Q6PBM9_DANRE/191-353--------------------------------------------------------------------------------
Q9PTE7_AMBTI/190-353--------------------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------------------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------------------------------------------------------------------------------
Q5KC81_CRYNJ/436-587--------------------------------------------------------------------------------
A7TQI8_VANPO/357-526--------------------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------------------------------------------------------------------------------
Q9W2V2_DROME/420-633--------------------------------------------------------------------------------
Q240M9_TETTS/188-318--------------------------------------------------------------------------------
Q568E1_DANRE/170-297--------------------------------------------------------------------------------
A5DUN4_LODEL/264-404--------------------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------------------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------------------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------------------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------------------------------------------------------------------------------
O17983_CAEEL/173-318--------------------------------------------------------------------------------
Q9V393_DROME/233-393--------------------------------------------------------------------------------
A0BMC5_PARTE/210-346--------------------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------------------------------------------------------------------------------
A0D004_PARTE/178-324--------------------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------------------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------------------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------------------------------------------------------------------------------
PALF_ASHGO/233-368--------------------------------------------------------------------------------
ARRS_MOUSE/200-361--------------------------------------------------------------------------------
A8WP37_CAEBR/170-319--------------------------------------------------------------------------------
Q6GR39_XENLA/180-307--------------------------------------------------------------------------------
Q5BAI3_EMENI/174-332--------------------------------------------------------------------------------
Q5C229_SCHJA/8-167--------------------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------------------------------------------------------------------------------
MU170_SCHPO/266-426--------------------------------------------------------------------------------
Q5AI11_CANAL/271-413--------------------------------------------------------------------------------
A5DW17_LODEL/261-403--------------------------------------------------------------------------------
A0D012_PARTE/172-315--------------------------------------------------------------------------------
ADCA_DICDI/313-441--------------------------------------------------------------------------------
Q9I7L0_DROME/174-307--------------------------------------------------------------------------------
A7SF55_NEMVE/129-256--------------------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------------------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------------------------------------------------------------------------------
Q9VHZ8_DROME/164-279--------------------------------------------------------------------------------
A0E996_PARTE/174-317--------------------------------------------------------------------------------
A6S093_BOTFB/188-324--------------------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------------------------------------------------------------------------------
PALF_YEAST/259-394--------------------------------------------------------------------------------
Q23672_CAEEL/163-311--------------------------------------------------------------------------------
Q6VZJ8_CNPV/177-304--------------------------------------------------------------------------------
A7TPY5_VANPO/228-381--------------------------------------------------------------------------------
A7A259_YEAS7/232-393--------------------------------------------------------------------------------
Q759V0_ASHGO/221-368--------------------------------------------------------------------------------
Q9VGU7_DROME/180-316--------------------------------------------------------------------------------
Q6FM62_CANGA/224-379--------------------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------------------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------------------------------------------------------------------------------
A6S0J6_BOTFB/81-239--------------------------------------------------------------------------------
Q6AZP4_XENLA/162-286--------------------------------------------------------------------------------
O42103_ORYLA/193-351--------------------------------------------------------------------------------
ARRD5_MOUSE/170-307--------------------------------------------------------------------------------
Q17624_CAEEL/176-340--------------------------------------------------------------------------------
A0D9C9_PARTE/194-337--------------------------------------------------------------------------------
A6ZV52_YEAS7/332-475--------------------------------------------------------------------------------
A0CE97_PARTE/209-345--------------------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------------------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------------------------------------------------------------------------------
A7SL06_NEMVE/167-299--------------------------------------------------------------------------------
Q23DV9_TETTS/738-882--------------------------------------------------------------------------------
O45782_CAEEL/179-307--------------------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------------------------------------------------------------------------------
ADCB_DICDI/337-465--------------------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------------------------------------------------------------------------------
Q294M3_DROPS/163-297--------------------------------------------------------------------------------
A8WP43_CAEBR/183-324--------------------------------------------------------------------------------
Q6P8F1_XENTR/195-356--------------------------------------------------------------------------------
A3LXL3_PICST/266-408--------------------------------------------------------------------------------
O17981_CAEEL/182-333--------------------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------------------------------------------------------------------------------
A8X383_CAEBR/164-301--------------------------------------------------------------------------------
Q9XXI0_CAEEL/180-321--------------------------------------------------------------------------------
Q20232_CAEEL/173-309--------------------------------------------------------------------------------
A0BCE6_PARTE/199-335--------------------------------------------------------------------------------
Q5AP77_CANAL/170-448--------------------------------------------------------------------------------
A0BDM3_PARTE/168-302--------------------------------------------------------------------------------
Q23674_CAEEL/182-339--------------------------------------------------------------------------------
ARRD5_BOVIN/171-309--------------------------------------------------------------------------------
Q4T8K9_TETNG/86-210--------------------------------------------------------------------------------
YA4C_SCHPO/180-322--------------------------------------------------------------------------------
Q294M1_DROPS/173-305--------------------------------------------------------------------------------
Q4P2K3_USTMA/181-316--------------------------------------------------------------------------------
A7TDW3_VANPO/229-389--------------------------------------------------------------------------------
Q6FY06_CANGA/237-406--------------------------------------------------------------------------------
A6R1F7_AJECN/559-759--------------------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------------------------------------------------------------------------------
A7TQH7_VANPO/294-447--------------------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------------------------------------------------------------------------------
PALF_KLULA/263-398--------------------------------------------------------------------------------
Q6CG62_YARLI/321-486--------------------------------------------------------------------------------
Q4RUP5_TETNG/170-295--------------------------------------------------------------------------------
Q4PD45_USTMA/601-804--------------------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------------------------------------------------------------------------------
YOA5_SCHPO/223-379--------------------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------------------------------------------------------------------------------

PF07070

Q8DDE9_VIBVU/6-232--------------------------------------------------------------------------------
Q9F2L5_STRCO/29-249--------------------------------------------------------------------------------
SP0M_BACSU/4-221--------------------------------------------------------------------------------
Q87KC8_VIBPA/6-231--------------------------------------------------------------------------------
Q8EMA6_OCEIH/2-220--------------------------------------------------------------------------------
Q8YPP0_NOSS1/22-238--------------------------------------------------------------------------------
Q9KVV0_VIBCH/21-246--------------------------------------------------------------------------------
Q935W0_9ACTO/3-222--------------------------------------------------------------------------------
Q8CK18_STRCO/3-222--------------------------------------------------------------------------------

PF04425

Q6BVD2_DEBHA/1-335...SACLDPTISVQSFNSCSENT.........................................................
A3GGA7_PICST/92-585...PGGLSPTTSATQGNSIDTIINDVSSRLE.................................EYQLEREHEERGDYLF
A5DRA9_PICGU/36-464...TSVTTSSITASSLSLHNSDTTAPSSNDP.................................................
Q6BJG5_DEBHA/93-577SPISSNRDNNLDSMMENVSERINEYALDNNDEEENYFF.............GGDENDTNQA...NEHLINEE........
A5DPQ0_PICGU/115-602.SLSPQTSATSQSGHENHIDGLLSSTADRLN............................EY...QMNDSAYQEQNFYFDD
Q6BSG0_DEBHA/5-422...TPSVALSAIQSPTSNSSVDEFPFPNQEI.................................HSGLEGGP........
A5DN76_PICGU/57-484...SDREPAPTQDGYFPPVEQARGEPMQTWE.................................................
Q6BVD1_DEBHA/28-455.SVSTARSNSVVAQASSVASTRETEDSNDNS.................................QRLIIADE........
Q5ABB5_CANAL/19-455..HDYFASVPTSPTLDPMLSEPLDAESAAVQ.................................................
Q876A8_SACEX/140-571..PAEIHPHDNSISNNHHHLPNQRIDSNVHQESIDI.................HDLRPLNT..LRYNISNN.........
Q75E04_ASHGO/51-474...ISVSSSRVNLTTIQSLDGVQSDSC....INL......................QALSA..QQYSLQTPS........
Q875N4_LACKL/72-505..NGSNNSSTIEPIPQPSVPATPNLLSPSVTPSGSL.................ANLQTFSA..SQVNIQALN........
BUL1_YEAST/108-543...AAGSSADLSHQSLSTDALGATRSSSTSNLEN.....................LIPLRT..EHHSIAAHQSTAV....
A3LRU1_PICST/29-421SDASPDANVNLHLHHMDMESASLAPAPLSPN..................................HAHLQNENQNEVGC.
A5E3Q9_LODEL/66-535..TSPRLHAQLS......IDQNLLQVSRRLEDTLQM..................ERDRQQEQMHEHAMVFVDETGLMPV.
A3LX53_PICST/9-457..YNEYGGFDGIPSTYSLPTSPVRELFANPL.................................................
Q6FUH4_CANGA/102-545.RPNPAVNGDSSQVSYDIDRNQTLLADNDPIDSRAL.................NNLQPLRT..EHHNINSTLSGVH....
Q6CSE2_KLULA/69-505...DSSDGTTVSQLDEMFLSPSPSLYDANTRVGSSQS...............LQSLNTVSSGVLQNSLQALS........
Q6FP46_CANGA/103-568...LQGSSSSQSGSELNVESPLRMNGSQTSIHGNFRNSSSNTLLPTTSGIFGGSSLQPYST..RHYSLNPNQNNPLHPT.
Q875T3_NAUCA/106-548....AYIENNVDLTTYPLQQPPLAHHSNSGHDIHITPSY............ALNALHPLNT..QHLTIQPTNDP......
A3LX54_PICST/5-426MNESVNNSVEAFPLSITESSTFNEESAQVWE.................................................
Q876B6_SACSE/94-510.............SHIGVTTPFT........DPL......................HALNT..VHYSISSES........
Q876C9_SACBA/7-447...LPTTDNSVERSPLTAVLDPENPCNSN..STHSL.................SNLHPLQT..QHLTLSTTGQP......
Q5AN22_CANAL/97-598PTLSPSSSR..........DHTIDEAIQRLNEYGLAQERD..........EMNNDEYLFEE...HNNDPHNNTNNTLSP.
A7TIV7_VANPO/87-537ERPDLMSINPFSHSSSDLTVSNTNSIQGSSSSTNLHAHNS..........LIENSLHPLST..QHLNLQSTTSA......
Q875T4_NAUCA/96-560...LSHDIADVGAATTATTTPNTTSLDHRVEILQDSTQAAPTL...SSTMVNLNNLHPLNT..RHYNISNGADLNSS...
Q875T2_NAUCA/78-518..TTIRIQNDVDYMQSP.ESPTSMLEGQTDGEQDIYVTPS..........YALRTLHALET..QHQNLNWER........

PF13002

C8ZH73_YEAS8/144-346-----------------------------------------------------------------VTLSLV---------
A7TSP7_VANPO/130-321-----------------------------------------------------------------VTLKLI---------
C5GL98_AJEDR/142-318-----------------------------------------------------------------LRMCLT---------
YNSK_SCHPO/63-242-----------------------------------------------------------------LKLQLI---------
C5DVA9_ZYGRC/141-332-----------------------------------------------------------------VMLTLV---------

PF00339

ARD15_CAEEL/38-167-----------------------------------------------------------------INIVLA---------
ARRB_CALVI/17-172-----------------------------------------------------------------VTFYLG---------
ARRD1_MOUSE/7-139-----------------------------------------------------------------FEIRLS---------
O44847_CAEEL/8-127-----------------------------------------------------------------LDISFD---------
O17812_CAEEL/8-141-----------------------------------------------------------------DCIVLA---------
O17981_CAEEL/6-159-----------------------------------------------------------------LHVIFD---------
O17983_CAEEL/6-146-----------------------------------------------------------------CDPQIS---------
O17984_CAEEL/4-157-----------------------------------------------------------------IFVLFD---------
O42103_ORYLA/17-174-----------------------------------------------------------------VAVYLA---------
O42104_ORYLA/14-171-----------------------------------------------------------------LTLYLG---------
O45782_CAEEL/7-155-----------------------------------------------------------------FEILFN---------
O76685_CAEEL/6-159-----------------------------------------------------------------LHVIFD---------
ARRS_BOVIN/22-180-----------------------------------------------------------------VTIYLG---------
ARRB1_BOVIN/18-174-----------------------------------------------------------------LTVYLG---------
ARRH_LOCMI/25-180-----------------------------------------------------------------VTVYLG---------
ARR1_ONCMY/19-175-----------------------------------------------------------------VTVYLG---------
ARRS_XENLA/21-176-----------------------------------------------------------------VSVYLG---------
ARRH_LIMPO/25-179-----------------------------------------------------------------ITVYLG---------
ARRB_CAEEL/22-186-----------------------------------------------------------------ITTYLG---------
P91469_CAEEL/7-159-----------------------------------------------------------------LQVIFD---------
YC9F_SCHPO/16-169-----------------------------------------------------------------FEVRLY---------
Q17624_CAEEL/11-155-----------------------------------------------------------------FDIHLD---------
Q20232_CAEEL/7-150-----------------------------------------------------------------FDIRLN---------
Q20577_CAEEL/7-158-----------------------------------------------------------------FGIVFD---------
Q22321_CAEEL/16-154-----------------------------------------------------------------CMLELS---------
Q23672_CAEEL/8-142-----------------------------------------------------------------VDISFD---------
Q23674_CAEEL/4-159-----------------------------------------------------------------CLVEFA---------
Q8SYU5_DROME/5-157-----------------------------------------------------------------CMITFD---------
Q9BIG9_9NEOP/17-173-----------------------------------------------------------------ITIYLG---------
ARRD2_MOUSE/9-158-----------------------------------------------------------------FVVEID---------
Q9D6S6_MOUSE/17-166-----------------------------------------------------------------LGLVFE---------
Q9I7L0_DROME/5-150-----------------------------------------------------------------CEIDFD---------
Q9PTE8_AMBTI/24-179-----------------------------------------------------------------VSVYLG---------
PALF_YEAST/39-201-----------------------------------------------------------------FRIDID---------
Q9V393_DROME/59-214-----------------------------------------------------------------ITVYLG---------
Q9VGU7_DROME/5-155-----------------------------------------------------------------VNFVFD---------
Q9VHZ9_DROME/5-140-----------------------------------------------------------------CVFQLD---------
Q9VI00_DROME/5-148-----------------------------------------------------------------CSFELD---------
Q9VI53_DROME/6-155-----------------------------------------------------------------CELQLD---------
Q9XXC4_CAEEL/3-136-----------------------------------------------------------------VNIVFS---------
Q9XXI0_CAEEL/6-159-----------------------------------------------------------------FLIEFD---------
Q9XXI4_CAEEL/4-156-----------------------------------------------------------------LRIEYD---------

PF03643

VPS26_DICDI/8-284-----------------------------------------------------------------FGTPCNVEFELDNCQ
VP26A_HUMAN/8-283-----------------------------------------------------------------FGPICEIDIVLNDGE
PEP8_YEAST/5-364-----------------------------------------------------------------FKPPIDIEILFDNEE
VP26A_ARATH/8-283-----------------------------------------------------------------FKPACNISITFTDGK
VPS26_SCHPO/5-279-----------------------------------------------------------------FKSPIDVDLHLDNEE
VPS26_DROME/6-280-----------------------------------------------------------------FGQSADIEIVF.DGA
VPS26_CAEEL/7-282-----------------------------------------------------------------FGQSAEIQIRLSNED
DSCR3_MOUSE/1-283-----------------------------------------------------------------MGTTLDIKIKR....

PF02752

Q7PUI7_ANOGA/236-407-------------------------------------------------------------ADGRVNLKAS---------
Q9TYQ0_CAEEL/174-315-------------------------------------------------------------RKGALIATMQ---------
Q7PUR5_ANOGA/187-319-------------------------------------------------------------LTDPLIVTAT---------
Q7PYD9_ANOGA/175-306-------------------------------------------------------------RTKPLFVKVT---------
Q380N5_ANOGA/183-323-------------------------------------------------------------RSRPLMVSAT---------
CRED_ASPOR/181-332-------------------------------------------------------------WPNKIEYSIS---------
Q752Z4_ASHGO/228-382-------------------------------------------------------------WAGRLQYELV---------
ARRD5_HUMAN/184-321-------------------------------------------------------------RQGTVCLQIQ---------
ARRD4_HUMAN/191-318-------------------------------------------------------------TSGPVSLSAK---------
Q294M9_DROPS/171-302-------------------------------------------------------------KTDPLKLELN---------
Q6BI98_DEBHA/278-420-------------------------------------------------------------WPNKAQYSVG---------
Q294M7_DROPS/174-306-------------------------------------------------------------TSKPLSLRLS---------
Q6BIN4_DEBHA/247-390-------------------------------------------------------------WPKKVEYSLN---------
Q293Z7_DROPS/175-308-------------------------------------------------------------GTRPITMVAL---------
Q9I7K7_DROME/179-320-------------------------------------------------------------WMKPLHLQLQ---------
Q294M2_DROPS/166-277-------------------------------------------------------------MKEESCLRLW---------
A5DM18_PICGU/246-387-------------------------------------------------------------WPGKVEYRVE---------
Q294M5_DROPS/171-304-------------------------------------------------------------SSGPVLSTLI---------
Q16ZK0_AEDAE/170-299-------------------------------------------------------------KSRPLLITVE---------
A0BIT0_PARTE/173-314-------------------------------------------------------------STGSTKVKVQ---------
Q4V467_DROME/125-256-------------------------------------------------------------RSDPLTLELN---------
Q7SC90_NEUCR/193-351-------------------------------------------------------------ADSIVTLGIS---------
Q66L50_DANRE/187-314-------------------------------------------------------------TSGPVSLSAK---------
Q95NF3_ANOGA/193-351-------------------------------------------------------------SPGELELEVT---------
Q6C993_YARLI/185-326-------------------------------------------------------------WPNKVDYEFS---------
O44847_CAEEL/147-273-------------------------------------------------------------SNGQPTFKVT---------
A0CWE9_PARTE/173-316-------------------------------------------------------------STGNTKVKIQ---------
Q23QU8_TETTS/188-318-------------------------------------------------------------RSGQIKYNIQ---------
Q6ZM71_DANRE/162-286-------------------------------------------------------------KNGTVVLNAK---------
A8WP41_CAEBR/178-317-------------------------------------------------------------KKGLVSMTVS---------
Q0E8K8_DROME/169-299-------------------------------------------------------------GGGQIKCRVS---------
A0C0J3_PARTE/194-337-------------------------------------------------------------PLGTISFKFQ---------
Q16ZJ7_AEDAE/171-300-------------------------------------------------------------TSNPLYIEVE---------
Q8T0P7_DROME/23-156-------------------------------------------------------------SSGPVLSTLT---------
Q55N22_CRYNB/182-345-------------------------------------------------------------ANDQMELTVS---------
Q23YG0_TETTS/188-318-------------------------------------------------------------KSGQIKYNIT---------
Q9W7R1_ORYLA/193-351-------------------------------------------------------------SDKPLHVQAT---------
ARRB_CAEEL/205-363-------------------------------------------------------------SSGLLHMEVS---------
Q7RZE0_NEUCR/198-350-------------------------------------------------------------WPNKIEYSIM---------
ALY2_SCHPO/345-506-------------------------------------------------------------WDERLHYELQ---------
Q5AM66_CANAL/305-457-------------------------------------------------------------WPNKVEYSLS---------
Q23YG2_TETTS/174-283-------------------------------------------------------------KSGQINYNIT---------
ARRB2_MOUSE/195-350-------------------------------------------------------------DRRSLHLEAS---------
ARRH_LIMPO/199-353-------------------------------------------------------------SSGKLQLEVT---------
A2BIP7_DANRE/186-313-------------------------------------------------------------NSGNVSMNIS---------
ARRD1_HUMAN/162-286-------------------------------------------------------------KTGSVVLTAS---------
A2QR01_ASPNC/439-613-------------------------------------------------------------WEDQLHYDIV---------
Q380P6_ANOGA/182-314-------------------------------------------------------------SSEPLYISAQ---------
YC9F_SCHPO/183-325-------------------------------------------------------------WPLKVNYETS---------
A8E775_DROME/192-350-------------------------------------------------------------SNGKISLEVT---------
Q16H74_AEDAE/171-301-------------------------------------------------------------RSAPMIMTVC---------
A4VB00_PLADU/42-172-------------------------------------------------------------ASGPISARLK---------
Q91X82_MOUSE/175-302-------------------------------------------------------------PDGRVSVSAR---------
Q6DH07_DANRE/192-355-------------------------------------------------------------SDKPVLLEAS---------
A8X4Z9_CAEBR/175-315-------------------------------------------------------------KKGIVTMTVT---------
ART1_SCHPO/287-428-------------------------------------------------------------SDGRVVVEVS---------
ARRD2_HUMAN/180-307-------------------------------------------------------------NRGLVSLSAK---------
A2ADV1_MOUSE/190-353-------------------------------------------------------------SSQPLQLQAW---------
Q294M6_DROPS/179-311-------------------------------------------------------------HTHPVELKVT---------
Q963B5_LOLPE/193-352-------------------------------------------------------------TSGAMKLECT---------
ADCC_DICDI/344-478-------------------------------------------------------------TGGNISISCK---------
Q08C63_DANRE/204-330-------------------------------------------------------------GSGKMSMTVT---------
Q6CS19_KLULA/219-373-------------------------------------------------------------WPQKVDYSIS---------
Q2UDU8_ASPOR/60-215-------------------------------------------------------------WDNVAQYSIS---------
Q22NR4_TETTS/187-325-------------------------------------------------------------NYGLYQQRVF---------
ROD1_YEAST/232-395-------------------------------------------------------------WPEKVDYTIS---------
A0CL31_PARTE/172-315-------------------------------------------------------------KRGTSSIEVK---------
APYA_EMENI/180-326-------------------------------------------------------------WANKIAYRIG---------
Q4PCS7_USTMA/465-633-------------------------------------------------------------GSGKVHLMAS---------
Q296V0_DROPS/178-310-------------------------------------------------------------ASGPLAVITS---------
Q8LKK8_PHYSO/242-377-------------------------------------------------------------SRGICTLSAS---------
Q6CW08_KLULA/282-443-------------------------------------------------------------WPDKLQYEIS---------
A8WP33_CAEBR/159-305-------------------------------------------------------------SDGTIQAKFV---------
Q6PBM9_DANRE/191-353-------------------------------------------------------------ADKPIHMEVS---------
Q9PTE7_AMBTI/190-353-------------------------------------------------------------SDRPLHLEAS---------
A0DYQ7_PARTE/173-314-------------------------------------------------------------STGGTKVKIQ---------
A0D2Y0_PARTE/206-342-------------------------------------------------------------SGGIVDLKIQ---------
Q5KC81_CRYNJ/436-587-------------------------------------------------------------DRGRVALHVA---------
A7TQI8_VANPO/357-526-------------------------------------------------------------WEHQLHYDIV---------
Q17EA7_AEDAE/182-314-------------------------------------------------------------LTEPLIVTAT---------
Q9W2V2_DROME/420-633-------------------------------------------------------------HDGRVGLRAS---------
Q240M9_TETTS/188-318-------------------------------------------------------------KSGQINYNIT---------
Q568E1_DANRE/170-297-------------------------------------------------------------ASGNISMDIF---------
A5DUN4_LODEL/264-404-------------------------------------------------------------WPKKVEYSLS---------
A0NDX6_ANOGA/173-303-------------------------------------------------------------RSEPLSINVM---------
Q16ZJ5_AEDAE/174-305-------------------------------------------------------------SSAPMLITAE---------
Q7QCL7_ANOGA/170-301-------------------------------------------------------------GGGIVKCKII---------
A2QTZ8_ASPNC/184-328-------------------------------------------------------------WPQKIIYRVS---------
O17983_CAEEL/173-318-------------------------------------------------------------TRGNVIYTLQ---------
Q9V393_DROME/233-393-------------------------------------------------------------KPNKIHLEAT---------
A0BMC5_PARTE/210-346-------------------------------------------------------------NRGTVELSLK---------
A1C8U8_ASPCL/140-283-------------------------------------------------------------WSGKVVYTVS---------
A0D004_PARTE/178-324-------------------------------------------------------------EKGSAQITAV---------
Q16ZK1_AEDAE/136-269-------------------------------------------------------------RSGPLVVALQ---------
Q17EA8_AEDAE/183-323-------------------------------------------------------------KSAPLMVKAT---------
Q16ZJ8_AEDAE/186-315-------------------------------------------------------------ISGPMHFSIE---------
PALF_ASHGO/233-368-------------------------------------------------------------SSKTVTISVD---------
ARRS_MOUSE/200-361-------------------------------------------------------------SDKPLNLSVS---------
A8WP37_CAEBR/170-319-------------------------------------------------------------KDGVFSIKLN---------
Q6GR39_XENLA/180-307-------------------------------------------------------------NLGQVSVTAK---------
Q5BAI3_EMENI/174-332-------------------------------------------------------------SDHLVTLGIS---------
Q5C229_SCHJA/8-167-------------------------------------------------------------SPGTLRLEVS---------
Q9GYT5_CAEEL/181-328-------------------------------------------------------------QGGILEMSLN---------
MU170_SCHPO/266-426-------------------------------------------------------------EEAKTTLEVH---------
Q5AI11_CANAL/271-413-------------------------------------------------------------WVGKLQYNVN---------
A5DW17_LODEL/261-403-------------------------------------------------------------WVGKLQYCVS---------
A0D012_PARTE/172-315-------------------------------------------------------------KQGSSSISAK---------
ADCA_DICDI/313-441-------------------------------------------------------------TKGKLHVKTW---------
Q9I7L0_DROME/174-307-------------------------------------------------------------RSDPLALQLT---------
A7SF55_NEMVE/129-256-------------------------------------------------------------TAAPLHALVY---------
Q16ZK2_AEDAE/273-408-------------------------------------------------------------PSGSLVLSVQ---------
A8XYD8_CAEBR/172-316-------------------------------------------------------------SRGSVIYELA---------
Q9VHZ8_DROME/164-279-------------------------------------------------------------YMETANMGLT---------
A0E996_PARTE/174-317-------------------------------------------------------------NGGSAQISLQ---------
A6S093_BOTFB/188-324-------------------------------------------------------------WPNKIEYQLV---------
Q0U5A6_PHANO/182-337-------------------------------------------------------------WANKLAYKIT---------
PALF_YEAST/259-394-------------------------------------------------------------PNKTVTISVD---------
Q23672_CAEEL/163-311-------------------------------------------------------------SNGPISLKVS---------
Q6VZJ8_CNPV/177-304-------------------------------------------------------------RSEVISLLAK---------
A7TPY5_VANPO/228-381-------------------------------------------------------------WPGKVEYTIS---------
A7A259_YEAS7/232-393-------------------------------------------------------------WPDKVDYSIS---------
Q759V0_ASHGO/221-368-------------------------------------------------------------WPGKLDYSLS---------
Q9VGU7_DROME/180-316-------------------------------------------------------------AHKPMIMDVS---------
Q6FM62_CANGA/224-379-------------------------------------------------------------WPKKVEYSIS---------
A7SKJ5_NEMVE/177-307-------------------------------------------------------------VSGPLSLVGH---------
Q6CGL3_YARLI/174-329-------------------------------------------------------------ADHLVDVDYT---------
A6S0J6_BOTFB/81-239-------------------------------------------------------------SDHLVTLRIT---------
Q6AZP4_XENLA/162-286-------------------------------------------------------------KSGQVLLTAS---------
O42103_ORYLA/193-351-------------------------------------------------------------SEKPLQVKLS---------
ARRD5_MOUSE/170-307-------------------------------------------------------------SQGWVSLHVQ---------
Q17624_CAEEL/176-340-------------------------------------------------------------CKSKLAAELA---------
A0D9C9_PARTE/194-337-------------------------------------------------------------PLGTILFKFQ---------
A6ZV52_YEAS7/332-475-------------------------------------------------------------WRDKLQYETS---------
A0CE97_PARTE/209-345-------------------------------------------------------------NSGAVELSVR---------
Q7PYE1_ANOGA/178-310-------------------------------------------------------------ASGPLSLIVH---------
Q16ZJ6_AEDAE/174-302-------------------------------------------------------------KSDPMDITVE---------
A7SL06_NEMVE/167-299-------------------------------------------------------------ASGSLTVTAK---------
Q23DV9_TETTS/738-882-------------------------------------------------------------EYGNVEIGLK---------
O45782_CAEEL/179-307-------------------------------------------------------------SAGSVTGEIR---------
Q17HB8_AEDAE/169-300-------------------------------------------------------------LGGTVRCNVG---------
ADCB_DICDI/337-465-------------------------------------------------------------TGGTIEMTIT---------
Q23FQ6_TETTS/188-318-------------------------------------------------------------KSGEINYSMS---------
Q294M3_DROPS/163-297-------------------------------------------------------------VSGPICSSLA---------
A8WP43_CAEBR/183-324-------------------------------------------------------------GSKEVKIKVQ---------
Q6P8F1_XENTR/195-356-------------------------------------------------------------SDKPLHLTAS---------
A3LXL3_PICST/266-408-------------------------------------------------------------WPEKVDYNVN---------
O17981_CAEEL/182-333-------------------------------------------------------------RKGYLELRVN---------
Q16ZK3_AEDAE/167-301-------------------------------------------------------------PSGMLYASVE---------
A8X383_CAEBR/164-301-------------------------------------------------------------PFGCVSLNMS---------
Q9XXI0_CAEEL/180-321-------------------------------------------------------------SNKEVKVKIS---------
Q20232_CAEEL/173-309-------------------------------------------------------------QRGALALRII---------
A0BCE6_PARTE/199-335-------------------------------------------------------------HRGMIELGIR---------
Q5AP77_CANAL/170-448-------------------------------------------------------------WNDAVHYIIT---------
A0BDM3_PARTE/168-302-------------------------------------------------------------PQGISKLECK---------
Q23674_CAEEL/182-339-------------------------------------------------------------KNGLVRMELR---------
ARRD5_BOVIN/171-309-------------------------------------------------------------SQGTICLQIQ---------
Q4T8K9_TETNG/86-210-------------------------------------------------------------KTGTLMLKTR---------
YA4C_SCHPO/180-322-------------------------------------------------------------WPNKIEYTIS---------
Q294M1_DROPS/173-305-------------------------------------------------------------PTGPLTVKFS---------
Q4P2K3_USTMA/181-316-------------------------------------------------------------LQDDMRVKVL---------
A7TDW3_VANPO/229-389-------------------------------------------------------------WPDKVEYSIS---------
Q6FY06_CANGA/237-406-------------------------------------------------------------WPEKVEYSIS---------
A6R1F7_AJECN/559-759-------------------------------------------------------------WEDQLHYDIV---------
Q9XXC4_CAEEL/159-308-------------------------------------------------------------KDGLFLLKLH---------
A7TQH7_VANPO/294-447-------------------------------------------------------------WPDKLQYEVS---------
Q16ID9_AEDAE/216-390-------------------------------------------------------------KPNKIHLEAS---------
PALF_KLULA/263-398-------------------------------------------------------------DNKTVKISVE---------
Q6CG62_YARLI/321-486-------------------------------------------------------------WEDQLHYDIV---------
Q4RUP5_TETNG/170-295-------------------------------------------------------------SSGGVFMHIK---------
Q4PD45_USTMA/601-804-------------------------------------------------------------WEDLLSYMVV---------
Q9XTU0_CAEEL/176-327-------------------------------------------------------------RYGKVNLQIR---------
YOA5_SCHPO/223-379-------------------------------------------------------------RKSATRITVS---------
Q0CQZ7_ASPTN/118-273-------------------------------------------------------------WDNKVHYRIS---------

PF07070

Q8DDE9_VIBVU/6-232-----------------------------------------------------LKKTLASFGIGSAKVDSI---------
Q9F2L5_STRCO/29-249-----------------------------------------------------FKRLLGSLGVGGPTVDTT---------
SP0M_BACSU/4-221-----------------------------------------------------FKKLAASAGIGAAKVDTI---------
Q87KC8_VIBPA/6-231-----------------------------------------------------LKKTLASFGIGSAKVDSI---------
Q8EMA6_OCEIH/2-220-----------------------------------------------------FNKMLSSIGIGSTKLDTQ---------
Q8YPP0_NOSS1/22-238-----------------------------------------------------FKNLLASVGIGAAKVDTR---------
Q9KVV0_VIBCH/21-246-----------------------------------------------------IKKTLASFGIGSAKVDSV---------
Q935W0_9ACTO/3-222-----------------------------------------------------FKRLLGSLGVGGPTVDTV---------
Q8CK18_STRCO/3-222-----------------------------------------------------FKKLLASLGAGGASVETV---------

PF04425

Q6BVD2_DEBHA/1-335..........................................ITVLDNLDSLASLQ......D.MVKQDIF---------
A3GGA7_PICST/92-585EDDDSEHTHTSSDAESDHADEHTHNENVA....VTMD..RYGHSPLDNIDRLPKLT......NSPIDIAIY---------
A5DRA9_PICGU/36-464.......................RVIVAD....ENTN..DWQNTLLDNIHQLKNLTFSNNKYAKSLNVSVH---------
Q6BJG5_DEBHA/93-577......................NTPVATN....DTYG.....ETVLDNIDKLPKLN......NSPIDIQVY---------
A5DPQ0_PICGU/115-602SND........QPGPASSTPRYRGINEPT....DTYG.....HTVLDNIDRLPKSH......SSPIDVQIY---------
Q6BSG0_DEBHA/5-422..................................NFW..E..NTILANAHKLPNLNRSDNKICQDLEIDMK---------
A5DN76_PICGU/57-484..........................................NSILANTHRMKKLSDIDNKVANHLHVEIY---------
Q6BVD1_DEBHA/28-455..................................DTN..SWRETILDNVHKLTNLTYFNKEVSNAVKISIQ---------
Q5ABB5_CANAL/19-455...................................QDGEQDDETILENAHKLKRLTSTNKEISKSLEVKIR---------
Q876A8_SACEX/140-571.........................IPFE....DDLN..DADNIVIDKVYSLPKLV......T.PIEIEIH---------
Q75E04_ASHGO/51-474.......................HDEPIE....DDLANQDDDNINIEKLYSLPKMV......T.PVEIDIR---------
Q875N4_LACKL/72-505......................TQQEPIE....DDLS..DNDNIFVDKLYSLPKLT......T.PIDIDIR---------
BUL1_YEAST/108-543..................DEDSLDIPPIL....DDLN..DTDNIFIDKLYTLPKMS......T.PIEITIK---------
A3LRU1_PICST/29-421..............EAGFGDFNMYDCADCTAANANLRRRSSFESIVDDINKLYDLTSTFNPISDAITMSVH---------
A5E3Q9_LODEL/66-535..............TSTADANSQVHNENLAITSDSYG.....HSPLDNIDRLQKAT......KSPFDIQIF---------
A3LX53_PICST/9-457...................................DLEGESNETILENAHKLKRISASNKEISKALHIHIF---------
Q6FUH4_CANGA/102-545.................SRSSVDLINPIQ....DDLN..DAKCVFVDKLYTLPKLS......T.PVEISIK---------
Q6CSE2_KLULA/69-505......................TRYEAII....DDLD..DSDNIKIEKLYSLPKVS......T.PIDVNIR---------
Q6FP46_CANGA/103-568...............VSGSTAVNDNTNIE....DDVN..DADNIAIDKLYSLPKFS......T.PLEIDIR---------
Q875T3_NAUCA/106-548...................SVDHIDTPFQ....DDLN..ESDNLFIDKLYTLPKID......T.PVEIEIK---------
A3LX54_PICST/5-426..........................................NTILANAHKLPNLTKTNNAVSSNLEVKIT---------
Q876B6_SACSE/94-510.........................SPFQ....DDLN..DSDNINIDKLYSLPKLT......TSPIDIDIR---------
Q876C9_SACBA/7-447...................RHSLSDTNISQIPFDDLN..DSDNIFIDKLYTLPKMT......T.PVEVDIR---------
Q5AN22_CANAL/97-598..............VGSSVNANVHNQNIEVTQDDTYG.....HSPLDNIDKLHKLP......HSPIDIQIY---------
A7TIV7_VANPO/87-537...................AAIDNNIPIE....DDLN..GSDNIFIDKLYTLPKLT......T.PVEVDIR---------
Q875T4_NAUCA/96-560.................QSRASLTMHDLNMQIEDDLN..DSDSIIIDRLYTLPKLA......T.PVDVEIR---------
Q875T2_NAUCA/78-518.......................FITNTD....DDLN..ESDNIFVDDIYTLPKVA......S.PIQISIK---------

PF13002

C8ZH73_YEAS8/144-346--------------------QKIHFHKP-----------------FVPNIS------SMQTCMN-------CKT-KITNM
A7TSP7_VANPO/130-321--------------------QIVHFHKT-----------------FVPDTQ------AIQTCKN-------CTT-KTTKI
C5GL98_AJEDR/142-318--------------------RKVSTKKP-----------------......------VSRDCSA-------CKY-QTEEL
YNSK_SCHPO/63-242--------------------KRITVLHP-----------------......------AISHCSA-------CAG-SKEVL
C5DVA9_ZYGRC/141-332--------------------QKVHFHKP-----------------FMADLH------SIQTCMN-------CQS-KTTDI

PF00339

ARD15_CAEEL/38-167----------------......EPRCMA-----------------G..EFF......NAKVLL.-------DSS-DPDTV
ARRB_CALVI/17-172----------------....RRHFIDHF-----------------DYIDPV......DGVIVVD-------PDY-L..KN
ARRD1_MOUSE/7-139----------------....QGRVVYGP-----------------G..EPL......AGTVHL.-------RLG-APLPF
O44847_CAEEL/8-127----------------......KPVYYP-----------------G..DNM......KLTVSV.-------DTK-RPLNA
O17812_CAEEL/8-141----------------....EPEKLHYP-----------------G..DTV......SGHIVL.-------KFE-KFSTC
O17981_CAEEL/6-159----------------....QPNEVFFP-----------------G..QPI......SGRVVLS-------TTE-EKYKA
O17983_CAEEL/6-146----------------....FEKEVYFP-----------------G..DEV......KGRAWV.-------STT-KNLKA
O17984_CAEEL/4-157----------------....KPNAVYAA-----------------G..QKI......SGRVVF.-------STA-SQQNP
O42103_ORYLA/17-174----------------....KRDFVDHC-----------------DFVDPV......DGVVVID-------PTQ-L..KG
O42104_ORYLA/14-171----------------....KRDYVDHV-----------------SSVEKL......DGVVKVD-------TTD-F..GD
O45782_CAEEL/7-155----------------....NPEQAYFA-----------------G..QEI......SGKVII.-------ENK-EPKKV
O76685_CAEEL/6-159----------------....QPDEVFHP-----------------G..KPI......SGRVVLS-------TTK-EKYKA
ARRS_BOVIN/22-180----------------....KRDYIDHV-----------------ERVEPV......DGVVLVD-------PEL-V..KG
ARRB1_BOVIN/18-174----------------....KRDFVDHI-----------------DLVEPV......DGVVLVD-------PEY-L..KE
ARRH_LOCMI/25-180----------------....KRDFIDHL-----------------DHVDPI......DGIVVVD-------NDY-L..RG
ARR1_ONCMY/19-175----------------....KRDFVDHL-----------------DQVDPV......DGVILVD-------PEY-L..KD
ARRS_XENLA/21-176----------------....KRDYVDHV-----------------DSVEPV......DGVVLVD-------PDL-L..KG
ARRH_LIMPO/25-179----------------....KRDFGDHG-----------------SYCEPV......EGVLLVD-------NEY-L..KG
ARRB_CAEEL/22-186----------------....KRDFIDRG-----------------DYVDLI......DGMVLID-------EEY-I..KD
P91469_CAEEL/7-159----------------....QPDEVFLP-----------------G..QPI......SGRVVL.-------TTK-KKLSA
YC9F_SCHPO/16-169----------------N..AEANVIVLY-----------------G..NSMDTSARLSGIVVL.-------SVS-SPIRV
Q17624_CAEEL/11-155----------------...AGDEPTFKG-----------------G..ELI......TGKLLI.-------ELR-KPIII
Q20232_CAEEL/7-150----------------......KDVYYA-----------------G..ETI......SGSVLL.-------ENT-ENIKI
Q20577_CAEEL/7-158----------------....SPRG.YAP-----------------G..QTV......TGQVVL.-------RSN-EPITA
Q22321_CAEEL/16-154----------------....RKDACYNW-----------------G..DTI......QGKLNLK-------ISE-GSIEI
Q23672_CAEEL/8-142----------------....KQSEPYYP-----------------G..DTV......KGTVVL.-------TNK-TPLDA
Q23674_CAEEL/4-159----------------....KSPPVFSP-----------------G..EKV......TGNVKMT-------IPD-DEFKA
Q8SYU5_DROME/5-157----------------...QNEHGTYFT-----------------G..QVI......TGKVIV.-------NLN-KTKKL
Q9BIG9_9NEOP/17-173----------------....KRDFVDHV-----------------SGVEPV......DGVLLLD-------DDY-INQKE
ARRD2_MOUSE/9-158----------------GARTGTEPVFHG-----------------G..QAV......AGRVLL.-------ELA-GAARV
Q9D6S6_MOUSE/17-166----------------...DESKGCYSS-----------------G..ETV......AGHVLL.-------EAA-EPVAL
Q9I7L0_DROME/5-150----------------...NNPHGTYFG-----------------G..EVL......TGRVTL.-------KLD-KMKLV
Q9PTE8_AMBTI/24-179----------------....KRDYVDHV-----------------DSVEPV......DGIVFVD-------PDL-L..KG
PALF_YEAST/39-201----------------....EPHRVWKP-----------------N..ESI......TGEAVI.-------DIK-RDITN
Q9V393_DROME/59-214----------------....KRDFVDHV-----------------THVDPI......DGVVFID-------PEY-V..KD
Q9VGU7_DROME/5-155----------------...SNPLGLYQA-----------------G..QLI......SGTAEL.-------ITE-RPKTI
Q9VHZ9_DROME/5-140----------------....RLNPVYNS-----------------G..EYI......SGRILL.-------RTD-KVKRV
Q9VI00_DROME/5-148----------------....RREPIYYS-----------------G..ETV......NGRAIL.-------TTT-SEKSV
Q9VI53_DROME/6-155----------------....NPWNTYYA-----------------G..QTV......NGQVKF.-------TFD-SPKKV
Q9XXC4_CAEEL/3-136----------------....NPSKTYLP-----------------G..DYV......SGKVLL.-------TTK-DPISA
Q9XXI0_CAEEL/6-159----------------....HPAAVYSP-----------------G..QNV......AGKLTI.-------RNR-NALNA
Q9XXI4_CAEEL/4-156----------------....APNDVYFP-----------------G..QAV......TGKVII.-------QNR-EWIKA

PF03643

VPS26_DICDI/8-284NRKTIEVTQD......KGKTEKLFVFIG-----------------N--EPV------SGKVSIN-------IKEKTKKIE
VP26A_HUMAN/8-283TRKMAEMKTE......DGKVEKHYLFYD-----------------G--ESV------SGKVNLA-------FKQPGKRLE
PEP8_YEAST/5-364SRKHVDIATRSSNSSYKSMKESLPVYED-----------------G--ESL------GGIVTLR-------VRD.SKKVD
VP26A_ARATH/8-283NRKQVPTKKD......NGQIVMNPLFQS-----------------Q--ETI------AGKINIE-------PYQ.GKKVE
VPS26_SCHPO/5-279ERTFVDYEFE......QGRKDKAPIYES-----------------D--ETV------KGTVMIR-------LKD.GRKLD
VPS26_DROME/6-280EHKTAEVKGE......DGKVEKMLLFYD-----------------G--ETV------SGKVNVT-------LKKPGSKLE
VPS26_CAEEL/7-282TRKIVKARGD......DGNMHDHFLYYD-----------------G--ESV------TGTVHVN-------LKKANHKFE
DSCR3_MOUSE/1-283.....................ANKVYHA-----------------G--EML------SGVVVIS-------SKD...SVQ

PF02752

Q7PUI7_ANOGA/236-407--------------------LNKAAYVH-----------------G--ENV------TVTLDIK.......N.D-SR.KI
Q9TYQ0_CAEEL/174-315--------------------VDEIGVMP-----------------G--MTS------KISLTVE.......N.K-TK.KR
Q7PUR5_ANOGA/187-319--------------------TPRTGYAP-----------------G--EVI------EVTVHVN.......N.Q-SS.VD
Q7PYD9_ANOGA/175-306--------------------VPFTGYVP-----------------G--QAI------PLTIDLH.......N.L-SS.RI
Q380N5_ANOGA/183-323--------------------TPKSGYAP-----------------G--ETI------ELEVFVQ.......N.S-SK.VT
CRED_ASPOR/181-332--------------------TPTKAVIF-----------------G--TSI------RVDFKLI......PL.L-KG.LT
Q752Z4_ASHGO/228-382--------------------VPSRAIAV-----------------G--AQT------ALQLRLF......PF.Q-KG.YR
ARRD5_HUMAN/184-321--------------------MERNTFTP-----------------G--EKV------VFTTEIN.......N.Q-TS.KC
ARRD4_HUMAN/191-318--------------------IERKGYCN-----------------G--EAI------PIYAEIE.......N.C-SS.RL
Q294M9_DROPS/171-302--------------------LPQAGYVP-----------------G--QKI------PVTVVVV.......N.N-SS.VA
Q6BI98_DEBHA/278-420--------------------LKRKGIAI-----------------G--STI------TVKLMVI......PI.A-KG.LK
Q294M7_DROPS/174-306--------------------LPQGGFVP-----------------G--QTI------PIGVLVS.......N.D-SS.IQ
Q6BIN4_DEBHA/247-390--------------------VPSKAIAI-----------------G--SNI------PISFMLV......PL.L-KG.LR
Q293Z7_DROPS/175-308--------------------LPEDFAVR-----------------G--EPL------RICVTVM.......N.N-ST.TN
Q9I7K7_DROME/179-320--------------------IPRQGYSP-----------------G--AGI------SVHLKLH.......N.P-EK.LT
Q294M2_DROPS/166-277--------------------LPRSVFVP-----------------G--QSV------VY............E.V-AS.KD
A5DM18_PICGU/246-387--------------------MPRRGLAV-----------------G--SSV------PIRLVIL......PL.A-KG.LK
Q294M5_DROPS/171-304--------------------IPFGGYAP-----------------G--QKI------HYTLEID.......N.K-SGAYD
Q16ZK0_AEDAE/170-299--------------------IPASGYVP-----------------G--QKI------PITNTLN.......N.A-SS.VA
A0BIT0_PARTE/173-314--------------------LNKPYYTF-----------------G--ENI------DIILQVD.......NSQ-SS.SA
Q4V467_DROME/125-256--------------------LPQTGFVP-----------------G--QTV------PANVLIG.......N.E-SK.IR
Q7SC90_NEUCR/193-351--------------------LPKWSYGP-----------------L--DPI------TVFIKLAPNPDMMNK.A-KK.VT
Q66L50_DANRE/187-314--------------------IERKGYTP-----------------G--ETI------QIFAEIE.......N.C-SS.RV
Q95NF3_ANOGA/193-351--------------------LDKQLYLH-----------------G--ERI------GVNICIR.......N.N-SN.KM
Q6C993_YARLI/185-326--------------------LPSKAVAV-----------------G--SST------PVHLSMT......PL.L-KG.LK
O44847_CAEEL/147-273--------------------MPKFTLYP-----------------G--ETT------EFKLEVE.......N.H-SS.ST
A0CWE9_PARTE/173-316--------------------LNKAQYVF-----------------G--DSI------QLNISVD.......NSQ-SN.VA
Q23QU8_TETTS/188-318--------------------TNGRSFAP-----------------N--ENI------QIKLDVD......FS.Q-YG.KK
Q6ZM71_DANRE/162-286--------------------TDMRGYIA-----------------G--QII------KVSAGIE.......N.K-SD.KT
A8WP41_CAEBR/178-317--------------------LPKRGYVA-----------------G--EIL------PITINIE.......N.N-SK.SP
Q0E8K8_DROME/169-299--------------------LDRGGYVP-----------------G--ENI------LVTAFIS.......N.Y-SN.VS
A0C0J3_PARTE/194-337--------------------FDKSAYQP-----------------G--EVA------KLQVEID......NT.Q-SK.VG
Q16ZJ7_AEDAE/171-300--------------------IPVSGYVP-----------------G--QKI------PITVALN.......N.T-SS.TT
Q8T0P7_DROME/23-156--------------------IPFGGYAP-----------------G--QKI------RFTLEID.......N.Q-SSGYD
Q55N22_CRYNB/182-345--------------------RPCTAFSA-----------------G--DKV------RISTSLKS.....SR.P-KP.FT
Q23YG0_TETTS/188-318--------------------TNSRSYSP-----------------N--EII------SMKIDID......FN.Q-FN.KN
Q9W7R1_ORYLA/193-351--------------------LDKELYYH-----------------G--EPI------KVHVNVT.......N.N-SN.KN
ARRB_CAEEL/205-363--------------------LDKEMYYH-----------------G--ESI------SVNVHIQ.......N.N-SN.KT
Q7RZE0_NEUCR/198-350--------------------IPKKAVVF-----------------G--STI------PLQTRFT......PL.L-KG.LE
ALY2_SCHPO/345-506--------------------VSGKSFRL-----------------G--EVV------PITFRFL.......L.L-DK.VR
Q5AM66_CANAL/305-457--------------------CPTKAIAI-----------------G--SST------PITMTLV......PL.L-KG.LQ
Q23YG2_TETTS/174-283--------------------TNSRSFAP-----------------N--ESI------QIKMAID......FS.Q-YT.KK
ARRB2_MOUSE/195-350--------------------LDKELYYH-----------------G--EPL------NVNVHVT.......N.N-SA.KT
ARRH_LIMPO/199-353--------------------LDKELYFH-----------------G--DKV------SANVTIS.......N.Y-SK.KT
A2BIP7_DANRE/186-313--------------------TEKMAYYL-----------------G--EGL------KVLAEIH.......N.G-SS.RI
ARRD1_HUMAN/162-286--------------------TDLRGYVV-----------------G--QAL------QLHADVE.......N.Q-SG.KD
A2QR01_ASPNC/439-613--------------------ISGKSFPL-----------------G--SQV------PIAFKLT.......P.L-AK.VE
Q380P6_ANOGA/182-314--------------------IARCGYIP-----------------G--QTI------VMKIDAV.......N.R-SR.TT
YC9F_SCHPO/183-325--------------------IPSKVYAI-----------------G--SEI------PVNITLY......PL.L-KG.LD
A8E775_DROME/192-350--------------------LDREIYYH-----------------G--EKT------AATVQVS.......N.N-SK.KS
Q16H74_AEDAE/171-301--------------------IPMTGYVP-----------------G--QLI------SVVVDVM.......N.K-ST.KD
A4VB00_PLADU/42-172--------------------LDRSGYVP-----------------G--EYI------TMSGEVD.......N.R-SR.RK
Q91X82_MOUSE/175-302--------------------IDRKGFCE-----------------G--DDI------SIHADFE.......NTC-SR...
Q6DH07_DANRE/192-355--------------------LEKEIYYH-----------------G--DPI------PVNIKIK.......N.E-TN.KV
A8X4Z9_CAEBR/175-315--------------------IPKQAVAS-----------------G--EAL------PITIDID.......N.C-SK.RA
ART1_SCHPO/287-428--------------------IPKLCIGP-----------------S--DLV------SVFVSIMP.....NN.G-SK.IR
ARRD2_HUMAN/180-307--------------------IDRKGYTP-----------------G--EVI------PVFAEID.......N.G-ST.RP
A2ADV1_MOUSE/190-353--------------------MDREVHYH-----------------G--EAI------SVHVSIN.......N.Y-TN.KV
Q294M6_DROPS/179-311--------------------LQQQGYVP-----------------G--QFM------LIHAQVR.......N.D-SS.SD
Q963B5_LOLPE/193-352--------------------LDKARYYS-----------------G--ESM------NISVCVD.......N.P-TS.KK
ADCC_DICDI/344-478--------------------SVKNSFYP-----------------G--EEI------ELEVEVN.......N.S-SK.KK
Q08C63_DANRE/204-330--------------------TDKTGYML-----------------G--EII------RVSVDID.......N.S-SS.RD
Q6CS19_KLULA/219-373--------------------VPSKAIAI-----------------G--SST------PINIMVV......PL.L-KG.LK
Q2UDU8_ASPOR/60-215--------------------IPDVNIPF-----------------G--ATF------PMKLRFA......PL.S-KG.IK
Q22NR4_TETTS/187-325--------------------IKRSEFNP-----------------G--ETI------PIQLSFE.......N.K-GS.KP
ROD1_YEAST/232-395--------------------IPTKAIAI-----------------G--SST------MINILIV......PI.L-KG.LK
A0CL31_PARTE/172-315--------------------VEKNIYFP-----------------T--EFL------NFSYDID......NS.N-CK.LD
APYA_EMENI/180-326--------------------IQNRTVAL-----------------G--TRI------DVDYVFA......PL.L-RD.MK
Q4PCS7_USTMA/465-633--------------------LHRNTWVA-----------------G--QRV------YINVGVQ.......N.D-TS.KK
Q296V0_DROPS/178-310--------------------VPQTGYVS-----------------G--QIL------PITCEVD.......N.T-SN.VN
Q8LKK8_PHYSO/242-377--------------------LDHDEVTA-----------------G--DMV------TVFTSVK.......N.E-TS.KD
Q6CW08_KLULA/282-443--------------------IPSKAIPI-----------------G--GAT------PLTVKLY......PF.Q-KG.YK
A8WP33_CAEBR/159-305--------------------TPSQVFKA-----------------G--QTF------DTEVTLN.......N.T-SG.NA
Q6PBM9_DANRE/191-353--------------------MEKELYYH-----------------G--DPI------PIKVKVN.......N.E-TS.KV
Q9PTE7_AMBTI/190-353--------------------LDKEIYYH-----------------G--EPI------NVNVKIN.......N.T-TG.KI
A0DYQ7_PARTE/173-314--------------------LNKPQYLF-----------------G--ENI------DIVMQVD.......NSS-SN.YH
A0D2Y0_PARTE/206-342--------------------LNKSNFTP-----------------G--ELA------IIQYHLD.......NTF-SS.KP
Q5KC81_CRYNJ/436-587--------------------LGRATWVS-----------------G--QRL------WCQVGIR.......N.G-SL.RK
A7TQI8_VANPO/357-526--------------------IASKDIIL-----------------D--AFL------PIAFRFS.......P.I-DK.VT
Q17EA7_AEDAE/182-314--------------------TPRSGYVP-----------------G--DVI------ELTMHVN.......N.Q-SS.VD
Q9W2V2_DROME/420-633--------------------LDKGWYTH-----------------G--EDV------QVTVNIR.......N.D-SR.KT
Q240M9_TETTS/188-318--------------------TSSRCFSP-----------------Q--ETI------NLNMDID......FS.Q-YS.KQ
Q568E1_DANRE/170-297--------------------LPKTGYQQ-----------------G--EGL------IVNGEIV.......N.S-ST.RK
A5DUN4_LODEL/264-404--------------------CPTRALAI-----------------G--SGT------PISIMLV......PL.L-KG.LT
A0NDX6_ANOGA/173-303--------------------LPMTGYVP-----------------G--QFI------LVTVDIS.......N.R-SN.KC
Q16ZJ5_AEDAE/174-305--------------------TPISGYVP-----------------G--QTI------AVHIEVD.......N.Q-SN.KN
Q7QCL7_ANOGA/170-301--------------------LDRGGYVP-----------------G--ESI------MITATVT.......N.A-SS.VT
A2QTZ8_ASPNC/184-328--------------------LPSQAYTF-----------------G--SAI------PIKFEFI......PL.C-KG.LE
O17983_CAEEL/173-318--------------------SPKCGYVA-----------------G--ENV------IVSGQIE.......N.G-TS.KP
Q9V393_DROME/233-393--------------------LDKELYHH-----------------G--EKI------SVNVHVA.......N.N-SN.RT
A0BMC5_PARTE/210-346--------------------LNKNNFIP-----------------G--EQM------QIEYTLD.......NTR-SQ.RS
A1C8U8_ASPCL/140-283--------------------MPSQAFPF-----------------G--SEV------PLNFQFI......PL.R-KG.LE
A0D004_PARTE/178-324--------------------TDRNVYRI-----------------G--EAI------RILIEVI......DE.E-RY.QK
Q16ZK1_AEDAE/136-269--------------------VPATGFVA-----------------G--QRI------PVVLEVS.......N.R-SG.CK
Q17EA8_AEDAE/183-323--------------------VPKSLYTP-----------------G--ESL------EVLLEVH.......N.L-SK.ED
Q16ZJ8_AEDAE/186-315--------------------LPVSGYVS-----------------G--QKI------PITVNLN.......N.A-SN.IP
PALF_ASHGO/233-368--------------------LPESGYVI-----------------G--DTI------RIKVHIQ......HY.K-EY.RN
ARRS_MOUSE/200-361--------------------LSKEIYFH-----------------G--EPI------PVTVTVT.......N.N-TD.KV
A8WP37_CAEBR/170-319--------------------FQKRSFMP-----------------G--ESV------EVIVTME.......N.N-SS.KP
Q6GR39_XENLA/180-307--------------------IDRKGYTP-----------------G--EVI------PIFAEID.......N.G-TT.RA
Q5BAI3_EMENI/174-332--------------------LPRWSYGP-----------------L--DPV------SVYVKLSPNPDWISK.A-RK.VT
Q5C229_SCHJA/8-167--------------------LNKEKYYH-----------------G--ESI------EINVLVD.......N.N-SN.KT
Q9GYT5_CAEEL/181-328--------------------IPKTGFVP-----------------G--ETV------PLNVHLI.......N.H-SS.TS
MU170_SCHPO/266-426--------------------TDRSLFFS-----------------G--QII------DFTICYT.......H.N-HH.RR
Q5AI11_CANAL/271-413--------------------MTKKGVAI-----------------G--STI------PINITII......PI.V-KG.LS
A5DW17_LODEL/261-403--------------------MPRKAIAI-----------------G--TTV------PIHLTIV......PI.A-KG.LS
A0D012_PARTE/172-315--------------------VEKNLYFP-----------------G--EFV------QITYDID......NS.D-CK.LN
ADCA_DICDI/313-441--------------------LNKNAYFP-----------------G--ETL------VAKMKAN.......N.T-SI.KP
Q9I7L0_DROME/174-307--------------------VPQTGFVP-----------------G--QNV------PLSVLVT.......N.D-SH.IP
A7SF55_NEMVE/129-256--------------------TDRSAYCP-----------------G--ERL------TLTTEIR.......N.L-PL.RE
Q16ZK2_AEDAE/273-408--------------------IPTNGFVP-----------------G--QII------PALIQVS.......S.R-RH.VT
A8XYD8_CAEBR/172-316--------------------SPKLGYVS-----------------G--ETV------IINGRIH.......N.K-TS.KP
Q9VHZ8_DROME/164-279--------------------LPRSVFVP-----------------G--QSV------SY............EIC-SK.DG
A0E996_PARTE/174-317--------------------INKQGFAI-----------------G--DVI------EANLEVD......NT.K-TD.LN
A6S093_BOTFB/188-324--------------------IPQKAIVF-----------------G--TSI------TIEMRFT......SL.L-KG.LK
Q0U5A6_PHANO/182-337--------------------VPQKNYIV-----------------G--TQI------TADFVLI......PL.R-KG.VE
PALF_YEAST/259-394--------------------IPQAGFMI-----------------G--EII------PIDVKID......HY.K-PF.YA
Q23672_CAEEL/163-311--------------------VPTLVFRQ-----------------G--QTA------EFHFEVK.......N.H-SS.ST
Q6VZJ8_CNPV/177-304--------------------IEKKGYVP-----------------G--EYV------RIVAEIE.......N.N-SS.RA
A7TPY5_VANPO/228-381--------------------APSKAVAI-----------------G--SST------PINMLLV......PL.L-KG.LK
A7A259_YEAS7/232-393--------------------VPNKAVAI-----------------G--SAT------PINISIV......PL.S-KG.LK
Q759V0_ASHGO/221-368--------------------IPSRAVAI-----------------G--TNV------PLDMILV......PY.V-KG.LK
Q9VGU7_DROME/180-316--------------------TSYSAYVP-----------------G--QKI------HFHLVLD.......N.Q-SD.VQ
Q6FM62_CANGA/224-379--------------------VPTKAVAI-----------------G--STT------PVNILLV......PL.L-KG.LK
A7SKJ5_NEMVE/177-307--------------------TDRGGYCP-----------------G--ESI------SVSVYIN.......N.R-TS.TN
Q6CGL3_YARLI/174-329--------------------YPVSSFGP-----------------L--DPI------QVYIKVAANPDIGS..K-SKRVK
A6S0J6_BOTFB/81-239--------------------IPRWSFGP-----------------S--DPV------SVYIHLFPNSLYMKK.A-TK.VV
Q6AZP4_XENLA/162-286--------------------SDLRGYVV-----------------G--QAI------QIHTELE.......N.K-SG.RD
O42103_ORYLA/193-351--------------------LPKETFYH-----------------G--EVL------KANVEIT.......N.S-SS.RN
ARRD5_MOUSE/170-307--------------------MSKNTYVP-----------------G--EKV------TFTSEIR.......N.H-TG.KY
Q17624_CAEEL/176-340--------------------LSKTGYLP-----------------G--EAI------YGNLKIG.......SKH-PK.DI
A0D9C9_PARTE/194-337--------------------FDKTAYQP-----------------G--EIA------QLQVEID......NS.Q-SK.VG
A6ZV52_YEAS7/332-475--------------------IPSRAVPI-----------------G--STT------PVKIKIF......PF.E-KN.IR
A0CE97_PARTE/209-345--------------------LKTNKFFP-----------------G--DKI------SVDYSVD.......NTR-SQ.RP
Q7PYE1_ANOGA/178-310--------------------VPVTGFVS-----------------G--QSV------PVTIECD.......N.A-SN.VG
Q16ZJ6_AEDAE/174-302--------------------IPGTGYVS-----------------G--QSI------PVAVRWK.......NNN-GA...
A7SL06_NEMVE/167-299--------------------IDRAGFYI-----------------G--DEA------QVTVFLD.......N.Q-ST.RD
Q23DV9_TETTS/738-882--------------------SNKAAYDS-----------------C--ESV------TVDININ......NT.D-VT.IP
O45782_CAEEL/179-307--------------------ISKCGYTP-----------------G--EKI------DVSFKVIN.....LS.S-K....
Q17HB8_AEDAE/169-300--------------------LDKRAYIP-----------------G--ENI------LVTGEIY.......N.Q-SN.VT
ADCB_DICDI/337-465--------------------APKNSYYP-----------------G--EDI------ELQVHVN.......N.S-SK.KK
Q23FQ6_TETTS/188-318--------------------LNSRCFIP-----------------N--EII------NIKINAD......LG.Q-NG.NK
Q294M3_DROPS/163-297--------------------LPASGFTP-----------------L--QEV------PFRLEVD.......N.Q-SPHYD
A8WP43_CAEBR/183-324--------------------LPKSGFIP-----------------G--EFI------PIAISIH.......N.H-TK.KP
Q6P8F1_XENTR/195-356--------------------LPKEVFYH-----------------G--EPI------SVSVSVT.......N.N-SD.KT
A3LXL3_PICST/266-408--------------------IAKKGLAI-----------------G--SSI------PINIIIV......PI.A-KG.LS
O17981_CAEEL/182-333--------------------IPKTGFVP-----------------G--ETV------PMNIHIL.......N.H-SS.VP
Q16ZK3_AEDAE/167-301--------------------LSTSGFVP-----------------G--QFI------PVVIQVN.......N.K-GN.NK
A8X383_CAEBR/164-301--------------------LTRTAFQI-----------------G--ESI------EAVVTIN.......N.R-TR.KG
Q9XXI0_CAEEL/180-321--------------------IPKSGYIP-----------------G--ETI------QVSALIQ.......N.H-TK.KP
Q20232_CAEEL/173-309--------------------LERTAYVC-----------------G--ENI------RVRAQIE.......NRQ-ST...
A0BCE6_PARTE/199-335--------------------TAKNLYKP-----------------G--EVL------ELEYTLN.......TTR-SQ.RS
Q5AP77_CANAL/170-448--------------------FPRKYVTL-----------------G--CEH------MINVKLS......PM.V-KD.VV
A0BDM3_PARTE/168-302--------------------YSGEEFSF-----------------G--DQI------NLEISID......LR.E-SK.QY
Q23674_CAEEL/182-339--------------------LPKQGFVC-----------------G--ENI------PVTMIVD.......N.K-TS.KS
ARRD5_BOVIN/171-309--------------------MEKNTFTP-----------------G--ERD------IFTTEIN.......N.Q-TS.KC
Q4T8K9_TETNG/86-210--------------------SDLRGYIP-----------------G--QVI------RLATEIH.......N.K-SG.KD
YA4C_SCHPO/180-322--------------------VPTKAYAI-----------------G--SYI------PIHFVLV......PL.L-KR.LT
Q294M1_DROPS/173-305--------------------TPYCGYAP-----------------G--QKI------HFVLYIN.......N.E-SS.ID
Q4P2K3_USTMA/181-316--------------------RDRSCFGP-----------------G--DNI------TLRIILSS.....DR.I-SP.IK
A7TDW3_VANPO/229-389--------------------VPARAIAI-----------------G--STT------KIHMHLI......PL.I-KG.LQ
Q6FY06_CANGA/237-406--------------------IPSKAVPI-----------------G--SSS------PIDISIT......PL.M-KG.LK
A6R1F7_AJECN/559-759--------------------ISGKSFPL-----------------G--GQV------PIAFKLT.......P.L-AK.VS
Q9XXC4_CAEEL/159-308--------------------FSKRAFLA-----------------G--ETI------RALAIME.......N.H-ST.KP
A7TQH7_VANPO/294-447--------------------IPSRAIPV-----------------G--GIT------PISIKIF......PF.Q-KH.YI
Q16ID9_AEDAE/216-390--------------------LDKELYHH-----------------G--ESL------SVNVHIA.......N.N-SS.KT
PALF_KLULA/263-398--------------------IPCLGYTI-----------------G--EEI------PVKVHVT......HY.K-QY.FH
Q6CG62_YARLI/321-486--------------------IGGKSIPI-----------------G--TKM------QVAFKLT.......P.L-AK.VR
Q4RUP5_TETNG/170-295--------------------TDRMGYMQ-----------------G--ETI------QVTLEIT.......N.C-SC.RS
Q4PD45_USTMA/601-804--------------------FSGKSFPI-----------------G--QQI------PLWLKFV.......P.L-GK.VK
Q9XTU0_CAEEL/176-327--------------------IPKKGYVP-----------------G--ETI------SIETNID.......N.M-SS.RP
YOA5_SCHPO/223-379--------------------LPRTDWLA-----------------G--ESV------VSKIKIE.......N.H-SK.SS
Q0CQZ7_ASPTN/118-273--------------------IPETNIPF-----------------G--STF------PVQFFLA......PL.S-KD.LR

PF07070

Q8DDE9_VIBVU/6-232--------------------LQQEVLYP-----------------G--QAA------NIKVHVY---------GGSSEQE
Q9F2L5_STRCO/29-249--------------------LAPGAARP-----------------G--GTL------SGRVRLV---------GGTVGHD
SP0M_BACSU/4-221--------------------LEKDAYFP-----------------G--EEV------QGTVHVK---------GGKIAQD
Q87KC8_VIBPA/6-231--------------------LNQDVLYP-----------------G--QSV------DVSIHVY---------GGATEQA
Q8EMA6_OCEIH/2-220--------------------LDKEIYMA-----------------G--ETV------TGKILVT---------GGKVEQE
Q8YPP0_NOSS1/22-238--------------------LFNNSVIP-----------------G--GIL------EGEVYIR---------GGDVAQD
Q9KVV0_VIBCH/21-246--------------------LQQEVLYP-----------------G--QSV------KVIIHVY---------GGATAQV
Q935W0_9ACTO/3-222--------------------LDPAPVRP-----------------G--GTL------TGQVRLQ---------GGNAGFD
Q8CK18_STRCO/3-222--------------------LSESNVVP-----------------G--GVV------QGEVRIQ---------GGSVDQE

PF04425

Q6BVD2_DEBHA/1-335--------------------FTNDDIEA.TEKPVLINNETLEYKQG--DTI------RGYITIE-------NLT-SKAIP
A3GGA7_PICST/92-585--------------------VTKSVPQP.HH.KNELETRLKEYTSG--DMV------NGYIIIT-------NNS-NKPVD
A5DRA9_PICGU/36-464--------------------FTKEVGKL.GKKPTYIDPSVYEYKQG--DTV------NGHILIE-------NTS-DEKIR
Q6BJG5_DEBHA/93-577--------------------VTKRVPQP.NL.PNDLETRLKMYSSG--DLV------NGYIIIT-------NTS-DEPVD
A5DPQ0_PICGU/115-602--------------------VTKKVPSP.NQ.KNELETRLKEYSSG--DVV------NGYIIIT-------NTS-DSVVN
Q6BSG0_DEBHA/5-422--------------------VTEKVCQK.GVKPTIIDPSEYEFKQG--DYI------HGYVTMK-------NKS-PVPIS
A5DN76_PICGU/57-484--------------------VTEKPGKL.GVKPSIIDPSVWEFQQG--DNV------NGFLTVT-------NTS-DRKLP
Q6BVD1_DEBHA/28-455--------------------FTKEVGEL.GKEPILIDSRLHEYKQG--DLI------NGFVLIT-------NES-NEPIP
Q5ABB5_CANAL/19-455--------------------LTEHIGKV.GEPYTLVDPLTLELKQG--DYI------YGFVLIT-------NKT-SNVIP
Q876A8_SACEX/140-571--------------------ITKNAPKP.DI.KVPDESILKEYTSG--DII------HGYCTIH-------NKS-PNRLK
Q75E04_ASHGO/51-474--------------------ITKHPVKP.HK.KPEEESILREYTSG--DII------NGYVVIK-------NRS-AQPLK
Q875N4_LACKL/72-505--------------------ITKNAVKP.HI.KPEEESILKEYTSG--DII------HGYAVIS-------NKS-SQPLK
BUL1_YEAST/108-543--------------------TTKHAPIP.HV.KPEEESILKEYTSG--DLI------HGFITIE-------NKS-QANLK
A3LRU1_PICST/29-421--------------------ISSD.....GE..........EHHQG--SVV------TGYMIIE-------NRG-AEPIP
A5E3Q9_LODEL/66-535--------------------VTKDVPRP.NQ.ENELETKLKEYTNG--DHV------NGYVIVT-------NTS-SKPVK
A3LX53_PICST/9-457--------------------MTETVGKV.GVKPKIIDPLSIEIKQG--DYL------YGFVLVT-------NKT-KYDVP
Q6FUH4_CANGA/102-545--------------------ITKHAPSP.NQ.KPEEESILKEYTSG--DLV------HGYCTIE-------NKS-SQPLQ
Q6CSE2_KLULA/69-505--------------------ILKKATKPCEE.KPEEESILKEYTSG--DII------NGFVVIE-------NRS-QHPLR
Q6FP46_CANGA/103-568--------------------ITKHVPKP.HE.KPEEESVLKEFTSG--DII------HGYCVIE-------NRS-TQPLK
Q875T3_NAUCA/106-548--------------------ITKHAGSP.HT.KPEEESILKEYTSG--DII------HGYCIIE-------NKS-SKALP
A3LX54_PICST/5-426--------------------VTEKVCQV.GMKPTVIDPSNKEFRQG--DYI------HGYVTIV-------NKS-DKPIS
Q876B6_SACSE/94-510--------------------ITKNIAKP.HTPKYEEQSMLKEYTNG--DII------HGYCIIS-------NQS-AHKLK
Q876C9_SACBA/7-447--------------------ITKTASIP.HE.RPEEQSILKEYTSG--DII------HGYCLIE-------NRS-PQPLK
Q5AN22_CANAL/97-598--------------------VTKQIPQP.NV.NNDLETRLKEYTSG--DFV------NGYITVI-------NNS-HEPIE
A7TIV7_VANPO/87-537--------------------ITKHAPQP.HE.KPEEESILKEYTSG--DVI------HGYCIIE-------NRS-SQPLK
Q875T4_NAUCA/96-560--------------------VTKDVSKP.HA.KNEEESILKEYTSG--DII------HGYCTIE-------NRS-SKRLK
Q875T2_NAUCA/78-518--------------------LTKQPCVP.HV.KPEEESILKEFTSG--EII------YGYFLVT-------NKS-LEPLP

PF13002

C8ZH73_YEAS8/144-346---------KSWEIQSN------------TQDLSV-GSHSY---------------------------------------
A7TSP7_VANPO/130-321---------KNWDIQKN------------TVEMSV-GSYVF---------------------------------------
C5GL98_AJEDR/142-318---------TSWEFLTE------------PAHLKS-GIHDY---------------------------------------
YNSK_SCHPO/63-242---------QTWDLAAN------------TT.YRP-GTQHW---------------------------------------
C5DVA9_ZYGRC/141-332---------RSWDIQKN------------AKDLPV-GNYSF---------------------------------------

PF00339

ARD15_CAEEL/38-167---------VHSFCAEI------------KGIGRT-GWVNI---------------------------------------
ARRB_CALVI/17-172---------.RKVFAQL------------ATIYRY-GREED---------------------------------------
ARRD1_MOUSE/7-139---------.RAIRVTC------------MGSCGV-STKAN---------------------------------------
O44847_CAEEL/8-127---------.RSVMFRC------------RG.FRN-RTV..---------------------------------------
O17812_CAEEL/8-141---------.RAITLTV------------KGKAET-GWDNV---------------------------------------
O17981_CAEEL/6-159---------.RAVNIKI------------LGLAHT-SWTDY---------------------------------------
O17983_CAEEL/6-146---------.TSVEITF------------SGKTIT-AHNGK---------------------------------------
O17984_CAEEL/4-157---------.RWIDVQL------------HGRSHT-FFTRQ---------------------------------------
O42103_ORYLA/17-174---------.RKVYVML------------SCTFRY-GRQDM---------------------------------------
O42104_ORYLA/14-171---------.RKAFVQM------------ACAFRY-GSDDL---------------------------------------
O45782_CAEEL/7-155---------.NEILLEL------------KGRART-YWTKH---------------------------------------
O76685_CAEEL/6-159---------.RAVNIKI------------LGLAHT-SWTDT---------------------------------------
ARRS_BOVIN/22-180---------.KRVYVSL------------TCAFRY-GQEDI---------------------------------------
ARRB1_BOVIN/18-174---------.RRVYVTL------------TCAFRY-GREDL---------------------------------------
ARRH_LOCMI/25-180---------.RKVFGQL------------TTTYRY-GREED---------------------------------------
ARR1_ONCMY/19-175---------.RKVFVTL------------TCAFRY-GREDL---------------------------------------
ARRS_XENLA/21-176---------.KKVYVTL------------TCAFRY-GQEDI---------------------------------------
ARRH_LIMPO/25-179---------.RKVFGQV------------TTTFRY-GREED---------------------------------------
ARRB_CAEEL/22-186---------NRKVTAHL------------LAAFRY-GREDL---------------------------------------
P91469_CAEEL/7-159---------.RAVNIKI------------VGLAHT-SWKNY---------------------------------------
YC9F_SCHPO/16-169---------.KNIKLRL------------SGRSFV-CWADE---------------------------------------
Q17624_CAEEL/11-155---------.NAVKLQM------------KGRA..-AWLND---------------------------------------
Q20232_CAEEL/7-150---------.RGIRVLL------------RGKVHA-TLKVV---------------------------------------
Q20577_CAEEL/7-158---------.RFLKICI------------HGAAHT-KWSEG---------------------------------------
Q22321_CAEEL/16-154---------.TSLRILF------------HGYGKI-NCKGK---------------------------------------
Q23672_CAEEL/8-142---------.RCVTIKC------------RGKSET-YLINW---------------------------------------
Q23674_CAEEL/4-159---------.RKVRMEM------------IGKAYT-YWEGN---------------------------------------
Q8SYU5_DROME/5-157---------.RGIKLQI------------SGYAQA-QWR..---------------------------------------
Q9BIG9_9NEOP/17-173---------.RKVFGQI------------VCSFRY-GREED---------------------------------------
ARRD2_MOUSE/9-158---------.GALRLRA------------RGRARA-HWTES---------------------------------------
Q9D6S6_MOUSE/17-166---------.RGLRLEA------------QGRATS-AWGPS---------------------------------------
Q9I7L0_DROME/5-150---------.KAITLNI------------TGYAET-RWIER---------------------------------------
Q9PTE8_AMBTI/24-179---------.KKVYVTL------------TCAFRY-GQEDI---------------------------------------
PALF_YEAST/39-201---------.VAIKLSL------------VCEVRV-KTGNS---------------------------------------
Q9V393_DROME/59-214---------.RKVFGQV------------LAAFRY-GREDL---------------------------------------
Q9VGU7_DROME/5-155---------.RSIFITI------------NGYGET-RWQES---------------------------------------
Q9VHZ9_DROME/5-140---------.NAVYVTL------------EGEAKV-QWS..---------------------------------------
Q9VI00_DROME/5-148---------.NEVYILF------------EGEAKV-RWDER---------------------------------------
Q9VI53_DROME/6-155---------.RGIIIRF------------LGEANT-EWSEE---------------------------------------
Q9XXC4_CAEEL/3-136---------.RYMEITW------------KGESKC-NFGGS---------------------------------------
Q9XXI0_CAEEL/6-159---------.LALKICI------------HGDIET-LWRKF---------------------------------------
Q9XXI4_CAEEL/4-156---------.RFLKICI------------HGGAHT-HWSES---------------------------------------

PF03643

VPS26_DICDI/8-284---------HTGIRVEF............VGQIEL-FYDRG..........................NHYE.FTSLVREL
VP26A_HUMAN/8-283---------HQGIRIEF............VGQIEL-FNDKS..........................NTHE.FVNLVKEL
PEP8_YEAST/5-364---------HLGIKVSV............IGSIDM-LKSHGSGNSSSKKVTSSTSSSSSNGSVDVRKNSVDQFLCQSYDL
VP26A_ARATH/8-283---------HNGVKVEL............LGQIEM-YFDRG..........................NFYD.FTSLVREI
VPS26_SCHPO/5-279---------HDGVKIEF............IGQIEN-TYDKG..........................NIHE.FTRSVQEL
VPS26_DROME/6-280---------HQGIKIEF............IGQIEL-YYDRG..........................NHHE.FKCLAKAL
VPS26_CAEEL/7-282---------HQGIRIEF............IGQIEV-YYDRG..........................NQQD.FISLTREL
DSCR3_MOUSE/1-283---------HQGVSLTMEGTVNLQLSAKSVGVFEA-FYNSV..........................KPIQ.IINSTIDV

PF02752

Q7PUI7_ANOGA/236-407.........VRKIRLVA------------VQHVDV-CMF.........................................
Q9TYQ0_CAEEL/174-315KKWMRKKDNHECVLLSL------------CQQLDF-VAVNR.NDPM..................................
Q7PUR5_ANOGA/187-319.........VRSITVKF------------QRVDTF-LSQVP.VV....................................
Q7PYD9_ANOGA/175-306.........IEGVNMKL------------LQEITY-HAEYP.AS....................................
Q380N5_ANOGA/183-323.........VSVIEIRW------------QKILKF-TSQTR.VIGQTQ................................
CRED_ASPOR/181-332.........IGQIVSQL------------IESHDL-TLNPEDPD....................................
Q752Z4_ASHGO/228-382.........LASFSASL------------VQYYAF-TDDAG.......................................
ARRD5_HUMAN/184-321.........IKTVVFAL------------YAHIQY-EGFTP.SAE...................................
ARRD4_HUMAN/191-318.........IVP.KAAI------------FQTQTY-LASG........................................
Q294M9_DROPS/171-302.........VSELRLSL------------VMLVRY-FSLSP.......................................
Q6BI98_DEBHA/278-420.........LKGMSGVI------------VQRSHT-AHSHG.......................................
Q294M7_DROPS/174-306.........VEEITARL------------TMVVIY-YSRPP.CP....................................
Q6BIN4_DEBHA/247-390.........LGDIKIQL------------VEYSSC-VGYLP.......................................
Q293Z7_DROPS/175-308.........VEKLRFSV------------LQYVTY-YSHVP.LR....................................
Q9I7K7_DROME/179-320.........LREAVYSL------------VQISTY-VAHLK.NKPK..................................
Q294M2_DROPS/166-277.........GSAVITRL------------CQCIYY-EGQNP.ER....................................
A5DM18_PICGU/246-387.........LKSLNGCI------------VQHSHV-EHSWG.......................................
Q294M5_DROPS/171-304.........LDGIELQL------------KQVCLL-KAETP.HH....................................
Q16ZK0_AEDAE/170-299.........MHGVQSSL------------DRTECY-RSETP.CE....................................
A0BIT0_PARTE/173-314.........IQNFKFQI------------TSQLVI-LYKQQ.KR....................................
Q4V467_DROME/125-256.........VHEVKVGL------------SMMITY-YSDLS..S....................................
Q7SC90_NEUCR/193-351.........INKITLAI------------EEEITF-NPEGD.......................................
Q66L50_DANRE/187-314.........VVP.KAAL------------YQTQTF-FAKG........................................
Q95NF3_ANOGA/193-351.........VKKIKAMV------------QQGVDV-VLF.........................................
Q6C993_YARLI/185-326.........LGSIKMTL------------VEISVL-TTPFG.......................................
O44847_CAEEL/147-273.........VKKIYAEL------------EAEPFP-LYH.........................................
A0CWE9_PARTE/173-316.........VQKFELKI------------SSQLVV-LYRQQ.KR....................................
Q23QU8_TETTS/188-318.........VNNLNVKL------------LGQLIM-KAS.........................................
Q6ZM71_DANRE/162-286.........TGHVVASL------------MQKVTY-NTKKP.T.....................................
A8WP41_CAEBR/178-317.........VVAVRSKM------------TQLSHF-HASHG.SAMNV.................................
Q0E8K8_DROME/169-299.........IKRTKASL------------TETIEY-LARGK.......................................
A0C0J3_PARTE/194-337.........IPIIKGSV------------TSKLRV-ISKQG.......................................
Q16ZJ7_AEDAE/171-300.........IVGIKSSL------------ERKVTY-ISQYP.RE....................................
Q8T0P7_DROME/23-156.........LNGIELKL------------KQIYKF-QAQTP.HH....................................
Q55N22_CRYNB/182-345.........LRGFEYTL------------SEVITY-IPLPP.GPSSKSKKH.............................
Q23YG0_TETTS/188-318.........IKCLNIKL------------IGLLSM-KAS.........................................
Q9W7R1_ORYLA/193-351.........IKNIIVSV------------DQVATV-VLF.........................................
ARRB_CAEEL/205-363.........VKKLKIYI------------IQVADI-CLF.........................................
Q7RZE0_NEUCR/198-350.........LGEITIRL------------LEVHEF-ILQSHSGYG...................................
ALY2_SCHPO/345-506.........LYKLSISV------------VESSEY-WCRSR.KFHRVDP...............................
Q5AM66_CANAL/305-457.........LGDIKIEL------------IEMYSF-VGSYP.......................................
Q23YG2_TETTS/174-283.........VQSLNVEL------------LGQVTM-KAD.........................................
ARRB2_MOUSE/195-350.........VKKIRVSV------------RQYADI-CLF.........................................
ARRH_LIMPO/199-353.........VKNIKVAV------------VQNTEV-TM..........................................
A2BIP7_DANRE/186-313.........IKP.KYCL------------YEKYSF-FAKGR.......................................
ARRD1_HUMAN/162-286.........TSPVVASL------------LQKVSY-KAKRW.I.....................................
A2QR01_ASPNC/439-613.........CHRIKVYV------------TENIQH-WTADK.SVHRFQP...............................
Q380P6_ANOGA/182-314.........VTEFRVKL------------VQKLCY-SSQQP.AV....................................
YC9F_SCHPO/183-325.........VGKVTLVL------------KEYCTL-FITSK.AYS...................................
A8E775_DROME/192-350.........VKSIKCFI------------VQHTEI-TM..........................................
Q16H74_AEDAE/171-301.........ISELKIKL------------RRQVKY-FSHST.SG....................................
A4VB00_PLADU/42-172.........VKNIRLKL------------DVRTTF-YAQG........................................
Q91X82_MOUSE/175-302.........IVVPKAAI------------VARHTY-LANG........................................
Q6DH07_DANRE/192-355.........VKRIRVTV------------DQTTDV-VLY.........................................
A8X4Z9_CAEBR/175-315.........AYCVRAEL------------KQNSHY-NASRN.SLFSHS................................
ART1_SCHPO/287-428.........VQQLSLSL------------VEYITF-IHPSS.......................................
ARRD2_HUMAN/180-307.........VLP.RAAV------------VQTQTF-MARG........................................
A2ADV1_MOUSE/190-353.........IRRIKIAV------------VQTTDV-VLY.........................................
Q294M6_DROPS/179-311.........CKKLLIMI------------HLRSTY-TADQP.SL....................................
Q963B5_LOLPE/193-352.........AKRIKIQI------------IQLADI-CLY.........................................
ADCC_DICDI/344-478.........IKNVDIQL------------.NKVEY-DGTDV.T.....................................
Q08C63_DANRE/204-330.........IK.LKYSL------------KQLQTF-IAGR........................................
Q6CS19_KLULA/219-373.........LGPIKISL------------VEYSSY-SAPYS.......................................
Q2UDU8_ASPOR/60-215.........LHALTIDV------------IEQHEV-KISAP.AAYSAQF...............................
Q22NR4_TETTS/187-325.........LKSVNVKL------------IREQNF-IKPESGGR....................................
ROD1_YEAST/232-395.........LGPVRISL------------VENSQY-CGSYG.......................................
A0CL31_PARTE/172-315.........VDKVDSVL------------VNRLRL-RSNSD.SEHI..................................
APYA_EMENI/180-326.........IAFIESQL------------LEVRDL-SVEPN.DGG...................................
Q4PCS7_USTMA/465-633.........INGMTLSL------------IRTVTL-YKPRPELNVDGMASR.............................
Q296V0_DROPS/178-310.........LSAVKFEL------------RKLVTF-HTSQP.RS....................................
Q8LKK8_PHYSO/242-377.........MTGISVQL------------VEDLAV-DVPFR.......................................
Q6CW08_KLULA/282-443.........LKKIVVSL------------LQYYAF-KDSAG.......................................
A8WP33_CAEBR/159-305.........IKSVQYTL------------FRHTHF-HKKWQ.PTPCSNS...............................
Q6PBM9_DANRE/191-353.........VKKIKINI------------FQITDV-VIY.........................................
Q9PTE7_AMBTI/190-353.........VKKIKIIV------------EQVTDV-VLF.........................................
A0DYQ7_PARTE/173-314.........IQKFKFSI------------SAQLVV-LYKQQ.KR....................................
A0D2Y0_PARTE/206-342.........VTRVEIRL------------INKLIF-IDDDQ.......................................
Q5KC81_CRYNJ/436-587.........IKNLSLAL------------LQDVRT-FGPKS.ATDQPVETHRKK..........................
A7TQI8_VANPO/357-526.........LHRIRIYL------------TETIDY-YCKGK.KVHRVEPTKKF...........................
Q17EA7_AEDAE/182-314.........VKCITVKL------------QRVDTF-ISQLP.RV....................................
Q9W2V2_DROME/420-633.........VRKVRVCA------------IQHVDV-CMF.........................................
Q240M9_TETTS/188-318.........VNKLTVKL------------LGQLTM-KAN.........................................
Q568E1_DANRE/170-297.........IVP.KYII------------YQKQSF-FAGG........................................
A5DUN4_LODEL/264-404.........LGDIKIQL------------IEFYSY-MGNVP.......................................
A0NDX6_ANOGA/173-303.........IAEVKLKL------------RRQVRY-SSQTP.YK....................................
Q16ZJ5_AEDAE/174-305.........LDEISTKL------------MRVVSF-VSQTP.YT....................................
Q7QCL7_ANOGA/170-301.........IKSTKAAL------------TETIQY-FARDK.......................................
A2QTZ8_ASPNC/184-328.........IATIHTEV------------KETHKV-LQF.........................................
O17983_CAEEL/173-318.........MKIITAKL------------TRRITY-REELK.AKANAKKK..............................
Q9V393_DROME/233-393.........VKKIKVCV------------RQFADI-CLF.........................................
A0BMC5_PARTE/210-346.........ISRVEARL------------INKLTF-IDDDE.......................................
A1C8U8_ASPCL/140-283.........LESINCQL------------VEIEER-KCPL........................................
A0D004_PARTE/178-324.........PEKIIIQL------------ENITQY-KYKNN.IET...................................
Q16ZK1_AEDAE/136-269.........IHLIQLKL------------VMVVAY-TSDTP.RV....................................
Q17EA8_AEDAE/183-323.........VSEIIVKF------------QKVVKF-LSQVQ.VIDST.................................
Q16ZJ8_AEDAE/186-315.........IHAIRSKL------------VRKVCF-ISQTP.TR....................................
PALF_ASHGO/233-368.........SAGLIATL------------VRICRV-HST.........................................
ARRS_MOUSE/200-361.........VKKIKVSV------------EQIANV-VLY.........................................
A8WP37_CAEBR/170-319.........IKSMQFEL------------IRQSHF-HSQHQ.KDFCSLNNCL............................
Q6GR39_XENLA/180-307.........VVP.KAAI------------IQSQAF-IARG........................................
Q5BAI3_EMENI/174-332.........INKITIGI------------DEEIIY-NHEGD.......................................
Q5C229_SCHJA/8-167.........VKKIKLSV------------VQITDI-ALF.........................................
Q9GYT5_CAEEL/181-328.........VNNIKAQM------------LQQCKF-TGYKSGATYNYGGDFER...........................
MU170_SCHPO/266-426.........IHNIKARL------------LETHIF-HPNTQ.NHYGGYCMNQAEETFA......................
Q5AI11_CANAL/271-413.........LKAINGCI------------VEHYHV-QIGNE.......................................
A5DW17_LODEL/261-403.........LKAMNACI------------VEHYHI-EVDNI.......................................
A0D012_PARTE/172-315.........IENVDVII------------VNRLNI-KSNSG.SQCH..................................
ADCA_DICDI/313-441.........TRKISLVV------------HHTMQL-KTRL........................................
Q9I7L0_DROME/174-307.........VEQLLISF------------VMLVTY-HSKPPSMP....................................
A7SF55_NEMVE/129-256.........PYETCVYL------------VQSITY-KSSCG.RTR...................................
Q16ZK2_AEDAE/273-408.........IRKVTTVL------------IQQTTF-SARWP.KA....................................
A8XYD8_CAEBR/172-316.........IRIIQAKL------------NRLVTY-REELQ.GKNKKRNP..............................
Q9VHZ8_DROME/164-279.........VQDFLTRL------------CKKISY-TSQQP.SA....................................
A0E996_PARTE/174-317.........LLNLTFSV------------QSQLII-LYPVL.KL....................................
A6S093_BOTFB/188-324.........IGKIKCHL------------IEVQEF-VLPGTSTTS...................................
Q0U5A6_PHANO/182-337.........IATIKMEL------------IESRQL-FADYA.GRR...................................
PALF_YEAST/259-394.........PAGLTTTL------------VRICRV-GGA.........................................
Q23672_CAEEL/163-311.........INEIFIKF------------GKQVHY-HSRNQ.LTPCRKFDS.............................
Q6VZJ8_CNPV/177-304.........VMP.NVCI------------YQIQTF-YTDR........................................
A7TPY5_VANPO/228-381.........LGPIKIAL------------VESSQF-CGNFG.......................................
A7A259_YEAS7/232-393.........LGSIKVVL------------FENYQY-CDPFP.......................................
Q759V0_ASHGO/221-368.........LGTVKASI------------VENLTF-ATPYG.......................................
Q9VGU7_DROME/180-316.........CMDVKVRL------------IKNVSY-RANSS.GAK...................................
Q6FM62_CANGA/224-379.........LGSIRMTL------------IEKYSY-GSKSD.......................................
A7SKJ5_NEMVE/177-307.........LPGIDLVL------------RQITVY-IASCG.......................................
Q6CGL3_YARLI/174-329.........LVKVSIQV------------VEVITY-NPEGD.......................................
A6S0J6_BOTFB/81-239.........IQKITIGI------------EEEITY-NPEGD.......................................
Q6AZP4_XENLA/162-286.........TSSIVASL------------IQKIAY-KSKRV.V.....................................
O42103_ORYLA/193-351.........IKDISLSV------------EQVTNV-VLY.........................................
ARRD5_MOUSE/170-307.........IKTVVFAL------------YAHVQY-EGFTP.SAE...................................
Q17624_CAEEL/176-340.........LNHMEARL------------VDRVRR-VGAPEISA....................................
A0D9C9_PARTE/194-337.........IPTITGRL------------TNTLRI-VSKQG.......................................
A6ZV52_YEAS7/332-475.........LDRIEMAL------------IQYYAM-KDSSA.......................................
A0CE97_PARTE/209-345.........VNRIEVRV------------IHKLIF-IDNDE.......................................
Q7PYE1_ANOGA/178-310.........VEKITINL------------RKLLAF-HVHTP.RR....................................
Q16ZJ6_AEDAE/174-302.........IRGIRIKL------------FKHETY-SATEP.YE....................................
A7SL06_NEMVE/167-299.........VTDVEICL------------FQFTTY-IYGTD.EN....................................
Q23DV9_TETTS/738-882.........LETLTFNL------------IKEIQF-NGKTK.NQYIK.................................
O45782_CAEEL/179-307.........TRTTALRF------------VQQTTY-KAKTF.AGH...................................
Q17HB8_AEDAE/169-300.........IKAVKYAL------------METIQY-YAHGK.......................................
ADCB_DICDI/337-465.........VKKIELEL------------QRTISI-QHEK........................................
Q23FQ6_TETTS/188-318.........VKNFSIKI------------IGLLEM-KAC.........................................
Q294M3_DROPS/163-297.........IIGVEVSI------------RQHFVF-LSRKP.......................................
A8WP43_CAEBR/183-324.........LYYLKAQL------------IQHVHY-QAQQE.NSHFNSDE..............................
Q6P8F1_XENTR/195-356.........VKKISASV------------EQVSNV-VLY.........................................
A3LXL3_PICST/266-408.........IRKIHGCI------------VQHYHV-MYEEG.......................................
O17981_CAEEL/182-333.........VTEVKAKI------------IQQCKF-IAYRNGTIFRFDGGSD............................
Q16ZK3_AEDAE/167-301.........MTRIVTML------------VQKAIY-SAKRP.FV....................................
A8X383_CAEBR/164-301.........LKEVALQL------------IMKTQF-EARSR.YEH...................................
Q9XXI0_CAEEL/180-321.........IYSIKAKL------------EQHVHY-QAQQE.NSHLFPEE..............................
Q20232_CAEEL/173-309.........AQSLVIRL------------VQHVEV-FVEKGLLG....................................
A0BCE6_PARTE/199-335.........ITKVEVKL------------NHFLSF-TDDDE.......................................
Q5AP77_CANAL/170-448.........IKRIKFNV------------LERITY-VSKNL.SREYDYDSEDPYCIHPVSKENKVRERVVSLYELKTKAK
A0BDM3_PARTE/168-302.........IQEIVMSL------------NKRTTI-MAK.........................................
Q23674_CAEEL/182-339.........FKKISLRL------------VQRVTY-TGFRDGFVNSHSQPCIGNE.........................
ARRD5_BOVIN/171-309.........IKTVIFAL------------YAHVHY-EGFTP.NAE...................................
Q4T8K9_TETNG/86-210.........TGCVLASL------------IQKVSY-KTRRP.L.....................................
YA4C_SCHPO/180-322.........IGKISITL------------KEYITL-HVAHG.YNG...................................
Q294M1_DROPS/173-305.........ITECEVKL------------KQEVSY-ESHDP.HH....................................
Q4P2K3_USTMA/181-316.........VKSISFSI------------RETITF-KGSAK.KTFGSN................................
A7TDW3_VANPO/229-389.........LGPIKINL------------IENSQY-CGSYS.......................................
Q6FY06_CANGA/237-406.........LGPVKVQL------------VEVGQL-CSATG.......................................
A6R1F7_AJECN/559-759.........LHRIKVIV------------SENTQV-VANNR.TYHRVDG...............................
Q9XXC4_CAEEL/159-308.........IINLRFEL------------IQQSHY-HSRPQ.KSLCSLNDCH............................
A7TQH7_VANPO/294-447.........LEKIGVTL------------IQFYSM-KDSSG.......................................
Q16ID9_AEDAE/216-390.........VKKIKVSV------------RQFADI-CLF.........................................
PALF_KLULA/263-398.........PAGLIATL------------VRISRV-SNP.........................................
Q6CG62_YARLI/321-486.........CHRIRIYI------------SENIDY-YCRKM.KIHRVEP...............................
Q4RUP5_TETNG/170-295.........VKP.TFAL------------YERQSF-FAQG........................................
Q4PD45_USTMA/601-804.........IYRILATL------------EERTDY-FAKGR.RVARHEVPR.............................
Q9XTU0_CAEEL/176-327.........ILKTECYL------------IQQCRF-LAYRYGISGPTDGRRAS...........................
YOA5_SCHPO/223-379.........IKTLKLCL------------YRRIIG-FDPPS.WKTQQMM...............................
Q0CQZ7_ASPTN/118-273.........LGAVTIQV------------VEKHEL-KIRAS.AAYSVQY...............................

PF07070

Q8DDE9_VIBVU/6-232---------IDNIHLKL------------CCRYIA.EVKED---------------------------------------
Q9F2L5_STRCO/29-249---------VEHVALEL------------VARVETGDGEHG---------------------------------------
SP0M_BACSU/4-221---------IRYIDLQL------------STRYVI.VKDDE---------------------------------------
Q87KC8_VIBPA/6-231---------IDNIDMKL------------CCRYIA.EAPDD---------------------------------------
Q8EMA6_OCEIH/2-220---------IDQIYLSV------------NTKYIK.ESDDD---------------------------------------
Q8YPP0_NOSS1/22-238---------IQDIYLKL------------ATEYQR.EVDDS---------------------------------------
Q9KVV0_VIBCH/21-246---------IDNIELKL------------CCCYIA.EVADE---------------------------------------
Q935W0_9ACTO/3-222---------IEHITLEL------------VARVEA.EHDGG---------------------------------------
Q8CK18_STRCO/3-222---------IEGLSVGL------------QAKVEV.ESGDQ---------------------------------------

PF04425

Q6BVD2_DEBHA/1-335---------LNVYYVLF------------EGIYC.-.....---------------------------------------
A3GGA7_PICST/92-585---------FGLFTVSL------------EGTIKA-TERNT---------------------------------------
A5DRA9_PICGU/36-464---------FDMMYVVF------------EGSFLV-ANA..---------------------------------------
Q6BJG5_DEBHA/93-577---------FGLFVVTL------------DGTIKT-THSNP---------------------------------------
A5DPQ0_PICGU/115-602---------FGLFTVSL------------EGTIKA-TERMD---------------------------------------
Q6BSG0_DEBHA/5-422---------FDMVYVVF------------EGMLVV-LEN..---------------------------------------
A5DN76_PICGU/57-484---------FDALSVVL------------EGRVMV-TSD..---------------------------------------
Q6BVD1_DEBHA/28-455---------FDMFYVLF------------EGNLTV-ANT..---------------------------------------
Q5ABB5_CANAL/19-455---------FDMFSVQL------------EGCAIF-GK...---------------------------------------
Q876A8_SACEX/140-571---------FEMFYVTL------------EGYISI-IDR..---------------------------------------
Q75E04_ASHGO/51-474---------FEMFYVTL------------EGYATV-IDR..---------------------------------------
Q875N4_LACKL/72-505---------FEMFYVTL------------EGYAAI-VDK..---------------------------------------
BUL1_YEAST/108-543---------FEMFYVTL------------ESYISI-IDK..---------------------------------------
A3LRU1_PICST/29-421---------FEMYYVTL------------EGSSTV-LETR.---------------------------------------
A5E3Q9_LODEL/66-535---------FGLFTVSL------------EGTIKS-LERSA---------------------------------------
A3LX53_PICST/9-457---------FDMFSTVL------------EGCATF-GSNG.---------------------------------------
Q6FUH4_CANGA/102-545---------FEMFYVTL------------EAYTSV-IDK..---------------------------------------
Q6CSE2_KLULA/69-505---------FEMFYVTL------------EGCACV-IDK..---------------------------------------
Q6FP46_CANGA/103-568---------FEMFYVTL------------EAYISI-VDK..---------------------------------------
Q875T3_NAUCA/106-548---------FEMFYVTL------------EAYTSV-IDK..---------------------------------------
A3LX54_PICST/5-426---------FDMVYIVF------------EGVITV-LDN..---------------------------------------
Q876B6_SACSE/94-510---------YEMFYVTL------------EGYISF-VDR..---------------------------------------
Q876C9_SACBA/7-447---------FEMFYVTL------------EAYISV-IDR..---------------------------------------
Q5AN22_CANAL/97-598---------FGLFTVSL------------EGTIKS-VERNP---------------------------------------
A7TIV7_VANPO/87-537---------FEMFYVTL------------EAYTSV-IDR..---------------------------------------
Q875T4_NAUCA/96-560---------FEMFYVTL------------EAYISI-IDR..---------------------------------------
Q875T2_NAUCA/78-518---------FEMFYVTL------------EAYTSI-VDK..---------------------------------------

PF13002

C8ZH73_YEAS8/144-346-PFSYLIPGS---------VPCS----SSLGAT---AETQVKY--ELIAVVTYID-------------------------
A7TSP7_VANPO/130-321-PFSCLIPGS---------VPAT----TTLGST---AETEIKY--ELIATVKYKD-------------------------
C5GL98_AJEDR/142-318-PFSYLFAGN---------LQPT----TQ...G---SLGAVSY--NLTACAVT..-------------------------
YNSK_SCHPO/63-242-PFSWLFPGS---------LPAS----VS...N---RYIKLEY--YLEATLCY..-------------------------
C5DVA9_ZYGRC/141-332-PFSCLISGS---------FPAK----SALGSN---SETQIKY--ELCAVVTYKD-------------------------

PF00339

ARD15_CAEEL/38-167-HTDKIFETE.............----.....K...TYIDTQV--QLCDS...---------------------------
ARRB_CALVI/17-172-EVMGVKFSKELILCREQIVPMG----NS..NM...EMTPTQE--KLVRK...---------------------------
ARRD1_MOUSE/7-139-DGAWVV................----....EE...SYFNSSL--SLADK...---------------------------
O44847_CAEEL/8-127-......................----.........SFLNKYG--IAWIC.KD---------------------------
O17812_CAEEL/8-141-TKVGQW................----.........TYFNESG--VLWKA.EM---------------------------
O17981_CAEEL/6-159-DSVRRVDNDGN...VRYDSESV----HYSSNV...HYLDQAL--LLWAC.KD---------------------------
O17983_CAEEL/6-146-KIIKDKKCK.............----..KGEE...TYVEMKH--EVWTP.ED---------------------------
O17984_CAEEL/4-157-ESETKTNSKGE...SETKTHTV----HYTATA...KHLDTAV--PLWRK.TD---------------------------
O42103_ORYLA/17-174-DVMGVAFRRDLFLVTRQVYPEL----QDKEKL...THTKIQQ--KLLRK...---------------------------
O42104_ORYLA/14-171-DVMGLCFRKDIWIQQIQIYPES----S...KP...ALSAMHD--TLLKK...---------------------------
O45782_CAEEL/7-155-SGKSRKHCS..........HSE----PYFLEQFNPGYTHKFT--VVKDG.KE---------------------------
O76685_CAEEL/6-159-ERVRKVNAEGK...EAYETKIV----NYSANV...NYLDYSL--LLWAS.SD---------------------------
ARRS_BOVIN/22-180-DVMGLSFRRDLYFSQVQVFPPV----GA..SG...ATTRLQE--SLIKK...---------------------------
ARRB1_BOVIN/18-174-DVLGLTFRKDLFVANVQSFPPA----PED.KK...PLTRLQE--RLIKK...---------------------------
ARRH_LOCMI/25-180-EVMGLKFTKEMVLAKEQIVPQT----KE..KM...ELTPIQE--RLMKK...---------------------------
ARR1_ONCMY/19-175-DVLGLSFRKDLYISTFQAFPPI----AEE.RK...ANSRLQE--RLLKK...---------------------------
ARRS_XENLA/21-176-DVIGLTFRKDLYYARTQIYPPV----ED..PK...ALTKVQE--RLMKK...---------------------------
ARRH_LIMPO/25-179-EVMGLHFSRQLYLALEQVLP.T----KK..NE...APSDFQN--RLVRK...---------------------------
ARRB_CAEEL/22-186-DVLGLTFRKDLISETFQVYPQT----DKSISR...PLSRLQE--RLKRK...---------------------------
P91469_CAEEL/7-159-ENSCKLSFHRI...VSYRPHGV----YYSANV...KYLDYTQ--LLWTC.GE---------------------------
YC9F_SCHPO/16-169-SRHASPGN..............----.........RIRRQVV--QILDK.SW---------------------------
Q17624_CAEEL/11-155-PLKKDDIEK.............----.........VYFDQDF--TLLER.PP---------------------------
Q20232_CAEEL/7-150-KSGERRTLK.............----...DDQ...YVLDEKQ--LLWGK.DK---------------------------
Q20577_CAEEL/7-158-ERRYRTNCEGK...EESYTEIV----HYSAEV...DYVSGET--IAWSA.RN---------------------------
Q22321_CAEEL/16-154-KDELLQENM.............----.........TYMKKFS--NAISQ...---------------------------
Q23672_CAEEL/8-142-TDLYCKK...............----.........DLFRKSE--MVWVS.KD---------------------------
Q23674_CAEEL/4-159-VRNNHTKIKNGD.IARVRHNCA----DHKGKI...VYCRFET--IVWKS.DG---------------------------
Q8SYU5_DROME/5-157-...IRRHGKAVAIQNPKKRSKH----QYSGRE...DYIASTT--YLMGSEQG---------------------------
Q9BIG9_9NEOP/17-173-EVMGLNFRKDLTLVSEQIYP.S----NE..KV...ETTKLQD--RLIKK...---------------------------
ARRD2_MOUSE/9-158-RSAGSSTAY...........TQ----SYSERV...EVVNHRA--TLLAP.DS---------------------------
Q9D6S6_MOUSE/17-166-AGARVCIGG..........GSP----AASSEV...EYLNLRL--SLLEA.PA---------------------------
Q9I7L0_DROME/5-150-VTTNRRRRR............R----TFCGRE...DYIASKT--FLVGSNLS---------------------------
Q9PTE8_AMBTI/24-179-DVMGLTFRKDIYFSRTQVYPPV----EN..TK...ATTKVQE--RLMKK...---------------------------
PALF_YEAST/39-201-PTSKNKRIE.......KTLEKS----TFLYGQ...DYVKTAF--SAKEK.KP---------------------------
Q9V393_DROME/59-214-DVLGLTFRKDLYLAHEQIYPPM----QL..DR...PMTRLQE--RLIKK...---------------------------
Q9VGU7_DROME/5-155-EERVGEDGK.......TTKSLV----THTTTE...VYYSTDQ--PVYGQ.AG---------------------------
Q9VHZ9_DROME/5-140-.........M.....SGKSETA----NYSGHQ...QYLHSRT--NVFDN...---------------------------
Q9VI00_DROME/5-148-RTRTRGGKT........EHYTE----YFRGKQ...QYLYTRT--SVFGS...---------------------------
Q9VI53_DROME/6-155-KSVTTSEGK.......TENEVT----QLKGHE...EYFKIQY--YLLGGKNS---------------------------
Q9XXC4_CAEEL/3-136-ESSNVQ................----.........RHLAGTF--MGWIA.KD---------------------------
Q9XXI0_CAEEL/6-159-ENKGRYDRHGR...WYRSSEHI----NYTSKI...NVLEGIA--QPWSSIEN---------------------------
Q9XXI4_CAEEL/4-156-RSTYRTNTRGE...RERFTENV----NYNATI...NYLTGES--IAWQS.RD---------------------------

PF03643

VPS26_DICDI/8-284APAGELTENKT.FSYDFSNVEKQ....YESYNG---TNVRLRY--FVRLTIGRSF.ASNIVKEYDIWVI...........
VP26A_HUMAN/8-283ALPGELTQSRS.YDFEFMQVEKP....YESYIG---ANVRLRY--FLKVTIVRRL..TDLVKEYDLIVH...........
PEP8_YEAST/5-364CPAGELQHSQS.FPFLFRDLSKR....YESYKG---KNVDVAY--YVKVTVMRKS..TDISKIKRFWVY...........
VP26A_ARATH/8-283DVPGEIYERKT.YPFEFSSVEMP....YETYNG---VNVRLRY--VLKVTVTRGY.AGSIVEYQDFVVR...........
VPS26_SCHPO/5-279ASPGEMRHAQM.FEFEFKHVDKP....YESYIG---KNVKLRY--ICRVTVSRKM..KDVIREKDLWVY...........
VPS26_DROME/6-280ARPGDLIQNNS.YPFDFPKVEKQ....FEVYAG---SNVRLRY--FLRATIVRRI..SDITKEVDIAVH...........
VPS26_CAEEL/7-282ARPGDLTQNAQ.FPFEFNNVEKP....FETYMG---TNVKLRY--FLRVTVIRRL..TDLTKELDLVVH...........
DSCR3_MOUSE/1-283LKPGKIPSGKTEVPFEFPLLVKGSKVLYETYHG---VFVNIQY--TLRCDMRRSLLAKDLTKTCEFIVHSAPQKGKLTPS

PF02752

Q7PUI7_ANOGA/236-407...............................SNG.KFKNIVAE.VDVSKHI..---------------------------
Q9TYQ0_CAEEL/174-315.............................MIDRK.SITIAVES..HGTCKT..---------------------------
Q7PUR5_ANOGA/187-319...............................QQH.LEHTVLEE..RTIGRV..---------------------------
Q7PYD9_ANOGA/175-306...............................KTR.RETHTIVK..HIGDGV..---------------------------
Q380N5_ANOGA/183-323...........................IPKEESN.VQYEVLEV..RKIPSI..---------------------------
CRED_ASPOR/181-332...............................SIR.NTYKNTRT..ILNDEFEL---------------------------
Q752Z4_ASHGO/228-382...............................QVY.DDEAVAHR..AAMEHFTD---------------------------
ARRD5_HUMAN/184-321.............................RRSRL.DSSELLRQ..EANTPV..---------------------------
ARRD4_HUMAN/191-318...............................KTK.TIRHMVAN..VRGNHI..---------------------------
Q294M9_DROPS/171-302...............................EHA.RVERIIIS.RAKGDAV..---------------------------
Q6BI98_DEBHA/278-420...............................VSG.DFEELIGK.QTMSIPD..---------------------------
Q294M7_DROPS/174-306...............................DTN.KDRFVVAE..KAGEGV..---------------------------
Q6BIN4_DEBHA/247-390...............................PAH.SEERVVVS.KTISQPNE.---------------------------
Q293Z7_DROPS/175-308...............................VQK.VECIAIAN..KETGSV..---------------------------
Q9I7K7_DROME/179-320.............................RLETK.VERQTVLSSRHELHNL..---------------------------
Q294M2_DROPS/166-277...............................KIK.KVIRILSE..........---------------------------
A5DM18_PICGU/246-387...............................RSP.EYEEIIGK.QDLKINP..---------------------------
Q294M5_DROPS/171-304...............................KTR.DIEKKLHG.CCQGERV..---------------------------
Q16ZK0_AEDAE/170-299...............................KTK.VISKTFAS...VSTAI..---------------------------
A0BIT0_PARTE/173-314...............................KLS.NYFDLFDQ..ELNF....---------------------------
Q4V467_DROME/125-256...............................GSK.CERKSVAK..LKADGV..---------------------------
Q7SC90_NEUCR/193-351...............................EPT.KKVNKIAK.HTQPVGV..---------------------------
Q66L50_DANRE/187-314...............................KVK.EIKQLIAN..LRGDPL..---------------------------
Q95NF3_ANOGA/193-351...............................QNG.SYRNTVAS..LETSEGC.---------------------------
Q6C993_YARLI/185-326...............................HNK.QVEKVVAN.KTIEATA..---------------------------
O44847_CAEEL/147-273...................................IYGNTKAK.GKMHVLV..---------------------------
A0CWE9_PARTE/173-316...............................KLS.NYFDIYLQ..ELNEQI..---------------------------
Q23QU8_TETTS/188-318...............................NTQ.RTKYINIF..EKMVNV..---------------------------
Q6ZM71_DANRE/162-286...................................YDLRSVAE..VEGPGV..---------------------------
A8WP41_CAEBR/178-317...........................THHTHHK.NDEKCVAE.SRRNFDV..---------------------------
Q0E8K8_DROME/169-299...............................VVQ.TEKRELAV..LVRGKI..---------------------------
A0C0J3_PARTE/194-337...............................HAR.VLYRVCAS..SSIQGI..---------------------------
Q16ZJ7_AEDAE/171-300...............................KSR.VVGKCLAS...VWTTV..---------------------------
Q8T0P7_DROME/23-156...............................KTR.EKEHSLNK.SCQQERV..---------------------------
Q55N22_CRYNB/182-345........................KISTAPVTKA.RPIQTVRA..PLNENI..---------------------------
Q23YG0_TETTS/188-318...............................NTQ.REKHVVIY..EQPMSV..---------------------------
Q9W7R1_ORYLA/193-351...............................SND.SYTKCVDY..EDNGDS..---------------------------
ARRB_CAEEL/205-363...............................TTA.SYSCEVAR..IESNEGF.---------------------------
Q7RZE0_NEUCR/198-350..............................VREH.KKEREISV.WKIPIEREK---------------------------
ALY2_SCHPO/345-506.........................KRRVLLAER.SAKHQNTD.NLFETPD..---------------------------
Q5AM66_CANAL/305-457...............................PMK.TDERIIAK.KKIPKRKKN---------------------------
Q23YG2_TETTS/174-283...............................NNF.REKKFKLY..EKIMSV..---------------------------
ARRB2_MOUSE/195-350...............................STA.QYKCPVAQ..LEQDDQ..---------------------------
ARRH_LIMPO/199-353...............................VNG.HFHKTISS..IESKEGC.---------------------------
A2BIP7_DANRE/186-313................................RK.IHTHDLLK..EVGESV..---------------------------
ARRD1_HUMAN/162-286...................................HDVRTIAE..VEGAGV..---------------------------
A2QR01_ASPNC/439-613.........................AKKVLLFEK.RADSASTS.EEIVDRNRT---------------------------
Q380P6_ANOGA/182-314...............................ETR.TDALVVAE..SRCSGV..---------------------------
YC9F_SCHPO/183-325.............................STCRK.EFKRALVK.KTIPGL...---------------------------
A8E775_DROME/192-350...............................VNA.QFSKHVAQ..LETKEGC.---------------------------
Q16H74_AEDAE/171-301...............................KSK.SVLSTLVK..YQCGGV..---------------------------
A4VB00_PLADU/42-172...............................KSK.TTWKTISE..IRRSGI..---------------------------
Q91X82_MOUSE/175-302...............................QTK.VFTQKLSS..VRGNHI..---------------------------
Q6DH07_DANRE/192-355...............................SAD.KYTKNVLT..EEFGET..---------------------------
A8X4Z9_CAEBR/175-315...........................SCHDHHK.DDSKRVAE.TRKNIKI..---------------------------
ART1_SCHPO/287-428...............................SSPIVRKKKVLR.YEEDLDD..---------------------------
ARRD2_HUMAN/180-307...............................ARK.QKRAVVAS..LAGEPV..---------------------------
A2ADV1_MOUSE/190-353...............................SLD.KYTKTVFV..QEFTET..---------------------------
Q294M6_DROPS/179-311...............................RTT.SEKIMLVK..RECGPV..---------------------------
Q963B5_LOLPE/193-352...............................ETV.TYKSVVTE..LETEEGF.---------------------------
ADCC_DICDI/344-478...............................GTS.YQLLTMTK..KFYPKI..---------------------------
Q08C63_DANRE/204-330...............................STN.HAHKDIVK..ETKDCI..---------------------------
Q6CS19_KLULA/219-373...............................NPN.GADRTILK.VKIQDPLHH---------------------------
Q2UDU8_ASPOR/60-215..........................NVHFLSSK.REHIIFNE..RHNLDDC.---------------------------
Q22NR4_TETTS/187-325...............................ENK.QKKLTISD..INLIQI..---------------------------
ROD1_YEAST/232-395...............................GVI.NQERMVAK.LKLKDPLKH---------------------------
A0CL31_PARTE/172-315.............................LEFQL.NYQHHKGP..QKGNKI..---------------------------
APYA_EMENI/180-326.............................SAHAA.RTETIVCS.DRYTLGEE.---------------------------
Q4PCS7_USTMA/465-633.......................RDLDPDACSTS.TTRKKIAE.EELEMGQKG---------------------------
Q296V0_DROPS/178-310...............................EKR.ESKVIISN..LSIGPV..---------------------------
Q8LKK8_PHYSO/242-377...............................TQK.RGSTVLCR..RDFPGV..---------------------------
Q6CW08_KLULA/282-443...............................EVY.DDENVIQK..QMLARFDD---------------------------
A8WP33_CAEBR/159-305..........................YKCHLHNS.EQFFTYGR.YGKGEKHK.---------------------------
Q6PBM9_DANRE/191-353...............................AAD.KYHKCVLN..EEFGDQ..---------------------------
Q9PTE7_AMBTI/190-353...............................SLD.KYVKTVCA..EETNDT..---------------------------
A0DYQ7_PARTE/173-314...............................KLS.NYFDIFDQ..ELIF....---------------------------
A0D2Y0_PARTE/206-342...............................IDRVILNQVVFS..KILPGA..---------------------------
Q5KC81_CRYNJ/436-587.....................VAEEAVEGDFTTH.GAGRVTGK..GWWTGV..---------------------------
A7TQI8_VANPO/357-526......................LLAEHNGPKLENLGENNNSSK.AKYLGNLL.---------------------------
Q17EA7_AEDAE/182-314...............................EQR.QEFTVLEE..RITGKI..---------------------------
Q9W2V2_DROME/420-633...............................NNG.KFKNVVAD..SDNVTPP.---------------------------
Q240M9_TETTS/188-318...............................TAD.KTKVLNIA..EKSIEV..---------------------------
Q568E1_DANRE/170-297...............................QRA.VHTTEILK..EKGEPL..---------------------------
A5DUN4_LODEL/264-404...............................PMH.SAERVIAS.KKIPKKD..---------------------------
A0NDX6_ANOGA/173-303...............................QVR.TVYNTLAK..FQCSGV..---------------------------
Q16ZJ5_AEDAE/174-305...............................RVK.NLSTIVAQ..VRCAGV..---------------------------
Q7QCL7_ANOGA/170-301...............................VMQ.TEKRELAV..IARGKI..---------------------------
A2QTZ8_ASPNC/184-328...............................TLS.RRARVIAE.DDFYPRDWN---------------------------
O17983_CAEEL/173-318........................ADGADGFKSK.LEEQILET.KIERCNV..---------------------------
Q9V393_DROME/233-393...............................STA.QYKSVVAE..IESEDGC.---------------------------
A0BMC5_PARTE/210-346...............................IERVVENVKVFQ..QNLGGV..---------------------------
A1C8U8_ASPCL/140-283...............................QAI.RSRDILTD.NYTAAGWG.---------------------------
A0D004_PARTE/178-324.............................RSKII.AEEQISTT.TKKLGSY..---------------------------
Q16ZK1_AEDAE/136-269...............................KVK.TNRQDVTG..AELDQV..---------------------------
Q17EA8_AEDAE/183-323...........................QLYAENKLIKYETIEM..QRTSAV..---------------------------
Q16ZJ8_AEDAE/186-315...............................KAR.NEAKTVAK...MVTTV..---------------------------
PALF_ASHGO/233-368...............................GTD.DPMETFRK..DICQCVA.---------------------------
ARRS_MOUSE/200-361...............................SSD.YYVKPVAS..EETQEK..---------------------------
A8WP37_CAEBR/170-319.......................KDCPVPPVYTR.NCEKVLNS.RVYPCNV..---------------------------
Q6GR39_XENLA/180-307...............................TMK.QKKSVVAT..LAGDAV..---------------------------
Q5BAI3_EMENI/174-332...............................EPQ.RKVKTLTK.RTEPIGV..---------------------------
Q5C229_SCHJA/8-167...............................SRA.IYKCTVDE..AEYDESF.---------------------------
Q9GYT5_CAEEL/181-328......................NEKMSDKIQRIK.FDTKKVVK.VCQKLEV..---------------------------
MU170_SCHPO/266-426................SCGYLKRYQKTKTKTRAK.STWKIANK..SVYSNL..---------------------------
Q5AI11_CANAL/271-413...............................RSP.EYERVIGK.QDLDAPN..---------------------------
A5DW17_LODEL/261-403...............................RSP.EFERLCGK.QQLHFPD..---------------------------
A0D012_PARTE/172-315.............................LEFQL.SALSQNGL..QKGLKI..---------------------------
ADCA_DICDI/313-441...............................YHR.CITNAIYK..QQYDGF..---------------------------
Q9I7L0_DROME/174-307...............................NTT.SERLVVNT..FKGDAV..---------------------------
A7SF55_NEMVE/129-256..............................SVNK.QVKVLQRS..SMSLEL..---------------------------
Q16ZK2_AEDAE/273-408...............................RQR.IESVVVSK..NVSPGI..---------------------------
A8XYD8_CAEBR/172-316.........................ANAKGFKSQ.AEKTVLET.KIERCQI..---------------------------
Q9VHZ8_DROME/164-279...............................KTK.NVTQVLSE..........---------------------------
A0E996_PARTE/174-317...............................RIS.NYFGLSKQ..AHNIVV..---------------------------
A6S093_BOTFB/188-324..............................DRYW.KNSRDVDA.WTFELNEEE---------------------------
Q0U5A6_PHANO/182-337.............................ISHQT.DVQVAVTE.GDMPPNSAN---------------------------
PALF_YEAST/259-394...............................GKD.DPMETFRK..DICQSIS.---------------------------
Q23672_CAEEL/163-311.......................HSCPLSVYHQT.NSSNCIGE..ATALKVN.---------------------------
Q6VZJ8_CNPV/177-304...............................NIK.KVRNLITS..SRGKQL..---------------------------
A7TPY5_VANPO/228-381...............................TII.NQERIVTK.MKVKDPLNY---------------------------
A7A259_YEAS7/232-393...............................PVI.SENRQVTE.LNLEDPLNE---------------------------
Q759V0_ASHGO/221-368...............................GSK.AEERTVSK.IKLSDPLGH---------------------------
Q9VGU7_DROME/180-316..............................EQLK.VTESRVAD..KHCGEV..---------------------------
Q6FM62_CANGA/224-379...............................PKQVEKERKVTQ.MKIRNPLKE---------------------------
A7SKJ5_NEMVE/177-307...............................KQR.RRTNEILR..HNHPGV..---------------------------
Q6CGL3_YARLI/174-329...............................EPV.EKRRKVVK.NTKQVDQ..---------------------------
A6S0J6_BOTFB/81-239...............................EPT.KKINRIAK.QTATVGA..---------------------------
Q6AZP4_XENLA/162-286...................................YDLRTIAE..VEGAPV..---------------------------
O42103_ORYLA/193-351...............................SND.KYVKSVAK..EETDDS..---------------------------
ARRD5_MOUSE/170-307.............................RRRRA.DSSELLRQ..MANARI..---------------------------
Q17624_CAEEL/176-340...............................ASP.WRTLLVRK.LESNQET..---------------------------
A0D9C9_PARTE/194-337...............................HSK.LIHRSCGT..SMIPGL..---------------------------
A6ZV52_YEAS7/332-475...............................QIY.DDEIAVMK.ITHLADF..---------------------------
A0CE97_PARTE/209-345...............................VERVIEDQVVVS..QNWDGL..---------------------------
Q7PYE1_ANOGA/178-310...............................ETK.RKKELVTT..ISMGPV..---------------------------
Q16ZJ6_AEDAE/174-302...............................KSR.TDSQNAVK..IENRDH..---------------------------
A7SL06_NEMVE/167-299...............................EYQ.VKDRLIDS..VKREGV..---------------------------
Q23DV9_TETTS/738-882............................HVRREF.NGEPVKDI..ILSQDIK.---------------------------
O45782_CAEEL/179-307..............................EHIK.NVVRVISK..IDKGEV..---------------------------
Q17HB8_AEDAE/169-300...............................LLH.QERRELAA..IVRDRI..---------------------------
ADCB_DICDI/337-465...............................GVP.TQVLKVSK..NFFPKI..---------------------------
Q23FQ6_TETTS/188-318...............................RRY.RDQVVTQF..EKSTTF..---------------------------
Q294M3_DROPS/163-297...............................VKRNFYTKTLTK.ELITDRT..---------------------------
A8WP43_CAEBR/183-324.........................HCHKHCDHK.TAETKMSE.VEKSFEV..---------------------------
Q6P8F1_XENTR/195-356...............................SSD.YYIKTVAL..EDSQDK..---------------------------
A3LXL3_PICST/266-408...............................TSP.EYEQLHGK.QNMPIPD..---------------------------
O17981_CAEEL/182-333.......................TLMSGSSQQTK.YDTKPVIT.QTQPMTV..---------------------------
Q16ZK3_AEDAE/167-301...............................YQK.VDRTIVCK..NVTPGI..---------------------------
A8X383_CAEBR/164-301.............................VNEKK.LAEQLIEM..VPLGAV..---------------------------
Q9XXI0_CAEEL/180-321.........................HCHKHCEHK.TAQTTMSK.VEKSCHV..---------------------------
Q20232_CAEEL/173-309...............................ENK.MMSCVVFE..HKSPAI..---------------------------
A0BCE6_PARTE/199-335...............................NERVIENKTLYS..NVLPGL..---------------------------
Q5AP77_CANAL/170-448QSSGGHLEAYKQEVMKCPENNLLFSCYEVENDNN.NGNGNGNG..NGNKNVKQ---------------------------
A0BDM3_PARTE/168-302...............................EPK.VIVEQISK..LSLPGV..---------------------------
Q23674_CAEEL/182-339...................KEKITYATRLNAQTR.VEERQISE.TNIDIKI..---------------------------
ARRD5_BOVIN/171-309.............................RRSRV.DSSELLRQ..EANTHI..---------------------------
Q4T8K9_TETNG/86-210...................................FDLRTIAE..VEGAGV..---------------------------
YA4C_SCHPO/180-322.............................LPASK.DEVRTVRS.LQTEEL...---------------------------
Q294M1_DROPS/173-305...............................EYR.YDKHLIAR..KQFGNV..---------------------------
Q4P2K3_USTMA/181-316...........................KAASQKT.ETLSSKSK..SFGKKV..---------------------------
A7TDW3_VANPO/229-389...............................PVT.YQERLITK.LKIKDPLGH---------------------------
Q6FY06_CANGA/237-406...............................VSS.LDDRLVSK.TKIKDPFGH---------------------------
A6R1F7_AJECN/559-759.........................SKKVLLFEK.RADSQSTS..AFPGSVCR---------------------------
Q9XXC4_CAEEL/159-308.......................SDCPIESKYRR.DGETVLRG.ANYSCDV..---------------------------
A7TQH7_VANPO/294-447...............................QLY.NDEVVALK..QSMTDFEG---------------------------
Q16ID9_AEDAE/216-390...............................STA.QYKCTVAE..VESEQAT.---------------------------
PALF_KLULA/263-398...............................RNT.EQIETFRK..DICQGVA.---------------------------
Q6CG62_YARLI/321-486.........................ARKYLVFEH.KPDGGIQD..SLLPNLD.---------------------------
Q4RUP5_TETNG/170-295...............................KRT.VHARNILK..VMAEAI..---------------------------
Q4PD45_USTMA/601-804.......................KWTLMKVAHAS.ATEPILPI.LSDSADALD---------------------------
Q9XTU0_CAEEL/176-327......................SLSENDRYLSRK.RDEIKIVS.VIHEMHI..---------------------------
YOA5_SCHPO/223-379.........................SHLNLSRKN.SEVSKTCK.CLQKETIRC---------------------------
Q0CQZ7_ASPTN/118-273..........................NVHFLTST.REHLVLSE..RYDSSDD.---------------------------

PF07070

Q8DDE9_VIBVU/6-232-----------------------RGSSSQGQQTRRVPQSHVLASWSLPYAF-----------------------------
Q9F2L5_STRCO/29-249-----------------------D...........GEGVVVFGRHTVGGPF-----------------------------
SP0M_BACSU/4-221-----------------------E...........HRKYATIHSFRVTGSF-----------------------------
Q87KC8_VIBPA/6-231-----------------------RGAREG.HSMRRVPQTHVLAKWNLPYAF-----------------------------
Q8EMA6_OCEIH/2-220-----------------------K..........RYHVNLIIDKFKIAESF-----------------------------
Q8YPP0_NOSS1/22-238-----------------------T...........VTEECVMVNYRLLEHL-----------------------------
Q9KVV0_VIBCH/21-246-----------------------RGQQQG.QPMRRVPHTYTLANWSLPYAF-----------------------------
Q935W0_9ACTO/3-222-----------------------E...........SEGVVAFERFTVGGGF-----------------------------
Q8CK18_STRCO/3-222-----------------------E...........YKQDVEFTKVRLGGAF-----------------------------

PF04425

Q6BVD2_DEBHA/1-335--------------------..........KDRKCDKFLQMIDFKASLNYD-----------------------------
A3GGA7_PICST/92-585--------------------HAEANEAHKYNKILMKKFLKMYDFNASYGYT-----------------------------
A5DRA9_PICGU/36-464--------------------....KNKKDRVPVKVKQFLQMFDFTASWNHG-----------------------------
Q6BJG5_DEBHA/93-577--------------------NANPADIHKYDKVLIKKFLKMYDLNASYGYT-----------------------------
A5DPQ0_PICGU/115-602--------------------NDGTQSPHRYKKVLMKKFLKMYDLNASYGYT-----------------------------
Q6BSG0_DEBHA/5-422--------------------..NRGLMDVKKPSKVHKFLTMLDLFASWSYA-----------------------------
A5DN76_PICGU/57-484--------------------.....SVESKEPSVFYKFLNMFDYSASWTPT-----------------------------
Q6BVD1_DEBHA/28-455--------------------....LDVNDRKPSKVERFLQMFDFSASWNHA-----------------------------
Q5ABB5_CANAL/19-455--------------------..TNNSTLVEQPSHIDRFLNMFDFNASWNDA-----------------------------
Q876A8_SACEX/140-571--------------------........QQGKRTVKRFLRMVDLSASWSYT-----------------------------
Q75E04_ASHGO/51-474--------------------........MKGKRTVKRFLRMVDISASWSYS-----------------------------
Q875N4_LACKL/72-505--------------------........QHGKRTVKRFLRMVDLSASWSYA-----------------------------
BUL1_YEAST/108-543--------------------........VKSKRTIKRFLRMVDLSASWSYS-----------------------------
A3LRU1_PICST/29-421--------------------..YTKYRKRKQPLHEQRFLEMIDFTGSYNPN-----------------------------
A5E3Q9_LODEL/66-535--------------------.NP..LQQRYRKILMKKILKMYDLCAGYSYG-----------------------------
A3LX53_PICST/9-457--------------------..NLQSSVVRPPTTVVRFLTMFDFNASWNDA-----------------------------
Q6FUH4_CANGA/102-545--------------------........QKGKRTLKRFLRMVDLSASWSYS-----------------------------
Q6CSE2_KLULA/69-505--------------------........KQGKRTVKRFLRMVDLSASWSYS-----------------------------
Q6FP46_CANGA/103-568--------------------........QKGKRTIKRFLRMVDMSASWSYS-----------------------------
Q875T3_NAUCA/106-548--------------------........TKGKRTVKRFLRMVDLSASWSYT-----------------------------
A3LX54_PICST/5-426--------------------..NKGFLDSENPVNVFKFLNMTDLYASWTYA-----------------------------
Q876B6_SACSE/94-510--------------------........KKGKRTVKRFLRMVDLSASWSYT-----------------------------
Q876C9_SACBA/7-447--------------------........QKGKRTLKRFLRMVDLSASWSYT-----------------------------
Q5AN22_CANAL/97-598--------------------.HAMGLTHKFSKILMKKFLKMYDLNASYGYV-----------------------------
A7TIV7_VANPO/87-537--------------------........QKGKRTVKRFLRMVDLSASWSYT-----------------------------
Q875T4_NAUCA/96-560--------------------........KKGKRVVKRFLRMVDLSASWSYT-----------------------------
Q875T2_NAUCA/78-518--------------------........QRRKRTLKRFLRMVDMSASWSYT-----------------------------

PF13002

C8ZH73_YEAS8/144-346-------PHRN---------------------------------------SFSSGHSTPRKEGSS.SKKRLLQLAMPIAV
A7TSP7_VANPO/130-321-------PRRD---------------------------------------L.......PT....F.GKVQSLKLSMPIAV
C5GL98_AJEDR/142-318-------....---------------------------------------.............TS.GKEL..CLNRPIKI
YNSK_SCHPO/63-242-------....---------------------------------------......GTPEGGISP.SKPEVLKF..PLQL
C5DVA9_ZYGRC/141-332-------....---------------------------------------........PRRGASPHQKDQLLQLVMPVPV

PF00339

ARD15_CAEEL/38-167------------------------------------------------------------------------........
ARRB_CALVI/17-172------------------------------------------------------------------------........
ARRD1_MOUSE/7-139------------------------------------------------------------------------........
O44847_CAEEL/8-127------------------------------------------------------------------------G.......
O17812_CAEEL/8-141------------------------------------------------------------------------S.......
O17981_CAEEL/6-159------------------------------------------------------------------------G.......
O17983_CAEEL/6-146------------------------------------------------------------------------T.......
O17984_CAEEL/4-157------------------------------------------------------------------------K.......
O42103_ORYLA/17-174------------------------------------------------------------------------........
O42104_ORYLA/14-171------------------------------------------------------------------------........
O45782_CAEEL/7-155------------------------------------------------------------------------K.......
O76685_CAEEL/6-159------------------------------------------------------------------------G.......
ARRS_BOVIN/22-180------------------------------------------------------------------------........
ARRB1_BOVIN/18-174------------------------------------------------------------------------........
ARRH_LOCMI/25-180------------------------------------------------------------------------........
ARR1_ONCMY/19-175------------------------------------------------------------------------........
ARRS_XENLA/21-176------------------------------------------------------------------------........
ARRH_LIMPO/25-179------------------------------------------------------------------------........
ARRB_CAEEL/22-186------------------------------------------------------------------------........
P91469_CAEEL/7-159------------------------------------------------------------------------G.......
YC9F_SCHPO/16-169------------------------------------------------------------------------SFLAPNES
Q17624_CAEEL/11-155------------------------------------------------------------------------GKPE.PGH
Q20232_CAEEL/7-150------------------------------------------------------------------------SDE..SDS
Q20577_CAEEL/7-158------------------------------------------------------------------------G.......
Q22321_CAEEL/16-154------------------------------------------------------------------------........
Q23672_CAEEL/8-142------------------------------------------------------------------------G.......
Q23674_CAEEL/4-159------------------------------------------------------------------------A.......
Q8SYU5_DROME/5-157------------------------------------------------------------------------S.......
Q9BIG9_9NEOP/17-173------------------------------------------------------------------------........
ARRD2_MOUSE/9-158------------------------------------------------------------------------G......D
Q9D6S6_MOUSE/17-166------------------------------------------------------------------------GE.....G
Q9I7L0_DROME/5-150------------------------------------------------------------------------S.......
Q9PTE8_AMBTI/24-179------------------------------------------------------------------------........
PALF_YEAST/39-201------------------------------------------------------------------------HVDK.TTI
Q9V393_DROME/59-214------------------------------------------------------------------------........
Q9VGU7_DROME/5-155------------------------------------------------------------------------G......S
Q9VHZ9_DROME/5-140------------------------------------------------------------------------........
Q9VI00_DROME/5-148------------------------------------------------------------------------........
Q9VI53_DROME/6-155------------------------------------------------------------------------S.......
Q9XXC4_CAEEL/3-136------------------------------------------------------------------------G.......
Q9XXI0_CAEEL/6-159------------------------------------------------------------------------A.......
Q9XXI4_CAEEL/4-156------------------------------------------------------------------------G.......

PF03643

VPS26_DICDI/8-284..NF...VKPP.......................................ESN............SNIKMEVGIEDCLHI
VP26A_HUMAN/8-283..QL...ATYP.......................................DVN............NSIKMEVGIEDCLHI
PEP8_YEAST/5-364..LYNSVTTAPNTLSANETKATTNDIAGGNYAADNASDNTQTKSTQGEAADVNQVLPISHSNNEPKPVRLDIGIENCLHI
VP26A_ARATH/8-283..NY...VPLP.......................................PIN............NSIKMEVGIEDCLHI
VPS26_SCHPO/5-279..RF...ENEP.......................................ETN............SLIRMDVGIDECLHI
VPS26_DROME/6-280..TL...CSYP.......................................EMN............NPIKMEVGIEDCLHI
VPS26_CAEEL/7-282..AL...SSYP.......................................DND............KSIKMEVGIEDCLHI
DSCR3_MOUSE/1-283PVDF...TITP.......................................ETL............QNVKERA........

PF02752

Q7PUI7_ANOGA/236-407-----------------------------------------------.................................
Q9TYQ0_CAEEL/174-315-----------------------------------------------.................................
Q7PUR5_ANOGA/187-319-----------------------------------------------.................................
Q7PYD9_ANOGA/175-306-----------------------------------------------.................................
Q380N5_ANOGA/183-323-----------------------------------------------.................................
CRED_ASPOR/181-332-----------------------------------------------D.............HD.NA............LE
Q752Z4_ASHGO/228-382-----------------------------------------------V.............AG.CD............PA
ARRD5_HUMAN/184-321-----------------------------------------------.................................
ARRD4_HUMAN/191-318-----------------------------------------------.................................
Q294M9_DROPS/171-302-----------------------------------------------.................................
Q6BI98_DEBHA/278-420-----------------------------------------------.................................
Q294M7_DROPS/174-306-----------------------------------------------.................................
Q6BIN4_DEBHA/247-390-----------------------------------------------.................N...............
Q293Z7_DROPS/175-308-----------------------------------------------.................................
Q9I7K7_DROME/179-320-----------------------------------------------.................................
Q294M2_DROPS/166-277-----------------------------------------------.................................
A5DM18_PICGU/246-387-----------------------------------------------.................................
Q294M5_DROPS/171-304-----------------------------------------------.................................
Q16ZK0_AEDAE/170-299-----------------------------------------------.................................
A0BIT0_PARTE/173-314-----------------------------------------------.................................
Q4V467_DROME/125-256-----------------------------------------------.................................
Q7SC90_NEUCR/193-351-----------------------------------------------.................................
Q66L50_DANRE/187-314-----------------------------------------------.................................
Q95NF3_ANOGA/193-351-----------------------------------------------.................................
Q6C993_YARLI/185-326-----------------------------------------------.................................
O44847_CAEEL/147-273-----------------------------------------------.................................
A0CWE9_PARTE/173-316-----------------------------------------------.................................
Q23QU8_TETTS/188-318-----------------------------------------------.................................
Q6ZM71_DANRE/162-286-----------------------------------------------.................................
A8WP41_CAEBR/178-317-----------------------------------------------.................................
Q0E8K8_DROME/169-299-----------------------------------------------.................................
A0C0J3_PARTE/194-337-----------------------------------------------.................................
Q16ZJ7_AEDAE/171-300-----------------------------------------------.................................
Q8T0P7_DROME/23-156-----------------------------------------------.................................
Q55N22_CRYNB/182-345-----------------------------------------------.................................
Q23YG0_TETTS/188-318-----------------------------------------------.................................
Q9W7R1_ORYLA/193-351-----------------------------------------------.................................
ARRB_CAEEL/205-363-----------------------------------------------.................................
Q7RZE0_NEUCR/198-350-----------------------------------------------..............HW.QD.............V
ALY2_SCHPO/345-506-----------------------------------------------.................................
Q5AM66_CANAL/305-457-----------------------------------------------N............NGD.EEE...........EE
Q23YG2_TETTS/174-283-----------------------------------------------.................................
ARRB2_MOUSE/195-350-----------------------------------------------.................................
ARRH_LIMPO/199-353-----------------------------------------------.................................
A2BIP7_DANRE/186-313-----------------------------------------------.................................
ARRD1_HUMAN/162-286-----------------------------------------------.................................
A2QR01_ASPNC/439-613-----------------------------------------------..............NL.LG............NL
Q380P6_ANOGA/182-314-----------------------------------------------.................................
YC9F_SCHPO/183-325-----------------------------------------------.................................
A8E775_DROME/192-350-----------------------------------------------.................................
Q16H74_AEDAE/171-301-----------------------------------------------.................................
A4VB00_PLADU/42-172-----------------------------------------------.................................
Q91X82_MOUSE/175-302-----------------------------------------------.................................
Q6DH07_DANRE/192-355-----------------------------------------------.................................
A8X4Z9_CAEBR/175-315-----------------------------------------------.................................
ART1_SCHPO/287-428-----------------------------------------------.................................
ARRD2_HUMAN/180-307-----------------------------------------------.................................
A2ADV1_MOUSE/190-353-----------------------------------------------.................................
Q294M6_DROPS/179-311-----------------------------------------------.................................
Q963B5_LOLPE/193-352-----------------------------------------------.................................
ADCC_DICDI/344-478-----------------------------------------------.................................
Q08C63_DANRE/204-330-----------------------------------------------.................................
Q6CS19_KLULA/219-373-----------------------------------------------IN...........NGE.YDA..........TNT
Q2UDU8_ASPOR/60-215-----------------------------------------------...............I.A..............P
Q22NR4_TETTS/187-325-----------------------------------------------.................................
ROD1_YEAST/232-395-----------------------------------------------VAQI.......KKKRS.LNEAAD.....EGVDT
A0CL31_PARTE/172-315-----------------------------------------------.................................
APYA_EMENI/180-326-----------------------------------------------.................................
Q4PCS7_USTMA/465-633-----------------------------------------------SR...........GVV.TAR..........GWW
Q296V0_DROPS/178-310-----------------------------------------------.................................
Q8LKK8_PHYSO/242-377-----------------------------------------------.................................
Q6CW08_KLULA/282-443-----------------------------------------------L.............PG.CD............PT
A8WP33_CAEBR/159-305-----------------------------------------------...............T.P...............
Q6PBM9_DANRE/191-353-----------------------------------------------.................................
Q9PTE7_AMBTI/190-353-----------------------------------------------.................................
A0DYQ7_PARTE/173-314-----------------------------------------------.................................
A0D2Y0_PARTE/206-342-----------------------------------------------.................................
Q5KC81_CRYNJ/436-587-----------------------------------------------.................................
A7TQI8_VANPO/357-526-----------------------------------------------...............V.D...............
Q17EA7_AEDAE/182-314-----------------------------------------------.................................
Q9W2V2_DROME/420-633-----------------------------------------------...............V.D...............
Q240M9_TETTS/188-318-----------------------------------------------.................................
Q568E1_DANRE/170-297-----------------------------------------------.................................
A5DUN4_LODEL/264-404-----------------------------------------------.................................
A0NDX6_ANOGA/173-303-----------------------------------------------.................................
Q16ZJ5_AEDAE/174-305-----------------------------------------------.................................
Q7QCL7_ANOGA/170-301-----------------------------------------------.................................
A2QTZ8_ASPNC/184-328-----------------------------------------------..............ED.EF............RI
O17983_CAEEL/173-318-----------------------------------------------.................................
Q9V393_DROME/233-393-----------------------------------------------.................................
A0BMC5_PARTE/210-346-----------------------------------------------.................................
A1C8U8_ASPCL/140-283-----------------------------------------------...............D.V..............I
A0D004_PARTE/178-324-----------------------------------------------.................................
Q16ZK1_AEDAE/136-269-----------------------------------------------.................................
Q17EA8_AEDAE/183-323-----------------------------------------------.................................
Q16ZJ8_AEDAE/186-315-----------------------------------------------.................................
PALF_ASHGO/233-368-----------------------------------------------...............P.L...............
ARRS_MOUSE/200-361-----------------------------------------------.................................
A8WP37_CAEBR/170-319-----------------------------------------------.................................
Q6GR39_XENLA/180-307-----------------------------------------------.................................
Q5BAI3_EMENI/174-332-----------------------------------------------.................................
Q5C229_SCHJA/8-167-----------------------------------------------.................................
Q9GYT5_CAEEL/181-328-----------------------------------------------.................................
MU170_SCHPO/266-426-----------------------------------------------.................................
Q5AI11_CANAL/271-413-----------------------------------------------.................................
A5DW17_LODEL/261-403-----------------------------------------------.................................
A0D012_PARTE/172-315-----------------------------------------------.................................
ADCA_DICDI/313-441-----------------------------------------------.................................
Q9I7L0_DROME/174-307-----------------------------------------------.................................
A7SF55_NEMVE/129-256-----------------------------------------------.................................
Q16ZK2_AEDAE/273-408-----------------------------------------------.................................
A8XYD8_CAEBR/172-316-----------------------------------------------.................................
Q9VHZ8_DROME/164-279-----------------------------------------------.................................
A0E996_PARTE/174-317-----------------------------------------------.................................
A6S093_BOTFB/188-324-----------------------------------------------..............HY.QD.............M
Q0U5A6_PHANO/182-337-----------------------------------------------R.............VP.EGV...........EE
PALF_YEAST/259-394-----------------------------------------------...............P.I...............
Q23672_CAEEL/163-311-----------------------------------------------.................................
Q6VZJ8_CNPV/177-304-----------------------------------------------.................................
A7TPY5_VANPO/228-381-----------------------------------------------A............SEN.INP..........SNE
A7A259_YEAS7/232-393-----------------------------------------------SSE........EFNGN.SCFVN......NPFFQ
Q759V0_ASHGO/221-368-----------------------------------------------...............L.SG.............E
Q9VGU7_DROME/180-316-----------------------------------------------.................................
Q6FM62_CANGA/224-379-----------------------------------------------LA...........RNV.NFQ..........DDE
A7SKJ5_NEMVE/177-307-----------------------------------------------.................................
Q6CGL3_YARLI/174-329-----------------------------------------------.................................
A6S0J6_BOTFB/81-239-----------------------------------------------.................................
Q6AZP4_XENLA/162-286-----------------------------------------------.................................
O42103_ORYLA/193-351-----------------------------------------------.................................
ARRD5_MOUSE/170-307-----------------------------------------------.................................
Q17624_CAEEL/176-340-----------------------------------------------.................................
A0D9C9_PARTE/194-337-----------------------------------------------.................................
A6ZV52_YEAS7/332-475-----------------------------------------------.................................
A0CE97_PARTE/209-345-----------------------------------------------.................................
Q7PYE1_ANOGA/178-310-----------------------------------------------.................................
Q16ZJ6_AEDAE/174-302-----------------------------------------------.................................
A7SL06_NEMVE/167-299-----------------------------------------------.................................
Q23DV9_TETTS/738-882-----------------------------------------------.................F...............
O45782_CAEEL/179-307-----------------------------------------------.................................
Q17HB8_AEDAE/169-300-----------------------------------------------.................................
ADCB_DICDI/337-465-----------------------------------------------.................................
Q23FQ6_TETTS/188-318-----------------------------------------------.................................
Q294M3_DROPS/163-297-----------------------------------------------.................................
A8WP43_CAEBR/183-324-----------------------------------------------.................................
Q6P8F1_XENTR/195-356-----------------------------------------------.................................
A3LXL3_PICST/266-408-----------------------------------------------.................................
O17981_CAEEL/182-333-----------------------------------------------.................................
Q16ZK3_AEDAE/167-301-----------------------------------------------.................................
A8X383_CAEBR/164-301-----------------------------------------------.................................
Q9XXI0_CAEEL/180-321-----------------------------------------------.................................
Q20232_CAEEL/173-309-----------------------------------------------.................................
A0BCE6_PARTE/199-335-----------------------------------------------.................................
Q5AP77_CANAL/170-448-----------------------------------------------...............K.N..............K
A0BDM3_PARTE/168-302-----------------------------------------------.................................
Q23674_CAEEL/182-339-----------------------------------------------.................................
ARRD5_BOVIN/171-309-----------------------------------------------.................................
Q4T8K9_TETNG/86-210-----------------------------------------------.................................
YA4C_SCHPO/180-322-----------------------------------------------.................................
Q294M1_DROPS/173-305-----------------------------------------------.................................
Q4P2K3_USTMA/181-316-----------------------------------------------.................................
A7TDW3_VANPO/229-389-----------------------------------------------VEL........FSNKL.KGRNI.......PNSV
Q6FY06_CANGA/237-406-----------------------------------------------LAKLR....KKKYTAK.SLTDPNF..NTGSDDD
A6R1F7_AJECN/559-759-----------------------------------------------VTAGGGVAYDARREAAEGIEYVNPRNTNLLGDL
Q9XXC4_CAEEL/159-308-----------------------------------------------.................................
A7TQH7_VANPO/294-447-----------------------------------------------..............FI.KI............NE
Q16ID9_AEDAE/216-390-----------------------------------------------...............V.R..............I
PALF_KLULA/263-398-----------------------------------------------...............P.L...............
Q6CG62_YARLI/321-486-----------------------------------------------...............G.V...............
Q4RUP5_TETNG/170-295-----------------------------------------------.................................
Q4PD45_USTMA/601-804-----------------------------------------------NSPL......APMARA.AAGEDQ....DSDALP
Q9XTU0_CAEEL/176-327-----------------------------------------------.................................
YOA5_SCHPO/223-379-----------------------------------------------N............KKS.NCY...........NW
Q0CQZ7_ASPTN/118-273-----------------------------------------------...............Y.A..............T

PF07070

Q8DDE9_VIBVU/6-232--------------------------------------------------------------------------------
Q9F2L5_STRCO/29-249--------------------------------------------------------------------------------
SP0M_BACSU/4-221--------------------------------------------------------------------------------
Q87KC8_VIBPA/6-231--------------------------------------------------------------------------------
Q8EMA6_OCEIH/2-220--------------------------------------------------------------------------------
Q8YPP0_NOSS1/22-238--------------------------------------------------------------------------------
Q9KVV0_VIBCH/21-246--------------------------------------------------------------------------------
Q935W0_9ACTO/3-222--------------------------------------------------------------------------------
Q8CK18_STRCO/3-222--------------------------------------------------------------------------------

PF04425

Q6BVD2_DEBHA/1-335-----------------------------------------------STETL..............IDRDDGTYLTM..G
A3GGA7_PICST/92-585-----------------------------------------------DVPNSAGIE.....YEAFSIDASDGCVIGLPNE
A5DRA9_PICGU/36-464-----------------------------------------------NIDRLITESSH.PYTCPNIVDPIDNAKLAV.KD
Q6BJG5_DEBHA/93-577-----------------------------------------------QIPNSAGIE.....YEAFTKDLHDGCELGLPNE
A5DPQ0_PICGU/115-602-----------------------------------------------HIPSSVGVE.....YKEYTRD.NEGCILGLPNE
Q6BSG0_DEBHA/5-422-----------------------------------------------NIARLSTDDGDPHDWCYGETDPYDNTVLSIDVK
A5DN76_PICGU/57-484-----------------------------------------------ILVSDFDSN..........VDPVDNTELMFPMK
Q6BVD1_DEBHA/28-455-----------------------------------------------YINRLITEYAN.AYECPLITDSYDDTKMGF.SN
Q5ABB5_CANAL/19-455-----------------------------------------------FLDRLVTEHND.PTHIGTIYDPIDGTYYHLDHR
Q876A8_SACEX/140-571-----------------------------------------------NIDLSSGID.....IKVGETDKEDGAIIGLNNS
Q75E04_ASHGO/51-474-----------------------------------------------SVESANGYA.....YTQSYKD.YDNCILGLSNT
Q875N4_LACKL/72-505-----------------------------------------------NIDLSSGIN.....YVPGELD.YDNCILGLNNN
BUL1_YEAST/108-543-----------------------------------------------KIALGSGVD.....FIPADVD.YDGSVFGLNNS
A3LRU1_PICST/29-421-----------------------------------------------LFD......................SDLFAGSG
A5E3Q9_LODEL/66-535-----------------------------------------------YVPSSAGIE.....FVPFTEDSYDGCEIGLPDD
A3LX53_PICST/9-457-----------------------------------------------ALDRLVSDNNN.PMVPTIIIDPIDGTHVQLDPR
Q6FUH4_CANGA/102-545-----------------------------------------------SIEVSSGIE.....IEYGGVD.YDNSIIGLNNN
Q6CSE2_KLULA/69-505-----------------------------------------------NIDLATGFQ.....YVPGDID.QDGCVLGLNND
Q6FP46_CANGA/103-568-----------------------------------------------SMQVSSGIE.....YVPGDVD.FDDSILGLSNS
Q875T3_NAUCA/106-548-----------------------------------------------NIFMGTGWK.....MTPGEID.FDNAVIGLRNS
A3LX54_PICST/5-426-----------------------------------------------NIDRLVTDNGDPHDWCEGETDPYDNTALSIDVK
Q876B6_SACSE/94-510-----------------------------------------------DIDASSGIN.....FTPGELDKYDGSYIGLTNN
Q876C9_SACBA/7-447-----------------------------------------------NIAPSTGIH.....IVPGERD.FDDAIIGLSNS
Q5AN22_CANAL/97-598-----------------------------------------------QVPNSAGIQ.....YEPFSHDTSDGSVIGLPTD
A7TIV7_VANPO/87-537-----------------------------------------------NMCLATGVN.....LVAGDVD.YDHSIIGLNNN
Q875T4_NAUCA/96-560-----------------------------------------------TIDLGSGIN.....VLPGQLDRYDNTIIGLENN
Q875T2_NAUCA/78-518-----------------------------------------------NISMGTGKK.....MPPGEID.FDKTIIGLPNS

PF13002

C8ZH73_YEAS8/144-346TRSIPRGPD--------------------KNSLRV-----------F----------------------PP---------
A7TSP7_VANPO/130-321TRSILRGPD--------------------KNSLRV-----------F----------------------PP---------
C5GL98_AJEDR/142-318KRAVMPGPD--------------------KYSMRI-----------F----------------------PP---------
YNSK_SCHPO/63-242KRAAIPSPD--------------------TIHKRI-----------F----------------------PP---------
C5DVA9_ZYGRC/141-332TRSLPRGPD--------------------KNSLRV-----------F----------------------PP---------

PF00339

ARD15_CAEEL/38-167GTCLPVGKH--------------------QFPVQI-----------R----------------------IP---------
ARRB_CALVI/17-172.....LGSN--------------------AHPFTF-----------H----------------------FP---------
ARRD1_MOUSE/7-139.GSLPAGEH--------------------NFPFQF-----------L----------------------LP---------
O44847_CAEEL/8-127KNELPVGRL--------------------EQKFQF-----------E----------------------LG---------
O17812_CAEEL/8-141ENRIEPGTH--------------------RIPFDY-----------T----------------------VP---------
O17981_CAEEL/6-159SNELSAGDY--------------------VWPFSY-----------T----------------------LP---------
O17983_CAEEL/6-146ENTFPSGDY--------------------EWNFSF-----------E----------------------LP---------
O17984_CAEEL/4-157AARLLPGKY--------------------EWQFWF-----------Q----------------------LP---------
O42103_ORYLA/17-174.....LGDN--------------------AFPFFF-----------E----------------------FP---------
O42104_ORYLA/14-171.....AGDN--------------------SYPFSF-----------E----------------------IP---------
O45782_CAEEL/7-155ERILPAGIH--------------------QVPFSY-----------T----------------------LP---------
O76685_CAEEL/6-159SNELAAGEY--------------------AWPFSY-----------N----------------------LP---------
ARRS_BOVIN/22-180.....LGAN--------------------TYPFLL-----------T----------------------FP---------
ARRB1_BOVIN/18-174.....LGEH--------------------AYPFTF-----------E----------------------IP---------
ARRH_LOCMI/25-180.....LGPN--------------------AFPFTF-----------H----------------------FP---------
ARR1_ONCMY/19-175.....LGQQ--------------------AHPFYF-----------T----------------------IP---------
ARRS_XENLA/21-176.....LGNN--------------------AFPFVL-----------E----------------------FP---------
ARRH_LIMPO/25-179.....LGTL--------------------AHPFTF-----------A----------------------LP---------
ARRB_CAEEL/22-186.....LGAN--------------------AFPFWF-----------E----------------------VA---------
P91469_CAEEL/7-159PKELNAGEY--------------------AWPFSY-----------T----------------------LP---------
YC9F_SCHPO/16-169AKVIDQGNY--------------------EYPFYY-----------E----------------------LP---------
Q17624_CAEEL/11-155FQWIGDFTY--------------------SLPFEC-----------P----------------------LP---------
Q20232_CAEEL/7-150VPILARGVH--------------------QFSFNF-----------D----------------------LP---------
Q20577_CAEEL/7-158TEKLPSGHH--------------------VFPFAF-----------P----------------------LP---------
Q22321_CAEEL/16-154PIVVSQQEY--------------------SIPIEE-----------T----------------------LP---------
Q23672_CAEEL/8-142QNKMPEGGY--------------------IWTFEI-----------K----------------------LP---------
Q23674_CAEEL/4-159KNDMPSGPH--------------------IFPFSF-----------Q----------------------LP---------
Q8SYU5_DROME/5-157NFNMDAGTY--------------------TYTFAC-----------P----------------------IP---------
Q9BIG9_9NEOP/17-173.....LGPN--------------------AIPFKF-----------V----------------------LP---------
ARRD2_MOUSE/9-158IATLPAGRH--------------------EFPFSF-----------Q----------------------LP---------
Q9D6S6_MOUSE/17-166VTLLQPGKH--------------------EFPFRF-----------Q----------------------LR---------
Q9I7L0_DROME/5-150QVSIEAGIH--------------------TYNFVC-----------L----------------------IP---------
Q9PTE8_AMBTI/24-179.....LGNN--------------------AYPFLL-----------T----------------------FP---------
PALF_YEAST/39-201LNGLSKGEH--------------------RFPFRI-----------R----------------------IP---------
Q9V393_DROME/59-214.....LGPN--------------------AHPFYF-----------E----------------------VP---------
Q9VGU7_DROME/5-155QLELPTGKY--------------------VFPFRA-----------T----------------------IP---------
Q9VHZ9_DROME/5-140.TLFRAGVH--------------------VYVLTL-----------R----------------------IP---------
Q9VI00_DROME/5-148.GNLPPGTH--------------------TYNFCI-----------P----------------------LP---------
Q9VI53_DROME/6-155ETELPPGTH--------------------TYPFTC-----------A----------------------LP---------
Q9XXC4_CAEEL/3-136VDTIPAGTL--------------------KSRFRF-----------R----------------------LP---------
Q9XXI0_CAEEL/6-159NNKIPGGVN--------------------IFPFLF-----------Q----------------------LP---------
Q9XXI4_CAEEL/4-156TDRLPAGTN--------------------VFPFAF-----------N----------------------LP---------

PF03643

VPS26_DICDI/8-284EFEYNKSKY....HLKDV.......IIGKIYFLLV-----------R...IKIKYMEIALIKRESTGS.GP---------
VP26A_HUMAN/8-283EFEYNKSKY....HLKDV.......IVGKIYFLLV-----------R...IKIQHMELQLIKKEITGI.GP---------
PEP8_YEAST/5-364EFEYAKSQY....SLKEV.......IVGRIYFLLT-----------R...LRIKHMELSLITRESSGLQTS---------
VP26A_ARATH/8-283EFEYNKSKY....HLKDV.......ILGKIYFLLV-----------R...IKIKNMDLEIRRRESTGA.GA---------
VPS26_SCHPO/5-279EFEYSKNKY....HLKDV.......IIGKIYFILV-----------R...IKVQRMEVSIIRRETIGT.SP---------
VPS26_DROME/6-280EFEYNKSKY....HLRDT.......IIGKIYFLLV-----------R...IKIKHMEIAIIKKESTGT.GP---------
VPS26_CAEEL/7-282EFEYNKNKY....HLQDV.......IVGKIYFLLV-----------R...IKIKYMEIAILKTEVVGS.GP---------
DSCR3_MOUSE/1-283....SLPKFFIRGHLNSTNCAITQPLTGE...LVV-----------EHSDAAIRSIELQLVRVETCGC.AE---------

PF02752

Q7PUI7_ANOGA/236-407...GPGDTL--------------------HASYSL............----------------------LPVRGTTKNWI
Q9TYQ0_CAEEL/174-315..KAGVGPQ--------------------TKEIEF...........S----------------------VP.........
Q7PUR5_ANOGA/187-319.AGRNDAVF--------------------E..ENI...........L----------------------IG.........
Q7PYD9_ANOGA/175-306.APESQKQY--------------------E..QRL...........V----------------------VP.........
Q380N5_ANOGA/183-323.EGENDARF--------------------V..ESF...........V----------------------VG.........
CRED_ASPOR/181-332IIDEAAEGY--------------------QFSRYL...........D----------------------LP.........
Q752Z4_ASHGO/228-382RGNLLVDAV--------------------RLQLPF...........S----------------------VP.........
ARRD5_HUMAN/184-321.TRFNTTKV--------------------V..STF...........N----------------------LP.........
ARRD4_HUMAN/191-318.ASGSTDTW--------------------N.GKTL...........K----------------------IP.........
Q294M9_DROPS/171-302.LKQCTRSL--------------------T..IGL...........P----------------------VP.........
Q6BI98_DEBHA/278-420SNSLSADRW--------------------DVKSTF...........K----------------------VPS........
Q294M7_DROPS/174-306.SKNSRKQF--------------------T..FDL...........K----------------------VP.........
Q6BIN4_DEBHA/247-390DPEFQMDKW--------------------EVDNYL...........K----------------------VP.........
Q293Z7_DROPS/175-308.QKKSERSF--------------------A..HEL...........L----------------------MP.........
Q9I7K7_DROME/179-320.PRGELQNF--------------------QHLHML...........Q----------------------VP.........
Q294M2_DROPS/166-277.....CSEF--------------------Q..AEL...........R----------------------LP.........
A5DM18_PICGU/246-387.GHAEEDYW--------------------DIRTQF...........H----------------------LP.........
Q294M5_DROPS/171-304.LRFSKRII--------------------K..GSL...........L----------------------IP.........
Q16ZK0_AEDAE/170-299.NNDVFSRL--------------------Q..QQL...........D----------------------IP.........
A0BIT0_PARTE/173-314.AAGEQKEV--------------------K..TIL...........S----------------------LPNGK......
Q4V467_DROME/125-256.LRNSRKMY--------------------D..FQL...........M----------------------IP.........
Q7SC90_NEUCR/193-351..KLTETGY--------------------VTNLGL...........V----------------------FPARDLRDP..
Q66L50_DANRE/187-314.HSGKTETW--------------------DG.KML...........K----------------------IP.........
Q95NF3_ANOGA/193-351PIQPGSS.L--------------------QKVMYL............----------------------TPLLSSNKQRR
Q6C993_YARLI/185-326DGYEGHDLW--------------------EVDDFF...........P----------------------IP.........
O44847_CAEEL/147-273.APYSTQKF--------------------T..IPF...........T----------------------IP.........
A0CWE9_PARTE/173-316.QAHSQKQI--------------------A..TKI...........H----------------------LPTGK......
Q23QU8_TETTS/188-318.KVEKT.HI--------------------NENVQL...........Q----------------------VP.........
Q6ZM71_DANRE/162-286.KGGNKSEW--------------------N..QQI...........I----------------------VP.........
A8WP41_CAEBR/178-317.APHSRGQV--------------------V..LSM...........K----------------------IP.........
Q0E8K8_DROME/169-299.RPGAKDEW--------------------H..NEL...........Y----------------------VP.........
A0C0J3_PARTE/194-337.ESGQSALN--------------------EHKKDM...........N----------------------LPLVD......
Q16ZJ7_AEDAE/171-300.TTDKSATY--------------------S..QNL...........E----------------------IP.........
Q8T0P7_DROME/23-156.LRLSKKKI--------------------E..GTL...........A----------------------IP.........
Q55N22_CRYNB/182-345.VSGGVKSA--------------------TIEMEV............----------------------...........
Q23YG0_TETTS/188-318.KVEKS.QI--------------------KQEVQI...........Q----------------------IP.........
Q9W7R1_ORYLA/193-351.VSAGAT.L--------------------KKVYTL............----------------------LPLLANNRERR
ARRB_CAEEL/205-363PVGPGGT.L--------------------SKVFAV............----------------------CPLLSNNKDKR
Q7RZE0_NEUCR/198-350IEDTGQEGW--------------------VMNTGL...........D----------------------LP.........
ALY2_SCHPO/345-506.EGDGLSSA--------------------VFNFNV...........A----------------------LP.........
Q5AM66_CANAL/305-457EEVDMFDQW--------------------QIDTII...........N----------------------IP.........
Q23YG2_TETTS/174-283.KVENSQQI--------------------NQEVSI...........Q----------------------VP.........
ARRB2_MOUSE/195-350.VSPSST.F--------------------CKVYTI............----------------------TPLLSDNREKR
ARRH_LIMPO/199-353PITPGAT.L--------------------SKVYTL............----------------------LPLASQNKDKR
A2BIP7_DANRE/186-313.EPNSKKTI--------------------T..TVL...........T----------------------IP.........
ARRD1_HUMAN/162-286.KAWRRAQW--------------------H..EQI...........L----------------------VP.........
A2QR01_ASPNC/439-613SSDAGVGPT--------------------EMEFNV...........Q----------------------LPS........
Q380P6_ANOGA/182-314.TSGEVVKH--------------------Q..QNL...........L----------------------IP.........
YC9F_SCHPO/183-325..PMVDDYW--------------------QDQIMV...........K----------------------IP.........
A8E775_DROME/192-350PITPGAN.L--------------------TKTFYL............----------------------IPLAANNKDRH
Q16H74_AEDAE/171-301.DRNKSAGY--------------------E..RRL...........L----------------------VP.........
A4VB00_PLADU/42-172..GKEERDC--------------------FNGLSL...........H----------------------IP.........
Q91X82_MOUSE/175-302.ISGTCASW--------------------RG.KSL...........R----------------------VQ.........
Q6DH07_DANRE/192-355.VEANSS.F--------------------EKSLDI............----------------------TPLLANNKEKR
A8X4Z9_CAEBR/175-315.TARTHGRE--------------------Q..LMM...........K----------------------IP.........
ART1_SCHPO/287-428.MKLTSEGL--------------------SKSLSK...........P----------------------FPDI.......
ARRD2_HUMAN/180-307.GPGQRALW--------------------QG.RAL...........R----------------------IP.........
A2ADV1_MOUSE/190-353.VAANSS.F--------------------SQTFAV............----------------------TPLLAANCQKQ
Q294M6_DROPS/179-311.AHHAQKIY--------------------T..ETL...........R----------------------IP.........
Q963B5_LOLPE/193-352PIEPNTSGF--------------------CQVYKL............----------------------RPVLEVTKRRA
ADCC_DICDI/344-478.KQNTACKQ--------------------M..VVI...........E----------------------LP.........
Q08C63_DANRE/204-330.PSGGKTRF--------------------V..VDI...........K----------------------LP.........
Q6CS19_KLULA/219-373TEFDFQDKW--------------------EINTSV...........R----------------------IP.........
Q2UDU8_ASPOR/60-215ESEEPDLEW--------------------CITKTI...........S----------------------LP.........
Q22NR4_TETTS/187-325.VPPKSVKE--------------------NVGIHF...........K----------------------IPD........
ROD1_YEAST/232-395DTGEFQDKW--------------------EVRALL...........N----------------------IP.........
A0CL31_PARTE/172-315.QPIQKQDY--------------------Q..LQLIN.......LKN----------------------PP.........
APYA_EMENI/180-326YSSKALESY--------------------QFSRTL...........Q----------------------LP.........
Q4PCS7_USTMA/465-633TGVEAGERV--------------------ESTHYM...........Q----------------------IP.........
Q296V0_DROPS/178-310.NGGESRTF--------------------T..QQL...........E----------------------IP.........
Q8LKK8_PHYSO/242-377.RARRQADR--------------------ALSLNLA.........TE----------------------TPW........
Q6CW08_KLULA/282-443QDNLLIDQI--------------------KLNSVL...........Q----------------------FP.........
A8WP33_CAEBR/159-305VAPYTEGKF--------------------K..IPF...........T----------------------IP.........
Q6PBM9_DANRE/191-353.INANST.F--------------------EKEYSV............----------------------TPLLVNNKEKR
Q9PTE7_AMBTI/190-353.VAANST.L--------------------SKTFSV............----------------------TPMLANNREKR
A0DYQ7_PARTE/173-314.EAGDEKEI--------------------K..TTF...........K----------------------LPQGK......
A0D2Y0_PARTE/206-342.NQGERLEA--------------------QI.AKF...........E----------------------IP.........
Q5KC81_CRYNJ/436-587.EPGESGHW--------------------D..MSI...........Q----------------------VPT........
A7TQI8_VANPO/357-526DSTGDLVNK--------------------EFEYQV...........F----------------------VP.........
Q17EA7_AEDAE/182-314.AKRQDAKL--------------------E..ENI...........L----------------------IG.........
Q9W2V2_DROME/420-633RTVAAGASL--------------------NTTVTL............----------------------RPQRGPTKNWI
Q240M9_TETTS/188-318.KVEQS.KM--------------------KQEVQF...........Q----------------------VP.........
Q568E1_DANRE/170-297.VSSTRENL--------------------Y..KVL...........P----------------------LP.........
A5DUN4_LODEL/264-404PSELEFDKW--------------------EFETFM...........R----------------------LP.........
A0NDX6_ANOGA/173-303.DAKGSAGY--------------------E..RRF...........L----------------------VP.........
Q16ZJ5_AEDAE/174-305.QRRNKGSY--------------------V..QHL...........L----------------------VP.........
Q7QCL7_ANOGA/170-301.RAGHRDEW--------------------QN.ESL...........Y----------------------VP.........
A2QTZ8_ASPNC/184-328TSDNEGCWH--------------------SLTRFL...........R----------------------LP.........
O17983_CAEEL/173-318.PARSSKDF--------------------A..FSF...........D----------------------IP.........
Q9V393_DROME/233-393QVAPGFT.L--------------------SKVFEL............----------------------CPLLANNKDKW
A0BMC5_PARTE/210-346.NSGQKLER--------------------QN.ASL...........E----------------------IP.........
A1C8U8_ASPCL/140-283PSSDGADWY--------------------HIIRRL...........Q----------------------LP.........
A0D004_PARTE/178-324.KVLNQQEV--------------------VLFAQLKNHNNNDQYNMI----------------------QP.........
Q16ZK1_AEDAE/136-269.DDPDVVRY--------------------E..ESI...........L----------------------VP.........
Q17EA8_AEDAE/183-323.ARQTNANF--------------------E..KHF...........L----------------------VG.........
Q16ZJ8_AEDAE/186-315.TRDKSDQY--------------------T..QDL...........V----------------------IP.........
PALF_ASHGO/233-368YVEPETHTC--------------------SVGMNL...........N----------------------VP.........
ARRS_MOUSE/200-361.VQPNST.L--------------------TKTLVL............----------------------VPLLANNRERR
A8WP37_CAEBR/170-319.PPGETEQV--------------------M..VAV...........D----------------------LP.........
Q6GR39_XENLA/180-307.PAGKRETW--------------------HG.RAL...........K----------------------IP.........
Q5BAI3_EMENI/174-332..KMPPTGF--------------------LTNMGL...........V----------------------FPAKDMRDG..
Q5C229_SCHJA/8-167PILPSQTGW--------------------CKVYKL............----------------------RPLLANNRHKR
Q9GYT5_CAEEL/181-328.PAKNEHKF--------------------V..LEL...........R----------------------IP.........
MU170_SCHPO/266-426.APTLKNTI--------------------H..AQI...........K----------------------IP.........
Q5AI11_CANAL/271-413SDDLPYDKW--------------------EFRTHY...........K----------------------VP.........
A5DW17_LODEL/261-403TSTLPYDKW--------------------VIKTHF...........K----------------------VP.........
A0D012_PARTE/172-315.QPASQIGC--------------------S..LQLV........NTK----------------------QP.........
ADCA_DICDI/313-441.QPCFYGKR--------------------Y..LPF...........S----------------------IP.........
Q9I7L0_DROME/174-307.QRNCKKLF--------------------S..YEI...........R----------------------VP.........
A7SF55_NEMVE/129-256.........--------------------...DEF...........E----------------------VP.........
Q16ZK2_AEDAE/273-408.RLPDGGVL--------------------AE.DNL...........Q----------------------VP.........
A8XYD8_CAEBR/172-316.QPDEIMPF--------------------E..FSF...........V----------------------IP.........
Q9VHZ8_DROME/164-279.SSELNGNL--------------------R..LPL...........T----------------------AP.........
A0E996_PARTE/174-317.KGGQKRQL--------------------EYKLKLEQ.......DSN----------------------DP.........
A6S093_BOTFB/188-324LDDSGQDGF--------------------KMTEYM...........P----------------------LP.........
Q0U5A6_PHANO/182-337ADEMFDESH--------------------RFSMTL...........D----------------------LP.........
PALF_YEAST/259-394YINPETLQF--------------------QSRVYL...........K----------------------VP.........
Q23672_CAEEL/163-311VAPYSTKSI--------------------I..LPF...........T----------------------IP.........
Q6VZJ8_CNPV/177-304.LPGNIEIW--------------------NN.KQL...........K----------------------VP.........
A7TPY5_VANPO/228-381EDSEFKDRW--------------------ELDLNL...........P----------------------IP.........
A7A259_YEAS7/232-393PDHSFQDKW--------------------EIDTIL...........Q----------------------IP.........
Q759V0_ASHGO/221-368PDSHAEDRW--------------------DLSMTI...........A----------------------VP.........
Q9VGU7_DROME/180-316.LKHNKAKF--------------------D..EFL...........T----------------------VP.........
Q6FM62_CANGA/224-379DNSEFKDSW--------------------DLQAYL...........K----------------------IP.........
A7SKJ5_NEMVE/177-307.RPHSEQHL--------------------PG.LLV...........Q----------------------IP.........
Q6CGL3_YARLI/174-329...KLARDF--------------------KFELSM...........D----------------------YPQYEPKDK..
A6S0J6_BOTFB/81-239..KLPEAGY--------------------FTTLGL...........I----------------------YPSKDLRDS..
Q6AZP4_XENLA/162-286.KAWKRAVW--------------------D..EQI...........L----------------------VP.........
O42103_ORYLA/193-351.VPSGTT.L--------------------KKEYTL............----------------------HPLLAYNKDRR
ARRD5_MOUSE/170-307.PAFNSTTV--------------------V..SAF...........N----------------------LP.........
Q17624_CAEEL/176-340.PAKTKGAI--------------------EQSGLFL.........LT----------------------VPPVCPSTKGD
A0D9C9_PARTE/194-337.QAGQSALN--------------------EQRKNM...........T----------------------LSLVD......
A6ZV52_YEAS7/332-475..GPLTDKL--------------------DVDCPF...........T----------------------IP.........
A0CE97_PARTE/209-345.LAGQSKDR--------------------IV.SLL...........E----------------------LP.........
Q7PYE1_ANOGA/178-310.EAGNSQTW--------------------Q..QFL...........Q----------------------IP.........
Q16ZJ6_AEDAE/174-302.QQDVEGKF--------------------E..RNL...........L----------------------IP.........
A7SL06_NEMVE/167-299..ARGKEVI--------------------IDDVTI...........T----------------------IP.........
Q23DV9_TETTS/738-882ERGELDQAA--------------------TKSATF...........E----------------------LP.........
O45782_CAEEL/179-307.PGGSTTEW--------------------QE.ESI...........T----------------------IP.........
Q17HB8_AEDAE/169-300.KSGIRDVL--------------------QN.GHL...........T----------------------VP.........
ADCB_DICDI/337-465.QQNQQSTQ--------------------I..VVM...........E----------------------TP.........
Q23FQ6_TETTS/188-318.KINSK.QV--------------------SQEIQL...........Q----------------------IP.........
Q294M3_DROPS/163-297.LRLSKRQY--------------------E..SSI...........C----------------------VP.........
A8WP43_CAEBR/183-324.NCCSEGII--------------------Q..VAL...........V----------------------LP.........
Q6P8F1_XENTR/195-356.VPSKAS.Y--------------------NHTFTL............----------------------LPLLAYNREKR
A3LXL3_PICST/266-408QETLPDDKW--------------------TISTHY...........K----------------------VP.........
O17981_CAEEL/182-333.TPGNEHKF--------------------V..LEF...........R----------------------LP.........
Q16ZK3_AEDAE/167-301.RLPEGGVL--------------------AA.ENL...........Q----------------------VP.........
A8X383_CAEBR/164-301.RSRCRMEF--------------------EK.CLL...........R----------------------IP.........
Q9XXI0_CAEEL/180-321.EFCSNSQI--------------------N..VPL...........V----------------------LP.........
Q20232_CAEEL/173-309.AANSQGKY--------------------DSTLEQP.........IR----------------------LP.........
A0BCE6_PARTE/199-335.SAGKRSEG--------------------LK.SSI...........T----------------------LP.........
Q5AP77_CANAL/170-448DQPMIATPL--------------------D..INV...........S----------------------LPFLTTMSDSL
A0BDM3_PARTE/168-302.IQGIVQTI--------------------KKSILL............----------------------..FDF......
Q23674_CAEEL/182-339.DKNEKQEV--------------------E..KPI...........P----------------------LP.........
ARRD5_BOVIN/171-309.TAFNTTKI--------------------V..STF...........H----------------------LP.........
Q4T8K9_TETNG/86-210.KAGKHAEW--------------------R..EQI...........I----------------------VP.........
YA4C_SCHPO/180-322..EEFSDHY--------------------ELTKNL...........E----------------------LP.........
Q294M1_DROPS/173-305.LRWSRKVY--------------------R..GYL...........D----------------------LP.........
Q4P2K3_USTMA/181-316.YKGDVHTF--------------------D..LVC...........Q----------------------IP.........
A7TDW3_VANPO/229-389PPMDYQDAW--------------------DITAEF...........Q----------------------IP.........
Q6FY06_CANGA/237-406SDMDFQDKW--------------------DINTTI...........E----------------------IP.........
A6R1F7_AJECN/559-759EESFEVGPT--------------------EMEFNV...........Q----------------------LPT........
Q9XXC4_CAEEL/159-308.APGEVKYI--------------------N..VEI...........D----------------------LP.........
A7TQH7_VANPO/294-447RTGSLIDKV--------------------EIDSMI...........K----------------------MP.........
Q16ID9_AEDAE/216-390QTSKATTNQ--------------------EPVVEL............----------------------QPRIRSLTLMD
PALF_KLULA/263-398YTDPETHEA--------------------VIMLKL...........K----------------------VP.........
Q6CG62_YARLI/321-486QELMAGGAT--------------------ELEFDV...........V----------------------IP.........
Q4RUP5_TETNG/170-295.EGGKKKAV--------------------T..QLI...........N----------------------LP.........
Q4PD45_USTMA/601-804SILDPTGPW--------------------ELATEL...........S----------------------IP.........
Q9XTU0_CAEEL/176-327.EPRTEHKA--------------------K..MRL...........K----------------------IP.........
YOA5_SCHPO/223-379NGIAALETY--------------------TTECHI...........Q----------------------IP.........
Q0CQZ7_ASPTN/118-273REGAFEIEW--------------------TAEKQV...........C----------------------LP.........

PF07070

Q8DDE9_VIBVU/6-232-VIKPSEER--------------------VFDVAL-----------D----------------------IP---------
Q9F2L5_STRCO/29-249-RLAAGEET--------------------SIPFTV-----------T----------------------LP---------
SP0M_BACSU/4-221-TIQPGEEH--------------------QFPFTF-----------T----------------------LP---------
Q87KC8_VIBPA/6-231-TIHPGEER--------------------TFDVKL-----------D----------------------VP---------
Q8EMA6_OCEIH/2-220-TIQPGEAK--------------------EIPFNF-----------D----------------------LS---------
Q8YPP0_NOSS1/22-238-TIQPKEEV--------------------VIPFSL-----------N----------------------LP---------
Q9KVV0_VIBCH/21-246-TIEAGETR--------------------NFDIEL-----------S----------------------IP---------
Q935W0_9ACTO/3-222-RLAEGEHR--------------------DVPFAV-----------T----------------------LP---------
Q8CK18_STRCO/3-222-QLKAGVVH--------------------AVPFGL-----------E----------------------IP---------

PF04425

Q6BVD2_DEBHA/1-335TTLLPKIKY--------------------KRFFTF-----------R----------------------VP---------
A3GGA7_PICST/92-585RVLKPSTKY--------------------KKFFTF-----------R----------------------FP---------
A5DRA9_PICGU/36-464RTIHPGNVY--------------------KRFFTF-----------K----------------------IP---------
Q6BJG5_DEBHA/93-577RVLRPHTKY--------------------KKFFTF-----------K----------------------FP---------
A5DPQ0_PICGU/115-602RILQPHQKY--------------------KKFFTF-----------T----------------------FP---------
Q6BSG0_DEBHA/5-422RFFQPNVTY--------------------KRFFTF-----------K----------------------IP---------
A5DN76_PICGU/57-484RYFTPGITY--------------------KRFFNF-----------C----------------------IP---------
Q6BVD1_DEBHA/28-455RKLLPGVTY--------------------KRFFTF-----------K----------------------IP---------
Q5ABB5_CANAL/19-455KILEPGITY--------------------KKYFTF-----------K----------------------IP---------
Q876A8_SACEX/140-571RILEPNMKY--------------------KKIFMF-----------K----------------------LP---------
Q75E04_ASHGO/51-474RVLEPGVKY--------------------KKFFTF-----------K----------------------FP---------
Q875N4_LACKL/72-505RILEPGAKY--------------------KKFFMF-----------K----------------------LP---------
BUL1_YEAST/108-543RVLEPGVKY--------------------KKFFIF-----------K----------------------LP---------
A3LRU1_PICST/29-421SVLLPGTTY--------------------TTPFWF-----------R----------------------IP---------
A5E3Q9_LODEL/66-535RILQPHRKY--------------------KKFFTF-----------R----------------------FP---------
A3LX53_PICST/9-457KILEPNITY--------------------KKFFAF-----------K----------------------VP---------
Q6FUH4_CANGA/102-545RILEPGKKY--------------------KKFFMF-----------K----------------------LP---------
Q6CSE2_KLULA/69-505RFLQPGVRY--------------------KKFFTF-----------K----------------------FP---------
Q6FP46_CANGA/103-568RTFLPKTKY--------------------KKYFMF-----------K----------------------IP---------
Q875T3_NAUCA/106-548RILEPGTRY--------------------KKYFMF-----------K----------------------LP---------
A3LX54_PICST/5-426RLFQPGVTY--------------------KRFFTF-----------R----------------------VP---------
Q876B6_SACSE/94-510RTLEPHTRY--------------------KKFFMF-----------K----------------------LP---------
Q876C9_SACBA/7-447RELKPNTKY--------------------KKFFMF-----------K----------------------LP---------
Q5AN22_CANAL/97-598RLLQPNIKY--------------------KKFFTF-----------K----------------------FP---------
A7TIV7_VANPO/87-537RVLEPGKKY--------------------KKFFTF-----------K----------------------LP---------
Q875T4_NAUCA/96-560RILEPNTKY--------------------KKFFMF-----------K----------------------LP---------
Q875T2_NAUCA/78-518RILEPMTTY--------------------KKYFMF-----------K----------------------LP---------

PF13002

C8ZH73_YEAS8/144-346-------------------------------------------------TELTAAAVLPN--------------------
A7TSP7_VANPO/130-321-------------------------------------------------TELTATAVLPN--------------------
C5GL98_AJEDR/142-318-------------------------------------------------TNLVGRATLPS--------------------
YNSK_SCHPO/63-242-------------------------------------------------TNLVANITLPS--------------------
C5DVA9_ZYGRC/141-332-------------------------------------------------TELTATAVLPN--------------------

PF00339

ARD15_CAEEL/38-167-----------------------------------------------..LNC.P----SS--------------------
ARRB_CALVI/17-172-----------------------------------------------..PNS.P----SS--------------------
ARRD1_MOUSE/7-139-----------------------------------------------..ATA.P----TS--------------------
O44847_CAEEL/8-127-----------------------------------------------..KDC.P----PT--------------------
O17812_CAEEL/8-141-----------------------------------------------..ENI.P----QS--------------------
O17981_CAEEL/6-159-----------------------------------------------..LNV.P----PS--------------------
O17983_CAEEL/6-146-----------------------------------------------..KDC.P----PS--------------------
O17984_CAEEL/4-157-----------------------------------------------..CSVLP----PS--------------------
O42103_ORYLA/17-174-----------------------------------------------..DNL.P----CS--------------------
O42104_ORYLA/14-171-----------------------------------------------..TNL.P----CS--------------------
O45782_CAEEL/7-155-----------------------------------------------..KSL.P----SS--------------------
O76685_CAEEL/6-159-----------------------------------------------..INV.P----PS--------------------
ARRS_BOVIN/22-180-----------------------------------------------..DYL.P----CS--------------------
ARRB1_BOVIN/18-174-----------------------------------------------..PNL.P----CS--------------------
ARRH_LOCMI/25-180-----------------------------------------------..ASS.P----SS--------------------
ARR1_ONCMY/19-175-----------------------------------------------..QNL.P----CS--------------------
ARRS_XENLA/21-176-----------------------------------------------..DFL.P----CS--------------------
ARRH_LIMPO/25-179-----------------------------------------------..ENA.P----PS--------------------
ARRB_CAEEL/22-186-----------------------------------------------..PKS.A----SS--------------------
P91469_CAEEL/7-159-----------------------------------------------..LNI.P----PS--------------------
YC9F_SCHPO/16-169-----------------------------------------------..PDI.P----DS--------------------
Q17624_CAEEL/11-155-----------------------------------------------..KGC.P----ST--------------------
Q20232_CAEEL/7-150-----------------------------------------------..QSSLP----CS--------------------
Q20577_CAEEL/7-158-----------------------------------------------..IEC.P----PS--------------------
Q22321_CAEEL/16-154-----------------------------------------------..DQL.P----TS--------------------
Q23672_CAEEL/8-142-----------------------------------------------..IDC.P----PT--------------------
Q23674_CAEEL/4-159-----------------------------------------------..HWA.P----PS--------------------
Q8SYU5_DROME/5-157-----------------------------------------------..SHC.P----SS--------------------
Q9BIG9_9NEOP/17-173-----------------------------------------------..PNA.P----AT--------------------
ARRD2_MOUSE/9-158-----------------------------------------------..ISL.V----TS--------------------
Q9D6S6_MOUSE/17-166-----------------------------------------------..SEPLA----TS--------------------
Q9I7L0_DROME/5-150-----------------------------------------------..TEC.P----SS--------------------
Q9PTE8_AMBTI/24-179-----------------------------------------------..DYL.P----CS--------------------
PALF_YEAST/39-201-----------------------------------------------RGRGM.L----SS--------------------
Q9V393_DROME/59-214-----------------------------------------------..PYC.P----AS--------------------
Q9VGU7_DROME/5-155-----------------------------------------------..PNA.P----TS--------------------
Q9VHZ9_DROME/5-140-----------------------------------------------..PDC.P----ST--------------------
Q9VI00_DROME/5-148-----------------------------------------------..LEC.P----SS--------------------
Q9VI53_DROME/6-155-----------------------------------------------..PNL.P----SS--------------------
Q9XXC4_CAEEL/3-136-----------------------------------------------..ENS.P----PS--------------------
Q9XXI0_CAEEL/6-159-----------------------------------------------..ANL.P----PS--------------------
Q9XXI4_CAEEL/4-156-----------------------------------------------..INC.A----PS--------------------

PF03643

VPS26_DICDI/8-284-------------------------------------------------NVFNESETLTK--------------------
VP26A_HUMAN/8-283-------------------------------------------------STTTETETIAK--------------------
PEP8_YEAST/5-364-------------------------------------------------NVMTDS.TAIR--------------------
VP26A_ARATH/8-283-------------------------------------------------NTHVETETLAK--------------------
VPS26_SCHPO/5-279-------------------------------------------------NQYSNSETITR--------------------
VPS26_DROME/6-280-------------------------------------------------TMFNENETIAK--------------------
VPS26_CAEEL/7-282-------------------------------------------------NTFKESETVAK--------------------
DSCR3_MOUSE/1-283-------------------------------------------------GYARDATEIQN--------------------

PF02752

Q7PUI7_ANOGA/236-407AVEGALFSSNSA................DPSSSAYNSKLATSAPRGMLSAPATS...AEE....................
Q9TYQ0_CAEEL/174-315.................................................PNLPP...TSI....................
Q7PUR5_ANOGA/187-319.................................................STVPS...DEE....................
Q7PYD9_ANOGA/175-306..................................................TVIP...TCG....................
Q380N5_ANOGA/183-323..................................................PVPS...TET....................
CRED_ASPOR/181-332.................................................KTLTRCLQDT.....................
Q752Z4_ASHGO/228-382.................................................PDLKRITQDCD....................
ARRD5_HUMAN/184-321..................................................LLLSV.SSST....................
ARRD4_HUMAN/191-318..................................................PVTP...SIL....................
Q294M9_DROPS/171-302..................................................STPP...TCV....................
Q6BI98_DEBHA/278-420...............................................SLKELTQ...TCD....................
Q294M7_DROPS/174-306..................................................ATPP...TCF....................
Q6BIN4_DEBHA/247-390.................................................DSLSKCTQDCD....................
Q293Z7_DROPS/175-308.................................................EGAQP...TDD....................
Q9I7K7_DROME/179-320..................................................QTAA...TLT....................
Q294M2_DROPS/166-277..................................................LTSP...IMT....................
A5DM18_PICGU/246-387.................................................ESLSKLTQSCE....................
Q294M5_DROPS/171-304..................................................SVPP...SSR....................
Q16ZK0_AEDAE/170-299..................................................SIAP...TG.....................
A0BIT0_PARTE/173-314.............................................PTKASAIFP...QSS....................
Q4V467_DROME/125-256..................................................STPP...SCF....................
Q7SC90_NEUCR/193-351.........................................DGIVKRGKPGFPMYEVTSF....................
Q66L50_DANRE/187-314..................................................PISP...SIL....................
Q95NF3_ANOGA/193-351G.....................................IALDGQIKRQDQCLAS...TTLLAQ.................
Q6C993_YARLI/185-326.................................................PSLSKVTQDAE....................
O44847_CAEEL/147-273.................................................TDLTA...SF.....................
A0CWE9_PARTE/173-316.............................................PDNYTSIFP...QST....................
Q23QU8_TETTS/188-318.................................................GNVTL...SC.....................
Q6ZM71_DANRE/162-286..................................................ALPH...SSL....................
A8WP41_CAEBR/178-317..................................................AIVP...SF.....................
Q0E8K8_DROME/169-299..................................................PLPP...TNL....................
A0C0J3_PARTE/194-337.............................................AGRHKPLDP...TT.....................
Q16ZJ7_AEDAE/171-300..................................................SVAP...TG.....................
Q8T0P7_DROME/23-156..................................................AVPP...SSR....................
Q55N22_CRYNB/182-345.................................................GNVLV...TVK....................
Q23YG0_TETTS/188-318.................................................GDVTL...SS.....................
Q9W7R1_ORYLA/193-351G.....................................IALDGKLKHEDTNLAS...SSVVKE.................
ARRB_CAEEL/205-363G.....................................LALDGQLKHEDTNLAS...STILDS.................
Q7RZE0_NEUCR/198-350.................................................RTLGKCVQDV.....................
ALY2_SCHPO/345-506.................................................TCLVKERDRLTF...................
Q5AM66_CANAL/305-457.................................................SSLSKCTQDVD....................
Q23YG2_TETTS/174-283.................................................GDITL...SS.....................
ARRB2_MOUSE/195-350G.....................................LALDGQLKHEDTNLAS...STIVKE.................
ARRH_LIMPO/199-353G.....................................IALDGMLKEGDTNLAS...STLN...................
A2BIP7_DANRE/186-313..................................................PSLT...ASI....................
ARRD1_HUMAN/162-286..................................................ALPQ...SAL....................
A2QR01_ASPNC/439-613................................................CQEMRNRDESQRLH..................
Q380P6_ANOGA/182-314..................................................AVPP...TYT....................
YC9F_SCHPO/183-325.................................................DSLGECTQDC.....................
A8E775_DROME/192-350G.....................................IALDGHLKDEDVNLAS...STMVQE.................
Q16H74_AEDAE/171-301..................................................PEPP...SR.....................
A4VB00_PLADU/42-172..................................................PLPP...SYL....................
Q91X82_MOUSE/175-302..................................................KIRP...SIL....................
Q6DH07_DANRE/192-355G.....................................LALDGRLKDEDTNLAS...TTIIRT.................
A8X4Z9_CAEBR/175-315..................................................KLAP...SF.....................
ART1_SCHPO/287-428...............................................DFEDANITGFTT.....................
ARRD2_HUMAN/180-307..................................................PVGP...SIL....................
A2ADV1_MOUSE/190-353G.....................................LALDGKLKHEDTNLAS...STILRP.................
Q294M6_DROPS/179-311..................................................ATAP...TCE....................
Q963B5_LOLPE/193-352G.....................................LALNGKVKYEDTMLAA...STEDAG.................
ADCC_DICDI/344-478.........................................................STTQCVG................
Q08C63_DANRE/204-330.................................................HDIMV...TIE....................
Q6CS19_KLULA/219-373.................................................PNLSKCVQDCL....................
Q2UDU8_ASPOR/60-215.................................................QDLAA...CTQ....................
Q22NR4_TETTS/187-325...............................................DPKLILP...SY.....................
ROD1_YEAST/232-395.................................................ASLTKCSQDCR....................
A0CL31_PARTE/172-315.................................................QHLTP...SI.....................
APYA_EMENI/180-326.................................................QALGHCVQDT.....................
Q4PCS7_USTMA/465-633.................................................ADALS...IS.....................
Q296V0_DROPS/178-310..................................................ALPP...TNL....................
Q8LKK8_PHYSO/242-377...............................................SFESINP...TM.....................
Q6CW08_KLULA/282-443.................................................DDLKRATQDCD....................
A8WP33_CAEBR/159-305.................................................AEATT...PSF....................
Q6PBM9_DANRE/191-353G.....................................LALDGRLKDEDTNLAS...STLLIP.................
Q9PTE7_AMBTI/190-353G.....................................LALDGKLKHEDTNLAS...TTVIRP.................
A0DYQ7_PARTE/173-314.............................................PRNPTSIFP...QSS....................
A0D2Y0_PARTE/206-342.................................................KNLKA...SV.....................
Q5KC81_CRYNJ/436-587...............................................GLLSIR...........................
A7TQI8_VANPO/357-526.................................................NTFAN...KQALH..................
Q17EA7_AEDAE/182-314..................................................PGIP...SDD....................
Q9W2V2_DROME/420-633A.....................................LEDTLQRSTEPEEITGAIAASAIRSPHFVMQNAQLLGGCGHP
Q240M9_TETTS/188-318.................................................SDIPL...SS.....................
Q568E1_DANRE/170-297..................................................PEIS...STI....................
A5DUN4_LODEL/264-404.................................................ASLSKCCQDV.....................
A0NDX6_ANOGA/173-303..................................................PEPP...TR.....................
Q16ZJ5_AEDAE/174-305..................................................PLPP...TSK....................
Q7QCL7_ANOGA/170-301..................................................PLPP...TNL....................
A2QTZ8_ASPNC/184-328.................................................NDPKECLQSL.....................
O17983_CAEEL/173-318..................................................AVVS...TIR....................
Q9V393_DROME/233-393G.....................................LALDGQLKHEDTNLAS...STLITN.................
A0BMC5_PARTE/210-346.................................................KSLRA...TI.....................
A1C8U8_ASPCL/140-283.................................................RNRRKCRQSH.....................
A0D004_PARTE/178-324.........................................................ST.....................
Q16ZK1_AEDAE/136-269..................................................QTPV...TST....................
Q17EA8_AEDAE/183-323..................................................PITP...TED....................
Q16ZJ8_AEDAE/186-315..................................................ATAP...TG.....................
PALF_ASHGO/233-368.................................................LDAFP...TLV....................
ARRS_MOUSE/200-361G.....................................IALDGKIKHEDTNLAS...STIIKE.................
A8WP37_CAEBR/170-319.................................................RGIPA...TF.....................
Q6GR39_XENLA/180-307..................................................PLGP...SIL....................
Q5BAI3_EMENI/174-332.........................................EGILPRGKPGFPTYAVSGF....................
Q5C229_SCHJA/8-167G.....................................LALDGKLKHEDTNLAS...STIICN.................
Q9GYT5_CAEEL/181-328..................................................SVTP...TIN....................
MU170_SCHPO/266-426..................................................EFCR...SVN....................
Q5AI11_CANAL/271-413.................................................EHLKKITQSCE....................
A5DW17_LODEL/261-403.................................................ENLKQITQSCE....................
A0D012_PARTE/172-315................................................QIVLTP...ST.....................
ADCA_DICDI/313-441.................................................VDLKP...SSS....................
Q9I7L0_DROME/174-307..................................................ATPP...TCF....................
A7SF55_NEMVE/129-256..................................................DVVP...TMR....................
Q16ZK2_AEDAE/273-408..................................................WVQP...TSR....................
A8XYD8_CAEBR/172-316..................................................PVVA...TIR....................
Q9VHZ8_DROME/164-279...................................................IMS...HSD....................
A0E996_PARTE/174-317.................................................KSIFP...QST....................
A6S093_BOTFB/188-324.................................................KRLSRCVQDV.....................
Q0U5A6_PHANO/182-337.................................................KSLKNCRQSV.....................
PALF_YEAST/259-394.................................................LDAFS...TLT....................
Q23672_CAEEL/163-311.................................................EEAKT...PSF....................
Q6VZJ8_CNPV/177-304..................................................QVSH...SIL....................
A7TPY5_VANPO/228-381.................................................ASLSKCTQDCS....................
A7A259_YEAS7/232-393.................................................NSLSNCVQDCD....................
Q759V0_ASHGO/221-368.................................................PSLSKCCQDCT....................
Q9VGU7_DROME/180-316..................................................PTTP...STQ....................
Q6FM62_CANGA/224-379.................................................PDLMKCSPDCF....................
A7SKJ5_NEMVE/177-307..................................................PLPP...TMS....................
Q6CGL3_YARLI/174-329.........................................DSIVAKERQDVPTIAMSGF....................
A6S0J6_BOTFB/81-239.........................................EGIIRRGKAAFPMHFVNSF....................
Q6AZP4_XENLA/162-286..................................................ALPQ...SIL....................
O42103_ORYLA/193-351G.....................................IALDGRLKHEDTNLAS...SSIVKQ.................
ARRD5_MOUSE/170-307..................................................LVLSV.SSGS....................
Q17624_CAEEL/176-340YE...................................DPSKIEHILSPYGKLLESPSTATL...................
A0D9C9_PARTE/194-337.............................................QGRNQPLDP...TT.....................
A6ZV52_YEAS7/332-475.................................................DNLKQITQDCC....................
A0CE97_PARTE/209-345.................................................KELKA...SL.....................
Q7PYE1_ANOGA/178-310..................................................PLPP...SNL....................
Q16ZJ6_AEDAE/174-302..................................................SLPP...SS.....................
A7SL06_NEMVE/167-299..................................................QLRP...TS.....................
Q23DV9_TETTS/738-882.................................................PNLQP...SF.....................
O45782_CAEEL/179-307..................................................SLPP...KLG....................
Q17HB8_AEDAE/169-300..................................................PLPP...TNL....................
ADCB_DICDI/337-465.................................................QTLLN...SIY....................
Q23FQ6_TETTS/188-318.................................................SNVLL...SS.....................
Q294M3_DROPS/163-297.................................................MDTPR...STL....................
A8WP43_CAEBR/183-324.................................................NPLIP...SF.....................
Q6P8F1_XENTR/195-356E.....................................IALDGKLKHEDTNLAS...STLLKE.................
A3LXL3_PICST/266-408.................................................ENLARITQSCV....................
O17981_CAEEL/182-333..................................................SVTP...TIC....................
Q16ZK3_AEDAE/167-301..................................................WVLP...SSC....................
A8X383_CAEBR/164-301.................................................DAAPP...TQNYN..................
Q9XXI0_CAEEL/180-321.................................................NQLVP...SF.....................
Q20232_CAEEL/173-309..................................................VVPP...TLV....................
A0BCE6_PARTE/199-335.................................................NDLAA...TV.....................
Q5AP77_CANAL/170-448IMTSAIEEEGSDSPHTSRRGSAVSMTDNNTTPSNNNPLSPFLGAVETNGASI.....NEIGDHT................
A0BDM3_PARTE/168-302..............................................HNRMELST..........................
Q23674_CAEEL/182-339..................................................PLPP...STK....................
ARRD5_BOVIN/171-309..................................................PVLSVSGSGS....................
Q4T8K9_TETNG/86-210..................................................PLPQ...SAL....................
YA4C_SCHPO/180-322.................................................SSLVECLQDC.....................
Q294M1_DROPS/173-305..................................................SIPP...TSV....................
Q4P2K3_USTMA/181-316.................................................RTHTL...MTI....................
A7TDW3_VANPO/229-389.................................................ASLSKCTQDCN....................
Q6FY06_CANGA/237-406.................................................PNLLACVQDCT....................
A6R1F7_AJECN/559-759................................................CAELKKRDPIRSLH..................
Q9XXC4_CAEEL/159-308.................................................NGLPP...TF.....................
A7TQH7_VANPO/294-447.................................................DDLKKATQDCD....................
Q16ID9_AEDAE/216-390VIRTEPQL.......................SGRDELATELPGRWSRNMVDGKYRIADPS....................
PALF_KLULA/263-398.................................................LDTFP...SLD....................
Q6CG62_YARLI/321-486..................................................EKVGRDKKERLH..................
Q4RUP5_TETNG/170-295..................................................MELP...SSI....................
Q4PD45_USTMA/601-804................................................ACGTTRINLSTN....................
Q9XTU0_CAEEL/176-327..................................................CTCP...TF.....................
YOA5_SCHPO/223-379..................................................DKEA...TIT....................
Q0CQZ7_ASPTN/118-273.................................................GTLDT...VTQ....................

PF07070

Q8DDE9_VIBVU/6-232-------------------------------------------------FNTPITI....--------------------
Q9F2L5_STRCO/29-249-------------------------------------------------WETPATELYGR--------------------
SP0M_BACSU/4-221-------------------------------------------------LDTPITV....--------------------
Q87KC8_VIBPA/6-231-------------------------------------------------WNTPVTI....--------------------
Q8EMA6_OCEIH/2-220-------------------------------------------------PQTPLTV....--------------------
Q8YPP0_NOSS1/22-238-------------------------------------------------DEMPLTF....--------------------
Q9KVV0_VIBCH/21-246-------------------------------------------------WNTPVTI....--------------------
Q935W0_9ACTO/3-222-------------------------------------------------WETPITELYGQ--------------------
Q8CK18_STRCO/3-222-------------------------------------------------WETPITMIDGQ--------------------

PF04425

Q6BVD2_DEBHA/1-335----------------------------------SSLLECACG.NHLGNHLKTP---PSCGDD.................
A3GGA7_PICST/92-585----------------------------------NRLLDNSCI.HSILPHILPP---PSMGVDSTCFYNRGQSIQMNKAL
A5DRA9_PICGU/36-464----------------------------------AQLLDSECS.HNLSGHTHIP---PSLGSSRQEQAKYSSKQMQTMR.
Q6BJG5_DEBHA/93-577----------------------------------HKLLDNNCI.HDVLPHILPP---PSMGLDKTCFYNRGGTIVLNKAL
A5DPQ0_PICGU/115-602----------------------------------EKLLDNNCM.HSILPHVLPP---PSFGFDKSSFYHRGENVSLNKAL
Q6BSG0_DEBHA/5-422----------------------------------EKLLDNTCEEHTFSIHTEIP---PSIGISRTSTTPSSLLVSNNGQ.
A5DN76_PICGU/57-484----------------------------------DKLLDCACETHNLATHCEPP---PTIGLARDQFLKNLRKLRGRPAT
Q6BVD1_DEBHA/28-455----------------------------------ENLLDSECG.HSLSDHTQIP---PSLGKSRSEDYVNLTYKPDATK.
Q5ABB5_CANAL/19-455----------------------------------EKLLDSACE.HSLIKHLQIP---PTFGVCKNEVISSLRHKWKDQQ.
Q876A8_SACEX/140-571----------------------------------TQLLDVSCK.HEQYSHCLLP---PSFGIDKFKDHGKYAGIRINSVL
Q75E04_ASHGO/51-474----------------------------------MQLLDVSCK.HEQFSHCLVP---PSFGIDKYKSNGKYATIQTNPLL
Q875N4_LACKL/72-505----------------------------------NQLLDISCK.HEQFSHCLMP---PSFGIDKFKSGGKYSSIKINPML
BUL1_YEAST/108-543----------------------------------LQLLDVTCK.QEHFSHCLLP---PSFGIDKYRNNCKYSGIKVNRVL
A3LRU1_PICST/29-421----------------------------------HQLVESACQHNPSTSHCQLP---PSFGIPLGSKTD...........
A5E3Q9_LODEL/66-535----------------------------------QRLLDNDCP.DAIFLHLLPP---PSVGVDKTSFYNRGEGIVINKAL
A3LX53_PICST/9-457----------------------------------EKLLDVTCE.HGFVKHLQIP---PTLGISKNEVITSLRQKYKESD.
Q6FUH4_CANGA/102-545----------------------------------TQLLDVTCK.QEHYAHCLLP---PSFGIDKYRNNCKYSVIKVNHVL
Q6CSE2_KLULA/69-505----------------------------------NQLLDISCK.HEMFCHCLLP---PSFGVDKYKHHARYSNIKLNSML
Q6FP46_CANGA/103-568----------------------------------DQLLDVTCR.QEIFPHCSLP---PSLGIDKWKDNGKYSIIKVNNVL
Q875T3_NAUCA/106-548----------------------------------NQLLDTTCK.QEHFSHCLLP---PSFGIDKYRNGCKYSGIKVNNVL
A3LX54_PICST/5-426----------------------------------QKLLDDICEPHSLSRHTDVP---PSIGIPRGLIAPSLLLANRESQ.
Q876B6_SACSE/94-510----------------------------------QQLLDMTCK.HEHYSHCLLP---PSFGIDKFKNHFKYSGIKINNVL
Q876C9_SACBA/7-447----------------------------------TQLLDVTCK.QEQFSHCLLP---PSFGIDRYKNNCKYSGIKVNSVL
Q5AN22_CANAL/97-598----------------------------------HRLLDNACI.NSLLPHLLPP---PSMGIDRTCFYNRGEAIQLNKAL
A7TIV7_VANPO/87-537----------------------------------SQLLDITCK.QEQFAHCLLP---PSLGLDKYRNNGRYSGIKVNSVL
Q875T4_NAUCA/96-560----------------------------------NQLLDVTCK.HEQYAHCLLP---PSFGIDSYKNGGKYSQIKVNSVL
Q875T2_NAUCA/78-518----------------------------------NQLLDTTCK.QEHFSHCLLP---PSLGVDKXXNGCVYSGIEVNNVL

PF13002

C8ZH73_YEAS8/144-346-----------------------------------VV-YPKS--------TFPLEMKLDGVSSGD....RRWRMRKLSWR
A7TSP7_VANPO/130-321-----------------------------------VV-YPKS--------SFPLEMKIDGISSGD....RRWRMRKLNWR
C5GL98_AJEDR/142-318-----------------------------------VV-HPIG--------NFPIQLTLCGVVERKEGGRIRWRLRKTMWR
YNSK_SCHPO/63-242-----------------------------------TL-HPHG--------AALMEVTMTGFAQND...GNDWKINRVTWR
C5DVA9_ZYGRC/141-332-----------------------------------VV-YPKS--------TFPLEMKIEGISIGD....RRWRMRKLTWR

PF00339

ARD15_CAEEL/38-167-----------------------------------YE-SQFG........SIRYQMKVEL....R----------.....
ARRB_CALVI/17-172-----------------------------------VT-LQQEGDDLGKPLGVEYTIRAYVADSED----------....D
ARRD1_MOUSE/7-139-----------------------------------FE-GPFG........KIVHQVRASI....D----------TPRFS
O44847_CAEEL/8-127-----------------------------------Y.-.KDG........KIIYKVRLEI....D----------QP.WS
O17812_CAEEL/8-141-----------------------------------FE-GPFG........FIRFYIKVHM....D----------RP.HA
O17981_CAEEL/6-159-----------------------------------FE-GKYG........YLRYSVTAEV....D----------RP.WR
O17983_CAEEL/6-146-----------------------------------FE-GKYG........FIRYSVLLHIAVPNG----------KP...
O17984_CAEEL/4-157-----------------------------------FE-GNNG........NIRYWVRAEV....S----------RS.WK
O42103_ORYLA/17-174-----------------------------------VS-LQPGPLDEGKKCAVEFEVKAFCGEAQD----------....E
O42104_ORYLA/14-171-----------------------------------VS-LQPGPDDKGKACGVDFEVKTYLAKEKN----------NP.DE
O45782_CAEEL/7-155-----------------------------------FE-GEFG........HIRYTCKAIC....E----------RP.WD
O76685_CAEEL/6-159-----------------------------------FE-GKYG........YLRYSVTAEV....D----------RP.WR
ARRS_BOVIN/22-180-----------------------------------VM-LQPAPQDVGKSCGVDFEIKAFATHSTD----------VEE.D
ARRB1_BOVIN/18-174-----------------------------------VT-LQPGPEDTGKACGVDYEVKAFCAENLE----------....E
ARRH_LOCMI/25-180-----------------------------------VT-LQPGDDDQGKPLGVEYSVKTWVGDHAE----------....E
ARR1_ONCMY/19-175-----------------------------------VT-LQPGPEDTGKACGVDFEIRAFCAKSIE----------....E
ARRS_XENLA/21-176-----------------------------------VS-LQPAPSDVGKACGVDFEIKAFSTNNLE----------....D
ARRH_LIMPO/25-179-----------------------------------VT-LQPGSEDQGRPLGVEYELKLFIAETED----------....E
ARRB_CAEEL/22-186-----------------------------------VT-LQPAPGDTGKPCGVDYELKTFVAVTDG----------SS.GE
P91469_CAEEL/7-159-----------------------------------FE-GKYG........YLRYTVKVEV....D----------RP.WR
YC9F_SCHPO/16-169-----------------------------------IE-GIPG.......CHIIYTLTASLERATQ----------PP...
Q17624_CAEEL/11-155-----------------------------------YE-GPHA........FIRYFIRASLVQEDE----------FE.KI
Q20232_CAEEL/7-150-----------------------------------LE-SRHC........TIRYYFKVII....D----------IP.YA
Q20577_CAEEL/7-158-----------------------------------FE-GFHG........HVRYSVRVEL....D----------RP.WK
Q22321_CAEEL/16-154-----------------------------------VY-SPKG........HIQYVIQCTLEYKTA----------AG.TP
Q23672_CAEEL/8-142-----------------------------------HE-GYAG........GTNYKVKVEI....D----------RP.WK
Q23674_CAEEL/4-159-----------------------------------FE-GDLG........FIRYFIKVEI....D----------RP.WK
Q8SYU5_DROME/5-157-----------------------------------FE-GAYG........HIRYLAKVTF....L----------KP.GA
Q9BIG9_9NEOP/17-173-----------------------------------IT-LQPGAEDQGEPCGVQYFLKAFVGESDT----------....E
ARRD2_MOUSE/9-158-----------------------------------FE-GKHG........SVRYSIKATL....H----------RP.WV
Q9D6S6_MOUSE/17-166-----------------------------------FT-GKYG........SIQYCVRAVL....E----------RP.QV
Q9I7L0_DROME/5-150-----------------------------------FE-GSHG........RVRYMATVTL....V----------RP.WK
Q9PTE8_AMBTI/24-179-----------------------------------VC-LQPAPQDKAKSCGVDFEVKVFSTANLD----------....E
PALF_YEAST/39-201-----------------------------------IK-FERG........SITYFLSCTLESLNN----------IN.GL
Q9V393_DROME/59-214-----------------------------------VS-LQPAPGDVGKSCGVDYELKAFVGENVE----------....D
Q9VGU7_DROME/5-155-----------------------------------FN-GAHG........QIKHEVTLTI....D----------RA.VR
Q9VHZ9_DROME/5-140-----------------------------------CK-GPYG........YIAYTISLTI....D----------KP.WG
Q9VI00_DROME/5-148-----------------------------------VV-AQYG........KIFYEVSVVI....D----------RQ.WR
Q9VI53_DROME/6-155-----------------------------------FE-GEFG........HVRYTIKVTL....D----------RP.WK
Q9XXC4_CAEEL/3-136-----------------------------------FC-GMFG........EIEYSVTVEF....D----------RP.WR
Q9XXI0_CAEEL/6-159-----------------------------------FE-GTHG........NVRYSVHVEL....D----------RP.WR
Q9XXI4_CAEEL/4-156-----------------------------------FE-GCHG........HIRYDVHVEL....D----------RP.WK

PF03643

VPS26_DICDI/8-284-----------------------------------FE-IMDGAPVR----GESIPVRLFLSVFDL----------TPTYR
VP26A_HUMAN/8-283-----------------------------------YE-IMDGAPVK----GESIPIRLFLAGYDP----------TPTMR
PEP8_YEAST/5-364-----------------------------------YE-IMDGSSVK----GETIPIRLFLSGYDL----------TPNMS
VP26A_ARATH/8-283-----------------------------------FE-LMDGAPVR----GESIPVRVFLTPYDL----------TPTHK
VPS26_SCHPO/5-279-----------------------------------FQ-IMDGNPNR----GETIPLRMFLNGYAL----------TPTFR
VPS26_DROME/6-280-----------------------------------YE-IMDGAPVK----GESIPIRVFLAGYNL----------TPTMR
VPS26_CAEEL/7-282-----------------------------------FE-IMDGAPVR----GESIPIRLFLAGYDL----------APSMR
DSCR3_MOUSE/1-283-----------------------------------IQ-IADGDICR----NLSVPLYMVFPRLFT----------CPTLE

PF02752

Q7PUI7_ANOGA/236-407...................................KN-VFAI--------YVSYYVKVKLILS.................
Q9TYQ0_CAEEL/174-315...................................HA-NRLV--------TVSYFFKLDLD...................
Q7PUR5_ANOGA/187-319....................................R-CRII--------MTRYEVEVMIRPV.................
Q7PYD9_ANOGA/175-306....................................D-QNLI--------SVAYRLHMTVRVQ.................
Q380N5_ANOGA/183-323...................................TH-SRIV--------AVEYELALVVKPQ.................
CRED_ASPOR/181-332....................................D-TKGI--------KVRHKLKFRVQLMN................
Q752Z4_ASHGO/228-382..................................V.G-ASLI--------RVRHKLLVHIVLLRGPP...........DA
ARRD5_HUMAN/184-321..................................Q.D-GEIM--------HTRYELVTTVHLP.................
ARRD4_HUMAN/191-318....................................D-CCII--------RVDYSLAVYIHIP.................
Q294M9_DROPS/171-302...................................EL-SNLI--------QIAYQVEVVALVK.................
Q6BI98_DEBHA/278-420...................................LK-NNII--------QVKHRLRIAVQLKN................
Q294M7_DROPS/174-306...................................NL-CSII--------QIAYQVEAEVKVK.................
Q6BIN4_DEBHA/247-390....................................I-QNFI--------KVRHKLKFTIGLIN................
Q293Z7_DROPS/175-308...................................QL-SGVI--------TIVYELRVEAVLR.................
Q9I7K7_DROME/179-320..................................VAG-CACL--------QLNYEVEVLVTTQ.................
Q294M2_DROPS/166-277....................................D-ERQP--------QVSYYIETLSHMK.................
A5DM18_PICGU/246-387...................................PK-SGAI--------SVKHRVRISIQLSN................
Q294M5_DROPS/171-304....................................T-DSII--------TVSYRVLFSIKMG.................
Q16ZK0_AEDAE/170-299....................................N-CSVL--------TIDYELNVTIQVD.................
A0BIT0_PARTE/173-314...................................LK-TKRI--------IFQYILTLKVIFAKR...............
Q4V467_DROME/125-256...................................HL-CRII--------KIGYQIEVVAKVK.................
Q7SC90_NEUCR/193-351..................................TTS-STLY--------KIEFFLSIKAHMN.................
Q66L50_DANRE/187-314....................................D-CSII--------HVEYSLMVYVDIP.................
Q95NF3_ANOGA/193-351................................PDQRD-AFGV--------IISYAVKVKLFLG.................
Q6C993_YARLI/185-326....................................V-PNLI--------KVTHKFKFVVGLKNP..............G
O44847_CAEEL/147-273....................................H-TCGS--------SLKYTMKFGLVTD.................
A0CWE9_PARTE/173-316...................................IK-TKRV--------SYQYILTVNVIFSRQ...............
Q23QU8_TETTS/188-318....................................Q-GSLI--------QVNYFLEFYPEIST................
Q6ZM71_DANRE/162-286...................................SD-GNLI--------QICYYIQVYLKYP.................
A8WP41_CAEBR/178-317....................................T-CPII--------DVDYCISVKLDTA.................
Q0E8K8_DROME/169-299...................................HG-CHLI--------KISYDVFFVIEPK.................
A0C0J3_PARTE/194-337....................................N-GKIV--------QNNYQLSATGEMDGI...............
Q16ZJ7_AEDAE/171-300....................................K-CSVL--------VIDYLLKVKVHCG.................
Q8T0P7_DROME/23-156....................................T-EGII--------SVSYQVILTISTG.................
Q55N22_CRYNB/182-345....................................G-AKTL--------EVEYDLEVKAIMEGVAEKV......EMRGI
Q23YG0_TETTS/188-318....................................Q-GQMI--------QVQYGLQLTSVIDT................
Q9W7R1_ORYLA/193-351................................GVLKE-VMGI--------MVSYRVMVKLIVGG................
ARRB_CAEEL/205-363................................KTSKE-SLGI--------VVQYRVKVRAVLG.................
Q7RZE0_NEUCR/198-350....................................N-AHGI--------KVRHKLKVVLALHNP..............D
ALY2_SCHPO/345-506..................................DTT-YKYI--------KVRHRLKALLVLSIEN............TE
Q5AM66_CANAL/305-457....................................L-STNV--------RVRHKLKFNIGLINP..............D
Q23YG2_TETTS/174-283....................................Q-GQLL--------SVVYSLRII.....................
ARRB2_MOUSE/195-350................................GANKE-VLGI--------LVSYRVKVKLVVS.................
ARRH_LIMPO/199-353.................................STGD-AIGI--------VISYVIRVRLYMG.................
A2BIP7_DANRE/186-313...................................LN-CRIL--------KVEYRLRVYLDVK.................
ARRD1_HUMAN/162-286...................................PG-CSLI--------HIDYYLQVSLKAP.................
A2QR01_ASPNC/439-613.................................FDTT-YENI--------QINHWIKIVLRLSKVD............ER
Q380P6_ANOGA/182-314...................................DG-APLF--------SVNYELEVEARVT.................
YC9F_SCHPO/183-325....................................D-LNCI--------RVHHKLRLSISLLNP..............D
A8E775_DROME/192-350...............................GKSTGD-ACGI--------VISYSVRIKLNCG.................
Q16H74_AEDAE/171-301....................................T-TSII--------QIEYFIEVVAKIP.................
A4VB00_PLADU/42-172...................................GG-CRII--------NITYILKLAVSPS.................
Q91X82_MOUSE/175-302....................................G-CNIL--------KVEYSLLIYVSVP.................
Q6DH07_DANRE/192-355................................GMDKE-MLGI--------LVSYKIKVNLMVSGGG.............L
A8X4Z9_CAEBR/175-315....................................Q-CPII--------GVEYCLSVKLDTE.................
ART1_SCHPO/287-428....................................T-SDLY--------SVQYMLVIKVQLY.................
ARRD2_HUMAN/180-307....................................H-CRVL--------HVDYALKVCVDIP.................
A2ADV1_MOUSE/190-353................................GMNKE-LLGI--------LVSYKVRVNLVVSYGG.............I
Q294M6_DROPS/179-311...................................HL-SKVV--------RVSYEVRVVAVMN.................
Q963B5_LOLPE/193-352................................NVDKE-NLGV--------VVSYKVRIKMTLG.................
ADCC_DICDI/344-478..............................LIHSIAE-TKMI--------RVEYHLLVNLDIP.................
Q08C63_DANRE/204-330....................................N-CRII--------KVQYELKVYLDVSF................
Q6CS19_KLULA/219-373....................................I-LTNI--------KVRHKLKFVIALVNP..............D
Q2UDU8_ASPOR/60-215..................................DVS-SKMM--------TIKHQVAFTVELLG................
Q22NR4_TETTS/187-325....................................N-GGAF--------SCRYFLQFTFLYNG................
ROD1_YEAST/232-395....................................I-LSNI--------KVRHKIKFTISLLNP..............D
A0CL31_PARTE/172-315....................................I-GNCV--------NSIYYLKVQPHYEGC..............S
APYA_EMENI/180-326....................................E-DMGV--------RVSHKLKIHVRMHNP..............D
Q4PCS7_USTMA/465-633....................................R-GRHV--------EVVYSIKVSIGSS.................
Q296V0_DROPS/178-310...................................SN-CGII--------ALDYDLHVTCEVS.................
Q8LKK8_PHYSO/242-377....................................A-CNFV--------QWKYRLVVTCSFR.................
Q6CW08_KLULA/282-443...................................VG-ADLI--------KVRHKLQVHITLKRNVIHK......DKPDD
A8WP33_CAEBR/159-305....................................A-SGMM--------THGYLLVAHVQVK.................
Q6PBM9_DANRE/191-353................................DMDKQ-MQGV--------VVSYKIKVILMMGGG..............L
Q9PTE7_AMBTI/190-353................................GMDKE-VLGI--------LVSYKVKVHLVVARGG.............I
A0DYQ7_PARTE/173-314...................................VK-TKRI--------IFQYILTLQVSFGKR...............
A0D2Y0_PARTE/206-342....................................K-NQTI--------LNQYLLQIEAIIDQL...............
Q5KC81_CRYNJ/436-587....................................R-TKLV--------DVSYTLRVTLNNS.................
A7TQI8_VANPO/357-526.................................PDTG-YEKI--------KSQHWIKICLRLSRM..............I
Q17EA7_AEDAE/182-314...................................SH-CRVI--------QVKYELDITVQPI.................
Q9W2V2_DROME/420-633LGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERN-VFAI--------YVSYYVKVKLTLS.................
Q240M9_TETTS/188-318....................................Q-GELV--------QVVYQLQLIPQIST................
Q568E1_DANRE/170-297...................................HN-CRIL--------KVEYRLKVILDVS.................
A5DUN4_LODEL/264-404....................................D-GEHV--------KVRHKLKFNIGLINP..............D
A0NDX6_ANOGA/173-303....................................S-DTII--------RLEYFVEVTAKVP.................
Q16ZJ5_AEDAE/174-305....................................T-CQVL--------TVNYMVEVEGKIS.................
Q7QCL7_ANOGA/170-301...................................RG-CHLI--------RIQYDVCFLIEPK.................
A2QTZ8_ASPNC/184-328....................................S-TNFL--------HVEHTLTTQIKLLN................
O17983_CAEEL/173-318....................................S-SRLL--------AVEYFVTVWGDTG.................
Q9V393_DROME/233-393................................PAQRE-SLGI--------MVHYKVKVKLLISS................
A0BMC5_PARTE/210-346....................................K-TSVI--------RNQYFLQMEAIADAF...............
A1C8U8_ASPCL/140-283....................................P-NSTM--------PIRHLIRVDIRIANR..............D
A0D004_PARTE/178-324....................................N-GEII--------KSHYQIVIRASFGIS...............
Q16ZK1_AEDAE/136-269..................................DDS-CKII--------QIVYELEAELEVG.................
Q17EA8_AEDAE/183-323...................................RQ-SKIL--------KIGYEIDVLVKPK.................
Q16ZJ8_AEDAE/186-315....................................K-CSII--------SVEYELKVKVKLG.................
PALF_ASHGO/233-368...................................VP-NQGF--------TFQYYIEVLANLSS................
ARRS_MOUSE/200-361................................GIDRT-VMGI--------LVSYHIKVKLTVSGF...............
A8WP37_CAEBR/170-319....................................E-SAMI--------SMGYLLGFSLKNG.................
Q6GR39_XENLA/180-307....................................Q-CRII--------RVEYALKVYVEIP.................
Q5BAI3_EMENI/174-332..................................TTT-ASLY--------KIEYYLTVKAHLT.................
Q5C229_SCHJA/8-167................................PNHKE-NLGM--------TVQYRVKVRLVLG.................
Q9GYT5_CAEEL/181-328...................................QF-SPVI--------TVEYILQVNVDGL.................
MU170_SCHPO/266-426....................................L-KDQL--------KIDYTLEVCFSAF.................
Q5AI11_CANAL/271-413...................................LR-DNMI--------VVKHRLRVSIQLRNS..............G
A5DW17_LODEL/261-403...................................IK-SGMI--------VVKHRLRVAIQLKNK..............E
A0D012_PARTE/172-315....................................T-GNFV--------NSSYYVKILPNFEGC..............T
ADCA_DICDI/313-441....................................L-GKHI--------TSSYLLELECDIPM................
Q9I7L0_DROME/174-307...................................NL-CGII--------QIAYQVEVEARVK.................
A7SF55_NEMVE/129-256....................................N-CGIV--------SICYHLKVIVAVAH................
Q16ZK2_AEDAE/273-408....................................C-SKVI--------KISYELKVALELDS................
A8XYD8_CAEBR/172-316....................................N-SKCI--------NVEYNVSIWADTG.................
Q9VHZ8_DROME/164-279....................................Q-LDPI--------QISYYIETFNSLN.................
A0E996_PARTE/174-317...................................LF-SDRI--------IYHYNFCLIANYSQ................
A6S093_BOTFB/188-324....................................D-VHGI--------KIRHK.........................
Q0U5A6_PHANO/182-337....................................D-TENI--------RLTHKLRLYVNLKNP..............E
PALF_YEAST/259-394...................................TV-GKFF--------SFQYYIEVMVNLSK................
Q23672_CAEEL/163-311....................................S-TGLV--------NFGYFMEFGIVTK.................
Q6VZJ8_CNPV/177-304....................................N-CSII--------RLEYLLVIYVEIP.................
A7TPY5_VANPO/228-381....................................I-LRNI--------KVRHKLKFVIPLINP..............D
A7A259_YEAS7/232-393....................................V-RSNI--------KVRHKLKFFIILINP..............D
Q759V0_ASHGO/221-368....................................I-LNNI--------KVRHKVKLVISLVNP..............E
Q9VGU7_DROME/180-316...................................SE-KDPI--------RVSYTLRFIAKTFK................
Q6FM62_CANGA/224-379....................................T-LERI--------KCRHQIKVVASLINP..............D
A7SKJ5_NEMVE/177-307....................................S-CRCI--------QVTYELEVEVDVS.................
Q6CGL3_YARLI/174-329..................................TAK-SSLY--------KVEYLLVIKAKFS.................
A6S0J6_BOTFB/81-239..................................TTT-GTLY--------KIEFFLVIKVHLS.................
Q6AZP4_XENLA/162-286...................................QG-CNLI--------HVDYYIQVSVKNP.................
O42103_ORYLA/193-351................................EVLKE-IQGM--------LVSYKVVLKMIASG................
ARRD5_MOUSE/170-307...................................QE-NEIM--------RTSYELVVTIHLP.................
Q17624_CAEEL/176-340.................................RFRK-IPFL--------KVEYGIQVTLGTD.................
A0D9C9_PARTE/194-337....................................N-GKVV--------MNNYQLSATGDLDGT...............
A6ZV52_YEAS7/332-475...................................LQ-DNLI--------RVMHKLQVRILLQRQV............DG
A0CE97_PARTE/209-345....................................K-TNTI--------KNQYFFQLEAIVDSF...............
Q7PYE1_ANOGA/178-310...................................VN-CGII--------DVDYDIKVVAEAS.................
Q16ZJ6_AEDAE/174-302....................................V-SPLI--------TIAYELAVYVHLS.................
A7SL06_NEMVE/167-299....................................L-YGII--------TTAYTIEVIINIK.................
Q23DV9_TETTS/738-882....................................Q-GKQF--------SCKYFFELYAHYVK................
O45782_CAEEL/179-307....................................K-CKIL--------SVTYSVELEVEQT.................
Q17HB8_AEDAE/169-300...................................LG-CHLI--------RIQYSVCILIEPN.................
ADCB_DICDI/337-465....................................Q-SGII--------KIEYKVRAVLDIL.................
Q23FQ6_TETTS/188-318....................................Q-GQLI--------QMNYYLQIIPDVNS................
Q294M3_DROPS/163-297...................................NT-NYIV--------FLHYTLQVKLKTG.................
A8WP43_CAEBR/183-324....................................K-TNII--------EVDYCVTVEVEKD.................
Q6P8F1_XENTR/195-356................................GIDRT-VMGI--------LVDYKIKVTLTVSGL...............
A3LXL3_PICST/266-408...................................LK-NNII--------QVRHRLRVCVQLNNK..............E
O17981_CAEEL/182-333...................................RF-SPVI--------TVEYVVQVRVETT.................
Q16ZK3_AEDAE/167-301....................................Y-SFVV--------QIAYEVAVEFQFDT................
A8X383_CAEBR/164-301................................RGGGE-CSII--------AIHFVLKLTALPG.................
Q9XXI0_CAEEL/180-321....................................R-TGII--------EVDYCIIVDIGEN.................
Q20232_CAEEL/173-309...................................GV-CRLI--------QIYYALRVCMEDE.................
A0BCE6_PARTE/199-335....................................K-MQFI--------KNHYILQVQAFADGL...............
Q5AP77_CANAL/170-448...............................LFPDSN-FRHI--------EIKHRLQVTFRISKPDS...........DN
A0BDM3_PARTE/168-302....................................T-GQLI--------KVDYLIRIQAYSTL................
Q23674_CAEEL/182-339....................................T-CEII--------DVEYFLKVKMSTS.................
ARRD5_BOVIN/171-309...................................QD-SEIM--------NTQYELVSTVHLP.................
Q4T8K9_TETNG/86-210...................................AG-CSLI--------DIEYFIQVSLKSP.................
YA4C_SCHPO/180-322....................................D-LDGI--------KIRHKLKFSVSLRNP..............D
Q294M1_DROPS/173-305...................................KP-TCPI--------SVNYSIKIIVNPT.................
Q4P2K3_USTMA/181-316...................................QT-AKHI--------EVSYSLRVQV....................
A7TDW3_VANPO/229-389....................................V-LKNI--------KVRHKLKFIISLINP..............D
Q6FY06_CANGA/237-406....................................V-LNNV--------KIRHKLKFVICLINP..............D
A6R1F7_AJECN/559-759.................................FDTT-HEQL--------QIHHWIKIVLRLSRTD............ER
Q9XXC4_CAEEL/159-308....................................E-SPMI--------SMGYLLGFTLRNG.................
A7TQH7_VANPO/294-447...................................II-GEII--------RIRHKLAIQIVMKRLAS...........DG
Q16ID9_AEDAE/216-390..................................QRE-NLGI--------IVQYKVKVKLCIT.................
PALF_KLULA/263-398...................................LK-NKFF--------TFQYYVEILANLSR................
Q6CG62_YARLI/321-486.................................PNTS-FKNI--------KVHHWIKVVMRLSKID............PD
Q4RUP5_TETNG/170-295...................................FN-CSII--------KLEYRLKAYLDNK.................
Q4PD45_USTMA/601-804...................................HS-KSNI--------AVHHLVRLSIRVGKSEGDWEVWNDSVGTSS
Q9XTU0_CAEEL/176-327....................................D-STLI--------HVEYFVVVKLHVK.................
YOA5_SCHPO/223-379....................................V-GSNF--------EVDHFLKISVGNK.................
Q0CQZ7_ASPTN/118-273..................................QVK-TPNI--------NIYHVLAFTIELRG................

PF07070

Q8DDE9_VIBVU/6-232-----------------------------------.G.DAKV--------WLETGLDIALAIDPTDKDILTVRPDPMMDG
Q9F2L5_STRCO/29-249-----------------------------------QL.GVVL--------GVRTELAVAGARDSGDPDPFAVAPLPAQEA
SP0M_BACSU/4-221-----------------------------------.G.KVEV--------AVVTDLDIQGGIDKSDHDRIFVEAHPWIEN
Q87KC8_VIBPA/6-231-----------------------------------.G.DAKV--------WLETGLDVAMALDPTDKDILTVRPDPLMDA
Q8EMA6_OCEIH/2-220-----------------------------------.R.DKNV--------WIDTGLDIKKAVDPGDIDYIQVNPSLIVGA
Q8YPP0_NOSS1/22-238-----------------------------------.G.HIPV--------YVRTGLDIKSAINPRDRDYLEVRTHPLMQR
Q9KVV0_VIBCH/21-246-----------------------------------.G.DAKV--------WLETGLDIALALDPTDKDILTVRPEPMMDG
Q935W0_9ACTO/3-222-----------------------------------PL.GIVL--------GVCTELSVAGARDKGDLDALAVAPLPAQES
Q8CK18_STRCO/3-222-----------------------------------ALRGMNI--------GVTTELEIARAVDSGDLDAINVHPLPAQKA

PF04425

Q6BVD2_DEBHA/1-335................................INDLM-..PA--------SIRYNIRSALIC..................
A3GGA7_PICST/92-585GYGFLNIRGTPLL...................TKDYS-FEDV--------SVSYTIEAKFIDRIDGKEQHNELS.EREIN
A5DRA9_PICGU/36-464................................VRDLS-FVDT--------SISYGVMTRIIGRSSMYNLDENDESEGTRL
Q6BJG5_DEBHA/93-577GYGFLNVRGTPLL...................TKDYS-FDNI--------SVSYTIEAKFIDKLNAKNQKDPLS.QHEIN
A5DPQ0_PICGU/115-602GYGYLDIRGTPLL...................TRDYS-FDDI--------SVSYAIEAKFIDKIDAKDQNEAVF.EHEIN
Q6BSG0_DEBHA/5-422................................IKDFS-ILDT--------SISYSVNARVIGKASDYK............
A5DN76_PICGU/57-484PTHSRSTSDFTIGGTPPSHSKKTSPMAGSSAKMRDFS-FADT--------SISYSVEVRVVGQAQEYAKELA.....KSK
Q6BVD1_DEBHA/28-455................................TKSLS-FIDT--------SISYGVQARFIGRASKYNVNQSKK.NDPVL
Q5ABB5_CANAL/19-455.......NGAP..EETASK......KYKYASLTNDFA-FNDT--------SISYCVSARVIGRASGYQHLFGSL.GGVHA
Q876A8_SACEX/140-571GCGHLGSKGSPIL...................TRDLS-DDDI--------SINYTIDARIVGKD................
Q75E04_ASHGO/51-474GYGHLGTKGSPIL...................TNDLV-SDTV--------SINYAVDAKIVGKD................
Q875N4_LACKL/72-505GYGHLGTKGSPIL...................TNDLV-NDNV--------SINYAVDAKVVGKD................
BUL1_YEAST/108-543GCGHLGTKGSPIL...................TNDMS-DDNL--------SINYTIDARIVGKD................
A3LRU1_PICST/29-421................................VNDHA-YTDT--------SISYRVVGRFIGRKQDYG............
A5E3Q9_LODEL/66-535GYGSLNLRGTPIL...................TKDYS-FEDM--------SVSYAVEAKIIDNVRTKDAVSH.....DEI
A3LX53_PICST/9-457.......LESSLSEEDAHR......GKCYASLTNDMF-FSSA--------SIDFSVSARIIGRASDYESIFV.....KSL
Q6FUH4_CANGA/102-545GCGHLGTKGSPIL...................TYDMV-DDHL--------SINYTIDARIVGKD................
Q6CSE2_KLULA/69-505GYGHLGTKGSPIL...................TNDLC-SDNL--------SVSYTIDARVVGKD................
Q6FP46_CANGA/103-568GCGHLGTKGSPIL...................TNDIT-DENL--------SINYTIDAKIVGKE................
Q875T3_NAUCA/106-548GSGHLGTKGSPIL...................TYDMV-DDNL--------SVNYTVDTRVVGKDP...............
A3LX54_PICST/5-426................................IRDMA-FIDT--------CISYSVDARVIGKSSDYNY..........E
Q876B6_SACSE/94-510GCGHMGIKGSPIL...................TNDLS-NDDI--------SINYTIDARIVGKD................
Q876C9_SACBA/7-447GCGHLGTKGSPIL...................TLDMA-DDNL--------SINYTIDAKIVGKD................
Q5AN22_CANAL/97-598GYGFLNVRGTPML...................TKDYS-FDDL--------SISYTIEAKFIDRLNSTEPISHDEINNTDN
A7TIV7_VANPO/87-537GCGHLGIKGSPIL...................TYDLI-DENL--------SINYTIDARIVGKD................
Q875T4_NAUCA/96-560GCGHLGVKGSPIL...................TSDLC-DEDV--------SINYTIDARIVGKD................
Q875T2_NAUCA/78-518GFGHIGTKGSPIL...................TYDMA-GESV--------SVNYSVDARIVGSNP...............

PF13002

C8ZH73_YEAS8/144-346IEETT--RVKAH-------------ACPVHKHE----------------------------------L------------
A7TSP7_VANPO/130-321IEETT--RIRSY-------------ACDSHKHD----------------------------------L------------
C5GL98_AJEDR/142-318IEEHQ--SIISH-------------VCPKHLHK----------------------------------V------------
YNSK_SCHPO/63-242LEEHM--QFSCQ-------------PCERHRDL----------------------------------V------------
C5DVA9_ZYGRC/141-332IDEIT--R