Sequence alignment for CL0135

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------
E7KUR3_YEASL/144-346--------------------------------------------------------------------------------

PF00339

O17981_CAEEL/6-159--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
O17984_CAEEL/4-157--------------------------------------------------------------------------------
O45782_CAEEL/7-155--------------------------------------------------------------------------------
O76685_CAEEL/6-159--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------
B4LEM0_DROVI/17-172--------------------------------------------------------------------------------
F6SKI7_XENTR/21-176--------------------------------------------------------------------------------
H2L9D1_ORYLA/15-171--------------------------------------------------------------------------------
H2N0W5_ORYLA/18-173--------------------------------------------------------------------------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------------------------
Q8VD69_MOUSE/22-166--------------------------------------------------------------------------------

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------A-----------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------R-----------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------L-----------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------R-----------------------------------------------------------------------
Q380N5_ANOGA/183-323--------R-----------------------------------------------------------------------
CRED_ASPOR/181-332--------W-----------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------W-----------------------------------------------------------------------
ARRD5_HUMAN/184-321--------R-----------------------------------------------------------------------
ARRD4_HUMAN/191-318--------T-----------------------------------------------------------------------
Q294M9_DROPS/171-302--------K-----------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------W-----------------------------------------------------------------------
Q294M7_DROPS/174-306--------T-----------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------W-----------------------------------------------------------------------
Q293Z7_DROPS/175-308--------G-----------------------------------------------------------------------
Q9I7K7_DROME/179-320--------W-----------------------------------------------------------------------
A5DM18_PICGU/246-387--------W-----------------------------------------------------------------------
Q294M5_DROPS/171-304--------S-----------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------K-----------------------------------------------------------------------
A0BIT0_PARTE/173-314--------S-----------------------------------------------------------------------
Q4V467_DROME/125-256--------R-----------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------A-----------------------------------------------------------------------
Q66L50_DANRE/187-314--------T-----------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------S-----------------------------------------------------------------------
Q6C993_YARLI/185-326--------W-----------------------------------------------------------------------
O44847_CAEEL/147-273--------S-----------------------------------------------------------------------
A0CWE9_PARTE/173-316--------S-----------------------------------------------------------------------
Q23QU8_TETTS/188-318--------R-----------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------K-----------------------------------------------------------------------
A8WP41_CAEBR/178-317--------K-----------------------------------------------------------------------
Q0E8K8_DROME/169-299--------G-----------------------------------------------------------------------
A0C0J3_PARTE/194-337--------P-----------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------T-----------------------------------------------------------------------
Q23YG0_TETTS/188-318--------K-----------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------S-----------------------------------------------------------------------
ARRB_CAEEL/205-363--------S-----------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------W-----------------------------------------------------------------------
ALY2_SCHPO/345-506--------W-----------------------------------------------------------------------
Q5AM66_CANAL/305-457--------W-----------------------------------------------------------------------
ARRB2_MOUSE/195-350--------D-----------------------------------------------------------------------
A2BIP7_DANRE/186-313--------N-----------------------------------------------------------------------
ARRD1_HUMAN/162-286--------K-----------------------------------------------------------------------
A2QR01_ASPNC/439-613--------W-----------------------------------------------------------------------
Q380P6_ANOGA/182-314--------S-----------------------------------------------------------------------
YC9F_SCHPO/183-325--------W-----------------------------------------------------------------------
Q16H74_AEDAE/171-301--------R-----------------------------------------------------------------------
Q6DH07_DANRE/192-355--------S-----------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------K-----------------------------------------------------------------------
ART1_SCHPO/287-428--------S-----------------------------------------------------------------------
ARRD2_HUMAN/180-307--------N-----------------------------------------------------------------------
Q294M6_DROPS/179-311--------H-----------------------------------------------------------------------
ADCC_DICDI/344-478--------T-----------------------------------------------------------------------
Q6CS19_KLULA/219-373--------W-----------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------W-----------------------------------------------------------------------
Q22NR4_TETTS/187-325--------N-----------------------------------------------------------------------
ROD1_YEAST/232-395--------W-----------------------------------------------------------------------
A0CL31_PARTE/172-315--------K-----------------------------------------------------------------------
APYA_EMENI/180-326--------W-----------------------------------------------------------------------
Q4PCS7_USTMA/465-633--------G-----------------------------------------------------------------------
Q296V0_DROPS/178-310--------A-----------------------------------------------------------------------
Q6CW08_KLULA/282-443--------W-----------------------------------------------------------------------
A8WP33_CAEBR/159-305--------S-----------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------S-----------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------S-----------------------------------------------------------------------
Q5KC81_CRYNJ/436-587--------D-----------------------------------------------------------------------
A7TQI8_VANPO/357-526--------W-----------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------L-----------------------------------------------------------------------
Q9W2V2_DROME/420-633--------H-----------------------------------------------------------------------
Q240M9_TETTS/188-318--------K-----------------------------------------------------------------------
A5DUN4_LODEL/264-404--------W-----------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------R-----------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------S-----------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------G-----------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------W-----------------------------------------------------------------------
O17983_CAEEL/173-318--------T-----------------------------------------------------------------------
Q9V393_DROME/233-393--------K-----------------------------------------------------------------------
A0BMC5_PARTE/210-346--------N-----------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------W-----------------------------------------------------------------------
A0D004_PARTE/178-324--------E-----------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------R-----------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------K-----------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------I-----------------------------------------------------------------------
PALF_ASHGO/233-368--------S-----------------------------------------------------------------------
ARRS_MOUSE/200-361--------S-----------------------------------------------------------------------
A8WP37_CAEBR/170-319--------K-----------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------Q-----------------------------------------------------------------------
MU170_SCHPO/266-426--------E-----------------------------------------------------------------------
Q5AI11_CANAL/271-413--------W-----------------------------------------------------------------------
A5DW17_LODEL/261-403--------W-----------------------------------------------------------------------
A0D012_PARTE/172-315--------K-----------------------------------------------------------------------
ADCA_DICDI/313-441--------T-----------------------------------------------------------------------
Q9I7L0_DROME/174-307--------R-----------------------------------------------------------------------
A7SF55_NEMVE/129-256--------T-----------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------P-----------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------S-----------------------------------------------------------------------
A0E996_PARTE/174-317--------N-----------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------W-----------------------------------------------------------------------
PALF_YEAST/259-394--------P-----------------------------------------------------------------------
Q23672_CAEEL/163-311--------S-----------------------------------------------------------------------
A7TPY5_VANPO/228-381--------W-----------------------------------------------------------------------
Q759V0_ASHGO/221-368--------W-----------------------------------------------------------------------
Q9VGU7_DROME/180-316--------A-----------------------------------------------------------------------
Q6FM62_CANGA/224-379--------W-----------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------V-----------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------A-----------------------------------------------------------------------
ARRD5_MOUSE/170-307--------S-----------------------------------------------------------------------
Q17624_CAEEL/176-340--------C-----------------------------------------------------------------------
A0D9C9_PARTE/194-337--------P-----------------------------------------------------------------------
A0CE97_PARTE/209-345--------N-----------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------A-----------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------K-----------------------------------------------------------------------
A7SL06_NEMVE/167-299--------A-----------------------------------------------------------------------
O45782_CAEEL/179-307--------S-----------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------L-----------------------------------------------------------------------
ADCB_DICDI/337-465--------T-----------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------K-----------------------------------------------------------------------
Q294M3_DROPS/163-297--------V-----------------------------------------------------------------------
A8WP43_CAEBR/183-324--------G-----------------------------------------------------------------------
A3LXL3_PICST/266-408--------W-----------------------------------------------------------------------
O17981_CAEEL/182-333--------R-----------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------P-----------------------------------------------------------------------
A8X383_CAEBR/164-301--------P-----------------------------------------------------------------------
Q20232_CAEEL/173-309--------Q-----------------------------------------------------------------------
A0BCE6_PARTE/199-335--------H-----------------------------------------------------------------------
Q5AP77_CANAL/170-448--------W-----------------------------------------------------------------------
A0BDM3_PARTE/168-302--------P-----------------------------------------------------------------------
Q23674_CAEEL/182-339--------K-----------------------------------------------------------------------
ARRD5_BOVIN/171-309--------S-----------------------------------------------------------------------
YA4C_SCHPO/180-322--------W-----------------------------------------------------------------------
Q294M1_DROPS/173-305--------P-----------------------------------------------------------------------
Q4P2K3_USTMA/181-316--------L-----------------------------------------------------------------------
A7TDW3_VANPO/229-389--------W-----------------------------------------------------------------------
Q6FY06_CANGA/237-406--------W-----------------------------------------------------------------------
A6R1F7_AJECN/559-759--------W-----------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------K-----------------------------------------------------------------------
A7TQH7_VANPO/294-447--------W-----------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------K-----------------------------------------------------------------------
PALF_KLULA/263-398--------D-----------------------------------------------------------------------
Q6CG62_YARLI/321-486--------W-----------------------------------------------------------------------
Q4PD45_USTMA/601-804--------W-----------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------R-----------------------------------------------------------------------
YOA5_SCHPO/223-379--------R-----------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------W-----------------------------------------------------------------------
E7LU16_YEASV/179-340--------W-----------------------------------------------------------------------
F1QAH2_DANRE/171-293--------.-----------------------------------------------------------------------
F6SKI7_XENTR/196-355--------.-----------------------------------------------------------------------
F6Y0E4_XENTR/163-285--------.-----------------------------------------------------------------------
G4VCF9_SCHMA/96-254--------.-----------------------------------------------------------------------
H2N0W5_ORYLA/194-351--------.-----------------------------------------------------------------------
H3CCN8_TETNG/163-285--------.-----------------------------------------------------------------------
H3DDA7_TETNG/203-325--------.-----------------------------------------------------------------------
ART5_YEAST/332-474--------W-----------------------------------------------------------------------
Q08CX7_XENTR/182-306--------.-----------------------------------------------------------------------
TXNIP_MOUSE/176-299--------.-----------------------------------------------------------------------
Q9VI00_DROME/172-303--------.-----------------------------------------------------------------------

PF07070

Q9F2L5_STRCO/29-246FKRLLGSLG-----------------------------------------------------------------------
B7VMX8_VIBSL/6-225LKKTLASFG-----------------------------------------------------------------------
Q87KC8_VIBPA/6-225LKKTLASFG-----------------------------------------------------------------------
D2SH36_GEOOG/3-219FRGMMARLG-----------------------------------------------------------------------
U5VQ01_9ACTO/3-221FKKMLGAFG-----------------------------------------------------------------------
A9B5Z7_HERA2/2-212FRKLLASVG-----------------------------------------------------------------------
Q8CK18_STRCO/3-220FKKLLASLG-----------------------------------------------------------------------
A1S9J4_SHEAM/2-220FKKILAAVG-----------------------------------------------------------------------
F8AWR6_FRADG/3-218MKRMMARLG-----------------------------------------------------------------------
D5XEE5_THEPJ/2-205LKKLLASVG-----------------------------------------------------------------------
F6CIG7_DESK7/3-205.TKLLASIG-----------------------------------------------------------------------
E8U7T1_DEIML/4-204FKRMLASVG-----------------------------------------------------------------------
D9SYU9_MICAI/3-221FKRLMQAMG-----------------------------------------------------------------------
SP0M_BACSU/4-215FKKLAASAG-----------------------------------------------------------------------
D6Y483_THEBD/3-220FKRMLGALG-----------------------------------------------------------------------
D7B3X5_NOCDD/3-219FKRLLAAFG-----------------------------------------------------------------------
A6W415_KINRD/4-218.RNLAARFG-----------------------------------------------------------------------
A5D298_PELTS/2-206LKKLLAGIG-----------------------------------------------------------------------
Q7MGK0_VIBVY/6-226LKKTLASFG-----------------------------------------------------------------------
I0JR17_HALH3/2-209FKKFLASVG-----------------------------------------------------------------------
L0A4L1_DEIPD/4-203LRRTLARVG-----------------------------------------------------------------------
C1D0Z4_DEIDV/4-204LKKMMAAVG-----------------------------------------------------------------------
Q8YPP0_NOSS1/22-232FKNLLASVG-----------------------------------------------------------------------
R4LYD7_9ACTO/3-216FDKVLRGFG-----------------------------------------------------------------------
C6WBH8_ACTMD/3-220FKRMLRAFG-----------------------------------------------------------------------
R4SZZ1_AMYOR/2-220FKRMLSAFG-----------------------------------------------------------------------
B1HWS8_LYSSC/4-216FHKALASFG-----------------------------------------------------------------------
Q3IE37_PSEHT/2-220FKKILASVG-----------------------------------------------------------------------
E3E849_PAEPS/5-215FNKILASAG-----------------------------------------------------------------------
E4N440_KITSK/3-219FKRLLGALG-----------------------------------------------------------------------
D3Q3X8_STANL/19-231.RKLTSGVG-----------------------------------------------------------------------
G2NX38_STRVO/3-220FKRVLGSLG-----------------------------------------------------------------------
E2Q1G0_STRC2/1-210.........-----------------------------------------------------------------------
U5W7Z2_9ACTO/3-221FKRMMQAMG-----------------------------------------------------------------------
D4GQ21_HALVD/1-210MKKVLARIG-----------------------------------------------------------------------
C4L3D6_EXISA/2-216FKKILSSIG-----------------------------------------------------------------------
L0JQI9_NATP1/1-207MKRVLSRLG-----------------------------------------------------------------------
U5LEI3_9BACI/4-217FNKVLASVG-----------------------------------------------------------------------
B7GKU0_ANOFW/25-238FNKVLASIG-----------------------------------------------------------------------
C5D3Y3_GEOSW/2-202LKKLLSKLG-----------------------------------------------------------------------
H2K613_STRHJ/3-217FKRLLGAIG-----------------------------------------------------------------------
Q9KVV0_VIBCH/21-240IKKTLASFG-----------------------------------------------------------------------
Q2J8X7_FRASC/3-219MKRFMSRLG-----------------------------------------------------------------------
D9STE5_CLOC7/4-215FKKVLSSVG-----------------------------------------------------------------------
I3RA56_HALMT/1-210MKKVLASIG-----------------------------------------------------------------------
Q81QV7_BACAN/2-216FQKFLASVG-----------------------------------------------------------------------
X5A5U4_9BACL/4-214FKKVLASVG-----------------------------------------------------------------------
D2B8E4_STRRD/3-216FRKLMAAFG-----------------------------------------------------------------------
F2EZY3_SOLSS/4-217FNKVLASVG-----------------------------------------------------------------------
Q5V309_HALMA/3-212MKDVLSRIG-----------------------------------------------------------------------
Q6LLI7_PHOPR/4-222FRKSFASLG-----------------------------------------------------------------------
E4NWJ2_HALBP/1-210MKKILASVG-----------------------------------------------------------------------
E1SSB8_FERBD/2-220FKKLLASVG-----------------------------------------------------------------------
D7AXU0_NOCDD/3-218LKRLLAGIG-----------------------------------------------------------------------
F4FG08_VERMA/3-218FKKMLSALG-----------------------------------------------------------------------
D3EJD4_GEOS4/4-214FNKMLASVG-----------------------------------------------------------------------
I0H7C6_ACTM4/3-220FKKLLGALG-----------------------------------------------------------------------
B1VNV5_STRGG/3-220FKKLLGALG-----------------------------------------------------------------------
H8MVT2_CORCM/3-213FMKMLARLG-----------------------------------------------------------------------
H8GZW1_DEIGI/5-204.GKMMAAVG-----------------------------------------------------------------------
Q5L337_GEOKA/2-214FKKLLSSIG-----------------------------------------------------------------------
C0ZHJ0_BREBN/2-212FKKLLASVG-----------------------------------------------------------------------
H2JK05_STRHJ/3-219FKRLLGSLG-----------------------------------------------------------------------
Q8EMA6_OCEIH/2-214FNKMLSSIG-----------------------------------------------------------------------
F0LQ35_VIBFN/4-223LKKTLASFG-----------------------------------------------------------------------
Q5L3I0_GEOKA/3-202.KKFLSKFG-----------------------------------------------------------------------
E1V3I8_HALED/2-217FDKLMAAVG-----------------------------------------------------------------------
R4SRA3_AMYOR/2-220FQKVLATFG-----------------------------------------------------------------------
G2NQ97_9ACTO/3-220FKKLLGSLG-----------------------------------------------------------------------
C7MVV3_SACVD/2-220FQRLLSAFG-----------------------------------------------------------------------
Q47QI1_THEFY/3-221FRRLLTAFG-----------------------------------------------------------------------
B1YLT3_EXIS2/2-215FKKILSQIG-----------------------------------------------------------------------
D2RPW6_HALTV/1-207MKRILSSLG-----------------------------------------------------------------------
D1A596_THECD/3-220FKRVLGTFG-----------------------------------------------------------------------
D2ASM7_STRRD/3-221FKRLLGAFG-----------------------------------------------------------------------
N0B2E1_9BACI/13-226FNKVLASVG-----------------------------------------------------------------------
H6NE63_9BACL/4-214FKKVLASVG-----------------------------------------------------------------------
K0K0P9_SACES/2-220FKRMLSAFG-----------------------------------------------------------------------
Q5E1Q2_VIBF1/4-222FKKTLASLG-----------------------------------------------------------------------
I7BQH2_NATSJ/1-204M...LSSLG-----------------------------------------------------------------------
K0JWS7_SACES/3-220FKRMLRAFG-----------------------------------------------------------------------
V6K362_STRNV/3-220FKRLLGSLG-----------------------------------------------------------------------
A4FGU2_SACEN/3-218FKKLLGALG-----------------------------------------------------------------------
Q5YZ34_NOCFA/2-219FKKLLAAAG-----------------------------------------------------------------------
D9T8R1_MICAI/3-218FKKMLGAFG-----------------------------------------------------------------------
C6CSI9_PAESJ/5-215FNRLLASIG-----------------------------------------------------------------------
D1A1F2_THECD/3-221FKKLLKAMG-----------------------------------------------------------------------
G0G8W7_AMYMS/2-216FQKVLATFG-----------------------------------------------------------------------
U5W8Q8_9ACTO/3-217FARVLRAFG-----------------------------------------------------------------------

PF04425

A3GGA7_PICST/92-585SSDSPIAPLSSVSSN.TQTEYFDVLPSFQMF.QSILKR.DDAQFSEDLQTLPPVYGDTTNSSPTP...............
A5DRA9_PICGU/36-464DGGEFNEDDILRSEQANQAPVWSILPSYHMY.KSLYMGMNAPTE..NIHE.PPTYEDVSHTSVSH...............
Q6BJG5_DEBHA/93-577SNSNETNLLSPASSN.TQTEYFDVLPSFQMF.QSILKR.DDSQFSENLSVNPPIYGDVTNSSPTPPSG........LSPI
A5DPQ0_PICGU/115-602TDVNVNADLTTTLSG.TRTEYFHVLPSFQMF.QSILKR.DDAQFNESLSGEPPTYEDSRSASPVLS...........PSL
Q6BSG0_DEBHA/5-422SKEKLKEKHNERILNEEDDLINNILPSYHMHQSTISKNLTPTNE..NFRVDPPMYEMTPVNSLST...............
Q6BVD1_DEBHA/28-455SQNYFSQKDIELTKTTNEAPVWNILPSYHMYTTTIYKGFNVSDE..SLTE.PPSYETSSIHSAGRL...........SSV
Q5ABB5_CANAL/19-455TPSRQASVSSRNQGDDEANELINILPSYQMYRSTITKNLTPSVE..DLRTAPPSYEVTPDLSTVQ.............LH
Q75E04_ASHGO/51-474AEEDDIDNCAGACAC.ADEEICDVLPSFQMY.NALHRHIPRGNVNADQHDLPPSYQEAYNGSVGG...............
BUL1_YEAST/108-543ANATPVETGRSLTDG.DINNVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEANNSTATG...............
A5E3Q9_LODEL/66-535NNSSATNIVATTSSN.TQTEYFDILPSFEMF.QSILKR.DDQQFQEDLTTVPPRYGDTAHSRSSR.............PT
A3LX53_PICST/9-457LKLSSLSLRRKSKSNGNDSELVNILPSYQMYRSTISKQLIPSRE..DLRTQPPSYELSPISSASS..............Y
Q6FUH4_CANGA/102-545AASVPPNKPNLLKRN.SESRVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPTYQEIESQSSTFG............RP
Q6CSE2_KLULA/69-505SGQSKLKNEDGSEVS.DTHHMIDVLPSFEMY.NALHRNIPRGNVNPDQHDLPPSYLEVESQRQTP...............
Q6FP46_CANGA/103-568VAKSSTELNQMNTDSKDPNMIIDVLPSFEFY.NVLHKHIPQGNVDPDIHDFPPTYQEVQTQRLPA...............
Q5AN22_CANAL/97-598TTTTPIAELSTVSSH.SQTEYFDVLPSFQMF.QSILKR.DDRQFQEDLSSLPPGYGDVTNSSPTPPPLPPPPPARSAPTL
A7TIV7_VANPO/87-537NVPFPGQFTKNSNSS.SSSILVDLLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEVQTQHSSILPI........HERP
E7KSA7_YEASL/88-524.......CTQSRLSH.RANMLVDVLPSFEMY.NALHRHIPQGNVDPDRHDFPPSYQEVRTQRMTI...............
G0VB73_NAUCC/105-559......RNLKNGTHGSTDNLLVDVLPSFDMY.NVLHRHIPQGNVNPDIHDFPPTYQEVQTHRDPV...............
G0VC27_NAUCC/80-515..SNDHPTNTPVEHQARDDILLDILPSFEMY.NSLHRHIPQGNVNPDLHDFPPSYQEIQEGSSSS.............GT
G0VC28_NAUCC/152-590...KDLPVGESLDDLDEDDIVFDVLPSFEMY.NALHRHIPQGNVNPDLHDFPPSYGEIQQGMATT...............

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------
E7KUR3_YEASL/144-346--------------------------------------------------------------------------------

PF00339

O17981_CAEEL/6-159--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
O17984_CAEEL/4-157--------------------------------------------------------------------------------
O45782_CAEEL/7-155--------------------------------------------------------------------------------
O76685_CAEEL/6-159--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------
B4LEM0_DROVI/17-172--------------------------------------------------------------------------------
F6SKI7_XENTR/21-176--------------------------------------------------------------------------------
H2L9D1_ORYLA/15-171--------------------------------------------------------------------------------
H2N0W5_ORYLA/18-173--------------------------------------------------------------------------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------------------------
Q8VD69_MOUSE/22-166--------------------------------------------------------------------------------

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------------------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------------------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------------------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------------------------------------------------------------------------------
Q380N5_ANOGA/183-323--------------------------------------------------------------------------------
CRED_ASPOR/181-332--------------------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------------------------------------------------------------------------------
ARRD5_HUMAN/184-321--------------------------------------------------------------------------------
ARRD4_HUMAN/191-318--------------------------------------------------------------------------------
Q294M9_DROPS/171-302--------------------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------------------------------------------------------------------------------
Q294M7_DROPS/174-306--------------------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------------------------------------------------------------------------------
Q293Z7_DROPS/175-308--------------------------------------------------------------------------------
Q9I7K7_DROME/179-320--------------------------------------------------------------------------------
A5DM18_PICGU/246-387--------------------------------------------------------------------------------
Q294M5_DROPS/171-304--------------------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------------------------------------------------------------------------------
A0BIT0_PARTE/173-314--------------------------------------------------------------------------------
Q4V467_DROME/125-256--------------------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------------------------------------------------------------------------------
Q66L50_DANRE/187-314--------------------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------------------------------------------------------------------------------
Q6C993_YARLI/185-326--------------------------------------------------------------------------------
O44847_CAEEL/147-273--------------------------------------------------------------------------------
A0CWE9_PARTE/173-316--------------------------------------------------------------------------------
Q23QU8_TETTS/188-318--------------------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------------------------------------------------------------------------------
A8WP41_CAEBR/178-317--------------------------------------------------------------------------------
Q0E8K8_DROME/169-299--------------------------------------------------------------------------------
A0C0J3_PARTE/194-337--------------------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------------------------------------------------------------------------------
Q23YG0_TETTS/188-318--------------------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------------------------------------------------------------------------------
ARRB_CAEEL/205-363--------------------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------------------------------------------------------------------------------
ALY2_SCHPO/345-506--------------------------------------------------------------------------------
Q5AM66_CANAL/305-457--------------------------------------------------------------------------------
ARRB2_MOUSE/195-350--------------------------------------------------------------------------------
A2BIP7_DANRE/186-313--------------------------------------------------------------------------------
ARRD1_HUMAN/162-286--------------------------------------------------------------------------------
A2QR01_ASPNC/439-613--------------------------------------------------------------------------------
Q380P6_ANOGA/182-314--------------------------------------------------------------------------------
YC9F_SCHPO/183-325--------------------------------------------------------------------------------
Q16H74_AEDAE/171-301--------------------------------------------------------------------------------
Q6DH07_DANRE/192-355--------------------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------------------------------------------------------------------------------
ART1_SCHPO/287-428--------------------------------------------------------------------------------
ARRD2_HUMAN/180-307--------------------------------------------------------------------------------
Q294M6_DROPS/179-311--------------------------------------------------------------------------------
ADCC_DICDI/344-478--------------------------------------------------------------------------------
Q6CS19_KLULA/219-373--------------------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------------------------------------------------------------------------------
Q22NR4_TETTS/187-325--------------------------------------------------------------------------------
ROD1_YEAST/232-395--------------------------------------------------------------------------------
A0CL31_PARTE/172-315--------------------------------------------------------------------------------
APYA_EMENI/180-326--------------------------------------------------------------------------------
Q4PCS7_USTMA/465-633--------------------------------------------------------------------------------
Q296V0_DROPS/178-310--------------------------------------------------------------------------------
Q6CW08_KLULA/282-443--------------------------------------------------------------------------------
A8WP33_CAEBR/159-305--------------------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------------------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------------------------------------------------------------------------------
Q5KC81_CRYNJ/436-587--------------------------------------------------------------------------------
A7TQI8_VANPO/357-526--------------------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------------------------------------------------------------------------------
Q9W2V2_DROME/420-633--------------------------------------------------------------------------------
Q240M9_TETTS/188-318--------------------------------------------------------------------------------
A5DUN4_LODEL/264-404--------------------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------------------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------------------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------------------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------------------------------------------------------------------------------
O17983_CAEEL/173-318--------------------------------------------------------------------------------
Q9V393_DROME/233-393--------------------------------------------------------------------------------
A0BMC5_PARTE/210-346--------------------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------------------------------------------------------------------------------
A0D004_PARTE/178-324--------------------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------------------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------------------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------------------------------------------------------------------------------
PALF_ASHGO/233-368--------------------------------------------------------------------------------
ARRS_MOUSE/200-361--------------------------------------------------------------------------------
A8WP37_CAEBR/170-319--------------------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------------------------------------------------------------------------------
MU170_SCHPO/266-426--------------------------------------------------------------------------------
Q5AI11_CANAL/271-413--------------------------------------------------------------------------------
A5DW17_LODEL/261-403--------------------------------------------------------------------------------
A0D012_PARTE/172-315--------------------------------------------------------------------------------
ADCA_DICDI/313-441--------------------------------------------------------------------------------
Q9I7L0_DROME/174-307--------------------------------------------------------------------------------
A7SF55_NEMVE/129-256--------------------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------------------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------------------------------------------------------------------------------
A0E996_PARTE/174-317--------------------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------------------------------------------------------------------------------
PALF_YEAST/259-394--------------------------------------------------------------------------------
Q23672_CAEEL/163-311--------------------------------------------------------------------------------
A7TPY5_VANPO/228-381--------------------------------------------------------------------------------
Q759V0_ASHGO/221-368--------------------------------------------------------------------------------
Q9VGU7_DROME/180-316--------------------------------------------------------------------------------
Q6FM62_CANGA/224-379--------------------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------------------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------------------------------------------------------------------------------
ARRD5_MOUSE/170-307--------------------------------------------------------------------------------
Q17624_CAEEL/176-340--------------------------------------------------------------------------------
A0D9C9_PARTE/194-337--------------------------------------------------------------------------------
A0CE97_PARTE/209-345--------------------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------------------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------------------------------------------------------------------------------
A7SL06_NEMVE/167-299--------------------------------------------------------------------------------
O45782_CAEEL/179-307--------------------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------------------------------------------------------------------------------
ADCB_DICDI/337-465--------------------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------------------------------------------------------------------------------
Q294M3_DROPS/163-297--------------------------------------------------------------------------------
A8WP43_CAEBR/183-324--------------------------------------------------------------------------------
A3LXL3_PICST/266-408--------------------------------------------------------------------------------
O17981_CAEEL/182-333--------------------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------------------------------------------------------------------------------
A8X383_CAEBR/164-301--------------------------------------------------------------------------------
Q20232_CAEEL/173-309--------------------------------------------------------------------------------
A0BCE6_PARTE/199-335--------------------------------------------------------------------------------
Q5AP77_CANAL/170-448--------------------------------------------------------------------------------
A0BDM3_PARTE/168-302--------------------------------------------------------------------------------
Q23674_CAEEL/182-339--------------------------------------------------------------------------------
ARRD5_BOVIN/171-309--------------------------------------------------------------------------------
YA4C_SCHPO/180-322--------------------------------------------------------------------------------
Q294M1_DROPS/173-305--------------------------------------------------------------------------------
Q4P2K3_USTMA/181-316--------------------------------------------------------------------------------
A7TDW3_VANPO/229-389--------------------------------------------------------------------------------
Q6FY06_CANGA/237-406--------------------------------------------------------------------------------
A6R1F7_AJECN/559-759--------------------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------------------------------------------------------------------------------
A7TQH7_VANPO/294-447--------------------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------------------------------------------------------------------------------
PALF_KLULA/263-398--------------------------------------------------------------------------------
Q6CG62_YARLI/321-486--------------------------------------------------------------------------------
Q4PD45_USTMA/601-804--------------------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------------------------------------------------------------------------------
YOA5_SCHPO/223-379--------------------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------------------------------------------------------------------------------
E7LU16_YEASV/179-340--------------------------------------------------------------------------------
F1QAH2_DANRE/171-293--------------------------------------------------------------------------------
F6SKI7_XENTR/196-355--------------------------------------------------------------------------------
F6Y0E4_XENTR/163-285--------------------------------------------------------------------------------
G4VCF9_SCHMA/96-254--------------------------------------------------------------------------------
H2N0W5_ORYLA/194-351--------------------------------------------------------------------------------
H3CCN8_TETNG/163-285--------------------------------------------------------------------------------
H3DDA7_TETNG/203-325--------------------------------------------------------------------------------
ART5_YEAST/332-474--------------------------------------------------------------------------------
Q08CX7_XENTR/182-306--------------------------------------------------------------------------------
TXNIP_MOUSE/176-299--------------------------------------------------------------------------------
Q9VI00_DROME/172-303--------------------------------------------------------------------------------

PF07070

Q9F2L5_STRCO/29-246--------------------------------------------------------------------------------
B7VMX8_VIBSL/6-225--------------------------------------------------------------------------------
Q87KC8_VIBPA/6-225--------------------------------------------------------------------------------
D2SH36_GEOOG/3-219--------------------------------------------------------------------------------
U5VQ01_9ACTO/3-221--------------------------------------------------------------------------------
A9B5Z7_HERA2/2-212--------------------------------------------------------------------------------
Q8CK18_STRCO/3-220--------------------------------------------------------------------------------
A1S9J4_SHEAM/2-220--------------------------------------------------------------------------------
F8AWR6_FRADG/3-218--------------------------------------------------------------------------------
D5XEE5_THEPJ/2-205--------------------------------------------------------------------------------
F6CIG7_DESK7/3-205--------------------------------------------------------------------------------
E8U7T1_DEIML/4-204--------------------------------------------------------------------------------
D9SYU9_MICAI/3-221--------------------------------------------------------------------------------
SP0M_BACSU/4-215--------------------------------------------------------------------------------
D6Y483_THEBD/3-220--------------------------------------------------------------------------------
D7B3X5_NOCDD/3-219--------------------------------------------------------------------------------
A6W415_KINRD/4-218--------------------------------------------------------------------------------
A5D298_PELTS/2-206--------------------------------------------------------------------------------
Q7MGK0_VIBVY/6-226--------------------------------------------------------------------------------
I0JR17_HALH3/2-209--------------------------------------------------------------------------------
L0A4L1_DEIPD/4-203--------------------------------------------------------------------------------
C1D0Z4_DEIDV/4-204--------------------------------------------------------------------------------
Q8YPP0_NOSS1/22-232--------------------------------------------------------------------------------
R4LYD7_9ACTO/3-216--------------------------------------------------------------------------------
C6WBH8_ACTMD/3-220--------------------------------------------------------------------------------
R4SZZ1_AMYOR/2-220--------------------------------------------------------------------------------
B1HWS8_LYSSC/4-216--------------------------------------------------------------------------------
Q3IE37_PSEHT/2-220--------------------------------------------------------------------------------
E3E849_PAEPS/5-215--------------------------------------------------------------------------------
E4N440_KITSK/3-219--------------------------------------------------------------------------------
D3Q3X8_STANL/19-231--------------------------------------------------------------------------------
G2NX38_STRVO/3-220--------------------------------------------------------------------------------
E2Q1G0_STRC2/1-210--------------------------------------------------------------------------------
U5W7Z2_9ACTO/3-221--------------------------------------------------------------------------------
D4GQ21_HALVD/1-210--------------------------------------------------------------------------------
C4L3D6_EXISA/2-216--------------------------------------------------------------------------------
L0JQI9_NATP1/1-207--------------------------------------------------------------------------------
U5LEI3_9BACI/4-217--------------------------------------------------------------------------------
B7GKU0_ANOFW/25-238--------------------------------------------------------------------------------
C5D3Y3_GEOSW/2-202--------------------------------------------------------------------------------
H2K613_STRHJ/3-217--------------------------------------------------------------------------------
Q9KVV0_VIBCH/21-240--------------------------------------------------------------------------------
Q2J8X7_FRASC/3-219--------------------------------------------------------------------------------
D9STE5_CLOC7/4-215--------------------------------------------------------------------------------
I3RA56_HALMT/1-210--------------------------------------------------------------------------------
Q81QV7_BACAN/2-216--------------------------------------------------------------------------------
X5A5U4_9BACL/4-214--------------------------------------------------------------------------------
D2B8E4_STRRD/3-216--------------------------------------------------------------------------------
F2EZY3_SOLSS/4-217--------------------------------------------------------------------------------
Q5V309_HALMA/3-212--------------------------------------------------------------------------------
Q6LLI7_PHOPR/4-222--------------------------------------------------------------------------------
E4NWJ2_HALBP/1-210--------------------------------------------------------------------------------
E1SSB8_FERBD/2-220--------------------------------------------------------------------------------
D7AXU0_NOCDD/3-218--------------------------------------------------------------------------------
F4FG08_VERMA/3-218--------------------------------------------------------------------------------
D3EJD4_GEOS4/4-214--------------------------------------------------------------------------------
I0H7C6_ACTM4/3-220--------------------------------------------------------------------------------
B1VNV5_STRGG/3-220--------------------------------------------------------------------------------
H8MVT2_CORCM/3-213--------------------------------------------------------------------------------
H8GZW1_DEIGI/5-204--------------------------------------------------------------------------------
Q5L337_GEOKA/2-214--------------------------------------------------------------------------------
C0ZHJ0_BREBN/2-212--------------------------------------------------------------------------------
H2JK05_STRHJ/3-219--------------------------------------------------------------------------------
Q8EMA6_OCEIH/2-214--------------------------------------------------------------------------------
F0LQ35_VIBFN/4-223--------------------------------------------------------------------------------
Q5L3I0_GEOKA/3-202--------------------------------------------------------------------------------
E1V3I8_HALED/2-217--------------------------------------------------------------------------------
R4SRA3_AMYOR/2-220--------------------------------------------------------------------------------
G2NQ97_9ACTO/3-220--------------------------------------------------------------------------------
C7MVV3_SACVD/2-220--------------------------------------------------------------------------------
Q47QI1_THEFY/3-221--------------------------------------------------------------------------------
B1YLT3_EXIS2/2-215--------------------------------------------------------------------------------
D2RPW6_HALTV/1-207--------------------------------------------------------------------------------
D1A596_THECD/3-220--------------------------------------------------------------------------------
D2ASM7_STRRD/3-221--------------------------------------------------------------------------------
N0B2E1_9BACI/13-226--------------------------------------------------------------------------------
H6NE63_9BACL/4-214--------------------------------------------------------------------------------
K0K0P9_SACES/2-220--------------------------------------------------------------------------------
Q5E1Q2_VIBF1/4-222--------------------------------------------------------------------------------
I7BQH2_NATSJ/1-204--------------------------------------------------------------------------------
K0JWS7_SACES/3-220--------------------------------------------------------------------------------
V6K362_STRNV/3-220--------------------------------------------------------------------------------
A4FGU2_SACEN/3-218--------------------------------------------------------------------------------
Q5YZ34_NOCFA/2-219--------------------------------------------------------------------------------
D9T8R1_MICAI/3-218--------------------------------------------------------------------------------
C6CSI9_PAESJ/5-215--------------------------------------------------------------------------------
D1A1F2_THECD/3-221--------------------------------------------------------------------------------
G0G8W7_AMYMS/2-216--------------------------------------------------------------------------------
U5W8Q8_9ACTO/3-217--------------------------------------------------------------------------------

PF04425

A3GGA7_PICST/92-585PGGLSPTTSATQGNSIDTIINDVSSRLE.................................EYQLEREHEERGDYLFEDD
A5DRA9_PICGU/36-464TSVTTSSITASSLSLHNSDTTAPSSNDP....................................................
Q6BJG5_DEBHA/93-577SSNRDNNLDSMMENVSERINEYALDNNDEEENYFF.............GGDENDTNQA...NEHLINEE...........
A5DPQ0_PICGU/115-602SPQTSATSQSGHENHIDGLLSSTADRLN............................EY...QMNDSAYQEQNFYFDDSND
Q6BSG0_DEBHA/5-422TPSVALSAIQSPTSNSSVDEFPFPNQEI.................................HSGLEGGP...........
Q6BVD1_DEBHA/28-455STARSNSVVAQASSVASTRETEDSNDNS.................................QRLIIADE...........
Q5ABB5_CANAL/19-455DYFASVPTSPTLDPMLSEPLDAESAAVQ....................................................
Q75E04_ASHGO/51-474ISVSSSRVNLTTIQSLDGVQSDSC....INL......................QALSA..QQYSLQTPS...........
BUL1_YEAST/108-543AAGSSADLSHQSLSTDALGATRSSSTSNLEN.....................LIPLRT..EHHSIAAHQSTAV.......
A5E3Q9_LODEL/66-535SPRLHAQLS......IDQNLLQVSRRLEDTLQM..................ERDRQQEQMHEHAMVFVDETGLMPV....
A3LX53_PICST/9-457NEYGGFDGIPSTYSLPTSPVRELFANPL....................................................
Q6FUH4_CANGA/102-545NPAVNGDSSQVSYDIDRNQTLLADNDPIDSRAL.................NNLQPLRT..EHHNINSTLSGVH.......
Q6CSE2_KLULA/69-505DSSDGTTVSQLDEMFLSPSPSLYDANTRVGSSQS...............LQSLNTVSSGVLQNSLQALS...........
Q6FP46_CANGA/103-568LQGSSSSQSGSELNVESPLRMNGSQTSIHGNFRNSSSNTLLPTTSGIFGGSSLQPYST..RHYSLNPNQNNPLHPT....
Q5AN22_CANAL/97-598SPSSSR..........DHTIDEAIQRLNEYGLAQERD..........EMNNDEYLFEE...HNNDPHNNTNNTLSP....
A7TIV7_VANPO/87-537DLMSINPFSHSSSDLTVSNTNSIQGSSSSTNLHAHNS..........LIENSLHPLST..QHLNLQSTTSA.........
E7KSA7_YEASL/88-524LPSNDNSVERSQLTAVPGSENACNNATAHSLTNLHPL..........QTQHLTINST...........RSGGQSL.....
G0VB73_NAUCC/105-559LSHDIADVGAATTATTTPNTTSLDHRVEILQDSTQAAPTL...SSTMVNLNNLHPLNT..RHYNISNGADLNSSQS....
G0VC27_NAUCC/80-515TIRIQNDVDYMQSPESPTSMLEGQTDGEQDIYVTPS...........YALRTLHALET..QHQNLNWER...........
G0VC28_NAUCC/152-590.AYIENNVDLTTYPLQQPPLAHHSNSGHDIHITPSY............ALNALHPLNT..QHLTIQPTNDP.........

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------VTLKLI------------
C5GL98_AJEDR/142-318--------------------------------------------------------------LRMCLT------------
YNSK_SCHPO/63-242--------------------------------------------------------------LKLQLI------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------VMLTLV------------
E7KUR3_YEASL/144-346--------------------------------------------------------------VTLSLV------------

PF00339

O17981_CAEEL/6-159--------------------------------------------------------------LHVIFD------------
O17983_CAEEL/6-146--------------------------------------------------------------CDPQIS------------
O17984_CAEEL/4-157--------------------------------------------------------------IFVLFD------------
O45782_CAEEL/7-155--------------------------------------------------------------FEILFN------------
O76685_CAEEL/6-159--------------------------------------------------------------LHVIFD------------
ARRS_BOVIN/22-180--------------------------------------------------------------VTIYLG------------
ARRB1_BOVIN/18-174--------------------------------------------------------------LTVYLG------------
ARRB_CAEEL/22-186--------------------------------------------------------------ITTYLG------------
P91469_CAEEL/7-159--------------------------------------------------------------LQVIFD------------
Q20232_CAEEL/7-150--------------------------------------------------------------FDIRLN------------
Q20577_CAEEL/7-158--------------------------------------------------------------FGIVFD------------
Q23672_CAEEL/8-142--------------------------------------------------------------VDISFD------------
Q23674_CAEEL/4-159--------------------------------------------------------------CLVEFA------------
Q8SYU5_DROME/5-157--------------------------------------------------------------CMITFD------------
ARRD2_MOUSE/9-158--------------------------------------------------------------FVVEID------------
Q9I7L0_DROME/5-150--------------------------------------------------------------CEIDFD------------
PALF_YEAST/39-201--------------------------------------------------------------FRIDID------------
Q9VGU7_DROME/5-155--------------------------------------------------------------VNFVFD------------
Q9VI00_DROME/5-148--------------------------------------------------------------CSFELD------------
Q9VI53_DROME/6-155--------------------------------------------------------------CELQLD------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------FLIEFD------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------LRIEYD------------
B4LEM0_DROVI/17-172--------------------------------------------------------------VTFYLG------------
F6SKI7_XENTR/21-176--------------------------------------------------------------VSVYLG------------
H2L9D1_ORYLA/15-171--------------------------------------------------------------.TLYLG------------
H2N0W5_ORYLA/18-173--------------------------------------------------------------.AVYLA------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------VTVYLG------------
Q8VD69_MOUSE/22-166--------------------------------------------------------------.....E------------

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------FGTPCNVEFELDNCQNRK
VP26A_HUMAN/8-283--------------------------------------------------------------FGPICEIDIVLNDGETRK
PEP8_YEAST/5-364--------------------------------------------------------------FKPPIDIEILFDNEESRK
VP26A_ARATH/8-283--------------------------------------------------------------FKPACNISITFTDGKNRK
VPS26_SCHPO/5-279--------------------------------------------------------------FKSPIDVDLHLDNEEERT
VPS26_DROME/6-280--------------------------------------------------------------FGQSADIEIVF.DGAEHK
VPS26_CAEEL/7-282--------------------------------------------------------------FGQSAEIQIRLSNEDTRK
DSCR3_MOUSE/1-283--------------------------------------------------------------MGTTLDIKIKR.......

PF02752

Q7PUI7_ANOGA/236-407-----------------------------------------------------------DGRVNLKAS------------
Q9TYQ0_CAEEL/174-315-----------------------------------------------------------KGALIATMQ------------
Q7PUR5_ANOGA/187-319-----------------------------------------------------------TDPLIVTAT------------
Q7PYD9_ANOGA/175-306-----------------------------------------------------------TKPLFVKVT------------
Q380N5_ANOGA/183-323-----------------------------------------------------------SRPLMVSAT------------
CRED_ASPOR/181-332-----------------------------------------------------------PNKIEYSIS------------
Q752Z4_ASHGO/228-382-----------------------------------------------------------AGRLQYELV------------
ARRD5_HUMAN/184-321-----------------------------------------------------------QGTVCLQIQ------------
ARRD4_HUMAN/191-318-----------------------------------------------------------SGPVSLSAK------------
Q294M9_DROPS/171-302-----------------------------------------------------------TDPLKLELN------------
Q6BI98_DEBHA/278-420-----------------------------------------------------------PNKAQYSVG------------
Q294M7_DROPS/174-306-----------------------------------------------------------SKPLSLRLS------------
Q6BIN4_DEBHA/247-390-----------------------------------------------------------PKKVEYSLN------------
Q293Z7_DROPS/175-308-----------------------------------------------------------TRPITMVAL------------
Q9I7K7_DROME/179-320-----------------------------------------------------------MKPLHLQLQ------------
A5DM18_PICGU/246-387-----------------------------------------------------------PGKVEYRVE------------
Q294M5_DROPS/171-304-----------------------------------------------------------SGPVLSTLI------------
Q16ZK0_AEDAE/170-299-----------------------------------------------------------SRPLLITVE------------
A0BIT0_PARTE/173-314-----------------------------------------------------------TGSTKVKVQ------------
Q4V467_DROME/125-256-----------------------------------------------------------SDPLTLELN------------
Q7SC90_NEUCR/193-351-----------------------------------------------------------DSIVTLGIS------------
Q66L50_DANRE/187-314-----------------------------------------------------------SGPVSLSAK------------
Q95NF3_ANOGA/193-351-----------------------------------------------------------PGELELEVT------------
Q6C993_YARLI/185-326-----------------------------------------------------------PNKVDYEFS------------
O44847_CAEEL/147-273-----------------------------------------------------------NGQPTFKVT------------
A0CWE9_PARTE/173-316-----------------------------------------------------------TGNTKVKIQ------------
Q23QU8_TETTS/188-318-----------------------------------------------------------SGQIKYNIQ------------
Q6ZM71_DANRE/162-286-----------------------------------------------------------NGTVVLNAK------------
A8WP41_CAEBR/178-317-----------------------------------------------------------KGLVSMTVS------------
Q0E8K8_DROME/169-299-----------------------------------------------------------GGQIKCRVS------------
A0C0J3_PARTE/194-337-----------------------------------------------------------LGTISFKFQ------------
Q16ZJ7_AEDAE/171-300-----------------------------------------------------------SNPLYIEVE------------
Q23YG0_TETTS/188-318-----------------------------------------------------------SGQIKYNIT------------
Q9W7R1_ORYLA/193-351-----------------------------------------------------------DKPLHVQAT------------
ARRB_CAEEL/205-363-----------------------------------------------------------SGLLHMEVS------------
Q7RZE0_NEUCR/198-350-----------------------------------------------------------PNKIEYSIM------------
ALY2_SCHPO/345-506-----------------------------------------------------------DERLHYELQ------------
Q5AM66_CANAL/305-457-----------------------------------------------------------PNKVEYSLS------------
ARRB2_MOUSE/195-350-----------------------------------------------------------RRSLHLEAS------------
A2BIP7_DANRE/186-313-----------------------------------------------------------SGNVSMNIS------------
ARRD1_HUMAN/162-286-----------------------------------------------------------TGSVVLTAS------------
A2QR01_ASPNC/439-613-----------------------------------------------------------EDQLHYDIV------------
Q380P6_ANOGA/182-314-----------------------------------------------------------SEPLYISAQ------------
YC9F_SCHPO/183-325-----------------------------------------------------------PLKVNYETS------------
Q16H74_AEDAE/171-301-----------------------------------------------------------SAPMIMTVC------------
Q6DH07_DANRE/192-355-----------------------------------------------------------DKPVLLEAS------------
A8X4Z9_CAEBR/175-315-----------------------------------------------------------KGIVTMTVT------------
ART1_SCHPO/287-428-----------------------------------------------------------DGRVVVEVS------------
ARRD2_HUMAN/180-307-----------------------------------------------------------RGLVSLSAK------------
Q294M6_DROPS/179-311-----------------------------------------------------------THPVELKVT------------
ADCC_DICDI/344-478-----------------------------------------------------------GGNISISCK------------
Q6CS19_KLULA/219-373-----------------------------------------------------------PQKVDYSIS------------
Q2UDU8_ASPOR/60-215-----------------------------------------------------------DNVAQYSIS------------
Q22NR4_TETTS/187-325-----------------------------------------------------------YGLYQQRVF------------
ROD1_YEAST/232-395-----------------------------------------------------------PEKVDYTIS------------
A0CL31_PARTE/172-315-----------------------------------------------------------RGTSSIEVK------------
APYA_EMENI/180-326-----------------------------------------------------------ANKIAYRIG------------
Q4PCS7_USTMA/465-633-----------------------------------------------------------SGKVHLMAS------------
Q296V0_DROPS/178-310-----------------------------------------------------------SGPLAVITS------------
Q6CW08_KLULA/282-443-----------------------------------------------------------PDKLQYEIS------------
A8WP33_CAEBR/159-305-----------------------------------------------------------DGTIQAKFV------------
A0DYQ7_PARTE/173-314-----------------------------------------------------------TGGTKVKIQ------------
A0D2Y0_PARTE/206-342-----------------------------------------------------------GGIVDLKIQ------------
Q5KC81_CRYNJ/436-587-----------------------------------------------------------RGRVALHVA------------
A7TQI8_VANPO/357-526-----------------------------------------------------------EHQLHYDIV------------
Q17EA7_AEDAE/182-314-----------------------------------------------------------TEPLIVTAT------------
Q9W2V2_DROME/420-633-----------------------------------------------------------DGRVGLRAS------------
Q240M9_TETTS/188-318-----------------------------------------------------------SGQINYNIT------------
A5DUN4_LODEL/264-404-----------------------------------------------------------PKKVEYSLS------------
A0NDX6_ANOGA/173-303-----------------------------------------------------------SEPLSINVM------------
Q16ZJ5_AEDAE/174-305-----------------------------------------------------------SAPMLITAE------------
Q7QCL7_ANOGA/170-301-----------------------------------------------------------GGIVKCKII------------
A2QTZ8_ASPNC/184-328-----------------------------------------------------------PQKIIYRVS------------
O17983_CAEEL/173-318-----------------------------------------------------------RGNVIYTLQ------------
Q9V393_DROME/233-393-----------------------------------------------------------PNKIHLEAT------------
A0BMC5_PARTE/210-346-----------------------------------------------------------RGTVELSLK------------
A1C8U8_ASPCL/140-283-----------------------------------------------------------SGKVVYTVS------------
A0D004_PARTE/178-324-----------------------------------------------------------KGSAQITAV------------
Q16ZK1_AEDAE/136-269-----------------------------------------------------------SGPLVVALQ------------
Q17EA8_AEDAE/183-323-----------------------------------------------------------SAPLMVKAT------------
Q16ZJ8_AEDAE/186-315-----------------------------------------------------------SGPMHFSIE------------
PALF_ASHGO/233-368-----------------------------------------------------------SKTVTISVD------------
ARRS_MOUSE/200-361-----------------------------------------------------------DKPLNLSVS------------
A8WP37_CAEBR/170-319-----------------------------------------------------------DGVFSIKLN------------
Q9GYT5_CAEEL/181-328-----------------------------------------------------------GGILEMSLN------------
MU170_SCHPO/266-426-----------------------------------------------------------EAKTTLEVH------------
Q5AI11_CANAL/271-413-----------------------------------------------------------VGKLQYNVN------------
A5DW17_LODEL/261-403-----------------------------------------------------------VGKLQYCVS------------
A0D012_PARTE/172-315-----------------------------------------------------------QGSSSISAK------------
ADCA_DICDI/313-441-----------------------------------------------------------KGKLHVKTW------------
Q9I7L0_DROME/174-307-----------------------------------------------------------SDPLALQLT------------
A7SF55_NEMVE/129-256-----------------------------------------------------------AAPLHALVY------------
Q16ZK2_AEDAE/273-408-----------------------------------------------------------SGSLVLSVQ------------
A8XYD8_CAEBR/172-316-----------------------------------------------------------RGSVIYELA------------
A0E996_PARTE/174-317-----------------------------------------------------------GGSAQISLQ------------
Q0U5A6_PHANO/182-337-----------------------------------------------------------ANKLAYKIT------------
PALF_YEAST/259-394-----------------------------------------------------------NKTVTISVD------------
Q23672_CAEEL/163-311-----------------------------------------------------------NGPISLKVS------------
A7TPY5_VANPO/228-381-----------------------------------------------------------PGKVEYTIS------------
Q759V0_ASHGO/221-368-----------------------------------------------------------PGKLDYSLS------------
Q9VGU7_DROME/180-316-----------------------------------------------------------HKPMIMDVS------------
Q6FM62_CANGA/224-379-----------------------------------------------------------PKKVEYSIS------------
A7SKJ5_NEMVE/177-307-----------------------------------------------------------SGPLSLVGH------------
Q6CGL3_YARLI/174-329-----------------------------------------------------------DHLVDVDYT------------
ARRD5_MOUSE/170-307-----------------------------------------------------------QGWVSLHVQ------------
Q17624_CAEEL/176-340-----------------------------------------------------------KSKLAAELA------------
A0D9C9_PARTE/194-337-----------------------------------------------------------LGTILFKFQ------------
A0CE97_PARTE/209-345-----------------------------------------------------------SGAVELSVR------------
Q7PYE1_ANOGA/178-310-----------------------------------------------------------SGPLSLIVH------------
Q16ZJ6_AEDAE/174-302-----------------------------------------------------------SDPMDITVE------------
A7SL06_NEMVE/167-299-----------------------------------------------------------SGSLTVTAK------------
O45782_CAEEL/179-307-----------------------------------------------------------AGSVTGEIR------------
Q17HB8_AEDAE/169-300-----------------------------------------------------------GGTVRCNVG------------
ADCB_DICDI/337-465-----------------------------------------------------------GGTIEMTIT------------
Q23FQ6_TETTS/188-318-----------------------------------------------------------SGEINYSMS------------
Q294M3_DROPS/163-297-----------------------------------------------------------SGPICSSLA------------
A8WP43_CAEBR/183-324-----------------------------------------------------------SKEVKIKVQ------------
A3LXL3_PICST/266-408-----------------------------------------------------------PEKVDYNVN------------
O17981_CAEEL/182-333-----------------------------------------------------------KGYLELRVN------------
Q16ZK3_AEDAE/167-301-----------------------------------------------------------SGMLYASVE------------
A8X383_CAEBR/164-301-----------------------------------------------------------FGCVSLNMS------------
Q20232_CAEEL/173-309-----------------------------------------------------------RGALALRII------------
A0BCE6_PARTE/199-335-----------------------------------------------------------RGMIELGIR------------
Q5AP77_CANAL/170-448-----------------------------------------------------------NDAVHYIIT------------
A0BDM3_PARTE/168-302-----------------------------------------------------------QGISKLECK------------
Q23674_CAEEL/182-339-----------------------------------------------------------NGLVRMELR------------
ARRD5_BOVIN/171-309-----------------------------------------------------------QGTICLQIQ------------
YA4C_SCHPO/180-322-----------------------------------------------------------PNKIEYTIS------------
Q294M1_DROPS/173-305-----------------------------------------------------------TGPLTVKFS------------
Q4P2K3_USTMA/181-316-----------------------------------------------------------QDDMRVKVL------------
A7TDW3_VANPO/229-389-----------------------------------------------------------PDKVEYSIS------------
Q6FY06_CANGA/237-406-----------------------------------------------------------PEKVEYSIS------------
A6R1F7_AJECN/559-759-----------------------------------------------------------EDQLHYDIV------------
Q9XXC4_CAEEL/159-308-----------------------------------------------------------DGLFLLKLH------------
A7TQH7_VANPO/294-447-----------------------------------------------------------PDKLQYEVS------------
Q16ID9_AEDAE/216-390-----------------------------------------------------------PNKIHLEAS------------
PALF_KLULA/263-398-----------------------------------------------------------NKTVKISVE------------
Q6CG62_YARLI/321-486-----------------------------------------------------------EDQLHYDIV------------
Q4PD45_USTMA/601-804-----------------------------------------------------------EDLLSYMVV------------
Q9XTU0_CAEEL/176-327-----------------------------------------------------------YGKVNLQIR------------
YOA5_SCHPO/223-379-----------------------------------------------------------KSATRITVS------------
Q0CQZ7_ASPTN/118-273-----------------------------------------------------------DNKVHYRIS------------
E7LU16_YEASV/179-340-----------------------------------------------------------PDKVDYSIS------------
F1QAH2_DANRE/171-293-----------------------------------------------------------SGNISMDIF------------
F6SKI7_XENTR/196-355-----------------------------------------------------------DKPLHLTAS------------
F6Y0E4_XENTR/163-285-----------------------------------------------------------SGQVLLAAS------------
G4VCF9_SCHMA/96-254-----------------------------------------------------------PGTLRLEVS------------
H2N0W5_ORYLA/194-351-----------------------------------------------------------EKPLQVKLS------------
H3CCN8_TETNG/163-285-----------------------------------------------------------TGTLMLKTR------------
H3DDA7_TETNG/203-325-----------------------------------------------------------SGGVFMHIK------------
ART5_YEAST/332-474-----------------------------------------------------------RDKLQYETS------------
Q08CX7_XENTR/182-306-----------------------------------------------------------.GHVSVTAK------------
TXNIP_MOUSE/176-299-----------------------------------------------------------DGRVSVSAR------------
Q9VI00_DROME/172-303-----------------------------------------------------------SGPVLSTLT------------

PF07070

Q9F2L5_STRCO/29-246-----------------------------------------------------------VGGPTVDTT------------
B7VMX8_VIBSL/6-225-----------------------------------------------------------IGSAKVDSV------------
Q87KC8_VIBPA/6-225-----------------------------------------------------------IGSAKVDSI------------
D2SH36_GEOOG/3-219-----------------------------------------------------------SGGAGVETV------------
U5VQ01_9ACTO/3-221-----------------------------------------------------------VGGPSVDTV------------
A9B5Z7_HERA2/2-212-----------------------------------------------------------IGNARIETH------------
Q8CK18_STRCO/3-220-----------------------------------------------------------AGGASVETV------------
A1S9J4_SHEAM/2-220-----------------------------------------------------------IGSAKVDTR------------
F8AWR6_FRADG/3-218-----------------------------------------------------------VGNADVETV------------
D5XEE5_THEPJ/2-205-----------------------------------------------------------IGSAKVDLE------------
F6CIG7_DESK7/3-205-----------------------------------------------------------IGSARVNLE------------
E8U7T1_DEIML/4-204-----------------------------------------------------------VGGARVDAR------------
D9SYU9_MICAI/3-221-----------------------------------------------------------VGGPSVETV------------
SP0M_BACSU/4-215-----------------------------------------------------------IGAAKVDTI------------
D6Y483_THEBD/3-220-----------------------------------------------------------VGAPSVDTV------------
D7B3X5_NOCDD/3-219-----------------------------------------------------------DDGPTVDTV------------
A6W415_KINRD/4-218-----------------------------------------------------------AGAASVDTV------------
A5D298_PELTS/2-206-----------------------------------------------------------IGAASVNLE------------
Q7MGK0_VIBVY/6-226-----------------------------------------------------------IGSAKVDSI------------
I0JR17_HALH3/2-209-----------------------------------------------------------VGSAKVDTQ------------
L0A4L1_DEIPD/4-203-----------------------------------------------------------IGNATVDTQ------------
C1D0Z4_DEIDV/4-204-----------------------------------------------------------VGAARVDTR------------
Q8YPP0_NOSS1/22-232-----------------------------------------------------------IGAAKVDTR------------
R4LYD7_9ACTO/3-216-----------------------------------------------------------LGGPTVHTA------------
C6WBH8_ACTMD/3-220-----------------------------------------------------------VGGPSVDTV------------
R4SZZ1_AMYOR/2-220-----------------------------------------------------------VGGPSVDTV------------
B1HWS8_LYSSC/4-216-----------------------------------------------------------IGSATVDTR------------
Q3IE37_PSEHT/2-220-----------------------------------------------------------IGAAKVDTI------------
E3E849_PAEPS/5-215-----------------------------------------------------------IGSAKVDTL------------
E4N440_KITSK/3-219-----------------------------------------------------------VGGPTVDTV------------
D3Q3X8_STANL/19-231-----------------------------------------------------------AG.VTVDTV------------
G2NX38_STRVO/3-220-----------------------------------------------------------VGGPVVDTV------------
E2Q1G0_STRC2/1-210-----------------------------------------------------------MGGPTVDTV------------
U5W7Z2_9ACTO/3-221-----------------------------------------------------------VGGPSVETV------------
D4GQ21_HALVD/1-210-----------------------------------------------------------IGNATVDTV------------
C4L3D6_EXISA/2-216-----------------------------------------------------------IGAAKVDTR------------
L0JQI9_NATP1/1-207-----------------------------------------------------------IGSATVETV------------
U5LEI3_9BACI/4-217-----------------------------------------------------------VGSASVDTK------------
B7GKU0_ANOFW/25-238-----------------------------------------------------------IGAAKVDTK------------
C5D3Y3_GEOSW/2-202-----------------------------------------------------------VGAAKVDLV------------
H2K613_STRHJ/3-217-----------------------------------------------------------VGGPSVDTV------------
Q9KVV0_VIBCH/21-240-----------------------------------------------------------IGSAKVDSV------------
Q2J8X7_FRASC/3-219-----------------------------------------------------------VGGAAVETV------------
D9STE5_CLOC7/4-215-----------------------------------------------------------IGGAKVDTV------------
I3RA56_HALMT/1-210-----------------------------------------------------------IGNATVDTV------------
Q81QV7_BACAN/2-216-----------------------------------------------------------IGNAKVDTV------------
X5A5U4_9BACL/4-214-----------------------------------------------------------IGSAKVDTR------------
D2B8E4_STRRD/3-216-----------------------------------------------------------AG.VEVDTI------------
F2EZY3_SOLSS/4-217-----------------------------------------------------------IGAAKVDTK------------
Q5V309_HALMA/3-212-----------------------------------------------------------IGSATVDTV------------
Q6LLI7_PHOPR/4-222-----------------------------------------------------------IGAAKVDTV------------
E4NWJ2_HALBP/1-210-----------------------------------------------------------IGNASVDTV------------
E1SSB8_FERBD/2-220-----------------------------------------------------------IGAAKVDTL------------
D7AXU0_NOCDD/3-218-----------------------------------------------------------FGGASVETT------------
F4FG08_VERMA/3-218-----------------------------------------------------------VGGPSVDTV------------
D3EJD4_GEOS4/4-214-----------------------------------------------------------IGAAQIDTH------------
I0H7C6_ACTM4/3-220-----------------------------------------------------------VGGPSVDTV------------
B1VNV5_STRGG/3-220-----------------------------------------------------------VGGPSVDTV------------
H8MVT2_CORCM/3-213-----------------------------------------------------------IGSARVDTR------------
H8GZW1_DEIGI/5-204-----------------------------------------------------------IGAARVDTR------------
Q5L337_GEOKA/2-214-----------------------------------------------------------IGAATVDTK------------
C0ZHJ0_BREBN/2-212-----------------------------------------------------------IGSAQVDAR------------
H2JK05_STRHJ/3-219-----------------------------------------------------------VGGPTVDTV------------
Q8EMA6_OCEIH/2-214-----------------------------------------------------------IGSTKLDTQ------------
F0LQ35_VIBFN/4-223-----------------------------------------------------------IGSAKVDSV------------
Q5L3I0_GEOKA/3-202-----------------------------------------------------------IGAAKVDLV------------
E1V3I8_HALED/2-217-----------------------------------------------------------IGNARVDTM------------
R4SRA3_AMYOR/2-220-----------------------------------------------------------SGGAKIDAR------------
G2NQ97_9ACTO/3-220-----------------------------------------------------------VGAPTVDTV------------
C7MVV3_SACVD/2-220-----------------------------------------------------------VGGPSVDTV------------
Q47QI1_THEFY/3-221-----------------------------------------------------------VGGPSVDTV------------
B1YLT3_EXIS2/2-215-----------------------------------------------------------IGAATVDTR------------
D2RPW6_HALTV/1-207-----------------------------------------------------------IGAATVDTI------------
D1A596_THECD/3-220-----------------------------------------------------------VGGPSVDTV------------
D2ASM7_STRRD/3-221-----------------------------------------------------------VGGPSVDTV------------
N0B2E1_9BACI/13-226-----------------------------------------------------------MGSATVNTK------------
H6NE63_9BACL/4-214-----------------------------------------------------------IGSAKVDTQ------------
K0K0P9_SACES/2-220-----------------------------------------------------------VGGPSVDTV------------
Q5E1Q2_VIBF1/4-222-----------------------------------------------------------IGSANVDTI------------
I7BQH2_NATSJ/1-204-----------------------------------------------------------IGAATVDTV------------
K0JWS7_SACES/3-220-----------------------------------------------------------VGGPSVDTV------------
V6K362_STRNV/3-220-----------------------------------------------------------VGGPTVETV------------
A4FGU2_SACEN/3-218-----------------------------------------------------------IGGPSVDTV------------
Q5YZ34_NOCFA/2-219-----------------------------------------------------------VGGAEVETQ------------
D9T8R1_MICAI/3-218-----------------------------------------------------------VGGPSVDTV------------
C6CSI9_PAESJ/5-215-----------------------------------------------------------IGSAKIDTL------------
D1A1F2_THECD/3-221-----------------------------------------------------------VGGPSVETV------------
G0G8W7_AMYMS/2-216-----------------------------------------------------------SGGARIDAR------------
U5W8Q8_9ACTO/3-217-----------------------------------------------------------VGGPTVDTI------------

PF04425

A3GGA7_PICST/92-585DSEHTHTSSDAESDHADEHTHNENVA....VTMD..RYGHSPLDNIDRLPKLT......NSPIDIAIY------------
A5DRA9_PICGU/36-464....................RVIVAD....ENTN..DWQNTLLDNIHQLKNLTFSNNKYAKSLNVSVH------------
Q6BJG5_DEBHA/93-577...................NTPVATN....DTYG.....ETVLDNIDKLPKLN......NSPIDIQVY------------
A5DPQ0_PICGU/115-602........QPGPASSTPRYRGINEPT....DTYG.....HTVLDNIDRLPKSH......SSPIDVQIY------------
Q6BSG0_DEBHA/5-422...............................NFW..E..NTILANAHKLPNLNRSDNKICQDLEIDMK------------
Q6BVD1_DEBHA/28-455...............................DTN..SWRETILDNVHKLTNLTYFNKEVSNAVKISIQ------------
Q5ABB5_CANAL/19-455................................QDGEQDDETILENAHKLKRLTSTNKEISKSLEVKIR------------
Q75E04_ASHGO/51-474....................HDEPIE....DDLANQDDDNINIEKLYSLPKMV......T.PVEIDIR------------
BUL1_YEAST/108-543...............DEDSLDIPPIL....DDLN..DTDNIFIDKLYTLPKMS......T.PIEITIK------------
A5E3Q9_LODEL/66-535...........TSTADANSQVHNENLAITSDSYG.....HSPLDNIDRLQKAT......KSPFDIQIF------------
A3LX53_PICST/9-457................................DLEGESNETILENAHKLKRISASNKEISKALHIHIF------------
Q6FUH4_CANGA/102-545..............SRSSVDLINPIQ....DDLN..DAKCVFVDKLYTLPKLS......T.PVEISIK------------
Q6CSE2_KLULA/69-505...................TRYEAII....DDLD..DSDNIKIEKLYSLPKVS......T.PIDVNIR------------
Q6FP46_CANGA/103-568............VSGSTAVNDNTNIE....DDVN..DADNIAIDKLYSLPKFS......T.PLEIDIR------------
Q5AN22_CANAL/97-598...........VGSSVNANVHNQNIEVTQDDTYG.....HSPLDNIDKLHKLP......HSPIDIQIY------------
A7TIV7_VANPO/87-537................AAIDNNIPIE....DDLN..GSDNIFIDKLYTLPKLT......T.PVEVDIR------------
E7KSA7_YEASL/88-524............HSSSDTNISQIPFE....DDLN..DSDNIFIDKLYTLPKLS......T.PIEIDIR------------
G0VB73_NAUCC/105-559............RASLTMHDLNMQIE....DDLN..DSDSIIIDRLYTLPKLA......T.PVDVEIR------------
G0VC27_NAUCC/80-515....................FITNTD....DDLN..ESDNIFVDDIYTLPKVA......S.PIQISIK------------
G0VC28_NAUCC/152-590................SVDHIDTPFQ....DDLN..ESDNLFIDKLYTLPKID......T.PVEIEIK------------

PF13002

A7TSP7_VANPO/130-321-----------------QIVHFHKT---------FVPDTQAIQTCKNCTTKTTKI-------KNW-DIQKN---------
C5GL98_AJEDR/142-318-----------------RKVSTKKP---------......VSRDCSACKYQTEEL-------TSW-EFLTE---------
YNSK_SCHPO/63-242-----------------KRITVLHP---------......AISHCSACAGSKEVL-------QTW-DLAAN---------
C5DVA9_ZYGRC/141-332-----------------QKVHFHKP---------FMADLHSIQTCMNCQSKTTDI-------RSW-DIQKN---------
E7KUR3_YEASL/144-346-----------------QKIHFHKP---------FVPNISSMQTCMNCKTKITNM-------KSW-EIQSN---------

PF00339

O17981_CAEEL/6-159-------------....QPNEVFFP-----------------G..QPISGRVVLS-------TTE-EKYKA---------
O17983_CAEEL/6-146-------------....FEKEVYFP-----------------G..DEVKGRAWV.-------STT-KNLKA---------
O17984_CAEEL/4-157-------------....KPNAVYAA-----------------G..QKISGRVVF.-------STA-SQQNP---------
O45782_CAEEL/7-155-------------....NPEQAYFA-----------------G..QEISGKVII.-------ENK-EPKKV---------
O76685_CAEEL/6-159-------------....QPDEVFHP-----------------G..KPISGRVVLS-------TTK-EKYKA---------
ARRS_BOVIN/22-180-------------....KRDYIDHV-----------------ERVEPVDGVVLVD-------PEL-V..KG---------
ARRB1_BOVIN/18-174-------------....KRDFVDHI-----------------DLVEPVDGVVLVD-------PEY-L..KE---------
ARRB_CAEEL/22-186-------------....KRDFIDRG-----------------DYVDLIDGMVLID-------EEY-I..KD---------
P91469_CAEEL/7-159-------------....QPDEVFLP-----------------G..QPISGRVVL.-------TTK-KKLSA---------
Q20232_CAEEL/7-150-------------......KDVYYA-----------------G..ETISGSVLL.-------ENT-ENIKI---------
Q20577_CAEEL/7-158-------------....SPRG.YAP-----------------G..QTVTGQVVL.-------RSN-EPITA---------
Q23672_CAEEL/8-142-------------....KQSEPYYP-----------------G..DTVKGTVVL.-------TNK-TPLDA---------
Q23674_CAEEL/4-159-------------....KSPPVFSP-----------------G..EKVTGNVKMT-------IPD-DEFKA---------
Q8SYU5_DROME/5-157-------------...QNEHGTYFT-----------------G..QVITGKVIV.-------NLN-KTKKL---------
ARRD2_MOUSE/9-158-------------GARTGTEPVFHG-----------------G..QAVAGRVLL.-------ELA-GAARV---------
Q9I7L0_DROME/5-150-------------...NNPHGTYFG-----------------G..EVLTGRVTL.-------KLD-KMKLV---------
PALF_YEAST/39-201-------------....EPHRVWKP-----------------N..ESITGEAVI.-------DIK-RDITN---------
Q9VGU7_DROME/5-155-------------...SNPLGLYQA-----------------G..QLISGTAEL.-------ITE-RPKTI---------
Q9VI00_DROME/5-148-------------....RREPIYYS-----------------G..ETVNGRAIL.-------TTT-SEKSV---------
Q9VI53_DROME/6-155-------------....NPWNTYYA-----------------G..QTVNGQVKF.-------TFD-SPKKV---------
Q9XXI0_CAEEL/6-159-------------....HPAAVYSP-----------------G..QNVAGKLTI.-------RNR-NALNA---------
Q9XXI4_CAEEL/4-156-------------....APNDVYFP-----------------G..QAVTGKVII.-------QNR-EWIKA---------
B4LEM0_DROVI/17-172-------------....RRDFIDHL-----------------DYCDPVDGVIVVE-------PEY-L..KN---------
F6SKI7_XENTR/21-176-------------....KRDYVDHV-----------------ESVDPVDGVVLV.-------DPD-L.LKG---------
H2L9D1_ORYLA/15-171-------------....KRDYVDHV-----------------SSVEKLDGVVKV.-------DTT-D.FGD---------
H2N0W5_ORYLA/18-173-------------....KRDFVDHC-----------------DFVDPVDGVVVID-------PTQ-L..KG---------
H2RRP6_TAKRU/18-174-------------....KRDFVDHL-----------------DHVDPVDGVILVD-------PEY-L..KD---------
Q8VD69_MOUSE/22-166-------------...DESKGCYSS-----------------G..ETVAGHVLL.-------EAA-EPVAL---------

PF03643

VPS26_DICDI/8-284TIEVTQD......KGKTEKLFVFIG-----------------N--EPVSGKVSIN-------IKEKTKKIE---------
VP26A_HUMAN/8-283MAEMKTE......DGKVEKHYLFYD-----------------G--ESVSGKVNLA-------FKQPGKRLE---------
PEP8_YEAST/5-364HVDIATRSSNSSYKSMKESLPVYED-----------------G--ESLGGIVTLR-------VRD.SKKVD---------
VP26A_ARATH/8-283QVPTKKD......NGQIVMNPLFQS-----------------Q--ETIAGKINIE-------PYQ.GKKVE---------
VPS26_SCHPO/5-279FVDYEFE......QGRKDKAPIYES-----------------D--ETVKGTVMIR-------LKD.GRKLD---------
VPS26_DROME/6-280TAEVKGE......DGKVEKMLLFYD-----------------G--ETVSGKVNVT-------LKKPGSKLE---------
VPS26_CAEEL/7-282IVKARGD......DGNMHDHFLYYD-----------------G--ESVTGTVHVN-------LKKANHKFE---------
DSCR3_MOUSE/1-283..................ANKVYHA-----------------G--EMLSGVVVIS-------SKD...SVQ---------

PF02752

Q7PUI7_ANOGA/236-407-----------------LNKAAYVH-----------------G--ENVTVTLDIK.......N.D-SR.KI.........
Q9TYQ0_CAEEL/174-315-----------------VDEIGVMP-----------------G--MTSKISLTVE.......N.K-TK.KRKKWMRKKDN
Q7PUR5_ANOGA/187-319-----------------TPRTGYAP-----------------G--EVIEVTVHVN.......N.Q-SS.VD.........
Q7PYD9_ANOGA/175-306-----------------VPFTGYVP-----------------G--QAIPLTIDLH.......N.L-SS.RI.........
Q380N5_ANOGA/183-323-----------------TPKSGYAP-----------------G--ETIELEVFVQ.......N.S-SK.VT.........
CRED_ASPOR/181-332-----------------TPTKAVIF-----------------G--TSIRVDFKLI......PL.L-KG.LT.........
Q752Z4_ASHGO/228-382-----------------VPSRAIAV-----------------G--AQTALQLRLF......PF.Q-KG.YR.........
ARRD5_HUMAN/184-321-----------------MERNTFTP-----------------G--EKVVFTTEIN.......N.Q-TS.KC.........
ARRD4_HUMAN/191-318-----------------IERKGYCN-----------------G--EAIPIYAEIE.......N.C-SS.RL.........
Q294M9_DROPS/171-302-----------------LPQAGYVP-----------------G--QKIPVTVVVV.......N.N-SS.VA.........
Q6BI98_DEBHA/278-420-----------------LKRKGIAI-----------------G--STITVKLMVI......PI.A-KG.LK.........
Q294M7_DROPS/174-306-----------------LPQGGFVP-----------------G--QTIPIGVLVS.......N.D-SS.IQ.........
Q6BIN4_DEBHA/247-390-----------------VPSKAIAI-----------------G--SNIPISFMLV......PL.L-KG.LR.........
Q293Z7_DROPS/175-308-----------------LPEDFAVR-----------------G--EPLRICVTVM.......N.N-ST.TN.........
Q9I7K7_DROME/179-320-----------------IPRQGYSP-----------------G--AGISVHLKLH.......N.P-EK.LT.........
A5DM18_PICGU/246-387-----------------MPRRGLAV-----------------G--SSVPIRLVIL......PL.A-KG.LK.........
Q294M5_DROPS/171-304-----------------IPFGGYAP-----------------G--QKIHYTLEID.......N.K-SGAYD.........
Q16ZK0_AEDAE/170-299-----------------IPASGYVP-----------------G--QKIPITNTLN.......N.A-SS.VA.........
A0BIT0_PARTE/173-314-----------------LNKPYYTF-----------------G--ENIDIILQVD.......NSQ-SS.SA.........
Q4V467_DROME/125-256-----------------LPQTGFVP-----------------G--QTVPANVLIG.......N.E-SK.IR.........
Q7SC90_NEUCR/193-351-----------------LPKWSYGP-----------------L--DPITVFIKLAPNPDMMNK.A-KK.VT.........
Q66L50_DANRE/187-314-----------------IERKGYTP-----------------G--ETIQIFAEIE.......N.C-SS.RV.........
Q95NF3_ANOGA/193-351-----------------LDKQLYLH-----------------G--ERIGVNICIR.......N.N-SN.KM.........
Q6C993_YARLI/185-326-----------------LPSKAVAV-----------------G--SSTPVHLSMT......PL.L-KG.LK.........
O44847_CAEEL/147-273-----------------MPKFTLYP-----------------G--ETTEFKLEVE.......N.H-SS.ST.........
A0CWE9_PARTE/173-316-----------------LNKAQYVF-----------------G--DSIQLNISVD.......NSQ-SN.VA.........
Q23QU8_TETTS/188-318-----------------TNGRSFAP-----------------N--ENIQIKLDVD......FS.Q-YG.KK.........
Q6ZM71_DANRE/162-286-----------------TDMRGYIA-----------------G--QIIKVSAGIE.......N.K-SD.KT.........
A8WP41_CAEBR/178-317-----------------LPKRGYVA-----------------G--EILPITINIE.......N.N-SK.SP.........
Q0E8K8_DROME/169-299-----------------LDRGGYVP-----------------G--ENILVTAFIS.......N.Y-SN.VS.........
A0C0J3_PARTE/194-337-----------------FDKSAYQP-----------------G--EVAKLQVEID......NT.Q-SK.VG.........
Q16ZJ7_AEDAE/171-300-----------------IPVSGYVP-----------------G--QKIPITVALN.......N.T-SS.TT.........
Q23YG0_TETTS/188-318-----------------TNSRSYSP-----------------N--EIISMKIDID......FN.Q-FN.KN.........
Q9W7R1_ORYLA/193-351-----------------LDKELYYH-----------------G--EPIKVHVNVT.......N.N-SN.KN.........
ARRB_CAEEL/205-363-----------------LDKEMYYH-----------------G--ESISVNVHIQ.......N.N-SN.KT.........
Q7RZE0_NEUCR/198-350-----------------IPKKAVVF-----------------G--STIPLQTRFT......PL.L-KG.LE.........
ALY2_SCHPO/345-506-----------------VSGKSFRL-----------------G--EVVPITFRFL.......L.L-DK.VR.........
Q5AM66_CANAL/305-457-----------------CPTKAIAI-----------------G--SSTPITMTLV......PL.L-KG.LQ.........
ARRB2_MOUSE/195-350-----------------LDKELYYH-----------------G--EPLNVNVHVT.......N.N-SA.KT.........
A2BIP7_DANRE/186-313-----------------TEKMAYYL-----------------G--EGLKVLAEIH.......N.G-SS.RI.........
ARRD1_HUMAN/162-286-----------------TDLRGYVV-----------------G--QALQLHADVE.......N.Q-SG.KD.........
A2QR01_ASPNC/439-613-----------------ISGKSFPL-----------------G--SQVPIAFKLT.......P.L-AK.VE.........
Q380P6_ANOGA/182-314-----------------IARCGYIP-----------------G--QTIVMKIDAV.......N.R-SR.TT.........
YC9F_SCHPO/183-325-----------------IPSKVYAI-----------------G--SEIPVNITLY......PL.L-KG.LD.........
Q16H74_AEDAE/171-301-----------------IPMTGYVP-----------------G--QLISVVVDVM.......N.K-ST.KD.........
Q6DH07_DANRE/192-355-----------------LEKEIYYH-----------------G--DPIPVNIKIK.......N.E-TN.KV.........
A8X4Z9_CAEBR/175-315-----------------IPKQAVAS-----------------G--EALPITIDID.......N.C-SK.RA.........
ART1_SCHPO/287-428-----------------IPKLCIGP-----------------S--DLVSVFVSIMP.....NN.G-SK.IR.........
ARRD2_HUMAN/180-307-----------------IDRKGYTP-----------------G--EVIPVFAEID.......N.G-ST.RP.........
Q294M6_DROPS/179-311-----------------LQQQGYVP-----------------G--QFMLIHAQVR.......N.D-SS.SD.........
ADCC_DICDI/344-478-----------------SVKNSFYP-----------------G--EEIELEVEVN.......N.S-SK.KK.........
Q6CS19_KLULA/219-373-----------------VPSKAIAI-----------------G--SSTPINIMVV......PL.L-KG.LK.........
Q2UDU8_ASPOR/60-215-----------------IPDVNIPF-----------------G--ATFPMKLRFA......PL.S-KG.IK.........
Q22NR4_TETTS/187-325-----------------IKRSEFNP-----------------G--ETIPIQLSFE.......N.K-GS.KP.........
ROD1_YEAST/232-395-----------------IPTKAIAI-----------------G--SSTMINILIV......PI.L-KG.LK.........
A0CL31_PARTE/172-315-----------------VEKNIYFP-----------------T--EFLNFSYDID......NS.N-CK.LD.........
APYA_EMENI/180-326-----------------IQNRTVAL-----------------G--TRIDVDYVFA......PL.L-RD.MK.........
Q4PCS7_USTMA/465-633-----------------LHRNTWVA-----------------G--QRVYINVGVQ.......N.D-TS.KK.........
Q296V0_DROPS/178-310-----------------VPQTGYVS-----------------G--QILPITCEVD.......N.T-SN.VN.........
Q6CW08_KLULA/282-443-----------------IPSKAIPI-----------------G--GATPLTVKLY......PF.Q-KG.YK.........
A8WP33_CAEBR/159-305-----------------TPSQVFKA-----------------G--QTFDTEVTLN.......N.T-SG.NA.........
A0DYQ7_PARTE/173-314-----------------LNKPQYLF-----------------G--ENIDIVMQVD.......NSS-SN.YH.........
A0D2Y0_PARTE/206-342-----------------LNKSNFTP-----------------G--ELAIIQYHLD.......NTF-SS.KP.........
Q5KC81_CRYNJ/436-587-----------------LGRATWVS-----------------G--QRLWCQVGIR.......N.G-SL.RK.........
A7TQI8_VANPO/357-526-----------------IASKDIIL-----------------D--AFLPIAFRFS.......P.I-DK.VT.........
Q17EA7_AEDAE/182-314-----------------TPRSGYVP-----------------G--DVIELTMHVN.......N.Q-SS.VD.........
Q9W2V2_DROME/420-633-----------------LDKGWYTH-----------------G--EDVQVTVNIR.......N.D-SR.KT.........
Q240M9_TETTS/188-318-----------------TSSRCFSP-----------------Q--ETINLNMDID......FS.Q-YS.KQ.........
A5DUN4_LODEL/264-404-----------------CPTRALAI-----------------G--SGTPISIMLV......PL.L-KG.LT.........
A0NDX6_ANOGA/173-303-----------------LPMTGYVP-----------------G--QFILVTVDIS.......N.R-SN.KC.........
Q16ZJ5_AEDAE/174-305-----------------TPISGYVP-----------------G--QTIAVHIEVD.......N.Q-SN.KN.........
Q7QCL7_ANOGA/170-301-----------------LDRGGYVP-----------------G--ESIMITATVT.......N.A-SS.VT.........
A2QTZ8_ASPNC/184-328-----------------LPSQAYTF-----------------G--SAIPIKFEFI......PL.C-KG.LE.........
O17983_CAEEL/173-318-----------------SPKCGYVA-----------------G--ENVIVSGQIE.......N.G-TS.KP.........
Q9V393_DROME/233-393-----------------LDKELYHH-----------------G--EKISVNVHVA.......N.N-SN.RT.........
A0BMC5_PARTE/210-346-----------------LNKNNFIP-----------------G--EQMQIEYTLD.......NTR-SQ.RS.........
A1C8U8_ASPCL/140-283-----------------MPSQAFPF-----------------G--SEVPLNFQFI......PL.R-KG.LE.........
A0D004_PARTE/178-324-----------------TDRNVYRI-----------------G--EAIRILIEVI......DE.E-RY.QK.........
Q16ZK1_AEDAE/136-269-----------------VPATGFVA-----------------G--QRIPVVLEVS.......N.R-SG.CK.........
Q17EA8_AEDAE/183-323-----------------VPKSLYTP-----------------G--ESLEVLLEVH.......N.L-SK.ED.........
Q16ZJ8_AEDAE/186-315-----------------LPVSGYVS-----------------G--QKIPITVNLN.......N.A-SN.IP.........
PALF_ASHGO/233-368-----------------LPESGYVI-----------------G--DTIRIKVHIQ......HY.K-EY.RN.........
ARRS_MOUSE/200-361-----------------LSKEIYFH-----------------G--EPIPVTVTVT.......N.N-TD.KV.........
A8WP37_CAEBR/170-319-----------------FQKRSFMP-----------------G--ESVEVIVTME.......N.N-SS.KP.........
Q9GYT5_CAEEL/181-328-----------------IPKTGFVP-----------------G--ETVPLNVHLI.......N.H-SS.TS.........
MU170_SCHPO/266-426-----------------TDRSLFFS-----------------G--QIIDFTICYT.......H.N-HH.RR.........
Q5AI11_CANAL/271-413-----------------MTKKGVAI-----------------G--STIPINITII......PI.V-KG.LS.........
A5DW17_LODEL/261-403-----------------MPRKAIAI-----------------G--TTVPIHLTIV......PI.A-KG.LS.........
A0D012_PARTE/172-315-----------------VEKNLYFP-----------------G--EFVQITYDID......NS.D-CK.LN.........
ADCA_DICDI/313-441-----------------LNKNAYFP-----------------G--ETLVAKMKAN.......N.T-SI.KP.........
Q9I7L0_DROME/174-307-----------------VPQTGFVP-----------------G--QNVPLSVLVT.......N.D-SH.IP.........
A7SF55_NEMVE/129-256-----------------TDRSAYCP-----------------G--ERLTLTTEIR.......N.L-PL.RE.........
Q16ZK2_AEDAE/273-408-----------------IPTNGFVP-----------------G--QIIPALIQVS.......S.R-RH.VT.........
A8XYD8_CAEBR/172-316-----------------SPKLGYVS-----------------G--ETVIINGRIH.......N.K-TS.KP.........
A0E996_PARTE/174-317-----------------INKQGFAI-----------------G--DVIEANLEVD......NT.K-TD.LN.........
Q0U5A6_PHANO/182-337-----------------VPQKNYIV-----------------G--TQITADFVLI......PL.R-KG.VE.........
PALF_YEAST/259-394-----------------IPQAGFMI-----------------G--EIIPIDVKID......HY.K-PF.YA.........
Q23672_CAEEL/163-311-----------------VPTLVFRQ-----------------G--QTAEFHFEVK.......N.H-SS.ST.........
A7TPY5_VANPO/228-381-----------------APSKAVAI-----------------G--SSTPINMLLV......PL.L-KG.LK.........
Q759V0_ASHGO/221-368-----------------IPSRAVAI-----------------G--TNVPLDMILV......PY.V-KG.LK.........
Q9VGU7_DROME/180-316-----------------TSYSAYVP-----------------G--QKIHFHLVLD.......N.Q-SD.VQ.........
Q6FM62_CANGA/224-379-----------------VPTKAVAI-----------------G--STTPVNILLV......PL.L-KG.LK.........
A7SKJ5_NEMVE/177-307-----------------TDRGGYCP-----------------G--ESISVSVYIN.......N.R-TS.TN.........
Q6CGL3_YARLI/174-329-----------------YPVSSFGP-----------------L--DPIQVYIKVAANPDIGS..K-SKRVK.........
ARRD5_MOUSE/170-307-----------------MSKNTYVP-----------------G--EKVTFTSEIR.......N.H-TG.KY.........
Q17624_CAEEL/176-340-----------------LSKTGYLP-----------------G--EAIYGNLKIG.......SKH-PK.DI.........
A0D9C9_PARTE/194-337-----------------FDKTAYQP-----------------G--EIAQLQVEID......NS.Q-SK.VG.........
A0CE97_PARTE/209-345-----------------LKTNKFFP-----------------G--DKISVDYSVD.......NTR-SQ.RP.........
Q7PYE1_ANOGA/178-310-----------------VPVTGFVS-----------------G--QSVPVTIECD.......N.A-SN.VG.........
Q16ZJ6_AEDAE/174-302-----------------IPGTGYVS-----------------G--QSIPVAVRWK.......NNN-GA............
A7SL06_NEMVE/167-299-----------------IDRAGFYI-----------------G--DEAQVTVFLD.......N.Q-ST.RD.........
O45782_CAEEL/179-307-----------------ISKCGYTP-----------------G--EKIDVSFKVIN.....LS.S-K.............
Q17HB8_AEDAE/169-300-----------------LDKRAYIP-----------------G--ENILVTGEIY.......N.Q-SN.VT.........
ADCB_DICDI/337-465-----------------APKNSYYP-----------------G--EDIELQVHVN.......N.S-SK.KK.........
Q23FQ6_TETTS/188-318-----------------LNSRCFIP-----------------N--EIINIKINAD......LG.Q-NG.NK.........
Q294M3_DROPS/163-297-----------------LPASGFTP-----------------L--QEVPFRLEVD.......N.Q-SPHYD.........
A8WP43_CAEBR/183-324-----------------LPKSGFIP-----------------G--EFIPIAISIH.......N.H-TK.KP.........
A3LXL3_PICST/266-408-----------------IAKKGLAI-----------------G--SSIPINIIIV......PI.A-KG.LS.........
O17981_CAEEL/182-333-----------------IPKTGFVP-----------------G--ETVPMNIHIL.......N.H-SS.VP.........
Q16ZK3_AEDAE/167-301-----------------LSTSGFVP-----------------G--QFIPVVIQVN.......N.K-GN.NK.........
A8X383_CAEBR/164-301-----------------LTRTAFQI-----------------G--ESIEAVVTIN.......N.R-TR.KG.........
Q20232_CAEEL/173-309-----------------LERTAYVC-----------------G--ENIRVRAQIE.......NRQ-ST............
A0BCE6_PARTE/199-335-----------------TAKNLYKP-----------------G--EVLELEYTLN.......TTR-SQ.RS.........
Q5AP77_CANAL/170-448-----------------FPRKYVTL-----------------G--CEHMINVKLS......PM.V-KD.VV.........
A0BDM3_PARTE/168-302-----------------YSGEEFSF-----------------G--DQINLEISID......LR.E-SK.QY.........
Q23674_CAEEL/182-339-----------------LPKQGFVC-----------------G--ENIPVTMIVD.......N.K-TS.KS.........
ARRD5_BOVIN/171-309-----------------MEKNTFTP-----------------G--ERDIFTTEIN.......N.Q-TS.KC.........
YA4C_SCHPO/180-322-----------------VPTKAYAI-----------------G--SYIPIHFVLV......PL.L-KR.LT.........
Q294M1_DROPS/173-305-----------------TPYCGYAP-----------------G--QKIHFVLYIN.......N.E-SS.ID.........
Q4P2K3_USTMA/181-316-----------------RDRSCFGP-----------------G--DNITLRIILSS.....DR.I-SP.IK.........
A7TDW3_VANPO/229-389-----------------VPARAIAI-----------------G--STTKIHMHLI......PL.I-KG.LQ.........
Q6FY06_CANGA/237-406-----------------IPSKAVPI-----------------G--SSSPIDISIT......PL.M-KG.LK.........
A6R1F7_AJECN/559-759-----------------ISGKSFPL-----------------G--GQVPIAFKLT.......P.L-AK.VS.........
Q9XXC4_CAEEL/159-308-----------------FSKRAFLA-----------------G--ETIRALAIME.......N.H-ST.KP.........
A7TQH7_VANPO/294-447-----------------IPSRAIPV-----------------G--GITPISIKIF......PF.Q-KH.YI.........
Q16ID9_AEDAE/216-390-----------------LDKELYHH-----------------G--ESLSVNVHIA.......N.N-SS.KT.........
PALF_KLULA/263-398-----------------IPCLGYTI-----------------G--EEIPVKVHVT......HY.K-QY.FH.........
Q6CG62_YARLI/321-486-----------------IGGKSIPI-----------------G--TKMQVAFKLT.......P.L-AK.VR.........
Q4PD45_USTMA/601-804-----------------FSGKSFPI-----------------G--QQIPLWLKFV.......P.L-GK.VK.........
Q9XTU0_CAEEL/176-327-----------------IPKKGYVP-----------------G--ETISIETNID.......N.M-SS.RP.........
YOA5_SCHPO/223-379-----------------LPRTDWLA-----------------G--ESVVSKIKIE.......N.H-SK.SS.........
Q0CQZ7_ASPTN/118-273-----------------IPETNIPF-----------------G--STFPVQFFLA......PL.S-KD.LR.........
E7LU16_YEASV/179-340-----------------VPNKAVAI-----------------G--SATPINISIV......PL.S-KG.LK.........
F1QAH2_DANRE/171-293-----------------LPKTGYQQ-----------------G--EGLIVNGEIV.......N.S-ST.RK.........
F6SKI7_XENTR/196-355-----------------LPKEVFYH-----------------G--EPISVSVSVT.......N.N-SD.KT.........
F6Y0E4_XENTR/163-285-----------------SDLRGYVV-----------------G--QAIQIHTELE.......N.K-SG.RD.........
G4VCF9_SCHMA/96-254-----------------LNKEKYYH-----------------G--ESIDINVLVD.......N.N-SN.KT.........
H2N0W5_ORYLA/194-351-----------------LPKETFYH-----------------G--EPLKANVEIT.......N.S-SS.RN.........
H3CCN8_TETNG/163-285-----------------SDLRGYIP-----------------G--QVIRLATEIH.......N.K-SG.KD.........
H3DDA7_TETNG/203-325-----------------TDRMGYMQ-----------------G--ETIQVTLEIT.......N.C-SC.RS.........
ART5_YEAST/332-474-----------------IPSRAVPI-----------------G--STTPVKIKIF......PF.E-KN.IR.........
Q08CX7_XENTR/182-306-----------------IDRKGYTP-----------------G--EVIPIFAEID.......N.C-TT.RA.........
TXNIP_MOUSE/176-299-----------------IDRKGFCE-----------------G--DDISIHADFE.......N.T-CS.RI.........
Q9VI00_DROME/172-303-----------------IPFGGYAP-----------------G--QKIRFTLEID.......NQS-SG.YD.........

PF07070

Q9F2L5_STRCO/29-246-----------------LAPGAARP-----------------G--GTLSGRVRLV---------GGTVGHD---------
B7VMX8_VIBSL/6-225-----------------LQQEVLYP-----------------G--KKASIIVHVY---------GGAQPQE---------
Q87KC8_VIBPA/6-225-----------------LNQDVLYP-----------------G--QSVDVSIHVY---------GGATEQA---------
D2SH36_GEOOG/3-219-----------------LDRPETTP-----------------G--GSVTGTVHVT---------GGSVPQD---------
U5VQ01_9ACTO/3-221-----------------LTDPTTRP-----------------G--ASLAGQVNLV---------GGNHDVE---------
A9B5Z7_HERA2/2-212-----------------LHNNTTAP-----------------G--GTITGEVHIM---------GGDVEQD---------
Q8CK18_STRCO/3-220-----------------LSESNVVP-----------------G--GVVQGEVRIQ---------GGSVDQE---------
A1S9J4_SHEAM/2-220-----------------LHQSQLLP-----------------G--QTFSATIVVQ---------GGDVAQK---------
F8AWR6_FRADG/3-218-----------------LDRPEVLP-----------------G--GLVTGTVTIK---------GGKVDQE---------
D5XEE5_THEPJ/2-205-----------------IPNPQVEL-----------------G--GILEGVVKIK---------GGSVEQE---------
F6CIG7_DESK7/3-205-----------------VAGTAVPL-----------------G--GILNGTIRIQ---------GGNVEQQ---------
E8U7T1_DEIML/4-204-----------------LERDAVRL-----------------G--EDLRGVVLLS---------GGAVEQN---------
D9SYU9_MICAI/3-221-----------------LANPNCRP-----------------G--GELAGRIQVV---------GGDHPVD---------
SP0M_BACSU/4-215-----------------LEKDAYFP-----------------G--EEVQGTVHVK---------GGKIAQD---------
D6Y483_THEBD/3-220-----------------LANPRVQP-----------------G--GTLTGEVRLK---------GGDFDAE---------
D7B3X5_NOCDD/3-219-----------------LPHPHTRP-----------------G--DLLEGSVELT---------GGGSRTE---------
A6W415_KINRD/4-218-----------------LDRDVAQP-----------------G--GPVSGRVVVV---------GGSVAQD---------
A5D298_PELTS/2-206-----------------IPQPRVPI-----------------G--GTVSGTVKVR---------GGSVDQK---------
Q7MGK0_VIBVY/6-226-----------------LQQEVLYP-----------------G--QAANIKVHVY---------GGSSEQE---------
I0JR17_HALH3/2-209-----------------LEKAQFVP-----------------G--EDVHGKVVIK---------GGDVEQP---------
L0A4L1_DEIPD/4-203-----------------LAQVSVRL-----------------G--EQVEGKVVVR---------GDQAPQA---------
C1D0Z4_DEIDV/4-204-----------------LSSAEVRV-----------------G--EELRGTVHVQ---------GGQVEQQ---------
Q8YPP0_NOSS1/22-232-----------------LFNNSVIP-----------------G--GILEGEVYIR---------GGDVAQD---------
R4LYD7_9ACTO/3-216-----------------LATPDTCP-----------------G--NPLMGAVRVR---------GGDYDVA---------
C6WBH8_ACTMD/3-220-----------------LSNPNVRP-----------------G--DVLTGEVRIS---------GGDHQAE---------
R4SZZ1_AMYOR/2-220-----------------LDSPHAVP-----------------G--EVITGQVRIQ---------GGSSDAQ---------
B1HWS8_LYSSC/4-216-----------------LEKDTYRA-----------------G--EVMRGEIIVR---------GGQVEQQ---------
Q3IE37_PSEHT/2-220-----------------LETEHLQP-----------------G--QLFNAQIVIT---------AGDVSQE---------
E3E849_PAEPS/5-215-----------------VDQTVYVP-----------------G--EELSGIIRIK---------GGKIDQE---------
E4N440_KITSK/3-219-----------------LSTPTVYP-----------------G--GTVHGQVNLV---------GGDRDAE---------
D3Q3X8_STANL/19-231-----------------LTDSHVTP-----------------G--GVLRGEVLFN---------GGERDCE---------
G2NX38_STRVO/3-220-----------------LDRRPVRP-----------------G--GVVRGHVRLR---------GGGRACD---------
E2Q1G0_STRC2/1-210-----------------LDPGPAAP-----------------G--SSLTGQVHLK---------GGSTDFT---------
U5W7Z2_9ACTO/3-221-----------------LANPNCRP-----------------G--GFLEGQVHVM---------GGDHAVD---------
D4GQ21_HALVD/1-210-----------------LPSDTVRP-----------------G--ETVDAEVRIE---------GGSAEQE---------
C4L3D6_EXISA/2-216-----------------LNESHCTP-----------------G--GELTGVVHIE---------GGSVEQS---------
L0JQI9_NATP1/1-207-----------------LP.PTLTA-----------------G--ESVDARVDVT---------GGNDSQD---------
U5LEI3_9BACI/4-217-----------------LERDSFYP-----------------G--EVAKGVIEIR---------GGKTEQK---------
B7GKU0_ANOFW/25-238-----------------LHESHLLL-----------------G--ESVTGVVEVT---------GGNIEQQ---------
C5D3Y3_GEOSW/2-202-----------------LHHPHVRL-----------------G--EKLEGEFFIE---------GGTVEQR---------
H2K613_STRHJ/3-217-----------------LDGGAALP-----------------G--GTLAGRVLLR---------GGATAVE---------
Q9KVV0_VIBCH/21-240-----------------LQQEVLYP-----------------G--QSVKVIIHVY---------GGATAQV---------
Q2J8X7_FRASC/3-219-----------------LDRPETLP-----------------G--QVVTGLTTVT---------GGKVEQK---------
D9STE5_CLOC7/4-215-----------------LSQKSVRI-----------------G--EDLEGVVNIV---------GGNVEQT---------
I3RA56_HALMT/1-210-----------------LPSDTVRP-----------------G--ETVDAEVHIT---------GGSVEQD---------
Q81QV7_BACAN/2-216-----------------LEKDEYIV-----------------G--EEILGKVHIT---------GGSVSQQ---------
X5A5U4_9BACL/4-214-----------------LEEAQIVA-----------------G--GTLRGVVSVR---------GGQVEQQ---------
D2B8E4_STRRD/3-216-----------------LQNSNVRP-----------------G--EVLRGQVNFR---------GGGSDYK---------
F2EZY3_SOLSS/4-217-----------------LHKSTYTL-----------------N--ENISGVVEII---------GGSTEQQ---------
Q5V309_HALMA/3-212-----------------LPTDSVRA-----------------G--ESVRAEVHVE---------GGSTDQN---------
Q6LLI7_PHOPR/4-222-----------------LKHDVLIP-----------------G--ENLPVVIHVQ---------GGATEQQ---------
E4NWJ2_HALBP/1-210-----------------LPSTTVSP-----------------G--ETVDAEVRVS---------GGDAEQS---------
E1SSB8_FERBD/2-220-----------------ILSETLVP-----------------G--ETMLIEIVIE---------GGDVPQT---------
D7AXU0_NOCDD/3-218-----------------LHSSVATP-----------------G--GTLRGTVVIE---------GGNVEQQ---------
F4FG08_VERMA/3-218-----------------LANPHTRP-----------------G--QTLDGQVNLI---------GGDAPAN---------
D3EJD4_GEOS4/4-214-----------------LEKSSYYP-----------------G--EEVRGIIHIK---------GGNVEQT---------
I0H7C6_ACTM4/3-220-----------------LSNPSTYP-----------------G--APLTGQVNVV---------GGTQDAD---------
B1VNV5_STRGG/3-220-----------------LEPGPALP-----------------G--AVLTGEVRLR---------GGGSDVT---------
H8MVT2_CORCM/3-213-----------------LEHDTVRA-----------------G--GDLRGLVHVQ---------GGHTPQR---------
H8GZW1_DEIGI/5-204-----------------LSRPEARV-----------------G--ERLSGVVAVQ---------GGRVEQR---------
Q5L337_GEOKA/2-214-----------------LAKAQYVQ-----------------G--ETVEGIVDIR---------GGSIEQH---------
C0ZHJ0_BREBN/2-212-----------------LEQDSLIP-----------------G--DMVRGEVHIK---------GGDVAQE---------
H2JK05_STRHJ/3-219-----------------LDPGAALP-----------------G--GALSGQVHLK---------GGNADFD---------
Q8EMA6_OCEIH/2-214-----------------LDKEIYMA-----------------G--ETVTGKILVT---------GGKVEQE---------
F0LQ35_VIBFN/4-223-----------------LQQEALIP-----------------G--QTVKVTIHVY---------GGATAQA---------
Q5L3I0_GEOKA/3-202-----------------LHRPHVRL-----------------G--ETLEGEFLLE---------GGSVAQH---------
E1V3I8_HALED/2-217-----------------LDSDTAEA-----------------G--GVLKGEIHIH---------GGEVSQD---------
R4SRA3_AMYOR/2-220-----------------LLDRTVSP-----------------G--RPLRGEVLLL---------GGEVDQE---------
G2NQ97_9ACTO/3-220-----------------LAGGAAVP-----------------G--GSLSGQVRLR---------GGSADFT---------
C7MVV3_SACVD/2-220-----------------LDNPHVLP-----------------G--QVITGQVRIQ---------GGSYDAE---------
Q47QI1_THEFY/3-221-----------------LRSPHTRP-----------------G--EFLEGTVELV---------GGESEVL---------
B1YLT3_EXIS2/2-215-----------------LEQEHCEP-----------------G--GTIQGVVHIK---------GGNVDQE---------
D2RPW6_HALTV/1-207-----------------LP.TTLTA-----------------G--ETVDARVDVT---------GGNDAQE---------
D1A596_THECD/3-220-----------------LASTHCRP-----------------G--EYLSGEVRIK---------AADYDVE---------
D2ASM7_STRRD/3-221-----------------LAVSRVSP-----------------G--GSLTGEVRIK---------GGDFEAE---------
N0B2E1_9BACI/13-226-----------------LESDKLVP-----------------G--QEVKGIVEIK---------GGSIDQK---------
H6NE63_9BACL/4-214-----------------LHNAQVTV-----------------G--GELSGVVVIQ---------GGQTEQQ---------
K0K0P9_SACES/2-220-----------------LDSPHATP-----------------G--QVITGQVRIQ---------GGSGDAN---------
Q5E1Q2_VIBF1/4-222-----------------IHHEVLIP-----------------G--QKAQVTIEVT---------GGATAQD---------
I7BQH2_NATSJ/1-204-----------------LP.TTLTA-----------------G--ESVDARVDIT---------GGNDTQE---------
K0JWS7_SACES/3-220-----------------LTNPNVRP-----------------G--ELLTGEVRIA---------GGDHPAD---------
V6K362_STRNV/3-220-----------------LEGGAVLP-----------------G--GTLRGEVRLA---------GGSSAYD---------
A4FGU2_SACEN/3-218-----------------LHHPGTRP-----------------G--EVLTGEVRIT---------GGSQAVT---------
Q5YZ34_NOCFA/2-219-----------------LFTPGVQP-----------------G--GVVDGVIRLR---------GGQVAQD---------
D9T8R1_MICAI/3-218-----------------LSNPSTRP-----------------G--LMLGGQVNLT---------GGSHDVE---------
C6CSI9_PAESJ/5-215-----------------LEKSQYVP-----------------G--EEVRGVVNIR---------GGNAPQN---------
D1A1F2_THECD/3-221-----------------LHNPNTTP-----------------G--GTISGDVHLM---------GGEHDSD---------
G0G8W7_AMYMS/2-216-----------------LLDSTAAP-----------------G--RPLRGEVLLL---------GGEVDQE---------
U5W8Q8_9ACTO/3-217-----------------LPNPATHP-----------------G--GTLTGEVRIA---------GGEYDVV---------

PF04425

A3GGA7_PICST/92-585-----------------VTKSVPQP.HH.KNELETRLKEYTSG--DMVNGYIIIT-------NNS-NKPVD---------
A5DRA9_PICGU/36-464-----------------FTKEVGKL.GKKPTYIDPSVYEYKQG--DTVNGHILIE-------NTS-DEKIR---------
Q6BJG5_DEBHA/93-577-----------------VTKRVPQP.NL.PNDLETRLKMYSSG--DLVNGYIIIT-------NTS-DEPVD---------
A5DPQ0_PICGU/115-602-----------------VTKKVPSP.NQ.KNELETRLKEYSSG--DVVNGYIIIT-------NTS-DSVVN---------
Q6BSG0_DEBHA/5-422-----------------VTEKVCQK.GVKPTIIDPSEYEFKQG--DYIHGYVTMK-------NKS-PVPIS---------
Q6BVD1_DEBHA/28-455-----------------FTKEVGEL.GKEPILIDSRLHEYKQG--DLINGFVLIT-------NES-NEPIP---------
Q5ABB5_CANAL/19-455-----------------LTEHIGKV.GEPYTLVDPLTLELKQG--DYIYGFVLIT-------NKT-SNVIP---------
Q75E04_ASHGO/51-474-----------------ITKHPVKP.HK.KPEEESILREYTSG--DIINGYVVIK-------NRS-AQPLK---------
BUL1_YEAST/108-543-----------------TTKHAPIP.HV.KPEEESILKEYTSG--DLIHGFITIE-------NKS-QANLK---------
A5E3Q9_LODEL/66-535-----------------VTKDVPRP.NQ.ENELETKLKEYTNG--DHVNGYVIVT-------NTS-SKPVK---------
A3LX53_PICST/9-457-----------------MTETVGKV.GVKPKIIDPLSIEIKQG--DYLYGFVLVT-------NKT-KYDVP---------
Q6FUH4_CANGA/102-545-----------------ITKHAPSP.NQ.KPEEESILKEYTSG--DLVHGYCTIE-------NKS-SQPLQ---------
Q6CSE2_KLULA/69-505-----------------ILKKATKPCEE.KPEEESILKEYTSG--DIINGFVVIE-------NRS-QHPLR---------
Q6FP46_CANGA/103-568-----------------ITKHVPKP.HE.KPEEESVLKEFTSG--DIIHGYCVIE-------NRS-TQPLK---------
Q5AN22_CANAL/97-598-----------------VTKQIPQP.NV.NNDLETRLKEYTSG--DFVNGYITVI-------NNS-HEPIE---------
A7TIV7_VANPO/87-537-----------------ITKHAPQP.HE.KPEEESILKEYTSG--DVIHGYCIIE-------NRS-SQPLK---------
E7KSA7_YEASL/88-524-----------------ITKTASIP.HE.RPEEQSILKEYTSG--DIIHGYCLIE-------NRS-SQPLK---------
G0VB73_NAUCC/105-559-----------------VTKDVSKP.HA.KNEEESILKEYTSG--DIIHGYCTIE-------NRS-SKRLK---------
G0VC27_NAUCC/80-515-----------------LTKQPCVP.HV.KPEEESILKEFTSG--EIIYGYFLVT-------NKS-LEPLP---------
G0VC28_NAUCC/152-590-----------------ITKHAGSP.HT.KPEEESILKEYTSG--DIIHGYCIIE-------NKS-SKALP---------

PF13002

A7TSP7_VANPO/130-321TVEMSVGS------------YVFPFSC---LIPG--------------------------------SVPATTTLGSTAET
C5GL98_AJEDR/142-318PAHLKSGI------------HDYPFSY---LFAG--------------------------------NLQPTTQ...GSLG
YNSK_SCHPO/63-242TT.YRPGT------------QHWPFSW---LFPG--------------------------------SLPASVS...NRYI
C5DVA9_ZYGRC/141-332AKDLPVGN------------YSFPFSC---LISG--------------------------------SFPAKSALGSNSET
E7KUR3_YEASL/144-346TQDLSVGS------------HSYPFSY---LIPG--------------------------------SVPCSSSLGATAET

PF00339

O17981_CAEEL/6-159.RAVNIKI------------LGLAHTS---WTDY--------------------------------DSVRRVDNDGN...
O17983_CAEEL/6-146.TSVEITF------------SGKTITA---HNGK--------------------------------KIIKDKKCK.....
O17984_CAEEL/4-157.RWIDVQL------------HGRSHTF---FTRQ--------------------------------ESETKTNSKGE...
O45782_CAEEL/7-155.NEILLEL------------KGRARTY---WTKH--------------------------------SGKSRKHCS.....
O76685_CAEEL/6-159.RAVNIKI------------LGLAHTS---WTDT--------------------------------ERVRKVNAEGK...
ARRS_BOVIN/22-180.KRVYVSL------------TCAFRYG---QEDI--------------------------------DVMGLSFRRDLYFS
ARRB1_BOVIN/18-174.RRVYVTL------------TCAFRYG---REDL--------------------------------DVLGLTFRKDLFVA
ARRB_CAEEL/22-186NRKVTAHL------------LAAFRYG---REDL--------------------------------DVLGLTFRKDLISE
P91469_CAEEL/7-159.RAVNIKI------------VGLAHTS---WKNY--------------------------------ENSCKLSFHRI...
Q20232_CAEEL/7-150.RGIRVLL------------RGKVHAT---LKVV--------------------------------KSGERRTLK.....
Q20577_CAEEL/7-158.RFLKICI------------HGAAHTK---WSEG--------------------------------ERRYRTNCEGK...
Q23672_CAEEL/8-142.RCVTIKC------------RGKSETY---LINW--------------------------------TDLYCKK.......
Q23674_CAEEL/4-159.RKVRMEM------------IGKAYTY---WEGN--------------------------------VRNNHTKIKNGD.I
Q8SYU5_DROME/5-157.RGIKLQI------------SGYAQAQ---WR..--------------------------------...IRRHGKAVAIQ
ARRD2_MOUSE/9-158.GALRLRA------------RGRARAH---WTES--------------------------------RSAGSSTAY.....
Q9I7L0_DROME/5-150.KAITLNI------------TGYAETR---WIER--------------------------------VTTNRRRRR.....
PALF_YEAST/39-201.VAIKLSL------------VCEVRVK---TGNS--------------------------------PTSKNKRIE.....
Q9VGU7_DROME/5-155.RSIFITI------------NGYGETR---WQES--------------------------------EERVGEDGK.....
Q9VI00_DROME/5-148.NEVYILF------------EGEAKVR---WDER--------------------------------RTRTRGGKT.....
Q9VI53_DROME/6-155.RGIIIRF------------LGEANTE---WSEE--------------------------------KSVTTSEGK.....
Q9XXI0_CAEEL/6-159.LALKICI------------HGDIETL---WRKF--------------------------------ENKGRYDRHGR...
Q9XXI4_CAEEL/4-156.RFLKICI------------HGGAHTH---WSES--------------------------------RSTYRTNTRGE...
B4LEM0_DROVI/17-172.RKVFGQL------------ATIYRYG---REED--------------------------------EVMGVKFSKELILC
F6SKI7_XENTR/21-176.KKVYVTL------------TCAFRYG---QEDI--------------------------------DVIGLTFRKDLYFA
H2L9D1_ORYLA/15-171.RKAFVQM------------ACAFRYG---SDDL--------------------------------DVMGLCFRKDI...
H2N0W5_ORYLA/18-173.RKVYVML------------SCTFRYG---RQDM--------------------------------DVMGVAFRRDLFLV
H2RRP6_TAKRU/18-174.RKVFVTL------------TCAFRYG---REDL--------------------------------DVLGLSFRKDLYIS
Q8VD69_MOUSE/22-166.RGLRLEA------------QGRATSA---WGPS--------------------------------AGARVCIGG.....

PF03643

VPS26_DICDI/8-284HTGIRVEF............VGQIELF---YDRG..........................NHYE.FTSLVRELAPAGELT
VP26A_HUMAN/8-283HQGIRIEF............VGQIELF---NDKS..........................NTHE.FVNLVKELALPGELT
PEP8_YEAST/5-364HLGIKVSV............IGSIDML---KSHGSGNSSSKKVTSSTSSSSSNGSVDVRKNSVDQFLCQSYDLCPAGELQ
VP26A_ARATH/8-283HNGVKVEL............LGQIEMY---FDRG..........................NFYD.FTSLVREIDVPGEIY
VPS26_SCHPO/5-279HDGVKIEF............IGQIENT---YDKG..........................NIHE.FTRSVQELASPGEMR
VPS26_DROME/6-280HQGIKIEF............IGQIELY---YDRG..........................NHHE.FKCLAKALARPGDLI
VPS26_CAEEL/7-282HQGIRIEF............IGQIEVY---YDRG..........................NQQD.FISLTRELARPGDLT
DSCR3_MOUSE/1-283HQGVSLTMEGTVNLQLSAKSVGVFEAF---YNSV..........................KPIQ.IINSTIDVLKPGKIP

PF02752

Q7PUI7_ANOGA/236-407VRKIRLVA------------VQHVDVC---MF..--------------------------------..............
Q9TYQ0_CAEEL/174-315HECVLLSL------------CQQLDFV---AVNR--------------------------------.NDPM.........
Q7PUR5_ANOGA/187-319VRSITVKF------------QRVDTFL---SQVP--------------------------------.VV...........
Q7PYD9_ANOGA/175-306IEGVNMKL------------LQEITYH---AEYP--------------------------------.AS...........
Q380N5_ANOGA/183-323VSVIEIRW------------QKILKFT---SQTR--------------------------------.VIGQTQ.......
CRED_ASPOR/181-332IGQIVSQL------------IESHDLT---LNPE--------------------------------DPD...........
Q752Z4_ASHGO/228-382LASFSASL------------VQYYAFT---DDAG--------------------------------..............
ARRD5_HUMAN/184-321IKTVVFAL------------YAHIQYE---GFTP--------------------------------.SAE..........
ARRD4_HUMAN/191-318IVP.KAAI------------FQTQTYL---ASG.--------------------------------..............
Q294M9_DROPS/171-302VSELRLSL------------VMLVRYF---SLSP--------------------------------..............
Q6BI98_DEBHA/278-420LKGMSGVI------------VQRSHTA---HSHG--------------------------------..............
Q294M7_DROPS/174-306VEEITARL------------TMVVIYY---SRPP--------------------------------.CP...........
Q6BIN4_DEBHA/247-390LGDIKIQL------------VEYSSCV---GYLP--------------------------------..............
Q293Z7_DROPS/175-308VEKLRFSV------------LQYVTYY---SHVP--------------------------------.LR...........
Q9I7K7_DROME/179-320LREAVYSL------------VQISTYV---AHLK--------------------------------.NKPK.........
A5DM18_PICGU/246-387LKSLNGCI------------VQHSHVE---HSWG--------------------------------..............
Q294M5_DROPS/171-304LDGIELQL------------KQVCLLK---AETP--------------------------------.HH...........
Q16ZK0_AEDAE/170-299MHGVQSSL------------DRTECYR---SETP--------------------------------.CE...........
A0BIT0_PARTE/173-314IQNFKFQI------------TSQLVIL---YKQQ--------------------------------.KR...........
Q4V467_DROME/125-256VHEVKVGL------------SMMITYY---SDLS--------------------------------..S...........
Q7SC90_NEUCR/193-351INKITLAI------------EEEITFN---PEGD--------------------------------..............
Q66L50_DANRE/187-314VVP.KAAL------------YQTQTFF---AKG.--------------------------------..............
Q95NF3_ANOGA/193-351VKKIKAMV------------QQGVDVV---LF..--------------------------------..............
Q6C993_YARLI/185-326LGSIKMTL------------VEISVLT---TPFG--------------------------------..............
O44847_CAEEL/147-273VKKIYAEL------------EAEPFPL---YH..--------------------------------..............
A0CWE9_PARTE/173-316VQKFELKI------------SSQLVVL---YRQQ--------------------------------.KR...........
Q23QU8_TETTS/188-318VNNLNVKL------------LGQLIMK---AS..--------------------------------..............
Q6ZM71_DANRE/162-286TGHVVASL------------MQKVTYN---TKKP--------------------------------.T............
A8WP41_CAEBR/178-317VVAVRSKM------------TQLSHFH---ASHG--------------------------------.SAMNV........
Q0E8K8_DROME/169-299IKRTKASL------------TETIEYL---ARGK--------------------------------..............
A0C0J3_PARTE/194-337IPIIKGSV------------TSKLRVI---SKQG--------------------------------..............
Q16ZJ7_AEDAE/171-300IVGIKSSL------------ERKVTYI---SQYP--------------------------------.RE...........
Q23YG0_TETTS/188-318IKCLNIKL------------IGLLSMK---AS..--------------------------------..............
Q9W7R1_ORYLA/193-351IKNIIVSV------------DQVATVV---LF..--------------------------------..............
ARRB_CAEEL/205-363VKKLKIYI------------IQVADIC---LF..--------------------------------..............
Q7RZE0_NEUCR/198-350LGEITIRL------------LEVHEFI---LQSH--------------------------------SGYG..........
ALY2_SCHPO/345-506LYKLSISV------------VESSEYW---CRSR--------------------------------.KFHRVDP......
Q5AM66_CANAL/305-457LGDIKIEL------------IEMYSFV---GSYP--------------------------------..............
ARRB2_MOUSE/195-350VKKIRVSV------------RQYADIC---LF..--------------------------------..............
A2BIP7_DANRE/186-313IKP.KYCL------------YEKYSFF---AKGR--------------------------------..............
ARRD1_HUMAN/162-286TSPVVASL------------LQKVSYK---AKRW--------------------------------.I............
A2QR01_ASPNC/439-613CHRIKVYV------------TENIQHW---TADK--------------------------------.SVHRFQP......
Q380P6_ANOGA/182-314VTEFRVKL------------VQKLCYS---SQQP--------------------------------.AV...........
YC9F_SCHPO/183-325VGKVTLVL------------KEYCTLF---ITSK--------------------------------.AYS..........
Q16H74_AEDAE/171-301ISELKIKL------------RRQVKYF---SHST--------------------------------.SG...........
Q6DH07_DANRE/192-355VKRIRVTV------------DQTTDVV---LY..--------------------------------..............
A8X4Z9_CAEBR/175-315AYCVRAEL------------KQNSHYN---ASRN--------------------------------.SLFSHS.......
ART1_SCHPO/287-428VQQLSLSL------------VEYITFI---HPSS--------------------------------..............
ARRD2_HUMAN/180-307VLP.RAAV------------VQTQTFM---ARG.--------------------------------..............
Q294M6_DROPS/179-311CKKLLIMI------------HLRSTYT---ADQP--------------------------------.SL...........
ADCC_DICDI/344-478IKNVDIQL------------.NKVEYD---GTDV--------------------------------.T............
Q6CS19_KLULA/219-373LGPIKISL------------VEYSSYS---APYS--------------------------------..............
Q2UDU8_ASPOR/60-215LHALTIDV------------IEQHEVK---ISAP--------------------------------.AAYSAQF......
Q22NR4_TETTS/187-325LKSVNVKL------------IREQNFI---KPES--------------------------------GGR...........
ROD1_YEAST/232-395LGPVRISL------------VENSQYC---GSYG--------------------------------..............
A0CL31_PARTE/172-315VDKVDSVL------------VNRLRLR---SNSD--------------------------------.SEHI.........
APYA_EMENI/180-326IAFIESQL------------LEVRDLS---VEPN--------------------------------.DGG..........
Q4PCS7_USTMA/465-633INGMTLSL------------IRTVTLY---KPRP--------------------------------ELNVDGMASR....
Q296V0_DROPS/178-310LSAVKFEL------------RKLVTFH---TSQP--------------------------------.RS...........
Q6CW08_KLULA/282-443LKKIVVSL------------LQYYAFK---DSAG--------------------------------..............
A8WP33_CAEBR/159-305IKSVQYTL------------FRHTHFH---KKWQ--------------------------------.PTPCSNS......
A0DYQ7_PARTE/173-314IQKFKFSI------------SAQLVVL---YKQQ--------------------------------.KR...........
A0D2Y0_PARTE/206-342VTRVEIRL------------INKLIFI---DDDQ--------------------------------..............
Q5KC81_CRYNJ/436-587IKNLSLAL------------LQDVRTF---GPKS--------------------------------.ATDQPVETHRKK.
A7TQI8_VANPO/357-526LHRIRIYL------------TETIDYY---CKGK--------------------------------.KVHRVEPTKKF..
Q17EA7_AEDAE/182-314VKCITVKL------------QRVDTFI---SQLP--------------------------------.RV...........
Q9W2V2_DROME/420-633VRKVRVCA------------IQHVDVC---MF..--------------------------------..............
Q240M9_TETTS/188-318VNKLTVKL------------LGQLTMK---AN..--------------------------------..............
A5DUN4_LODEL/264-404LGDIKIQL------------IEFYSYM---GNVP--------------------------------..............
A0NDX6_ANOGA/173-303IAEVKLKL------------RRQVRYS---SQTP--------------------------------.YK...........
Q16ZJ5_AEDAE/174-305LDEISTKL------------MRVVSFV---SQTP--------------------------------.YT...........
Q7QCL7_ANOGA/170-301IKSTKAAL------------TETIQYF---ARDK--------------------------------..............
A2QTZ8_ASPNC/184-328IATIHTEV------------KETHKVL---QF..--------------------------------..............
O17983_CAEEL/173-318MKIITAKL------------TRRITYR---EELK--------------------------------.AKANAKKK.....
Q9V393_DROME/233-393VKKIKVCV------------RQFADIC---LF..--------------------------------..............
A0BMC5_PARTE/210-346ISRVEARL------------INKLTFI---DDDE--------------------------------..............
A1C8U8_ASPCL/140-283LESINCQL------------VEIEERK---CPL.--------------------------------..............
A0D004_PARTE/178-324PEKIIIQL------------ENITQYK---YKNN--------------------------------.IET..........
Q16ZK1_AEDAE/136-269IHLIQLKL------------VMVVAYT---SDTP--------------------------------.RV...........
Q17EA8_AEDAE/183-323VSEIIVKF------------QKVVKFL---SQVQ--------------------------------.VIDST........
Q16ZJ8_AEDAE/186-315IHAIRSKL------------VRKVCFI---SQTP--------------------------------.TR...........
PALF_ASHGO/233-368SAGLIATL------------VRICRVH---ST..--------------------------------..............
ARRS_MOUSE/200-361VKKIKVSV------------EQIANVV---LY..--------------------------------..............
A8WP37_CAEBR/170-319IKSMQFEL------------IRQSHFH---SQHQ--------------------------------.KDFCSLNNCL...
Q9GYT5_CAEEL/181-328VNNIKAQM------------LQQCKFT---GYKS--------------------------------GATYNYGGDFER..
MU170_SCHPO/266-426IHNIKARL------------LETHIFH---PNTQ--------------------------------.NHYGGYCMNQAEE
Q5AI11_CANAL/271-413LKAINGCI------------VEHYHVQ---IGNE--------------------------------..............
A5DW17_LODEL/261-403LKAMNACI------------VEHYHIE---VDNI--------------------------------..............
A0D012_PARTE/172-315IENVDVII------------VNRLNIK---SNSG--------------------------------.SQCH.........
ADCA_DICDI/313-441TRKISLVV------------HHTMQLK---TRL.--------------------------------..............
Q9I7L0_DROME/174-307VEQLLISF------------VMLVTYH---SKPP--------------------------------SMP...........
A7SF55_NEMVE/129-256PYETCVYL------------VQSITYK---SSCG--------------------------------.RTR..........
Q16ZK2_AEDAE/273-408IRKVTTVL------------IQQTTFS---ARWP--------------------------------.KA...........
A8XYD8_CAEBR/172-316IRIIQAKL------------NRLVTYR---EELQ--------------------------------.GKNKKRNP.....
A0E996_PARTE/174-317LLNLTFSV------------QSQLIIL---YPVL--------------------------------.KL...........
Q0U5A6_PHANO/182-337IATIKMEL------------IESRQLF---ADYA--------------------------------.GRR..........
PALF_YEAST/259-394PAGLTTTL------------VRICRVG---GA..--------------------------------..............
Q23672_CAEEL/163-311INEIFIKF------------GKQVHYH---SRNQ--------------------------------.LTPCRKFDS....
A7TPY5_VANPO/228-381LGPIKIAL------------VESSQFC---GNFG--------------------------------..............
Q759V0_ASHGO/221-368LGTVKASI------------VENLTFA---TPYG--------------------------------..............
Q9VGU7_DROME/180-316CMDVKVRL------------IKNVSYR---ANSS--------------------------------.GAK..........
Q6FM62_CANGA/224-379LGSIRMTL------------IEKYSYG---SKSD--------------------------------..............
A7SKJ5_NEMVE/177-307LPGIDLVL------------RQITVYI---ASCG--------------------------------..............
Q6CGL3_YARLI/174-329LVKVSIQV------------VEVITYN---PEGD--------------------------------..............
ARRD5_MOUSE/170-307IKTVVFAL------------YAHVQYE---GFTP--------------------------------.SAE..........
Q17624_CAEEL/176-340LNHMEARL------------VDRVRRV---GAPE--------------------------------ISA...........
A0D9C9_PARTE/194-337IPTITGRL------------TNTLRIV---SKQG--------------------------------..............
A0CE97_PARTE/209-345VNRIEVRV------------IHKLIFI---DNDE--------------------------------..............
Q7PYE1_ANOGA/178-310VEKITINL------------RKLLAFH---VHTP--------------------------------.RR...........
Q16ZJ6_AEDAE/174-302IRGIRIKL------------FKHETYS---ATEP--------------------------------.YE...........
A7SL06_NEMVE/167-299VTDVEICL------------FQFTTYI---YGTD--------------------------------.EN...........
O45782_CAEEL/179-307TRTTALRF------------VQQTTYK---AKTF--------------------------------.AGH..........
Q17HB8_AEDAE/169-300IKAVKYAL------------METIQYY---AHGK--------------------------------..............
ADCB_DICDI/337-465VKKIELEL------------QRTISIQ---HEK.--------------------------------..............
Q23FQ6_TETTS/188-318VKNFSIKI------------IGLLEMK---AC..--------------------------------..............
Q294M3_DROPS/163-297IIGVEVSI------------RQHFVFL---SRKP--------------------------------..............
A8WP43_CAEBR/183-324LYYLKAQL------------IQHVHYQ---AQQE--------------------------------.NSHFNSDE.....
A3LXL3_PICST/266-408IRKIHGCI------------VQHYHVM---YEEG--------------------------------..............
O17981_CAEEL/182-333VTEVKAKI------------IQQCKFI---AYRN--------------------------------GTIFRFDGGSD...
Q16ZK3_AEDAE/167-301MTRIVTML------------VQKAIYS---AKRP--------------------------------.FV...........
A8X383_CAEBR/164-301LKEVALQL------------IMKTQFE---ARSR--------------------------------.YEH..........
Q20232_CAEEL/173-309AQSLVIRL------------VQHVEVF---VEKG--------------------------------LLG...........
A0BCE6_PARTE/199-335ITKVEVKL------------NHFLSFT---DDDE--------------------------------..............
Q5AP77_CANAL/170-448IKRIKFNV------------LERITYV---SKNL--------------------------------.SREYDYDSEDPYC
A0BDM3_PARTE/168-302IQEIVMSL------------NKRTTIM---AK..--------------------------------..............
Q23674_CAEEL/182-339FKKISLRL------------VQRVTYT---GFRD--------------------------------GFVNSHSQPCIGNE
ARRD5_BOVIN/171-309IKTVIFAL------------YAHVHYE---GFTP--------------------------------.NAE..........
YA4C_SCHPO/180-322IGKISITL------------KEYITLH---VAHG--------------------------------.YNG..........
Q294M1_DROPS/173-305ITECEVKL------------KQEVSYE---SHDP--------------------------------.HH...........
Q4P2K3_USTMA/181-316VKSISFSI------------RETITFK---GSAK--------------------------------.KTFGSN.......
A7TDW3_VANPO/229-389LGPIKINL------------IENSQYC---GSYS--------------------------------..............
Q6FY06_CANGA/237-406LGPVKVQL------------VEVGQLC---SATG--------------------------------..............
A6R1F7_AJECN/559-759LHRIKVIV------------SENTQVV---ANNR--------------------------------.TYHRVDG......
Q9XXC4_CAEEL/159-308IINLRFEL------------IQQSHYH---SRPQ--------------------------------.KSLCSLNDCH...
A7TQH7_VANPO/294-447LEKIGVTL------------IQFYSMK---DSSG--------------------------------..............
Q16ID9_AEDAE/216-390VKKIKVSV------------RQFADIC---LF..--------------------------------..............
PALF_KLULA/263-398PAGLIATL------------VRISRVS---NP..--------------------------------..............
Q6CG62_YARLI/321-486CHRIRIYI------------SENIDYY---CRKM--------------------------------.KIHRVEP......
Q4PD45_USTMA/601-804IYRILATL------------EERTDYF---AKGR--------------------------------.RVARHEVPR....
Q9XTU0_CAEEL/176-327ILKTECYL------------IQQCRFL---AYRY--------------------------------GISGPTDGRRAS..
YOA5_SCHPO/223-379IKTLKLCL------------YRRIIGF---DPPS--------------------------------.WKTQQMM......
Q0CQZ7_ASPTN/118-273LGAVTIQV------------VEKHELK---IRAS--------------------------------.AAYSVQY......
E7LU16_YEASV/179-340LGSIKVVL------------FENYQYC---DPFP--------------------------------..............
F1QAH2_DANRE/171-293IVP.KYII------------YQKQSFF---AGGQ--------------------------------..............
F6SKI7_XENTR/196-355VKKISASV------------EQVSNVV---LY..--------------------------------..............
F6Y0E4_XENTR/163-285TGSIVAAL------------VQKIAYK---SK..--------------------------------..............
G4VCF9_SCHMA/96-254VKKIKLSV------------RQYTQLC---LH..--------------------------------..............
H2N0W5_ORYLA/194-351IKDISLSV------------EQVTNVV---LY..--------------------------------..............
H3CCN8_TETNG/163-285TGCVLASL------------IQKVSYK---TR..--------------------------------..............
H3DDA7_TETNG/203-325VKP.TFAL------------YERQSFF---AQG.--------------------------------..............
ART5_YEAST/332-474LDRIEMAL------------IQYYAMK---DSSA--------------------------------..............
Q08CX7_XENTR/182-306VIP.KAAI------------IQSQAFV---ARG.--------------------------------..............
TXNIP_MOUSE/176-299VVP.KAAI------------VARHTYL---ANG.--------------------------------..............
Q9VI00_DROME/172-303LNGIELKL------------KQIYKFQ---AQTP--------------------------------.HH...........

PF07070

Q9F2L5_STRCO/29-246VEHVALEL------------VARVETG..DGEHG----------------------------------------------
B7VMX8_VIBSL/6-225IDNIDLNL------------CCRYVKE...VTAN----------------------------------------------
Q87KC8_VIBPA/6-225IDNIDMKL------------CCRYIAE...APDD----------------------------------------------
D2SH36_GEOOG/3-219VTAVRVAL------------QATVEVE...SGDS----------------------------------------------
U5VQ01_9ACTO/3-221IEHITLGL------------VTRVEVE...GGQG----------------------------------------------
A9B5Z7_HERA2/2-212IEALYLFL------------VARYTRE...YDDS----------------------------------------------
Q8CK18_STRCO/3-220IEGLSVGL------------QAKVEVE...SGDQ----------------------------------------------
A1S9J4_SHEAM/2-220IDGIDLAL------------MTRAKVS...TDNG----------------------------------------------
F8AWR6_FRADG/3-218VNEIRVAL------------EATVEVE...TDDS----------------------------------------------
D5XEE5_THEPJ/2-205IEKIYINL------------VLNSKYG...SGDE----------------------------------------------
F6CIG7_DESK7/3-205VDKIYINL------------ILSSAYK...AGDQ----------------------------------------------
E8U7T1_DEIML/4-204IERLNFSL------------MTLARHD...DT..----------------------------------------------
D9SYU9_MICAI/3-221VSYIALGL------------VTRVEVE...SSDS----------------------------------------------
SP0M_BACSU/4-215IRYIDLQL------------STRYVIV...KDDE----------------------------------------------
D6Y483_THEBD/3-220IEHITLSL------------VAQVEIE...HGDR----------------------------------------------
D7B3X5_NOCDD/3-219IAEIVLVL------------VARTEDE...EGEA----------------------------------------------
A6W415_KINRD/4-218VEEVVVAL------------QARVEVE...SGDS----------------------------------------------
A5D298_PELTS/2-206IEQIYITL------------VLDSSYK...HDDE----------------------------------------------
Q7MGK0_VIBVY/6-226IDNIHLKL------------CCRYIAE...VKED----------------------------------------------
I0JR17_HALH3/2-209IDSIHIFL------------MTEALRE...SGDK----------------------------------------------
L0A4L1_DEIPD/4-203IEHIELFV------------LAGNSDQ.......----------------------------------------------
C1D0Z4_DEIDV/4-204VERINVGL------------ATRYKHD...DS..----------------------------------------------
Q8YPP0_NOSS1/22-232IQDIYLKL------------ATEYQRE...VDDS----------------------------------------------
R4LYD7_9ACTO/3-216VETIAVGL------------VTRAEAE...DGD.----------------------------------------------
C6WBH8_ACTMD/3-220IDRVKLTL------------VTRVEVE...RGDE----------------------------------------------
R4SZZ1_AMYOR/2-220IEEILLSL------------VTRVEVE...HGDH----------------------------------------------
B1HWS8_LYSSC/4-216VDSIYLSI------------NTTYIRE...SNDH----------------------------------------------
Q3IE37_PSEHT/2-220IAGLDLLL------------MTRVKAS...NEDG----------------------------------------------
E3E849_PAEPS/5-215IGKIDIEL------------KTEYIVE...HDDK----------------------------------------------
E4N440_KITSK/3-219INGITLCL------------VARVEVE...YEDG----------------------------------------------
D3Q3X8_STANL/19-231VEGIALDF------------TAVVEAE...DEGD----------------------------------------------
G2NX38_STRVO/3-220IEHLALEL------------VARVEAG...DGGE----------------------------------------------
E2Q1G0_STRC2/1-210VEHITLEL------------VARVETESFDHGEG----------------------------------------------
U5W7Z2_9ACTO/3-221IEYVAVGL------------MTRVEVE...SGDS----------------------------------------------
D4GQ21_HALVD/1-210IGKVRFEL------------ETRYRTD...DG..----------------------------------------------
C4L3D6_EXISA/2-216VDSIYLFF------------NTLYKHE...VNDK----------------------------------------------
L0JQI9_NATP1/1-207VESISVAL------------VTRYETD...ES..----------------------------------------------
U5LEI3_9BACI/4-217IDQIYLAL------------NTTYIRE...SDDK----------------------------------------------
B7GKU0_ANOFW/25-238IDDIYLSL------------CTMYTKE...VDDR----------------------------------------------
C5D3Y3_GEOSW/2-202IRKLEVEL------------QLIVQTN...GK..----------------------------------------------
H2K613_STRHJ/3-217VEHIGLEL------------IARVEAE...HADG----------------------------------------------
Q9KVV0_VIBCH/21-240IDNIELKL------------CCCYIAE...VADE----------------------------------------------
Q2J8X7_FRASC/3-219IEKVLVAL------------EATVEVE...TDDS----------------------------------------------
D9STE5_CLOC7/4-215ISRIEVEL------------KTEYLKE...IDDS----------------------------------------------
I3RA56_HALMT/1-210IGTIRFEL------------ETRYRTE...EG..----------------------------------------------
Q81QV7_BACAN/2-216IESIYLTL------------STSYIRE...VDDK----------------------------------------------
X5A5U4_9BACL/4-214IDKIYIYV------------KTQYEKE...DNDR----------------------------------------------
D2B8E4_STRRD/3-216VEGIFIDF------------TAVVEVE...SGDN----------------------------------------------
F2EZY3_SOLSS/4-217IDAIYLTL------------HTNFIRE...IDDK----------------------------------------------
Q5V309_HALMA/3-212IDSVYFAL------------ETEYKSD...EG..----------------------------------------------
Q6LLI7_PHOPR/4-222IDNINVQL------------CCRYIDE...VPVS----------------------------------------------
E4NWJ2_HALBP/1-210ISAIDLEV------------ETRYRTE...EG..----------------------------------------------
E1SSB8_FERBD/2-220INGLELSL------------MTMAEVE...HEGG----------------------------------------------
D7AXU0_NOCDD/3-218VERLTVGL------------QARVEVE...SGDH----------------------------------------------
F4FG08_VERMA/3-218IEHLAVGL------------VTRVEIE...SGDS----------------------------------------------
D3EJD4_GEOS4/4-214VDRIYLKL------------MTEYTRE...SDDK----------------------------------------------
I0H7C6_ACTM4/3-220IEHITLGL------------VTRMEVE...GGGG----------------------------------------------
B1VNV5_STRGG/3-220VDRISLLL------------VARVERE...DQDE----------------------------------------------
H8MVT2_CORCM/3-213IDRIDLHL------------MAQYLQR...DNDR----------------------------------------------
H8GZW1_DEIGI/5-204IERVNLGL------------ATRYRSD...DS..----------------------------------------------
Q5L337_GEOKA/2-214IDEIYLAL------------VTTYLRE...IDDK----------------------------------------------
C0ZHJ0_BREBN/2-212IDEIYMYV------------VTHYEKE...SNDS----------------------------------------------
H2JK05_STRHJ/3-219IDHITLEL------------VARVEAE...HEHG----------------------------------------------
Q8EMA6_OCEIH/2-214IDQIYLSV------------NTKYIKE...SDDD----------------------------------------------
F0LQ35_VIBFN/4-223IDNIELKL------------CCRYIAE...VTMA----------------------------------------------
Q5L3I0_GEOKA/3-202IRNLDVVL------------QLEVHAE...GK..----------------------------------------------
E1V3I8_HALED/2-217LDALVLDL------------ASEAIKE...VDDK----------------------------------------------
R4SRA3_AMYOR/2-220INGLSVKL------------LARVTLP...DERR----------------------------------------------
G2NQ97_9ACTO/3-220VESITLEL------------VARVEAE...HEEG----------------------------------------------
C7MVV3_SACVD/2-220IGEVALSL------------VTRVEME...TGDH----------------------------------------------
Q47QI1_THEFY/3-221IEEISVCL------------ASAVEVE...AGDT----------------------------------------------
B1YLT3_EXIS2/2-215IARIYLAF------------NTQYKQE...VGDS----------------------------------------------
D2RPW6_HALTV/1-207VDGIYFAL------------ETRYETD...ES..----------------------------------------------
D1A596_THECD/3-220IQRITLAL------------VTRVEVE...VGDH----------------------------------------------
D2ASM7_STRRD/3-221IEHITLGL------------VTRIETE...HSEG----------------------------------------------
N0B2E1_9BACI/13-226INEIYLSL------------YTTYIKE...ADEK----------------------------------------------
H6NE63_9BACL/4-214VDSIYIYI------------KTQYIKE...ENDQ----------------------------------------------
K0K0P9_SACES/2-220IDQIVLSL------------VTRVEVE...HGDH----------------------------------------------
Q5E1Q2_VIBF1/4-222IDNIDLKL------------CCQYKKE...VHRK----------------------------------------------
I7BQH2_NATSJ/1-204IDDIYFAL------------ATRYETD...ES..----------------------------------------------
K0JWS7_SACES/3-220IDEVKLAL------------VTRVEVE...SGDN----------------------------------------------
V6K362_STRNV/3-220IDRVTLEL------------VARVEAE...HEEG----------------------------------------------
A4FGU2_SACEN/3-218IEHVALGL------------VTRIETE...HGGH----------------------------------------------
Q5YZ34_NOCFA/2-219ISQIAVEF------------VTRAEVE...YDDH----------------------------------------------
D9T8R1_MICAI/3-218IDHITVGL------------VTRVEID...GAEE----------------------------------------------
C6CSI9_PAESJ/5-215IDTIQMSV------------MTEYIRE...SNDN----------------------------------------------
D1A1F2_THECD/3-221IRYVSVAL------------RTRVEVE...SGDS----------------------------------------------
G0G8W7_AMYMS/2-216IKGLAVTL------------LARVGVP...GDR.----------------------------------------------
U5W8Q8_9ACTO/3-217IDNIVLSL------------VTRVEAE...DGD.----------------------------------------------

PF04425

A3GGA7_PICST/92-585FGLFTVSL------------EGTIKAT---ERNT----------------------------------------------
A5DRA9_PICGU/36-464FDMMYVVF------------EGSFLVA---NA..----------------------------------------------
Q6BJG5_DEBHA/93-577FGLFVVTL------------DGTIKTT---HSNP----------------------------------------------
A5DPQ0_PICGU/115-602FGLFTVSL------------EGTIKAT---ERMD----------------------------------------------
Q6BSG0_DEBHA/5-422FDMVYVVF------------EGMLVVL---ENN.----------------------------------------------
Q6BVD1_DEBHA/28-455FDMFYVLF------------EGNLTVA---NT..----------------------------------------------
Q5ABB5_CANAL/19-455FDMFSVQL------------EGCAIFG---K.T.----------------------------------------------
Q75E04_ASHGO/51-474FEMFYVTL------------EGYATVI---DR..----------------------------------------------
BUL1_YEAST/108-543FEMFYVTL------------ESYISII---DK..----------------------------------------------
A5E3Q9_LODEL/66-535FGLFTVSL------------EGTIKSL---ERSA----------------------------------------------
A3LX53_PICST/9-457FDMFSTVL------------EGCATFG---SNG.----------------------------------------------
Q6FUH4_CANGA/102-545FEMFYVTL------------EAYTSVI---DK..----------------------------------------------
Q6CSE2_KLULA/69-505FEMFYVTL------------EGCACVI---DK..----------------------------------------------
Q6FP46_CANGA/103-568FEMFYVTL------------EAYISIV---DK..----------------------------------------------
Q5AN22_CANAL/97-598FGLFTVSL------------EGTIKSV---ERNP----------------------------------------------
A7TIV7_VANPO/87-537FEMFYVTL------------EAYTSVI---DR..----------------------------------------------
E7KSA7_YEASL/88-524FEMFYVTL------------EAYISVI---DR..----------------------------------------------
G0VB73_NAUCC/105-559FEMFYVTL------------EAYISII---DR..----------------------------------------------
G0VC27_NAUCC/80-515FEMFYVTL------------EAYTSIV---DK..----------------------------------------------
G0VC28_NAUCC/152-590FEMFYVTL------------EAYTSVI---DK..----------------------------------------------

PF13002

A7TSP7_VANPO/130-321EIKY----------------------------------------------------EL-----------IATVKYKDPR.
C5GL98_AJEDR/142-318AVSY----------------------------------------------------NL-----------TACAVT.....
YNSK_SCHPO/63-242KLEY----------------------------------------------------YL-----------EATLCY..G..
C5DVA9_ZYGRC/141-332QIKY----------------------------------------------------EL-----------CAVVTYKD...
E7KUR3_YEASL/144-346QVKY----------------------------------------------------EL-----------IAVVTYIDPHR

PF00339

O17981_CAEEL/6-159VRYD----------------------------------------------------SE-----------SVHYS------
O17983_CAEEL/6-146....----------------------------------------------------..-----------....K------
O17984_CAEEL/4-157SETK----------------------------------------------------TH-----------TVHYT------
O45782_CAEEL/7-155....----------------------------------------------------.H-----------SEPYF------
O76685_CAEEL/6-159EAYE----------------------------------------------------TK-----------IVNYS------
ARRS_BOVIN/22-180QVQV----------------------------------------------------FP-----------PVGA.------
ARRB1_BOVIN/18-174NVQS----------------------------------------------------FP-----------PAPED------
ARRB_CAEEL/22-186TFQV----------------------------------------------------YP-----------QTDKS------
P91469_CAEEL/7-159VSYR----------------------------------------------------PH-----------GVYYS------
Q20232_CAEEL/7-150....----------------------------------------------------..-----------.....------
Q20577_CAEEL/7-158EESY----------------------------------------------------TE-----------IVHYS------
Q23672_CAEEL/8-142....----------------------------------------------------..-----------.....------
Q23674_CAEEL/4-159ARVR----------------------------------------------------HN-----------CADHK------
Q8SYU5_DROME/5-157NPKK----------------------------------------------------RS-----------KHQYS------
ARRD2_MOUSE/9-158....----------------------------------------------------..-----------TQSYS------
Q9I7L0_DROME/5-150....----------------------------------------------------..-----------.RTFC------
PALF_YEAST/39-201..KT----------------------------------------------------LE-----------KSTFL------
Q9VGU7_DROME/5-155..TT----------------------------------------------------KS-----------LVTHT------
Q9VI00_DROME/5-148...E----------------------------------------------------HY-----------TEYFR------
Q9VI53_DROME/6-155..TE----------------------------------------------------NE-----------VTQLK------
Q9XXI0_CAEEL/6-159WYRS----------------------------------------------------SE-----------HINYT------
Q9XXI4_CAEEL/4-156RERF----------------------------------------------------TE-----------NVNYN------
B4LEM0_DROVI/17-172REQI----------------------------------------------------VP-----------MTNP.------
F6SKI7_XENTR/21-176RTQI----------------------------------------------------YP-----------PVED.------
H2L9D1_ORYLA/15-171WIQQ----------------------------------------------------IQ-----------IYPES------
H2N0W5_ORYLA/18-173TRQV----------------------------------------------------YP-----------ELQDK------
H2RRP6_TAKRU/18-174TFQA----------------------------------------------------FP-----------PVPE.------
Q8VD69_MOUSE/22-166....----------------------------------------------------.G-----------SPAAS------

PF03643

VPS26_DICDI/8-284ENKT----------------------------------------------------.F-----------SYDFSNVEKQ.
VP26A_HUMAN/8-283QSRS----------------------------------------------------.Y-----------DFEFMQVEKP.
PEP8_YEAST/5-364HSQS----------------------------------------------------.F-----------PFLFRDLSKR.
VP26A_ARATH/8-283ERKT----------------------------------------------------.Y-----------PFEFSSVEMP.
VPS26_SCHPO/5-279HAQM----------------------------------------------------.F-----------EFEFKHVDKP.
VPS26_DROME/6-280QNNS----------------------------------------------------.Y-----------PFDFPKVEKQ.
VPS26_CAEEL/7-282QNAQ----------------------------------------------------.F-----------PFEFNNVEKP.
DSCR3_MOUSE/1-283SGKT----------------------------------------------------EV-----------PFEFPLLVKGS

PF02752

Q7PUI7_ANOGA/236-407........................................................SN-----------G.KFK------
Q9TYQ0_CAEEL/174-315......................................................MIDR-----------K.SIT------
Q7PUR5_ANOGA/187-319........................................................QQ-----------H.LEH------
Q7PYD9_ANOGA/175-306........................................................KT-----------R.RET------
Q380N5_ANOGA/183-323....................................................IPKEES-----------N.VQY------
CRED_ASPOR/181-332........................................................SI-----------R.NTY------
Q752Z4_ASHGO/228-382........................................................QV-----------Y.DDE------
ARRD5_HUMAN/184-321......................................................RRSR-----------L.DSS------
ARRD4_HUMAN/191-318........................................................KT-----------K.TIR------
Q294M9_DROPS/171-302........................................................EH-----------A.RVE------
Q6BI98_DEBHA/278-420........................................................VS-----------G.DFE------
Q294M7_DROPS/174-306........................................................DT-----------N.KDR------
Q6BIN4_DEBHA/247-390........................................................PA-----------H.SEE------
Q293Z7_DROPS/175-308........................................................VQ-----------K.VEC------
Q9I7K7_DROME/179-320......................................................RLET-----------K.VER------
A5DM18_PICGU/246-387........................................................RS-----------P.EYE------
Q294M5_DROPS/171-304........................................................KT-----------R.DIE------
Q16ZK0_AEDAE/170-299........................................................KT-----------K.VIS------
A0BIT0_PARTE/173-314........................................................KL-----------S.NYF------
Q4V467_DROME/125-256........................................................GS-----------K.CER------
Q7SC90_NEUCR/193-351........................................................EP-----------T.KKV------
Q66L50_DANRE/187-314........................................................KV-----------K.EIK------
Q95NF3_ANOGA/193-351........................................................QN-----------G.SYR------
Q6C993_YARLI/185-326........................................................HN-----------K.QVE------
O44847_CAEEL/147-273..........................................................-----------..IYG------
A0CWE9_PARTE/173-316........................................................KL-----------S.NYF------
Q23QU8_TETTS/188-318........................................................NT-----------Q.RTK------
Q6ZM71_DANRE/162-286..........................................................-----------..YDL------
A8WP41_CAEBR/178-317....................................................THHTHH-----------K.NDE------
Q0E8K8_DROME/169-299........................................................VV-----------Q.TEK------
A0C0J3_PARTE/194-337........................................................HA-----------R.VLY------
Q16ZJ7_AEDAE/171-300........................................................KS-----------R.VVG------
Q23YG0_TETTS/188-318........................................................NT-----------Q.REK------
Q9W7R1_ORYLA/193-351........................................................SN-----------D.SYT------
ARRB_CAEEL/205-363........................................................TT-----------A.SYS------
Q7RZE0_NEUCR/198-350.......................................................VRE-----------H.KKE------
ALY2_SCHPO/345-506..................................................KRRVLLAE-----------R.SAK------
Q5AM66_CANAL/305-457........................................................PM-----------K.TDE------
ARRB2_MOUSE/195-350........................................................ST-----------A.QYK------
A2BIP7_DANRE/186-313.........................................................R-----------K.IHT------
ARRD1_HUMAN/162-286..........................................................-----------..HDV------
A2QR01_ASPNC/439-613..................................................AKKVLLFE-----------K.RAD------
Q380P6_ANOGA/182-314........................................................ET-----------R.TDA------
YC9F_SCHPO/183-325......................................................STCR-----------K.EFK------
Q16H74_AEDAE/171-301........................................................KS-----------K.SVL------
Q6DH07_DANRE/192-355........................................................SA-----------D.KYT------
A8X4Z9_CAEBR/175-315....................................................SCHDHH-----------K.DDS------
ART1_SCHPO/287-428........................................................SS-----------PIVRK------
ARRD2_HUMAN/180-307........................................................AR-----------K.QKR------
Q294M6_DROPS/179-311........................................................RT-----------T.SEK------
ADCC_DICDI/344-478........................................................GT-----------S.YQL------
Q6CS19_KLULA/219-373........................................................NP-----------N.GAD------
Q2UDU8_ASPOR/60-215...................................................NVHFLSS-----------K.REH------
Q22NR4_TETTS/187-325........................................................EN-----------K.QKK------
ROD1_YEAST/232-395........................................................GV-----------I.NQE------
A0CL31_PARTE/172-315......................................................LEFQ-----------L.NYQ------
APYA_EMENI/180-326......................................................SAHA-----------A.RTE------
Q4PCS7_USTMA/465-633................................................RDLDPDACST-----------S.TTR------
Q296V0_DROPS/178-310........................................................EK-----------R.ESK------
Q6CW08_KLULA/282-443........................................................EV-----------Y.DDE------
A8WP33_CAEBR/159-305...................................................YKCHLHN-----------S.EQF------
A0DYQ7_PARTE/173-314........................................................KL-----------S.NYF------
A0D2Y0_PARTE/206-342........................................................ID-----------RVILN------
Q5KC81_CRYNJ/436-587..............................................VAEEAVEGDFTT-----------H.GAG------
A7TQI8_VANPO/357-526...............................................LLAEHNGPKLE-----------NLGEN------
Q17EA7_AEDAE/182-314........................................................EQ-----------R.QEF------
Q9W2V2_DROME/420-633........................................................NN-----------G.KFK------
Q240M9_TETTS/188-318........................................................TA-----------D.KTK------
A5DUN4_LODEL/264-404........................................................PM-----------H.SAE------
A0NDX6_ANOGA/173-303........................................................QV-----------R.TVY------
Q16ZJ5_AEDAE/174-305........................................................RV-----------K.NLS------
Q7QCL7_ANOGA/170-301........................................................VM-----------Q.TEK------
A2QTZ8_ASPNC/184-328........................................................TL-----------S.RRA------
O17983_CAEEL/173-318.................................................ADGADGFKS-----------K.LEE------
Q9V393_DROME/233-393........................................................ST-----------A.QYK------
A0BMC5_PARTE/210-346........................................................IE-----------RVVEN------
A1C8U8_ASPCL/140-283........................................................QA-----------I.RSR------
A0D004_PARTE/178-324......................................................RSKI-----------I.AEE------
Q16ZK1_AEDAE/136-269........................................................KV-----------K.TNR------
Q17EA8_AEDAE/183-323....................................................QLYAEN-----------KLIKY------
Q16ZJ8_AEDAE/186-315........................................................KA-----------R.NEA------
PALF_ASHGO/233-368........................................................GT-----------D.DPM------
ARRS_MOUSE/200-361........................................................SS-----------D.YYV------
A8WP37_CAEBR/170-319................................................KDCPVPPVYT-----------R.NCE------
Q9GYT5_CAEEL/181-328...............................................NEKMSDKIQRI-----------K.FDT------
MU170_SCHPO/266-426TFA......................................SCGYLKRYQKTKTKTRA-----------K.STW------
Q5AI11_CANAL/271-413........................................................RS-----------P.EYE------
A5DW17_LODEL/261-403........................................................RS-----------P.EFE------
A0D012_PARTE/172-315......................................................LEFQ-----------L.SAL------
ADCA_DICDI/313-441........................................................YH-----------R.CIT------
Q9I7L0_DROME/174-307........................................................NT-----------T.SER------
A7SF55_NEMVE/129-256.......................................................SVN-----------K.QVK------
Q16ZK2_AEDAE/273-408........................................................RQ-----------R.IES------
A8XYD8_CAEBR/172-316..................................................ANAKGFKS-----------Q.AEK------
A0E996_PARTE/174-317........................................................RI-----------S.NYF------
Q0U5A6_PHANO/182-337......................................................ISHQ-----------T.DVQ------
PALF_YEAST/259-394........................................................GK-----------D.DPM------
Q23672_CAEEL/163-311................................................HSCPLSVYHQ-----------T.NSS------
A7TPY5_VANPO/228-381........................................................TI-----------I.NQE------
Q759V0_ASHGO/221-368........................................................GS-----------K.AEE------
Q9VGU7_DROME/180-316.......................................................EQL-----------K.VTE------
Q6FM62_CANGA/224-379........................................................PK-----------QVEKE------
A7SKJ5_NEMVE/177-307........................................................KQ-----------R.RRT------
Q6CGL3_YARLI/174-329........................................................EP-----------V.EKR------
ARRD5_MOUSE/170-307......................................................RRRR-----------A.DSS------
Q17624_CAEEL/176-340........................................................AS-----------P.WRT------
A0D9C9_PARTE/194-337........................................................HS-----------K.LIH------
A0CE97_PARTE/209-345........................................................VE-----------RVIED------
Q7PYE1_ANOGA/178-310........................................................ET-----------K.RKK------
Q16ZJ6_AEDAE/174-302........................................................KS-----------R.TDS------
A7SL06_NEMVE/167-299........................................................EY-----------Q.VKD------
O45782_CAEEL/179-307.......................................................EHI-----------K.NVV------
Q17HB8_AEDAE/169-300........................................................LL-----------H.QER------
ADCB_DICDI/337-465........................................................GV-----------P.TQV------
Q23FQ6_TETTS/188-318........................................................RR-----------Y.RDQ------
Q294M3_DROPS/163-297........................................................VK-----------RNFYT------
A8WP43_CAEBR/183-324..................................................HCHKHCDH-----------K.TAE------
A3LXL3_PICST/266-408........................................................TS-----------P.EYE------
O17981_CAEEL/182-333................................................TLMSGSSQQT-----------K.YDT------
Q16ZK3_AEDAE/167-301........................................................YQ-----------K.VDR------
A8X383_CAEBR/164-301......................................................VNEK-----------K.LAE------
Q20232_CAEEL/173-309........................................................EN-----------K.MMS------
A0BCE6_PARTE/199-335........................................................NE-----------RVIEN------
Q5AP77_CANAL/170-448IHPVSKENKVRERVVSLYELKTKAKQSSGGHLEAYKQEVMKCPENNLLFSCYEVENDN-----------N.NGN------
A0BDM3_PARTE/168-302........................................................EP-----------K.VIV------
Q23674_CAEEL/182-339............................................KEKITYATRLNAQT-----------R.VEE------
ARRD5_BOVIN/171-309......................................................RRSR-----------V.DSS------
YA4C_SCHPO/180-322......................................................LPAS-----------K.DEV------
Q294M1_DROPS/173-305........................................................EY-----------R.YDK------
Q4P2K3_USTMA/181-316....................................................KAASQK-----------T.ETL------
A7TDW3_VANPO/229-389........................................................PV-----------T.YQE------
Q6FY06_CANGA/237-406........................................................VS-----------S.LDD------
A6R1F7_AJECN/559-759..................................................SKKVLLFE-----------K.RAD------
Q9XXC4_CAEEL/159-308................................................SDCPIESKYR-----------R.DGE------
A7TQH7_VANPO/294-447........................................................QL-----------Y.NDE------
Q16ID9_AEDAE/216-390........................................................ST-----------A.QYK------
PALF_KLULA/263-398........................................................RN-----------T.EQI------
Q6CG62_YARLI/321-486..................................................ARKYLVFE-----------H.KPD------
Q4PD45_USTMA/601-804................................................KWTLMKVAHA-----------S.ATE------
Q9XTU0_CAEEL/176-327...............................................SLSENDRYLSR-----------K.RDE------
YOA5_SCHPO/223-379..................................................SHLNLSRK-----------N.SEV------
Q0CQZ7_ASPTN/118-273...................................................NVHFLTS-----------T.REH------
E7LU16_YEASV/179-340........................................................PV-----------I.SEN------
F1QAH2_DANRE/171-293........................................................RA-----------V.HTT------
F6SKI7_XENTR/196-355........................................................SS-----------D.YYI------
F6Y0E4_XENTR/163-285........................................................RV-----------V.YDL------
G4VCF9_SCHMA/96-254........................................................NN-----------N.RYN------
H2N0W5_ORYLA/194-351........................................................SN-----------D.KYV------
H3CCN8_TETNG/163-285........................................................RP-----------L.FDL------
H3DDA7_TETNG/203-325........................................................KR-----------T.VHA------
ART5_YEAST/332-474........................................................QI-----------Y.DDE------
Q08CX7_XENTR/182-306........................................................TM-----------K.QKK------
TXNIP_MOUSE/176-299........................................................QT-----------K.VFT------
Q9VI00_DROME/172-303........................................................KT-----------R.EKE------

PF07070

Q9F2L5_STRCO/29-246--------------------------------------------------------DG...........E-GVV------
B7VMX8_VIBSL/6-225--------------------------------------------------------SQ.GQEGGHKRRMH-QTY------
Q87KC8_VIBPA/6-225--------------------------------------------------------RG.AREGHSMRRVP-QTH------
D2SH36_GEOOG/3-219--------------------------------------------------------SW...........R-EEV------
U5VQ01_9ACTO/3-221--------------------------------------------------------EY...........G-ATG------
A9B5Z7_HERA2/2-212--------------------------------------------------------KI...........T-QDH------
Q8CK18_STRCO/3-220--------------------------------------------------------EY...........K-QDV------
A1S9J4_SHEAM/2-220--------------------------------------------------------DY...........F-KNH------
F8AWR6_FRADG/3-218--------------------------------------------------------TW...........Y-ENV------
D5XEE5_THEPJ/2-205--------------------------------------------------------TK...........P-VSR------
F6CIG7_DESK7/3-205--------------------------------------------------------TR...........N-IRR------
E8U7T1_DEIML/4-204--------------------------------------------------------.............T-SAH------
D9SYU9_MICAI/3-221--------------------------------------------------------EY...........D-VNQ------
SP0M_BACSU/4-215--------------------------------------------------------EH...........R-KYA------
D6Y483_THEBD/3-220--------------------------------------------------------ER...........R-GVG------
D7B3X5_NOCDD/3-219--------------------------------------------------------.............T-GGA------
A6W415_KINRD/4-218--------------------------------------------------------EW...........R-EDV------
A5D298_PELTS/2-206--------------------------------------------------------TR...........H-LRQ------
Q7MGK0_VIBVY/6-226--------------------------------------------------------RGSSSQGQQTRRVP-QSH------
I0JR17_HALH3/2-209--------------------------------------------------------KI...........K-EKV------
L0A4L1_DEIPD/4-203--------------------------------------------------------.............V-NMH------
C1D0Z4_DEIDV/4-204--------------------------------------------------------.............Y-VNH------
Q8YPP0_NOSS1/22-232--------------------------------------------------------TV...........T-EEC------
R4LYD7_9ACTO/3-216--------------------------------------------------------..............-ALL------
C6WBH8_ACTMD/3-220--------------------------------------------------------EH...........V-RNV------
R4SZZ1_AMYOR/2-220--------------------------------------------------------ER...........A-GTA------
B1HWS8_LYSSC/4-216--------------------------------------------------------KH...........T-EVA------
Q3IE37_PSEHT/2-220--------------------------------------------------------DY...........F-TNH------
E3E849_PAEPS/5-215--------------------------------------------------------KT...........V-TTC------
E4N440_KITSK/3-219--------------------------------------------------------EA...........H-RTQ------
D3Q3X8_STANL/19-231--------------------------------------------------------E............Q-VEY------
G2NX38_STRVO/3-220--------------------------------------------------------EG...........A-GGV------
E2Q1G0_STRC2/1-210--------------------------------------------------------EG...........E-GVV------
U5W7Z2_9ACTO/3-221--------------------------------------------------------EY...........N-TDQ------
D4GQ21_HALVD/1-210--------------------------------------------------------.............Y-REV------
C4L3D6_EXISA/2-216--------------------------------------------------------ST...........Y-STF------
L0JQI9_NATP1/1-207--------------------------------------------------------.............Y-GTA------
U5LEI3_9BACI/4-217--------------------------------------------------------KY...........T-AAG------
B7GKU0_ANOFW/25-238--------------------------------------------------------KV...........M-KQA------
C5D3Y3_GEOSW/2-202--------------------------------------------------------.............A-YRR------
H2K613_STRHJ/3-217--------------------------------------------------------ES...........E-GTV------
Q9KVV0_VIBCH/21-240--------------------------------------------------------RG.QQQGQPMRRVP-HTY------
Q2J8X7_FRASC/3-219--------------------------------------------------------TW...........H-EQV------
D9STE5_CLOC7/4-215--------------------------------------------------------KV...........R-CTA------
I3RA56_HALMT/1-210--------------------------------------------------------.............Y-QEV------
Q81QV7_BACAN/2-216--------------------------------------------------------KI...........T-TTT------
X5A5U4_9BACL/4-214--------------------------------------------------------KV...........T-HEV------
D2B8E4_STRRD/3-216--------------------------------------------------------EH...........K-STY------
F2EZY3_SOLSS/4-217--------------------------------------------------------KI...........K-DEA------
Q5V309_HALMA/3-212--------------------------------------------------------.............Y-KDA------
Q6LLI7_PHOPR/4-222--------------------------------------------------------RGDSEHRKEKR..P-QTC------
E4NWJ2_HALBP/1-210--------------------------------------------------------.............Y-RDT------
E1SSB8_FERBD/2-220--------------------------------------------------------ES...........R-QPV------
D7AXU0_NOCDD/3-218--------------------------------------------------------ES...........T-RDL------
F4FG08_VERMA/3-218--------------------------------------------------------EY...........A-GVM------
D3EJD4_GEOS4/4-214--------------------------------------------------------KY...........I-ESY------
I0H7C6_ACTM4/3-220--------------------------------------------------------DY...........S-AVA------
B1VNV5_STRGG/3-220--------------------------------------------------------EH...........E-GTV------
H8MVT2_CORCM/3-213--------------------------------------------------------RS...........A-LNA------
H8GZW1_DEIGI/5-204--------------------------------------------------------.............T-VTH------
Q5L337_GEOKA/2-214--------------------------------------------------------KH...........E-EKA------
C0ZHJ0_BREBN/2-212--------------------------------------------------------KT...........K-EEC------
H2JK05_STRHJ/3-219--------------------------------------------------------ES...........E-GAV------
Q8EMA6_OCEIH/2-214--------------------------------------------------------KR...........Y-HVN------
F0LQ35_VIBFN/4-223--------------------------------------------------------RG.REEGGSTRRMP-QAH------
Q5L3I0_GEOKA/3-202--------------------------------------------------------.............A-YRR------
E1V3I8_HALED/2-217--------------------------------------------------------KV...........H-LPH------
R4SRA3_AMYOR/2-220--------------------------------------------------------PG...........V-EDL------
G2NQ97_9ACTO/3-220--------------------------------------------------------ES...........E-GTV------
C7MVV3_SACVD/2-220--------------------------------------------------------EF...........T-GTA------
Q47QI1_THEFY/3-221--------------------------------------------------------EG...........V-SRV------
B1YLT3_EXIS2/2-215--------------------------------------------------------KT...........F-TTF------
D2RPW6_HALTV/1-207--------------------------------------------------------.............A-RTG------
D1A596_THECD/3-220--------------------------------------------------------EG...........A-GGM------
D2ASM7_STRRD/3-221--------------------------------------------------------EH...........T-GLG------
N0B2E1_9BACI/13-226--------------------------------------------------------KY...........T-NNA------
H6NE63_9BACL/4-214--------------------------------------------------------KV...........R-KTA------
K0K0P9_SACES/2-220--------------------------------------------------------EF...........A-GVS------
Q5E1Q2_VIBF1/4-222--------------------------------------------------------SE...NGSQTQMIK-QTH------
I7BQH2_NATSJ/1-204--------------------------------------------------------.............T-RTA------
K0JWS7_SACES/3-220--------------------------------------------------------EH...........N-RNV------
V6K362_STRNV/3-220--------------------------------------------------------ES...........E-GFV------
A4FGU2_SACEN/3-218--------------------------------------------------------DG...........D-AFV------
Q5YZ34_NOCFA/2-219--------------------------------------------------------EG...........V-REI------
D9T8R1_MICAI/3-218--------------------------------------------------------EY...........D-ALV------
C6CSI9_PAESJ/5-215--------------------------------------------------------RF...........R-QHG------
D1A1F2_THECD/3-221--------------------------------------------------------EY...........N-TNM------
G0G8W7_AMYMS/2-216--------------------------------------------------------.............T-EDL------
U5W8Q8_9ACTO/3-217--------------------------------------------------------..............-ALI------

PF04425

A3GGA7_PICST/92-585------------------------------------------------HAEANEAHKY-----------NKILM------
A5DRA9_PICGU/36-464------------------------------------------------....KNKKDR-----------VPVKV------
Q6BJG5_DEBHA/93-577------------------------------------------------NANPADIHKY-----------DKVLI------
A5DPQ0_PICGU/115-602------------------------------------------------NDGTQSPHRY-----------KKVLM------
Q6BSG0_DEBHA/5-422------------------------------------------------...RGLMDVK-----------KPSKV------
Q6BVD1_DEBHA/28-455------------------------------------------------....LDVNDR-----------KPSKV------
Q5ABB5_CANAL/19-455------------------------------------------------...NNSTLVE-----------QPSHI------
Q75E04_ASHGO/51-474------------------------------------------------........MK-----------GKRTV------
BUL1_YEAST/108-543------------------------------------------------........VK-----------SKRTI------
A5E3Q9_LODEL/66-535------------------------------------------------..NP.LQQRY-----------RKILM------
A3LX53_PICST/9-457------------------------------------------------..NLQSSVVR-----------PPTTV------
Q6FUH4_CANGA/102-545------------------------------------------------........QK-----------GKRTL------
Q6CSE2_KLULA/69-505------------------------------------------------........KQ-----------GKRTV------
Q6FP46_CANGA/103-568------------------------------------------------........QK-----------GKRTI------
Q5AN22_CANAL/97-598------------------------------------------------.HAMGLTHKF-----------SKILM------
A7TIV7_VANPO/87-537------------------------------------------------........QK-----------GKRTV------
E7KSA7_YEASL/88-524------------------------------------------------........QK-----------GKRTL------
G0VB73_NAUCC/105-559------------------------------------------------........KK-----------GKRVV------
G0VC27_NAUCC/80-515------------------------------------------------........QR-----------RKRTL------
G0VC28_NAUCC/152-590------------------------------------------------........TK-----------GKRTV------

PF13002

A7TSP7_VANPO/130-321......RDLPT....F.GKV---QSLKLSMPIAVT-------------------------------------RSILRG-P
C5GL98_AJEDR/142-318..............TS.GKE---L..CLNRPIKIK-------------------------------------RAVMPG-P
YNSK_SCHPO/63-242........TPEGGISP.SKP---EVLKF..PLQLK-------------------------------------RAAIPS-P
C5DVA9_ZYGRC/141-332.........PRRGASPHQKD---QLLQLVMPVPVT-------------------------------------RSLPRG-P
E7KUR3_YEASL/144-346NSFSSGHSTPRKEGSS.SKK---RLLQLAMPIAVT-------------------------------------RSIPRG-P

PF00339

O17981_CAEEL/6-159-----------------SNV...HYLDQALLLWAC.--------------------------KDG......SNELSAG-D
O17983_CAEEL/6-146-----------------GEE...TYVEMKHEVWTP.--------------------------EDT......ENTFPSG-D
O17984_CAEEL/4-157-----------------ATA...KHLDTAVPLWRK.--------------------------TDK......AARLLPG-K
O45782_CAEEL/7-155-----------------LEQFNPGYTHKFTVVKDG.--------------------------KEK......ERILPAG-I
O76685_CAEEL/6-159-----------------ANV...NYLDYSLLLWAS.--------------------------SDG......SNELAAG-E
ARRS_BOVIN/22-180-----------------.SG...ATTRLQESLIKK.--------------------------..............LG-A
ARRB1_BOVIN/18-174-----------------.KK...PLTRLQERLIKK.--------------------------..............LG-E
ARRB_CAEEL/22-186-----------------ISR...PLSRLQERLKRK.--------------------------..............LG-A
P91469_CAEEL/7-159-----------------ANV...KYLDYTQLLWTC.--------------------------GEG......PKELNAG-E
Q20232_CAEEL/7-150-----------------DDQ...YVLDEKQLLWGK.--------------------------DKSDE.SDSVPILARG-V
Q20577_CAEEL/7-158-----------------AEV...DYVSGETIAWSA.--------------------------RNG......TEKLPSG-H
Q23672_CAEEL/8-142-----------------......DLFRKSEMVWVS.--------------------------KDG......QNKMPEG-G
Q23674_CAEEL/4-159-----------------GKI...VYCRFETIVWKS.--------------------------DGA......KNDMPSG-P
Q8SYU5_DROME/5-157-----------------GRE...DYIASTTYLMGSE--------------------------QGS......NFNMDAG-T
ARRD2_MOUSE/9-158-----------------ERV...EVVNHRATLLAP.--------------------------DSG.....DIATLPAG-R
Q9I7L0_DROME/5-150-----------------GRE...DYIASKTFLVGSN--------------------------LSS......QVSIEAG-I
PALF_YEAST/39-201-----------------YGQ...DYVKTAFSAKEK.--------------------------KPHVDKTTILNGLSKG-E
Q9VGU7_DROME/5-155-----------------TTE...VYYSTDQPVYGQ.--------------------------AGG.....SQLELPTG-K
Q9VI00_DROME/5-148-----------------GKQ...QYLYTRTSVFGS.--------------------------..........GNLPPG-T
Q9VI53_DROME/6-155-----------------GHE...EYFKIQYYLLGGK--------------------------NSS......ETELPPG-T
Q9XXI0_CAEEL/6-159-----------------SKI...NVLEGIAQPWSSI--------------------------ENA......NNKIPGG-V
Q9XXI4_CAEEL/4-156-----------------ATI...NYLTGESIAWQS.--------------------------RDG......TDRLPAG-T
B4LEM0_DROVI/17-172-----------------.NM...EMTPMQEKIVRK.--------------------------..............LG-S
F6SKI7_XENTR/21-176-----------------.PK...ALTKVQERLMKK.--------------------------..............LG-N
H2L9D1_ORYLA/15-171-----------------SKP...ALSAMHDTLLKK.--------------------------..............AG-D
H2N0W5_ORYLA/18-173-----------------EKL...THTKIQQKLLRK.--------------------------..............LG-D
H2RRP6_TAKRU/18-174-----------------ERK...PNSRLQERLLKK.--------------------------..............LG-Q
Q8VD69_MOUSE/22-166-----------------SEV...EYLNLRLSLLEA.--------------------------PAGE....GVTLLQPG-K

PF03643

VPS26_DICDI/8-284...--------------YESYNGTNVRLRYFVRLTI--------------------------GRSF.ASNIVKEYDIW-V
VP26A_HUMAN/8-283...--------------YESYIGANVRLRYFLKVTI--------------------------VRRL..TDLVKEYDLI-V
PEP8_YEAST/5-364...--------------YESYKGKNVDVAYYVKVTV--------------------------MRKS..TDISKIKRFW-V
VP26A_ARATH/8-283...--------------YETYNGVNVRLRYVLKVTV--------------------------TRGY.AGSIVEYQDFV-V
VPS26_SCHPO/5-279...--------------YESYIGKNVKLRYICRVTV--------------------------SRKM..KDVIREKDLW-V
VPS26_DROME/6-280...--------------FEVYAGSNVRLRYFLRATI--------------------------VRRI..SDITKEVDIA-V
VPS26_CAEEL/7-282...--------------FETYMGTNVKLRYFLRVTV--------------------------IRRL..TDLTKELDLV-V
DSCR3_MOUSE/1-283KVL--------------YETYHGVFVNIQYTLRCDM--------------------------RRSLLAKDLTKTCEFI-V

PF02752

Q7PUI7_ANOGA/236-407-----------------------NIVAE.VDVSKHI......................................GPGD-T
Q9TYQ0_CAEEL/174-315-----------------------IAVES..HGTCKT.....................................KAGVG-P
Q7PUR5_ANOGA/187-319-----------------------TVLEE..RTIGRV....................................AGRNDA-V
Q7PYD9_ANOGA/175-306-----------------------HTIVK..HIGDGV....................................APESQK-Q
Q380N5_ANOGA/183-323-----------------------EVLEV..RKIPSI....................................EGENDA-R
CRED_ASPOR/181-332-----------------------KNTRT..ILNDEFELDHD..........................NALEIIDEAAE-G
Q752Z4_ASHGO/228-382-----------------------AVAHR..AAMEHFTDVAG..........................CDPARGNLLVD-A
ARRD5_HUMAN/184-321-----------------------ELLRQ..EANTPV....................................TRFNTT-K
ARRD4_HUMAN/191-318-----------------------HMVAN..VRGNHI....................................ASGSTD-T
Q294M9_DROPS/171-302-----------------------RIIIS.RAKGDAV....................................LKQCTR-S
Q6BI98_DEBHA/278-420-----------------------ELIGK.QTMSIPD...................................SNSLSAD-R
Q294M7_DROPS/174-306-----------------------FVVAE..KAGEGV....................................SKNSRK-Q
Q6BIN4_DEBHA/247-390-----------------------RVVVS.KTISQPNE.................................NDPEFQMD-K
Q293Z7_DROPS/175-308-----------------------IAIAN..KETGSV....................................QKKSER-S
Q9I7K7_DROME/179-320-----------------------QTVLSSRHELHNL....................................PRGELQ-N
A5DM18_PICGU/246-387-----------------------EIIGK.QDLKINP....................................GHAEED-Y
Q294M5_DROPS/171-304-----------------------KKLHG.CCQGERV....................................LRFSKR-I
Q16ZK0_AEDAE/170-299-----------------------KTFAS...VSTAI....................................NNDVFS-R
A0BIT0_PARTE/173-314-----------------------DLFDQ..ELNF......................................AAGEQK-E
Q4V467_DROME/125-256-----------------------KSVAK..LKADGV....................................LRNSRK-M
Q7SC90_NEUCR/193-351-----------------------NKIAK.HTQPVGV.....................................KLTET-G
Q66L50_DANRE/187-314-----------------------QLIAN..LRGDPL....................................HSGKTE-T
Q95NF3_ANOGA/193-351-----------------------NTVAS..LETSEGC..................................PIQPGSS-.
Q6C993_YARLI/185-326-----------------------KVVAN.KTIEATA...................................DGYEGHD-L
O44847_CAEEL/147-273-----------------------NTKAK.GKMHVLV....................................APYSTQ-K
A0CWE9_PARTE/173-316-----------------------DIYLQ..ELNEQI....................................QAHSQK-Q
Q23QU8_TETTS/188-318-----------------------YINIF..EKMVNV....................................KVEKT.-H
Q6ZM71_DANRE/162-286-----------------------RSVAE..VEGPGV....................................KGGNKS-E
A8WP41_CAEBR/178-317-----------------------KCVAE.SRRNFDV....................................APHSRG-Q
Q0E8K8_DROME/169-299-----------------------RELAV..LVRGKI....................................RPGAKD-E
A0C0J3_PARTE/194-337-----------------------RVCAS..SSIQGI....................................ESGQSA-L
Q16ZJ7_AEDAE/171-300-----------------------KCLAS...VWTTV....................................TTDKSA-T
Q23YG0_TETTS/188-318-----------------------HVVIY..EQPMSV....................................KVEKS.-Q
Q9W7R1_ORYLA/193-351-----------------------KCVDY..EDNGDS....................................VSAGAT-.
ARRB_CAEEL/205-363-----------------------CEVAR..IESNEGF..................................PVGPGGT-.
Q7RZE0_NEUCR/198-350-----------------------REISV.WKIPIEREKHW............................QDVIEDTGQE-G
ALY2_SCHPO/345-506-----------------------HQNTD.NLFETPD....................................EGDGLS-S
Q5AM66_CANAL/305-457-----------------------RIIAK.KKIPKRKKNNNGD........................EEEEEEEVDMFD-Q
ARRB2_MOUSE/195-350-----------------------CPVAQ..LEQDDQ....................................VSPSST-.
A2BIP7_DANRE/186-313-----------------------HDLLK..EVGESV....................................EPNSKK-T
ARRD1_HUMAN/162-286-----------------------RTIAE..VEGAGV....................................KAWRRA-Q
A2QR01_ASPNC/439-613-----------------------SASTS.EEIVDRNRTNL...........................LGNLSSDAGVG-P
Q380P6_ANOGA/182-314-----------------------LVVAE..SRCSGV....................................TSGEVV-K
YC9F_SCHPO/183-325-----------------------RALVK.KTIPGL......................................PMVDD-Y
Q16H74_AEDAE/171-301-----------------------STLVK..YQCGGV....................................DRNKSA-G
Q6DH07_DANRE/192-355-----------------------KNVLT..EEFGET....................................VEANSS-.
A8X4Z9_CAEBR/175-315-----------------------KRVAE.TRKNIKI....................................TARTHG-R
ART1_SCHPO/287-428-----------------------KKVLR.YEEDLDD....................................MKLTSE-G
ARRD2_HUMAN/180-307-----------------------AVVAS..LAGEPV....................................GPGQRA-L
Q294M6_DROPS/179-311-----------------------IMLVK..RECGPV....................................AHHAQK-I
ADCC_DICDI/344-478-----------------------LTMTK..KFYPKI....................................KQNTAC-K
Q6CS19_KLULA/219-373-----------------------RTILK.VKIQDPLHHINNGE......................YDATNTTEFDFQD-K
Q2UDU8_ASPOR/60-215-----------------------IIFNE..RHNLDDCI...............................APESEEPDL-E
Q22NR4_TETTS/187-325-----------------------LTISD..INLIQI....................................VPPKSV-K
ROD1_YEAST/232-395-----------------------RMVAK.LKLKDPLKHVAQIKKKRS.............LNEAADEGVDTDTGEFQD-K
A0CL31_PARTE/172-315-----------------------HHKGP..QKGNKI....................................QPIQKQ-D
APYA_EMENI/180-326-----------------------TIVCS.DRYTLGEE..................................YSSKALE-S
Q4PCS7_USTMA/465-633-----------------------KKIAE.EELEMGQKGSRGVV......................TARGWWTGVEAGE-R
Q296V0_DROPS/178-310-----------------------VIISN..LSIGPV....................................NGGESR-T
Q6CW08_KLULA/282-443-----------------------NVIQK..QMLARFDDLPG..........................CDPTQDNLLID-Q
A8WP33_CAEBR/159-305-----------------------FTYGR.YGKGEKHKT................................PVAPYTEG-K
A0DYQ7_PARTE/173-314-----------------------DIFDQ..ELIF......................................EAGDEK-E
A0D2Y0_PARTE/206-342-----------------------QVVFS..KILPGA....................................NQGERL-E
Q5KC81_CRYNJ/436-587-----------------------RVTGK..GWWTGV....................................EPGESG-H
A7TQI8_VANPO/357-526-----------------------NNSSK.AKYLGNLLV................................DDSTGDLV-N
Q17EA7_AEDAE/182-314-----------------------TVLEE..RITGKI....................................AKRQDA-K
Q9W2V2_DROME/420-633-----------------------NVVAD..SDNVTPPV................................DRTVAAGA-S
Q240M9_TETTS/188-318-----------------------VLNIA..EKSIEV....................................KVEQS.-K
A5DUN4_LODEL/264-404-----------------------RVIAS.KKIPKKD...................................PSELEFD-K
A0NDX6_ANOGA/173-303-----------------------NTLAK..FQCSGV....................................DAKGSA-G
Q16ZJ5_AEDAE/174-305-----------------------TIVAQ..VRCAGV....................................QRRNKG-S
Q7QCL7_ANOGA/170-301-----------------------RELAV..IARGKI....................................RAGHRD-E
A2QTZ8_ASPNC/184-328-----------------------RVIAE.DDFYPRDWNED...........................EFRITSDNEGC-W
O17983_CAEEL/173-318-----------------------QILET.KIERCNV....................................PARSSK-D
Q9V393_DROME/233-393-----------------------SVVAE..IESEDGC..................................QVAPGFT-.
A0BMC5_PARTE/210-346-----------------------VKVFQ..QNLGGV....................................NSGQKL-E
A1C8U8_ASPCL/140-283-----------------------DILTD.NYTAAGWGD...............................VIPSSDGAD-W
A0D004_PARTE/178-324-----------------------QISTT.TKKLGSY....................................KVLNQQ-E
Q16ZK1_AEDAE/136-269-----------------------QDVTG..AELDQV....................................DDPDVV-R
Q17EA8_AEDAE/183-323-----------------------ETIEM..QRTSAV....................................ARQTNA-N
Q16ZJ8_AEDAE/186-315-----------------------KTVAK...MVTTV....................................TRDKSD-Q
PALF_ASHGO/233-368-----------------------ETFRK..DICQCVAP................................LYVEPETH-T
ARRS_MOUSE/200-361-----------------------KPVAS..EETQEK....................................VQPNST-.
A8WP37_CAEBR/170-319-----------------------KVLNS.RVYPCNV....................................PPGETE-Q
Q9GYT5_CAEEL/181-328-----------------------KKVVK.VCQKLEV....................................PAKNEH-K
MU170_SCHPO/266-426-----------------------KIANK..SVYSNL....................................APTLKN-T
Q5AI11_CANAL/271-413-----------------------RVIGK.QDLDAPN...................................SDDLPYD-K
A5DW17_LODEL/261-403-----------------------RLCGK.QQLHFPD...................................TSTLPYD-K
A0D012_PARTE/172-315-----------------------SQNGL..QKGLKI....................................QPASQI-G
ADCA_DICDI/313-441-----------------------NAIYK..QQYDGF....................................QPCFYG-K
Q9I7L0_DROME/174-307-----------------------LVVNT..FKGDAV....................................QRNCKK-L
A7SF55_NEMVE/129-256-----------------------VLQRS..SMSLEL..........................................-.
Q16ZK2_AEDAE/273-408-----------------------VVVSK..NVSPGI....................................RLPDGG-V
A8XYD8_CAEBR/172-316-----------------------TVLET.KIERCQI....................................QPDEIM-P
A0E996_PARTE/174-317-----------------------GLSKQ..AHNIVV....................................KGGQKR-Q
Q0U5A6_PHANO/182-337-----------------------VAVTE.GDMPPNSANRVP.........................EGVEEADEMFDE-S
PALF_YEAST/259-394-----------------------ETFRK..DICQSISP................................IYINPETL-Q
Q23672_CAEEL/163-311-----------------------NCIGE..ATALKVN..................................VAPYSTK-S
A7TPY5_VANPO/228-381-----------------------RIVTK.MKVKDPLNYASEN.......................INPSNEEDSEFKD-R
Q759V0_ASHGO/221-368-----------------------RTVSK.IKLSDPLGHL.............................SGEPDSHAED-R
Q9VGU7_DROME/180-316-----------------------SRVAD..KHCGEV....................................LKHNKA-K
Q6FM62_CANGA/224-379-----------------------RKVTQ.MKIRNPLKELARNV......................NFQDDEDNSEFKD-S
A7SKJ5_NEMVE/177-307-----------------------NEILR..HNHPGV....................................RPHSEQ-H
Q6CGL3_YARLI/174-329-----------------------RKVVK.NTKQVDQ......................................KLAR-D
ARRD5_MOUSE/170-307-----------------------ELLRQ..MANARI....................................PAFNST-T
Q17624_CAEEL/176-340-----------------------LLVRK.LESNQET....................................PAKTKG-A
A0D9C9_PARTE/194-337-----------------------RSCGT..SMIPGL....................................QAGQSA-L
A0CE97_PARTE/209-345-----------------------QVVVS..QNWDGL....................................LAGQSK-D
Q7PYE1_ANOGA/178-310-----------------------ELVTT..ISMGPV....................................EAGNSQ-T
Q16ZJ6_AEDAE/174-302-----------------------QNAVK..IENRDH....................................QQDVEG-K
A7SL06_NEMVE/167-299-----------------------RLIDS..VKREGV.....................................ARGKE-V
O45782_CAEEL/179-307-----------------------RVISK..IDKGEV....................................PGGSTT-E
Q17HB8_AEDAE/169-300-----------------------RELAA..IVRDRI....................................KSGIRD-V
ADCB_DICDI/337-465-----------------------LKVSK..NFFPKI....................................QQNQQS-T
Q23FQ6_TETTS/188-318-----------------------VVTQF..EKSTTF....................................KINSK.-Q
Q294M3_DROPS/163-297-----------------------KTLTK.ELITDRT....................................LRLSKR-Q
A8WP43_CAEBR/183-324-----------------------TKMSE.VEKSFEV....................................NCCSEG-I
A3LXL3_PICST/266-408-----------------------QLHGK.QNMPIPD...................................QETLPDD-K
O17981_CAEEL/182-333-----------------------KPVIT.QTQPMTV....................................TPGNEH-K
Q16ZK3_AEDAE/167-301-----------------------TIVCK..NVTPGI....................................RLPEGG-V
A8X383_CAEBR/164-301-----------------------QLIEM..VPLGAV....................................RSRCRM-E
Q20232_CAEEL/173-309-----------------------CVVFE..HKSPAI....................................AANSQG-K
A0BCE6_PARTE/199-335-----------------------KTLYS..NVLPGL....................................SAGKRS-E
Q5AP77_CANAL/170-448-----------------------GNGNG..NGNKNVKQK..............................NKDQPMIAT-P
A0BDM3_PARTE/168-302-----------------------EQISK..LSLPGV....................................IQGIVQ-T
Q23674_CAEEL/182-339-----------------------RQISE.TNIDIKI....................................DKNEKQ-E
ARRD5_BOVIN/171-309-----------------------ELLRQ..EANTHI....................................TAFNTT-K
YA4C_SCHPO/180-322-----------------------RTVRS.LQTEEL......................................EEFSD-H
Q294M1_DROPS/173-305-----------------------HLIAR..KQFGNV....................................LRWSRK-V
Q4P2K3_USTMA/181-316-----------------------SSKSK..SFGKKV....................................YKGDVH-T
A7TDW3_VANPO/229-389-----------------------RLITK.LKIKDPLGHVELFSNKL................KGRNIPNSVPPMDYQD-A
Q6FY06_CANGA/237-406-----------------------RLVSK.TKIKDPFGHLAKLRKKKYTAK.......SLTDPNFNTGSDDDSDMDFQD-K
A6R1F7_AJECN/559-759-----------------------SQSTS..AFPGSVCRVTAGGGVAYDARREAAEGIEYVNPRNTNLLGDLEESFEVG-P
Q9XXC4_CAEEL/159-308-----------------------TVLRG.ANYSCDV....................................APGEVK-Y
A7TQH7_VANPO/294-447-----------------------VVALK..QSMTDFEGFI...........................KINERTGSLID-K
Q16ID9_AEDAE/216-390-----------------------CTVAE..VESEQATV...............................RIQTSKATT-N
PALF_KLULA/263-398-----------------------ETFRK..DICQGVAP................................LYTDPETH-E
Q6CG62_YARLI/321-486-----------------------GGIQD..SLLPNLDG................................VQELMAGG-A
Q4PD45_USTMA/601-804-----------------------PILPI.LSDSADALDNSPLAPMARA...........AAGEDQDSDALPSILDPTG-P
Q9XTU0_CAEEL/176-327-----------------------IKIVS.VIHEMHI....................................EPRTEH-K
YOA5_SCHPO/223-379-----------------------SKTCK.CLQKETIRCNKKS........................NCYNWNGIAALE-T
Q0CQZ7_ASPTN/118-273-----------------------LVLSE..RYDSSDDY...............................ATREGAFEI-E
E7LU16_YEASV/179-340-----------------------RQVTE.LNLEDPLNESSEEFNGN...............SCFVNNPFFQPDHSFQD-K
F1QAH2_DANRE/171-293-----------------------EILKE..KGEPLV.....................................SSTRE-N
F6SKI7_XENTR/196-355-----------------------KTVAL..EDSQDK.....................................VPSKA-S
F6Y0E4_XENTR/163-285-----------------------RTIAE..VEGAPV....................................KAWKRA-V
G4VCF9_SCHMA/96-254-----------------------CVVDE..LETDESF..................................PILPSQT-G
H2N0W5_ORYLA/194-351-----------------------KSVAK..EETDDS.....................................VPSGT-T
H3CCN8_TETNG/163-285-----------------------RTIAE..VEGAGV....................................KAGKHA-E
H3DDA7_TETNG/203-325-----------------------RNILK..VMAEAI....................................EGGKKK-A
ART5_YEAST/332-474-----------------------IAVMK.ITHLADF.....................................GPLTD-K
Q08CX7_XENTR/182-306-----------------------SVVAT..LAGDAV....................................PAGKRE-T
TXNIP_MOUSE/176-299-----------------------QKLSS..VRGNHI....................................ISGTCA-S
Q9VI00_DROME/172-303-----------------------HSLNK.SCQQERV....................................LRLSKK-K

PF07070

Q9F2L5_STRCO/29-246-----------------------V.FGRHTVGG.PF------------------------------------RLAAGE.E
B7VMX8_VIBSL/6-225-----------------------S.LAKWSLPY.AF------------------------------------VIQPGE.T
Q87KC8_VIBPA/6-225-----------------------V.LAKWNLPY.AF------------------------------------TIHPGE.E
D2SH36_GEOOG/3-219-----------------------T.FGTVAVAG.AA------------------------------------RVEPGA.R
U5VQ01_9ACTO/3-221-----------------------E.FHRVGVSG.PL------------------------------------RLAEKQ.Q
A9B5Z7_HERA2/2-212-----------------------T.IGQYPLTQ.RF------------------------------------QLQPGA.Q
Q8CK18_STRCO/3-220-----------------------E.FTKVRLGG.AF------------------------------------QLKAGV.V
A1S9J4_SHEAM/2-220-----------------------C.LARWRVAE.RF------------------------------------EIQPGE.V
F8AWR6_FRADG/3-218-----------------------S.FGTRSIGG.KF------------------------------------TIAANQ.E
D5XEE5_THEPJ/2-205-----------------------T.VGTVKVTD.KL------------------------------------TLAPGQ.E
F6CIG7_DESK7/3-205-----------------------I.IGTVTVGE.KM------------------------------------VVRPGE.E
E8U7T1_DEIML/4-204-----------------------A.VARVTLGE.RV------------------------------------TLRAGE.T
D9SYU9_MICAI/3-221-----------------------E.FGRAQVTG.AF------------------------------------RLEPGQ.R
SP0M_BACSU/4-215-----------------------T.IHSFRVTG.SF------------------------------------TIQPGE.E
D6Y483_THEBD/3-220-----------------------E.FYRYQVSG.PT------------------------------------VLRKGE.N
D7B3X5_NOCDD/3-219-----------------------E.CTRVPVAA.GV------------------------------------SLDAGE.H
A6W415_KINRD/4-218-----------------------V.FGSARVGA.GF------------------------------------TTVPGQ.R
A5D298_PELTS/2-206-----------------------E.IGTVKVSD.GM------------------------------------LVKANSPE
Q7MGK0_VIBVY/6-226-----------------------V.LASWSLPY.AF------------------------------------VIKPSE.E
I0JR17_HALH3/2-209-----------------------A.IQKYPIAH.QE------------------------------------TIKEGE.T
L0A4L1_DEIPD/4-203-----------------------E.VQRARVCG.PL------------------------------------EIAPGE.E
C1D0Z4_DEIDV/4-204-----------------------T.LQSEVVVP.AF------------------------------------TIRPGE.T
Q8YPP0_NOSS1/22-232-----------------------V.MVNYRLLE.HL------------------------------------TIQPKE.E
R4LYD7_9ACTO/3-216-----------------------E.FHRAWVAA.GF------------------------------------TLAPGE.H
C6WBH8_ACTMD/3-220-----------------------E.FAGVVVAE.KV------------------------------------VVGAGQ.Q
R4SZZ1_AMYOR/2-220-----------------------E.FLRVSAGR.KV------------------------------------RVTAGQ.L
B1HWS8_LYSSC/4-216-----------------------T.LQKVKVTE.PF------------------------------------TLAASE.E
Q3IE37_PSEHT/2-220-----------------------V.IEQWRITD.IG------------------------------------TVEPGE.V
E3E849_PAEPS/5-215-----------------------C.IARIKVSD.GF------------------------------------HLKQGQ.E
E4N440_KITSK/3-219-----------------------E.FAPLRVSG.PL------------------------------------RLAAGE.R
D3Q3X8_STANL/19-231-----------------------D.FHGADVCE.PF------------------------------------LLEAGV.E
G2NX38_STRVO/3-220-----------------------V.FDRLRLSG.GF------------------------------------RLDTRE.H
E2Q1G0_STRC2/1-210-----------------------V.FDRFTVAE.GI------------------------------------RLAAGE.Q
U5W7Z2_9ACTO/3-221-----------------------E.FHRQRLTG.SF------------------------------------KLDAHA.R
D4GQ21_HALVD/1-210-----------------------D.IAQYTLAE.SL------------------------------------TVQPDE.Q
C4L3D6_EXISA/2-216-----------------------T.IEKILLNEAPF------------------------------------MIGPGE.V
L0JQI9_NATP1/1-207-----------------------K.FEADALTN.SF------------------------------------TIDPDE.E
U5LEI3_9BACI/4-217-----------------------V.IDKYRIAE.TL------------------------------------VIQPNE.T
B7GKU0_ANOFW/25-238-----------------------V.IEKWKIAQ.SF------------------------------------VIRAGE.K
C5D3Y3_GEOSW/2-202-----------------------T.VAVIPVSP.SF------------------------------------TIQPGE.R
H2K613_STRHJ/3-217-----------------------A.FERFTVGG.GF------------------------------------RLGEQE.E
Q9KVV0_VIBCH/21-240-----------------------T.LANWSLPY.AF------------------------------------TIEAGE.T
Q2J8X7_FRASC/3-219-----------------------T.FGTQQIGG.GF------------------------------------TIHPEQ.Q
D9STE5_CLOC7/4-215-----------------------N.LLRLVVAR.DL------------------------------------VIAPNE.R
I3RA56_HALMT/1-210-----------------------D.IKKYTLAD.GL------------------------------------TIEPEQ.E
Q81QV7_BACAN/2-216-----------------------YDLERVRLTE.PF------------------------------------SVEPNE.K
X5A5U4_9BACL/4-214-----------------------E.IARILITE.GL------------------------------------LLQAGE.T
D2B8E4_STRRD/3-216-----------------------S.FLRKQITG.PF------------------------------------HLAAGA.P
F2EZY3_SOLSS/4-217-----------------------V.LHKYKLNE.PF------------------------------------TIQADE.K
Q5V309_HALMA/3-212-----------------------I.IDQWQLTE.PF------------------------------------TIEAGE.K
Q6LLI7_PHOPR/4-222-----------------------V.LATWSLPE.SF------------------------------------VIGVNE.A
E4NWJ2_HALBP/1-210-----------------------T.VGRMRLSE.SF------------------------------------DIEPGE.E
E1SSB8_FERBD/2-220-----------------------R.LHHWHLDD.RF------------------------------------TVAANE.R
D7AXU0_NOCDD/3-218-----------------------E.FHRVQIGG.GV------------------------------------TLAPGQ.R
F4FG08_VERMA/3-218-----------------------E.FHRHPISG.AF------------------------------------QLAPKQ.Q
D3EJD4_GEOS4/4-214-----------------------T.IAKVNVSS.RL------------------------------------TLKPGD.Q
I0H7C6_ACTM4/3-220-----------------------D.FHRLTVSG.PM------------------------------------RLAAGQ.Q
B1VNV5_STRGG/3-220-----------------------V.LERFTVGG.GF------------------------------------RLAEEA.E
H8MVT2_CORCM/3-213-----------------------V.VRTWRVAN.PF------------------------------------TLQPRE.E
H8GZW1_DEIGI/5-204-----------------------T.LFSQPVVP.GF------------------------------------TIRPGE.T
Q5L337_GEOKA/2-214-----------------------V.LARYKVSG.SL------------------------------------TIGPNE.T
C0ZHJ0_BREBN/2-212-----------------------T.LVKYRLSE.RV------------------------------------QLKPKE.E
H2JK05_STRHJ/3-219-----------------------V.FERFTVGG.GF------------------------------------RLGEGE.H
Q8EMA6_OCEIH/2-214-----------------------LIIDKFKIAE.SF------------------------------------TIQPGE.A
F0LQ35_VIBFN/4-223-----------------------T.LASWSLPY.AF------------------------------------TIAAGE.T
Q5L3I0_GEOKA/3-202-----------------------T.AAVIPVAS.SF------------------------------------TIQPGE.R
E1V3I8_HALED/2-217-----------------------S.WATLRLSE.AM------------------------------------TIEPGE.H
R4SRA3_AMYOR/2-220-----------------------E.FGSQQLAG.NE------------------------------------RIGPGQ.Q
G2NQ97_9ACTO/3-220-----------------------S.FGRFTVSG.GF------------------------------------VLTEGA.E
C7MVV3_SACVD/2-220-----------------------E.FFRVVAQQ.GV------------------------------------WVPAEQ.F
Q47QI1_THEFY/3-221-----------------------E.FARFPVTG.AF------------------------------------PLGPGQ.R
B1YLT3_EXIS2/2-215-----------------------T.LDRFVLNEAPF------------------------------------TIEADV.E
D2RPW6_HALTV/1-207-----------------------T.IDSFRIAD.PF------------------------------------TIEPDE.D
D1A596_THECD/3-220-----------------------E.FHRVDVSG.PF------------------------------------RLPKGQ.D
D2ASM7_STRRD/3-221-----------------------E.FFRTEVSG.PF------------------------------------KLGVGE.E
N0B2E1_9BACI/13-226-----------------------L.IDQVRIND.PF------------------------------------VIKKQE.T
H6NE63_9BACL/4-214-----------------------E.VAKIRVTE.GF------------------------------------LVQAGE.R
K0K0P9_SACES/2-220-----------------------E.FLRIPVAQ.GV------------------------------------RVAANQ.P
Q5E1Q2_VIBF1/4-222-----------------------V.LADWSLPY.AF------------------------------------TIEPKQ.E
I7BQH2_NATSJ/1-204-----------------------K.IETVRVGD.SF------------------------------------TIDPDE.E
K0JWS7_SACES/3-220-----------------------E.FARAVVAR.NV------------------------------------QVGPGQ.R
V6K362_STRNV/3-220-----------------------G.FARYEVGG.GF------------------------------------RLGEED.S
A4FGU2_SACEN/3-218-----------------------E.FHRVVVAG.RF------------------------------------ELAEGE.D
Q5YZ34_NOCFA/2-219-----------------------G.FGRVGVTG.PL------------------------------------HLPAGA.V
D9T8R1_MICAI/3-218-----------------------E.FHRVQVAG.GL------------------------------------HLREGQ.Q
C6CSI9_PAESJ/5-215-----------------------E.IGRYDVST.PF------------------------------------TLEAGE.T
D1A1F2_THECD/3-221-----------------------E.YAKVQLTG.PF------------------------------------QLRKGA.R
G0G8W7_AMYMS/2-216-----------------------P.FETRQLVG.GE------------------------------------VIRAGQ.Q
U5W8Q8_9ACTO/3-217-----------------------E.FHRVSVAG.HF------------------------------------TLPAGA.R

PF04425

A3GGA7_PICST/92-585-----------------------KKFLKMYDFNASYGYTDVPNSAGIE.....YEAFSIDASDGCVIGLPNERVLKPSTK
A5DRA9_PICGU/36-464-----------------------KQFLQMFDFTASWNHGNIDRLITESSH.PYTCPNIVDPIDNAKLAV.KDRTIHPGNV
Q6BJG5_DEBHA/93-577-----------------------KKFLKMYDLNASYGYTQIPNSAGIE.....YEAFTKDLHDGCELGLPNERVLRPHTK
A5DPQ0_PICGU/115-602-----------------------KKFLKMYDLNASYGYTHIPSSVGVE.....YKEYTRD.NEGCILGLPNERILQPHQK
Q6BSG0_DEBHA/5-422-----------------------HKFLTMLDLFASWSYANIARLSTDDGDPHDWCYGETDPYDNTVLSIDVKRFFQPNVT
Q6BVD1_DEBHA/28-455-----------------------ERFLQMFDFSASWNHAYINRLITEYAN.AYECPLITDSYDDTKMGF.SNRKLLPGVT
Q5ABB5_CANAL/19-455-----------------------DRFLNMFDFNASWNDAFLDRLVTEHND.PTHIGTIYDPIDGTYYHLDHRKILEPGIT
Q75E04_ASHGO/51-474-----------------------KRFLRMVDISASWSYSSVESANGYA.....YTQSYKD.YDNCILGLSNTRVLEPGVK
BUL1_YEAST/108-543-----------------------KRFLRMVDLSASWSYSKIALGSGVD.....FIPADVD.YDGSVFGLNNSRVLEPGVK
A5E3Q9_LODEL/66-535-----------------------KKILKMYDLCAGYSYGYVPSSAGIE.....FVPFTEDSYDGCEIGLPDDRILQPHRK
A3LX53_PICST/9-457-----------------------VRFLTMFDFNASWNDAALDRLVSDNNN.PMVPTIIIDPIDGTHVQLDPRKILEPNIT
Q6FUH4_CANGA/102-545-----------------------KRFLRMVDLSASWSYSSIEVSSGIE.....IEYGGVD.YDNSIIGLNNNRILEPGKK
Q6CSE2_KLULA/69-505-----------------------KRFLRMVDLSASWSYSNIDLATGFQ.....YVPGDID.QDGCVLGLNNDRFLQPGVR
Q6FP46_CANGA/103-568-----------------------KRFLRMVDMSASWSYSSMQVSSGIE.....YVPGDVD.FDDSILGLSNSRTFLPKTK
Q5AN22_CANAL/97-598-----------------------KKFLKMYDLNASYGYVQVPNSAGIQ.....YEPFSHDTSDGSVIGLPTDRLLQPNIK
A7TIV7_VANPO/87-537-----------------------KRFLRMVDLSASWSYTNMCLATGVN.....LVAGDVD.YDHSIIGLNNNRVLEPGKK
E7KSA7_YEASL/88-524-----------------------KRFLRMVDLSASWSYTNITPSTGIN.....IVPGERD.FDDAIIGLSNSRELKPNTK
G0VB73_NAUCC/105-559-----------------------KRFLRMVDLSASWSYTTIDLGSGIN.....VLPGQLDRYDNTIIGLENNRILEPNTK
G0VC27_NAUCC/80-515-----------------------KRFLRMVDMSASWSYTNISMGTGKK.....MPPGEID.FDKTIIGLPNSRILEPMTT
G0VC28_NAUCC/152-590-----------------------KRFLRMVDLSASWSYTNIFMGTGWK.....MTPGEID.FDNAVIGLRNSRILEPGTR

PF13002

A7TSP7_VANPO/130-321D-------------KNSLRV-----------FPP----------------------------------------------
C5GL98_AJEDR/142-318D-------------KYSMRI-----------FPP----------------------------------------------
YNSK_SCHPO/63-242D-------------TIHKRI-----------FPP----------------------------------------------
C5DVA9_ZYGRC/141-332D-------------KNSLRV-----------FPP----------------------------------------------
E7KUR3_YEASL/144-346D-------------KNSLRV-----------FPP----------------------------------------------

PF00339

O17981_CAEEL/6-159Y-------------VWPFSY-----------TLP----------------------------------------------
O17983_CAEEL/6-146Y-------------EWNFSF-----------ELP----------------------------------------------
O17984_CAEEL/4-157Y-------------EWQFWF-----------QLP----------------------------------------------
O45782_CAEEL/7-155H-------------QVPFSY-----------TLP----------------------------------------------
O76685_CAEEL/6-159Y-------------AWPFSY-----------NLP----------------------------------------------
ARRS_BOVIN/22-180N-------------TYPFLL-----------TFP----------------------------------------------
ARRB1_BOVIN/18-174H-------------AYPFTF-----------EIP----------------------------------------------
ARRB_CAEEL/22-186N-------------AFPFWF-----------EVA----------------------------------------------
P91469_CAEEL/7-159Y-------------AWPFSY-----------TLP----------------------------------------------
Q20232_CAEEL/7-150H-------------QFSFNF-----------DLP----------------------------------------------
Q20577_CAEEL/7-158H-------------VFPFAF-----------PLP----------------------------------------------
Q23672_CAEEL/8-142Y-------------IWTFEI-----------KLP----------------------------------------------
Q23674_CAEEL/4-159H-------------IFPFSF-----------QLP----------------------------------------------
Q8SYU5_DROME/5-157Y-------------TYTFAC-----------PIP----------------------------------------------
ARRD2_MOUSE/9-158H-------------EFPFSF-----------QLP----------------------------------------------
Q9I7L0_DROME/5-150H-------------TYNFVC-----------LIP----------------------------------------------
PALF_YEAST/39-201H-------------RFPFRI-----------RIP----------------------------------------------
Q9VGU7_DROME/5-155Y-------------VFPFRA-----------TIP----------------------------------------------
Q9VI00_DROME/5-148H-------------TYNFCI-----------PLP----------------------------------------------
Q9VI53_DROME/6-155H-------------TYPFTC-----------ALP----------------------------------------------
Q9XXI0_CAEEL/6-159N-------------IFPFLF-----------QLP----------------------------------------------
Q9XXI4_CAEEL/4-156N-------------VFPFAF-----------NLP----------------------------------------------
B4LEM0_DROVI/17-172H-------------AHPFTF-----------HFP----------------------------------------------
F6SKI7_XENTR/21-176N-------------AYPFLL-----------QFP----------------------------------------------
H2L9D1_ORYLA/15-171N-------------SYPFSF-----------EIP----------------------------------------------
H2N0W5_ORYLA/18-173N-------------AFPFFF-----------EFP----------------------------------------------
H2RRP6_TAKRU/18-174H-------------AHPFYF-----------TIP----------------------------------------------
Q8VD69_MOUSE/22-166H-------------EFPFRF-----------QLP----------------------------------------------

PF03643

VPS26_DICDI/8-284I.............NF...V-----------KPP.......................................ESN....
VP26A_HUMAN/8-283H.............QL...A-----------TYP.......................................DVN....
PEP8_YEAST/5-364Y.............LYNSVT-----------TAPNTLSANETKATTNDIAGGNYAADNASDNTQTKSTQGEAADVNQVLP
VP26A_ARATH/8-283R.............NY...V-----------PLP.......................................PIN....
VPS26_SCHPO/5-279Y.............RF...E-----------NEP.......................................ETN....
VPS26_DROME/6-280H.............TL...C-----------SYP.......................................EMN....
VPS26_CAEEL/7-282H.............AL...S-----------SYP.......................................DND....
DSCR3_MOUSE/1-283HSAPQKGKLTPSPVDF...T-----------ITP.......................................ETL....

PF02752

Q7PUI7_ANOGA/236-407L-------------HASYSL............LP----------------------------------------------
Q9TYQ0_CAEEL/174-315Q-------------TKEIEF...........SVP----------------------------------------------
Q7PUR5_ANOGA/187-319F-------------E..ENI...........LIG----------------------------------------------
Q7PYD9_ANOGA/175-306Y-------------E..QRL...........VVP----------------------------------------------
Q380N5_ANOGA/183-323F-------------V..ESF...........VVG----------------------------------------------
CRED_ASPOR/181-332Y-------------QFSRYL...........DLP----------------------------------------------
Q752Z4_ASHGO/228-382V-------------RLQLPF...........SVP----------------------------------------------
ARRD5_HUMAN/184-321V-------------V..STF...........NLP----------------------------------------------
ARRD4_HUMAN/191-318W-------------N.GKTL...........KIP----------------------------------------------
Q294M9_DROPS/171-302L-------------T..IGL...........PVP----------------------------------------------
Q6BI98_DEBHA/278-420W-------------DVKSTF...........KVP----------------------------------------------
Q294M7_DROPS/174-306F-------------T..FDL...........KVP----------------------------------------------
Q6BIN4_DEBHA/247-390W-------------EVDNYL...........KVP----------------------------------------------
Q293Z7_DROPS/175-308F-------------A..HEL...........LMP----------------------------------------------
Q9I7K7_DROME/179-320F-------------QHLHML...........QVP----------------------------------------------
A5DM18_PICGU/246-387W-------------DIRTQF...........HLP----------------------------------------------
Q294M5_DROPS/171-304I-------------K..GSL...........LIP----------------------------------------------
Q16ZK0_AEDAE/170-299L-------------Q..QQL...........DIP----------------------------------------------
A0BIT0_PARTE/173-314V-------------K..TIL...........SLP----------------------------------------------
Q4V467_DROME/125-256Y-------------D..FQL...........MIP----------------------------------------------
Q7SC90_NEUCR/193-351Y-------------VTNLGL...........VFP----------------------------------------------
Q66L50_DANRE/187-314W-------------DG.KML...........KIP----------------------------------------------
Q95NF3_ANOGA/193-351L-------------QKVMYL............TP----------------------------------------------
Q6C993_YARLI/185-326W-------------EVDDFF...........PIP----------------------------------------------
O44847_CAEEL/147-273F-------------T..IPF...........TIP----------------------------------------------
A0CWE9_PARTE/173-316I-------------A..TKI...........HLP----------------------------------------------
Q23QU8_TETTS/188-318I-------------NENVQL...........QVP----------------------------------------------
Q6ZM71_DANRE/162-286W-------------N..QQI...........IVP----------------------------------------------
A8WP41_CAEBR/178-317V-------------V..LSM...........KIP----------------------------------------------
Q0E8K8_DROME/169-299W-------------H..NEL...........YVP----------------------------------------------
A0C0J3_PARTE/194-337N-------------EHKKDM...........NLP----------------------------------------------
Q16ZJ7_AEDAE/171-300Y-------------S..QNL...........EIP----------------------------------------------
Q23YG0_TETTS/188-318I-------------KQEVQI...........QIP----------------------------------------------
Q9W7R1_ORYLA/193-351L-------------KKVYTL............LP----------------------------------------------
ARRB_CAEEL/205-363L-------------SKVFAV............CP----------------------------------------------
Q7RZE0_NEUCR/198-350W-------------VMNTGL...........DLP----------------------------------------------
ALY2_SCHPO/345-506A-------------VFNFNV...........ALP----------------------------------------------
Q5AM66_CANAL/305-457W-------------QIDTII...........NIP----------------------------------------------
ARRB2_MOUSE/195-350F-------------CKVYTI............TP----------------------------------------------
A2BIP7_DANRE/186-313I-------------T..TVL...........TIP----------------------------------------------
ARRD1_HUMAN/162-286W-------------H..EQI...........LVP----------------------------------------------
A2QR01_ASPNC/439-613T-------------EMEFNV...........QLP----------------------------------------------
Q380P6_ANOGA/182-314H-------------Q..QNL...........LIP----------------------------------------------
YC9F_SCHPO/183-325W-------------QDQIMV...........KIP----------------------------------------------
Q16H74_AEDAE/171-301Y-------------E..RRL...........LVP----------------------------------------------
Q6DH07_DANRE/192-355F-------------EKSLDI............TP----------------------------------------------
A8X4Z9_CAEBR/175-315E-------------Q..LMM...........KIP----------------------------------------------
ART1_SCHPO/287-428L-------------SKSLSK...........PFP----------------------------------------------
ARRD2_HUMAN/180-307W-------------QG.RAL...........RIP----------------------------------------------
Q294M6_DROPS/179-311Y-------------T..ETL...........RIP----------------------------------------------
ADCC_DICDI/344-478Q-------------M..VVI...........ELP----------------------------------------------
Q6CS19_KLULA/219-373W-------------EINTSV...........RIP----------------------------------------------
Q2UDU8_ASPOR/60-215W-------------CITKTI...........SLP----------------------------------------------
Q22NR4_TETTS/187-325E-------------NVGIHF...........KIP----------------------------------------------
ROD1_YEAST/232-395W-------------EVRALL...........NIP----------------------------------------------
A0CL31_PARTE/172-315Y-------------Q..LQLIN.......LKNPP----------------------------------------------
APYA_EMENI/180-326Y-------------QFSRTL...........QLP----------------------------------------------
Q4PCS7_USTMA/465-633V-------------ESTHYM...........QIP----------------------------------------------
Q296V0_DROPS/178-310F-------------T..QQL...........EIP----------------------------------------------
Q6CW08_KLULA/282-443I-------------KLNSVL...........QFP----------------------------------------------
A8WP33_CAEBR/159-305F-------------K..IPF...........TIP----------------------------------------------
A0DYQ7_PARTE/173-314I-------------K..TTF...........KLP----------------------------------------------
A0D2Y0_PARTE/206-342A-------------QI.AKF...........EIP----------------------------------------------
Q5KC81_CRYNJ/436-587W-------------D..MSI...........QVP----------------------------------------------
A7TQI8_VANPO/357-526K-------------EFEYQV...........FVP----------------------------------------------
Q17EA7_AEDAE/182-314L-------------E..ENI...........LIG----------------------------------------------
Q9W2V2_DROME/420-633L-------------NTTVTL............RP----------------------------------------------
Q240M9_TETTS/188-318M-------------KQEVQF...........QVP----------------------------------------------
A5DUN4_LODEL/264-404W-------------EFETFM...........RLP----------------------------------------------
A0NDX6_ANOGA/173-303Y-------------E..RRF...........LVP----------------------------------------------
Q16ZJ5_AEDAE/174-305Y-------------V..QHL...........LVP----------------------------------------------
Q7QCL7_ANOGA/170-301W-------------QN.ESL...........YVP----------------------------------------------
A2QTZ8_ASPNC/184-328H-------------SLTRFL...........RLP----------------------------------------------
O17983_CAEEL/173-318F-------------A..FSF...........DIP----------------------------------------------
Q9V393_DROME/233-393L-------------SKVFEL............CP----------------------------------------------
A0BMC5_PARTE/210-346R-------------QN.ASL...........EIP----------------------------------------------
A1C8U8_ASPCL/140-283Y-------------HIIRRL...........QLP----------------------------------------------
A0D004_PARTE/178-324V-------------VLFAQLKNHNNNDQYNMIQP----------------------------------------------
Q16ZK1_AEDAE/136-269Y-------------E..ESI...........LVP----------------------------------------------
Q17EA8_AEDAE/183-323F-------------E..KHF...........LVG----------------------------------------------
Q16ZJ8_AEDAE/186-315Y-------------T..QDL...........VIP----------------------------------------------
PALF_ASHGO/233-368C-------------SVGMNL...........NVP----------------------------------------------
ARRS_MOUSE/200-361L-------------TKTLVL............VP----------------------------------------------
A8WP37_CAEBR/170-319V-------------M..VAV...........DLP----------------------------------------------
Q9GYT5_CAEEL/181-328F-------------V..LEL...........RIP----------------------------------------------
MU170_SCHPO/266-426I-------------H..AQI...........KIP----------------------------------------------
Q5AI11_CANAL/271-413W-------------EFRTHY...........KVP----------------------------------------------
A5DW17_LODEL/261-403W-------------VIKTHF...........KVP----------------------------------------------
A0D012_PARTE/172-315C-------------S..LQLV........NTKQP----------------------------------------------
ADCA_DICDI/313-441R-------------Y..LPF...........SIP----------------------------------------------
Q9I7L0_DROME/174-307F-------------S..YEI...........RVP----------------------------------------------
A7SF55_NEMVE/129-256.-------------...DEF...........EVP----------------------------------------------
Q16ZK2_AEDAE/273-408L-------------AE.DNL...........QVP----------------------------------------------
A8XYD8_CAEBR/172-316F-------------E..FSF...........VIP----------------------------------------------
A0E996_PARTE/174-317L-------------EYKLKLEQ.......DSNDP----------------------------------------------
Q0U5A6_PHANO/182-337H-------------RFSMTL...........DLP----------------------------------------------
PALF_YEAST/259-394F-------------QSRVYL...........KVP----------------------------------------------
Q23672_CAEEL/163-311I-------------I..LPF...........TIP----------------------------------------------
A7TPY5_VANPO/228-381W-------------ELDLNL...........PIP----------------------------------------------
Q759V0_ASHGO/221-368W-------------DLSMTI...........AVP----------------------------------------------
Q9VGU7_DROME/180-316F-------------D..EFL...........TVP----------------------------------------------
Q6FM62_CANGA/224-379W-------------DLQAYL...........KIP----------------------------------------------
A7SKJ5_NEMVE/177-307L-------------PG.LLV...........QIP----------------------------------------------
Q6CGL3_YARLI/174-329F-------------KFELSM...........DYP----------------------------------------------
ARRD5_MOUSE/170-307V-------------V..SAF...........NLP----------------------------------------------
Q17624_CAEEL/176-340I-------------EQSGLFL.........LTVP----------------------------------------------
A0D9C9_PARTE/194-337N-------------EQRKNM...........TLS----------------------------------------------
A0CE97_PARTE/209-345R-------------IV.SLL...........ELP----------------------------------------------
Q7PYE1_ANOGA/178-310W-------------Q..QFL...........QIP----------------------------------------------
Q16ZJ6_AEDAE/174-302F-------------E..RNL...........LIP----------------------------------------------
A7SL06_NEMVE/167-299I-------------IDDVTI...........TIP----------------------------------------------
O45782_CAEEL/179-307W-------------QE.ESI...........TIP----------------------------------------------
Q17HB8_AEDAE/169-300L-------------QN.GHL...........TVP----------------------------------------------
ADCB_DICDI/337-465Q-------------I..VVM...........ETP----------------------------------------------
Q23FQ6_TETTS/188-318V-------------SQEIQL...........QIP----------------------------------------------
Q294M3_DROPS/163-297Y-------------E..SSI...........CVP----------------------------------------------
A8WP43_CAEBR/183-324I-------------Q..VAL...........VLP----------------------------------------------
A3LXL3_PICST/266-408W-------------TISTHY...........KVP----------------------------------------------
O17981_CAEEL/182-333F-------------V..LEF...........RLP----------------------------------------------
Q16ZK3_AEDAE/167-301L-------------AA.ENL...........QVP----------------------------------------------
A8X383_CAEBR/164-301F-------------EK.CLL...........RIP----------------------------------------------
Q20232_CAEEL/173-309Y-------------DSTLEQP.........IRLP----------------------------------------------
A0BCE6_PARTE/199-335G-------------LK.SSI...........TLP----------------------------------------------
Q5AP77_CANAL/170-448L-------------D..INV...........SLP----------------------------------------------
A0BDM3_PARTE/168-302I-------------KKSILL..............----------------------------------------------
Q23674_CAEEL/182-339V-------------E..KPI...........PLP----------------------------------------------
ARRD5_BOVIN/171-309I-------------V..STF...........HLP----------------------------------------------
YA4C_SCHPO/180-322Y-------------ELTKNL...........ELP----------------------------------------------
Q294M1_DROPS/173-305Y-------------R..GYL...........DLP----------------------------------------------
Q4P2K3_USTMA/181-316F-------------D..LVC...........QIP----------------------------------------------
A7TDW3_VANPO/229-389W-------------DITAEF...........QIP----------------------------------------------
Q6FY06_CANGA/237-406W-------------DINTTI...........EIP----------------------------------------------
A6R1F7_AJECN/559-759T-------------EMEFNV...........QLP----------------------------------------------
Q9XXC4_CAEEL/159-308I-------------N..VEI...........DLP----------------------------------------------
A7TQH7_VANPO/294-447V-------------EIDSMI...........KMP----------------------------------------------
Q16ID9_AEDAE/216-390Q-------------EPVVEL............QP----------------------------------------------
PALF_KLULA/263-398A-------------VIMLKL...........KVP----------------------------------------------
Q6CG62_YARLI/321-486T-------------ELEFDV...........VIP----------------------------------------------
Q4PD45_USTMA/601-804W-------------ELATEL...........SIP----------------------------------------------
Q9XTU0_CAEEL/176-327A-------------K..MRL...........KIP----------------------------------------------
YOA5_SCHPO/223-379Y-------------TTECHI...........QIP----------------------------------------------
Q0CQZ7_ASPTN/118-273W-------------TAEKQV...........CLP----------------------------------------------
E7LU16_YEASV/179-340W-------------EIDTIL...........QIP----------------------------------------------
F1QAH2_DANRE/171-293L-------------Y..KVL...........PLP----------------------------------------------
F6SKI7_XENTR/196-355Y-------------NHTFTL............LP----------------------------------------------
F6Y0E4_XENTR/163-285W-------------D..EQI...........LVP----------------------------------------------
G4VCF9_SCHMA/96-254W-------------CKVYKL............RP----------------------------------------------
H2N0W5_ORYLA/194-351L-------------KKEYTL............HP----------------------------------------------
H3CCN8_TETNG/163-285W-------------R..EQI...........IVP----------------------------------------------
H3DDA7_TETNG/203-325V-------------T..QLI...........NLP----------------------------------------------
ART5_YEAST/332-474L-------------DVDCPF...........TIP----------------------------------------------
Q08CX7_XENTR/182-306W-------------H.GRAL...........KIP----------------------------------------------
TXNIP_MOUSE/176-299W-------------R.GKSL...........RVQ----------------------------------------------
Q9VI00_DROME/172-303I-------------E..GTL...........AIP----------------------------------------------

PF07070

Q9F2L5_STRCO/29-246T-------------SIPFTV-----------TLP----------------------------------------------
B7VMX8_VIBSL/6-225R-------------DFECEF-----------DVP----------------------------------------------
Q87KC8_VIBPA/6-225R-------------TFDVKL-----------DVP----------------------------------------------
D2SH36_GEOOG/3-219H-------------ALPFSL-----------PVP----------------------------------------------
U5VQ01_9ACTO/3-221L-------------SLPFEF-----------VVP----------------------------------------------
A9B5Z7_HERA2/2-212Q-------------RIPFSI-----------NLP----------------------------------------------
Q8CK18_STRCO/3-220H-------------AVPFGL-----------EIP----------------------------------------------
A1S9J4_SHEAM/2-220R-------------EIPFSG-----------QLH----------------------------------------------
F8AWR6_FRADG/3-218T-------------SGRFEL-----------PVP----------------------------------------------
D5XEE5_THEPJ/2-205K-------------TIPVNF-----------EIP----------------------------------------------
F6CIG7_DESK7/3-205K-------------VYPVSF-----------QIP----------------------------------------------
E8U7T1_DEIML/4-204R-------------ELPFHL-----------TVP----------------------------------------------
D9SYU9_MICAI/3-221H-------------DVPFRF-----------QVP----------------------------------------------
SP0M_BACSU/4-215H-------------QFPFTF-----------TLP----------------------------------------------
D6Y483_THEBD/3-220R-------------VLPFQM-----------SVP----------------------------------------------
D7B3X5_NOCDD/3-219L-------------SIPFSH-----------PVP----------------------------------------------
A6W415_KINRD/4-218T-------------ELPFAL-----------ALP----------------------------------------------
A5D298_PELTS/2-206V-------------SIPVQL-----------RLP----------------------------------------------
Q7MGK0_VIBVY/6-226R-------------VFDVAL-----------DIP----------------------------------------------
I0JR17_HALH3/2-209K-------------EIPFSI-----------QLP----------------------------------------------
L0A4L1_DEIPD/4-203R-------------VLPFEF-----------VLS----------------------------------------------
C1D0Z4_DEIDV/4-204R-------------EFPFTL-----------RVG----------------------------------------------
Q8YPP0_NOSS1/22-232V-------------VIPFSL-----------NLP----------------------------------------------
R4LYD7_9ACTO/3-216Q-------------DIPFTI-----------TPP----------------------------------------------
C6WBH8_ACTMD/3-220Y-------------SLPFQF-----------QIP----------------------------------------------
R4SZZ1_AMYOR/2-220T-------------TVPFQL-----------ALP----------------------------------------------
B1HWS8_LYSSC/4-216K-------------VIPISL-----------TLP----------------------------------------------
Q3IE37_PSEHT/2-220K-------------TIPFQA-----------RLH----------------------------------------------
E3E849_PAEPS/5-215L-------------ETPFSF-----------RLP----------------------------------------------
E4N440_KITSK/3-219R-------------AVPFAL-----------PVP----------------------------------------------
D3Q3X8_STANL/19-231Y-------------AVEFDV-----------EVP----------------------------------------------
G2NX38_STRVO/3-220R-------------DVPFTL-----------HIP----------------------------------------------
E2Q1G0_STRC2/1-210R-------------AVPFGV-----------PLP----------------------------------------------
U5W7Z2_9ACTO/3-221H-------------DIPFRF-----------DVP----------------------------------------------
D4GQ21_HALVD/1-210E-------------TRDVSL-----------DIP----------------------------------------------
C4L3D6_EXISA/2-216K-------------EIPFTV-----------NVP----------------------------------------------
L0JQI9_NATP1/1-207R-------------SFTVSI-----------DIP----------------------------------------------
U5LEI3_9BACI/4-217R-------------EIPFSI-----------QIP----------------------------------------------
B7GKU0_ANOFW/25-238K-------------QITFSF-----------ALP----------------------------------------------
C5D3Y3_GEOSW/2-202K-------------VLPFSY-----------VLP----------------------------------------------
H2K613_STRHJ/3-217R-------------ELAFSV-----------PLP----------------------------------------------
Q9KVV0_VIBCH/21-240R-------------NFDIEL-----------SIP----------------------------------------------
Q2J8X7_FRASC/3-219I-------------SGRFEL-----------PVP----------------------------------------------
D9STE5_CLOC7/4-215K-------------QIPFGF-----------TVP----------------------------------------------
I3RA56_HALMT/1-210E-------------TRSVSL-----------DIP----------------------------------------------
Q81QV7_BACAN/2-216R-------------EIPFSF-----------KMP----------------------------------------------
X5A5U4_9BACL/4-214R-------------EIPFEM-----------TVP----------------------------------------------
D2B8E4_STRRD/3-216Q-------------SAPFEI-----------PVP----------------------------------------------
F2EZY3_SOLSS/4-217R-------------QIPFSF-----------SLP----------------------------------------------
Q5V309_HALMA/3-212R-------------RFETTI-----------DIP----------------------------------------------
Q6LLI7_PHOPR/4-222R-------------EFDVNL-----------ELP----------------------------------------------
E4NWJ2_HALBP/1-210T-------------TYDAEI-----------TIP----------------------------------------------
E1SSB8_FERBD/2-220R-------------SERFEL-----------TLP----------------------------------------------
D7AXU0_NOCDD/3-218F-------------EVPFEL-----------FVP----------------------------------------------
F4FG08_VERMA/3-218L-------------SIPFQL-----------VVP----------------------------------------------
D3EJD4_GEOS4/4-214Q-------------EIPFAF-----------PLP----------------------------------------------
I0H7C6_ACTM4/3-220L-------------SIPFQI-----------DMP----------------------------------------------
B1VNV5_STRGG/3-220H-------------AVPFSV-----------TLP----------------------------------------------
H8MVT2_CORCM/3-213R-------------EIPFSL-----------RIP----------------------------------------------
H8GZW1_DEIGI/5-204R-------------EFPFEL-----------PVP----------------------------------------------
Q5L337_GEOKA/2-214K-------------TIPFQF-----------ALP----------------------------------------------
C0ZHJ0_BREBN/2-212V-------------VLPFAF-----------QLP----------------------------------------------
H2JK05_STRHJ/3-219R-------------SVPFRI-----------SLP----------------------------------------------
Q8EMA6_OCEIH/2-214K-------------EIPFNF-----------DLS----------------------------------------------
F0LQ35_VIBFN/4-223R-------------DFDVEL-----------AVP----------------------------------------------
Q5L3I0_GEOKA/3-202K-------------VLPFSY-----------ALP----------------------------------------------
E1V3I8_HALED/2-217R-------------TLPFEL-----------PLP----------------------------------------------
R4SRA3_AMYOR/2-220V-------------RIPFEV-----------ALP----------------------------------------------
G2NQ97_9ACTO/3-220H-------------SIPFDV-----------ALP----------------------------------------------
C7MVV3_SACVD/2-220V-------------VVPFQI-----------MVP----------------------------------------------
Q47QI1_THEFY/3-221H-------------SIPFRY-----------PVP----------------------------------------------
B1YLT3_EXIS2/2-215R-------------EIPFTL-----------QVP----------------------------------------------
D2RPW6_HALTV/1-207R-------------SFSVSI-----------DVP----------------------------------------------
D1A596_THECD/3-220R-------------AVPFQL-----------AIP----------------------------------------------
D2ASM7_STRRD/3-221R-------------TVPFQV-----------PVP----------------------------------------------
N0B2E1_9BACI/13-226K-------------QIPFSF-----------ELP----------------------------------------------
H6NE63_9BACL/4-214R-------------EIPFSF-----------IIP----------------------------------------------
K0K0P9_SACES/2-220L-------------TVPFQL-----------PIP----------------------------------------------
Q5E1Q2_VIBF1/4-222R-------------KFELEL-----------DLP----------------------------------------------
I7BQH2_NATSJ/1-204R-------------TRTVSI-----------DVP----------------------------------------------
K0JWS7_SACES/3-220L-------------ALPFQF-----------PVP----------------------------------------------
V6K362_STRNV/3-220Y-------------RVPFEV-----------TLP----------------------------------------------
A4FGU2_SACEN/3-218R-------------VIPFEF-----------PVP----------------------------------------------
Q5YZ34_NOCFA/2-219L-------------EFRFGA-----------RAP----------------------------------------------
D9T8R1_MICAI/3-218L-------------SLPFQV-----------AMP----------------------------------------------
C6CSI9_PAESJ/5-215K-------------EVPFSF-----------RLP----------------------------------------------
D1A1F2_THECD/3-221H-------------SLPFTL-----------QIP----------------------------------------------
G0G8W7_AMYMS/2-216I-------------RVPFEV-----------PLP----------------------------------------------
U5W8Q8_9ACTO/3-217E-------------DIPFQM-----------SVP----------------------------------------------

PF04425

A3GGA7_PICST/92-585Y-------------KKFFTF-----------RFP----------------------------------------------
A5DRA9_PICGU/36-464Y-------------KRFFTF-----------KIP----------------------------------------------
Q6BJG5_DEBHA/93-577Y-------------KKFFTF-----------KFP----------------------------------------------
A5DPQ0_PICGU/115-602Y-------------KKFFTF-----------TFP----------------------------------------------
Q6BSG0_DEBHA/5-422Y-------------KRFFTF-----------KIP----------------------------------------------
Q6BVD1_DEBHA/28-455Y-------------KRFFTF-----------KIP----------------------------------------------
Q5ABB5_CANAL/19-455Y-------------KKYFTF-----------KIP----------------------------------------------
Q75E04_ASHGO/51-474Y-------------KKFFTF-----------KFP----------------------------------------------
BUL1_YEAST/108-543Y-------------KKFFIF-----------KLP----------------------------------------------
A5E3Q9_LODEL/66-535Y-------------KKFFTF-----------RFP----------------------------------------------
A3LX53_PICST/9-457Y-------------KKFFAF-----------KVP----------------------------------------------
Q6FUH4_CANGA/102-545Y-------------KKFFMF-----------KLP----------------------------------------------
Q6CSE2_KLULA/69-505Y-------------KKFFTF-----------KFP----------------------------------------------
Q6FP46_CANGA/103-568Y-------------KKYFMF-----------KIP----------------------------------------------
Q5AN22_CANAL/97-598Y-------------KKFFTF-----------KFP----------------------------------------------
A7TIV7_VANPO/87-537Y-------------KKFFTF-----------KLP----------------------------------------------
E7KSA7_YEASL/88-524Y-------------KKFFMF-----------KLP----------------------------------------------
G0VB73_NAUCC/105-559Y-------------KKFFMF-----------KLP----------------------------------------------
G0VC27_NAUCC/80-515Y-------------KKYFMF-----------KLP----------------------------------------------
G0VC28_NAUCC/152-590Y-------------KKYFMF-----------KLP----------------------------------------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------
E7KUR3_YEASL/144-346--------------------------------------------------------------------------------

PF00339

O17981_CAEEL/6-159--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
O17984_CAEEL/4-157--------------------------------------------------------------------------------
O45782_CAEEL/7-155--------------------------------------------------------------------------------
O76685_CAEEL/6-159--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------
B4LEM0_DROVI/17-172--------------------------------------------------------------------------------
F6SKI7_XENTR/21-176--------------------------------------------------------------------------------
H2L9D1_ORYLA/15-171--------------------------------------------------------------------------------
H2N0W5_ORYLA/18-173--------------------------------------------------------------------------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------------------------
Q8VD69_MOUSE/22-166--------------------------------------------------------------------------------

PF03643

VPS26_DICDI/8-284........SNIKMEVGIEDCLHIEFEYNKSKY....HLKDV.......IIGKIYFLLVR...IKIKYMEIALIKRESTGS
VP26A_HUMAN/8-283........NSIKMEVGIEDCLHIEFEYNKSKY....HLKDV.......IVGKIYFLLVR...IKIQHMELQLIKKEITGI
PEP8_YEAST/5-364ISHSNNEPKPVRLDIGIENCLHIEFEYAKSQY....SLKEV.......IVGRIYFLLTR...LRIKHMELSLITRESSGL
VP26A_ARATH/8-283........NSIKMEVGIEDCLHIEFEYNKSKY....HLKDV.......ILGKIYFLLVR...IKIKNMDLEIRRRESTGA
VPS26_SCHPO/5-279........SLIRMDVGIDECLHIEFEYSKNKY....HLKDV.......IIGKIYFILVR...IKVQRMEVSIIRRETIGT
VPS26_DROME/6-280........NPIKMEVGIEDCLHIEFEYNKSKY....HLRDT.......IIGKIYFLLVR...IKIKHMEIAIIKKESTGT
VPS26_CAEEL/7-282........KSIKMEVGIEDCLHIEFEYNKNKY....HLQDV.......IVGKIYFLLVR...IKIKYMEIAILKTEVVGS
DSCR3_MOUSE/1-283........QNVKERA............SLPKFFIRGHLNSTNCAITQPLTGE...LVVEHSDAAIRSIELQLVRVETCGC

PF02752

Q7PUI7_ANOGA/236-407-------------------------VRGTTKNWIAVEGALFSSNSA................DPSSSAYNSKLATSAPRG
Q9TYQ0_CAEEL/174-315-------------------------.......................................................
Q7PUR5_ANOGA/187-319-------------------------.......................................................
Q7PYD9_ANOGA/175-306-------------------------.......................................................
Q380N5_ANOGA/183-323-------------------------.......................................................
CRED_ASPOR/181-332-------------------------.......................................................
Q752Z4_ASHGO/228-382-------------------------.......................................................
ARRD5_HUMAN/184-321-------------------------.......................................................
ARRD4_HUMAN/191-318-------------------------.......................................................
Q294M9_DROPS/171-302-------------------------.......................................................
Q6BI98_DEBHA/278-420-------------------------S......................................................
Q294M7_DROPS/174-306-------------------------.......................................................
Q6BIN4_DEBHA/247-390-------------------------.......................................................
Q293Z7_DROPS/175-308-------------------------.......................................................
Q9I7K7_DROME/179-320-------------------------.......................................................
A5DM18_PICGU/246-387-------------------------.......................................................
Q294M5_DROPS/171-304-------------------------.......................................................
Q16ZK0_AEDAE/170-299-------------------------.......................................................
A0BIT0_PARTE/173-314-------------------------NGK...................................................P
Q4V467_DROME/125-256-------------------------.......................................................
Q7SC90_NEUCR/193-351-------------------------ARDLRDP...........................................DGIVK
Q66L50_DANRE/187-314-------------------------.......................................................
Q95NF3_ANOGA/193-351-------------------------LLSSNKQRRG.....................................IALDGQIK
Q6C993_YARLI/185-326-------------------------.......................................................
O44847_CAEEL/147-273-------------------------.......................................................
A0CWE9_PARTE/173-316-------------------------TGK...................................................P
Q23QU8_TETTS/188-318-------------------------.......................................................
Q6ZM71_DANRE/162-286-------------------------.......................................................
A8WP41_CAEBR/178-317-------------------------.......................................................
Q0E8K8_DROME/169-299-------------------------.......................................................
A0C0J3_PARTE/194-337-------------------------LVD...................................................A
Q16ZJ7_AEDAE/171-300-------------------------.......................................................
Q23YG0_TETTS/188-318-------------------------.......................................................
Q9W7R1_ORYLA/193-351-------------------------LLANNRERRG.....................................IALDGKLK
ARRB_CAEEL/205-363-------------------------LLSNNKDKRG.....................................LALDGQLK
Q7RZE0_NEUCR/198-350-------------------------.......................................................
ALY2_SCHPO/345-506-------------------------.......................................................
Q5AM66_CANAL/305-457-------------------------.......................................................
ARRB2_MOUSE/195-350-------------------------LLSDNREKRG.....................................LALDGQLK
A2BIP7_DANRE/186-313-------------------------.......................................................
ARRD1_HUMAN/162-286-------------------------.......................................................
A2QR01_ASPNC/439-613-------------------------S......................................................
Q380P6_ANOGA/182-314-------------------------.......................................................
YC9F_SCHPO/183-325-------------------------.......................................................
Q16H74_AEDAE/171-301-------------------------.......................................................
Q6DH07_DANRE/192-355-------------------------LLANNKEKRG.....................................LALDGRLK
A8X4Z9_CAEBR/175-315-------------------------.......................................................
ART1_SCHPO/287-428-------------------------DI.....................................................
ARRD2_HUMAN/180-307-------------------------.......................................................
Q294M6_DROPS/179-311-------------------------.......................................................
ADCC_DICDI/344-478-------------------------.......................................................
Q6CS19_KLULA/219-373-------------------------.......................................................
Q2UDU8_ASPOR/60-215-------------------------.......................................................
Q22NR4_TETTS/187-325-------------------------D......................................................
ROD1_YEAST/232-395-------------------------.......................................................
A0CL31_PARTE/172-315-------------------------.......................................................
APYA_EMENI/180-326-------------------------.......................................................
Q4PCS7_USTMA/465-633-------------------------.......................................................
Q296V0_DROPS/178-310-------------------------.......................................................
Q6CW08_KLULA/282-443-------------------------.......................................................
A8WP33_CAEBR/159-305-------------------------.......................................................
A0DYQ7_PARTE/173-314-------------------------QGK...................................................P
A0D2Y0_PARTE/206-342-------------------------.......................................................
Q5KC81_CRYNJ/436-587-------------------------T......................................................
A7TQI8_VANPO/357-526-------------------------.......................................................
Q17EA7_AEDAE/182-314-------------------------.......................................................
Q9W2V2_DROME/420-633-------------------------QRGPTKNWIA.....................................LEDTLQRS
Q240M9_TETTS/188-318-------------------------.......................................................
A5DUN4_LODEL/264-404-------------------------.......................................................
A0NDX6_ANOGA/173-303-------------------------.......................................................
Q16ZJ5_AEDAE/174-305-------------------------.......................................................
Q7QCL7_ANOGA/170-301-------------------------.......................................................
A2QTZ8_ASPNC/184-328-------------------------.......................................................
O17983_CAEEL/173-318-------------------------.......................................................
Q9V393_DROME/233-393-------------------------LLANNKDKWG.....................................LALDGQLK
A0BMC5_PARTE/210-346-------------------------.......................................................
A1C8U8_ASPCL/140-283-------------------------.......................................................
A0D004_PARTE/178-324-------------------------.......................................................
Q16ZK1_AEDAE/136-269-------------------------.......................................................
Q17EA8_AEDAE/183-323-------------------------.......................................................
Q16ZJ8_AEDAE/186-315-------------------------.......................................................
PALF_ASHGO/233-368-------------------------.......................................................
ARRS_MOUSE/200-361-------------------------LLANNRERRG.....................................IALDGKIK
A8WP37_CAEBR/170-319-------------------------.......................................................
Q9GYT5_CAEEL/181-328-------------------------.......................................................
MU170_SCHPO/266-426-------------------------.......................................................
Q5AI11_CANAL/271-413-------------------------.......................................................
A5DW17_LODEL/261-403-------------------------.......................................................
A0D012_PARTE/172-315-------------------------.......................................................
ADCA_DICDI/313-441-------------------------.......................................................
Q9I7L0_DROME/174-307-------------------------.......................................................
A7SF55_NEMVE/129-256-------------------------.......................................................
Q16ZK2_AEDAE/273-408-------------------------.......................................................
A8XYD8_CAEBR/172-316-------------------------.......................................................
A0E996_PARTE/174-317-------------------------.......................................................
Q0U5A6_PHANO/182-337-------------------------.......................................................
PALF_YEAST/259-394-------------------------.......................................................
Q23672_CAEEL/163-311-------------------------.......................................................
A7TPY5_VANPO/228-381-------------------------.......................................................
Q759V0_ASHGO/221-368-------------------------.......................................................
Q9VGU7_DROME/180-316-------------------------.......................................................
Q6FM62_CANGA/224-379-------------------------.......................................................
A7SKJ5_NEMVE/177-307-------------------------.......................................................
Q6CGL3_YARLI/174-329-------------------------QYEPKDK...........................................DSIVA
ARRD5_MOUSE/170-307-------------------------.......................................................
Q17624_CAEEL/176-340-------------------------PVCPSTKGDYE...................................DPSKIEHIL
A0D9C9_PARTE/194-337-------------------------LVD...................................................Q
A0CE97_PARTE/209-345-------------------------.......................................................
Q7PYE1_ANOGA/178-310-------------------------.......................................................
Q16ZJ6_AEDAE/174-302-------------------------.......................................................
A7SL06_NEMVE/167-299-------------------------.......................................................
O45782_CAEEL/179-307-------------------------.......................................................
Q17HB8_AEDAE/169-300-------------------------.......................................................
ADCB_DICDI/337-465-------------------------.......................................................
Q23FQ6_TETTS/188-318-------------------------.......................................................
Q294M3_DROPS/163-297-------------------------.......................................................
A8WP43_CAEBR/183-324-------------------------.......................................................
A3LXL3_PICST/266-408-------------------------.......................................................
O17981_CAEEL/182-333-------------------------.......................................................
Q16ZK3_AEDAE/167-301-------------------------.......................................................
A8X383_CAEBR/164-301-------------------------.......................................................
Q20232_CAEEL/173-309-------------------------.......................................................
A0BCE6_PARTE/199-335-------------------------.......................................................
Q5AP77_CANAL/170-448-------------------------FLTTMSDSLIMTSAIEEEGSDSPHTSRRGSAVSMTDNNTTPSNNNPLSPFLGAVE
A0BDM3_PARTE/168-302-------------------------FDF....................................................
Q23674_CAEEL/182-339-------------------------.......................................................
ARRD5_BOVIN/171-309-------------------------.......................................................
YA4C_SCHPO/180-322-------------------------.......................................................
Q294M1_DROPS/173-305-------------------------.......................................................
Q4P2K3_USTMA/181-316-------------------------.......................................................
A7TDW3_VANPO/229-389-------------------------.......................................................
Q6FY06_CANGA/237-406-------------------------.......................................................
A6R1F7_AJECN/559-759-------------------------T......................................................
Q9XXC4_CAEEL/159-308-------------------------.......................................................
A7TQH7_VANPO/294-447-------------------------.......................................................
Q16ID9_AEDAE/216-390-------------------------RIRSLTLMDVIRTEPQL.......................SGRDELATELPGRWS
PALF_KLULA/263-398-------------------------.......................................................
Q6CG62_YARLI/321-486-------------------------.......................................................
Q4PD45_USTMA/601-804-------------------------.......................................................
Q9XTU0_CAEEL/176-327-------------------------.......................................................
YOA5_SCHPO/223-379-------------------------.......................................................
Q0CQZ7_ASPTN/118-273-------------------------.......................................................
E7LU16_YEASV/179-340-------------------------.......................................................
F1QAH2_DANRE/171-293-------------------------.......................................................
F6SKI7_XENTR/196-355-------------------------LLAYNREKRE.....................................IALDGKLK
F6Y0E4_XENTR/163-285-------------------------.......................................................
G4VCF9_SCHMA/96-254-------------------------LLANNRHKRG.....................................LALDGKLK
H2N0W5_ORYLA/194-351-------------------------LLAYNKDRRG.....................................IALDGRLK
H3CCN8_TETNG/163-285-------------------------.......................................................
H3DDA7_TETNG/203-325-------------------------.......................................................
ART5_YEAST/332-474-------------------------.......................................................
Q08CX7_XENTR/182-306-------------------------.......................................................
TXNIP_MOUSE/176-299-------------------------.......................................................
Q9VI00_DROME/172-303-------------------------.......................................................

PF07070

Q9F2L5_STRCO/29-246------------------------------------------------------WETPATELYGRQL.GV..VLGVRTEL
B7VMX8_VIBSL/6-225------------------------------------------------------LNTPVT......IGDS..KVWLETGL
Q87KC8_VIBPA/6-225------------------------------------------------------WNTPVT......IGDA..KVWLETGL
D2SH36_GEOOG/3-219------------------------------------------------------WQCPVTAIDGWQLRGM..RVGLRTRL
U5VQ01_9ACTO/3-221------------------------------------------------------WETPITAVHGQHLRGM..TMGVRTEV
A9B5Z7_HERA2/2-212------------------------------------------------------LDTPLT......MGHQ..PVFIRTGL
Q8CK18_STRCO/3-220------------------------------------------------------WETPITMIDGQALRGM..NIGVTTEL
A1S9J4_SHEAM/2-220------------------------------------------------------PETPFTALP...VRNNQCHVWLQTGA
F8AWR6_FRADG/3-218------------------------------------------------------WQTPITDVGGWHLRGM..KIGVKTTV
D5XEE5_THEPJ/2-205------------------------------------------------------LDIPIS......KGRT..RYYLKTGL
F6CIG7_DESK7/3-205------------------------------------------------------FGLPIS......RGRT..RYFLQTGL
E8U7T1_DEIML/4-204------------------------------------------------------YHAPIS......APGV..RLWLHTDA
D9SYU9_MICAI/3-221------------------------------------------------------WETPLTDLYGQHLHGM..TMGLRTEL
SP0M_BACSU/4-215------------------------------------------------------LDTPIT......VGKV..EVAVVTDL
D6Y483_THEBD/3-220------------------------------------------------------WETPITEVDGQHLTGM..AVGVRTEL
D7B3X5_NOCDD/3-219------------------------------------------------------WQAPLTEAGGSPLPGV..LAGLRTEV
A6W415_KINRD/4-218------------------------------------------------------WQTPITAISGWHLRGV..HVGVATRL
A5D298_PELTS/2-206------------------------------------------------------YSIPIS......KGRS..KYYFITGL
Q7MGK0_VIBVY/6-226------------------------------------------------------FNTPIT......IGDA..KVWLETGL
I0JR17_HALH3/2-209------------------------------------------------------YHTPAS......LGRL..PLWFETGL
L0A4L1_DEIPD/4-203------------------------------------------------------YHTPLS......LRGT..RVGVQTGV
C1D0Z4_DEIDV/4-204------------------------------------------------------PGTPLS......LPGS..DVWVFTDA
Q8YPP0_NOSS1/22-232------------------------------------------------------DEMPLT......FGHI..PVYVRTGL
R4LYD7_9ACTO/3-216------------------------------------------------------WETPLTHAHGKHLPGM..SLGLRTEV
C6WBH8_ACTMD/3-220------------------------------------------------------LETPLTVVHGRHLHGM..TMGLRTEL
R4SZZ1_AMYOR/2-220------------------------------------------------------WETPISAVGGRELPGM..VVGVRTEL
B1HWS8_LYSSC/4-216------------------------------------------------------FETPIS......AGKT..QVWIQTGL
Q3IE37_PSEHT/2-220------------------------------------------------------SETPITEIN...AGYNQSYVWLETGL
E3E849_PAEPS/5-215------------------------------------------------------LETPVT......HAKQ..PVWLETAL
E4N440_KITSK/3-219------------------------------------------------------WEAPLTVVDGHHLSGM..ALGVRTDV
D3Q3X8_STANL/19-231------------------------------------------------------WETPISTVGGLVLPGL..ELGVATAL
G2NX38_STRVO/3-220------------------------------------------------------WETPLTELSGQPL.GV..VLGFRIEL
E2Q1G0_STRC2/1-210------------------------------------------------------WETPVTELYGQAL.GI..VLGVRTEM
U5W7Z2_9ACTO/3-221------------------------------------------------------WETPITEVYGQHLHGM..TMGLRTEL
D4GQ21_HALVD/1-210------------------------------------------------------HGTPVT......LGNV..DVWVETEL
C4L3D6_EXISA/2-216------------------------------------------------------FNTPLS......VSQS..KSWIETGL
L0JQI9_NATP1/1-207------------------------------------------------------YHTPVT......SDRT..DVWLDTGL
U5LEI3_9BACI/4-217------------------------------------------------------EDSPLT......LGRT..KVWISTGL
B7GKU0_ANOFW/25-238------------------------------------------------------LDTPIT......VGRT..RVWLHTGL
C5D3Y3_GEOSW/2-202------------------------------------------------------LHLPIT......RPSV..GYTFVTRL
H2K613_STRHJ/3-217------------------------------------------------------WETPVTELRGQPL.GI..VLGVRTEV
Q9KVV0_VIBCH/21-240------------------------------------------------------WNTPVT......IGDA..KVWLETGL
Q2J8X7_FRASC/3-219------------------------------------------------------WQTPITDIGGWHLHGM..KIGVRTKL
D9STE5_CLOC7/4-215------------------------------------------------------KHTPVS......MSRR..NVWVETEL
I3RA56_HALMT/1-210------------------------------------------------------YTTPVT......LGNV..DVWVETEL
Q81QV7_BACAN/2-216------------------------------------------------------VETPLT......LGMK..TVWIHTGL
X5A5U4_9BACL/4-214------------------------------------------------------ERAPVS......YRNT..PVWLMTGL
D2B8E4_STRRD/3-216------------------------------------------------------WETPISAIGGHPLRGM..QLGVSTEL
F2EZY3_SOLSS/4-217------------------------------------------------------PVVPVT......TGNS..RVWIQTGL
Q5V309_HALMA/3-212------------------------------------------------------RETPVT......TRST..AVEIETGL
Q6LLI7_PHOPR/4-222------------------------------------------------------FNTPVT......IGDA..KVWLETYL
E4NWJ2_HALBP/1-210------------------------------------------------------WETPLT......LGST..EVWVETEL
E1SSB8_FERBD/2-220------------------------------------------------------LETPITALR...CTRGFSEVWLETGL
D7AXU0_NOCDD/3-218------------------------------------------------------WETPVTVHRGRHLHRM..NVGVNTRL
F4FG08_VERMA/3-218------------------------------------------------------WETPITDVYGQRLRGM..TMGLRTEL
D3EJD4_GEOS4/4-214------------------------------------------------------LETPLT......ISRQ..PVWIHTGL
I0H7C6_ACTM4/3-220------------------------------------------------------WETPITTVYGQTLRGM..VMGVRTEV
B1VNV5_STRGG/3-220------------------------------------------------------WETPITELHGQHL.GP..VLGIRTEL
H8MVT2_CORCM/3-213------------------------------------------------------AHAPIT......ERGT..PVWIKTAL
H8GZW1_DEIGI/5-204------------------------------------------------------HGTPLS......LPGS..EVWLVTDA
Q5L337_GEOKA/2-214------------------------------------------------------YDVPVT......LGSS..RVWLQTGL
C0ZHJ0_BREBN/2-212------------------------------------------------------YETPLT......MGRQ..PVYLRTGL
H2JK05_STRHJ/3-219------------------------------------------------------WETPVTELHGQPL.GI..VLGVRTEL
Q8EMA6_OCEIH/2-214------------------------------------------------------PQTPLT......VRDK..NVWIDTGL
F0LQ35_VIBFN/4-223------------------------------------------------------WNTPVT......IGDA..KVWLETGL
Q5L3I0_GEOKA/3-202------------------------------------------------------LHLPIS......RPTV..RYTFVTRL
E1V3I8_HALED/2-217------------------------------------------------------LLSPLS......VGRQHPKTWVATRA
R4SRA3_AMYOR/2-220------------------------------------------------------WETPISSVFGKPLNGM..AVGLQTSL
G2NQ97_9ACTO/3-220------------------------------------------------------WETPITELYGQDL.GI..VLGVRTEL
C7MVV3_SACVD/2-220------------------------------------------------------WETPITAVGDRVLPGM..TVGVCTDL
Q47QI1_THEFY/3-221------------------------------------------------------WQAPITAAGGGPLPGA..RVGLRTDV
B1YLT3_EXIS2/2-215------------------------------------------------------FNTPLS......VSQS..KSWIETGL
D2RPW6_HALTV/1-207------------------------------------------------------YHTPVT......MGKT..EVWLDTGL
D1A596_THECD/3-220------------------------------------------------------WETPITEVYGQHLHGM..AMGVRTEL
D2ASM7_STRRD/3-221------------------------------------------------------WETPLTEVQGQPLNGM..AMGVRTEL
N0B2E1_9BACI/13-226------------------------------------------------------IDTPIS......LGKT..QIWVATGL
H6NE63_9BACL/4-214------------------------------------------------------DYAPIS......LRGA..NVWIETGL
K0K0P9_SACES/2-220------------------------------------------------------WETPITAVGGHPLPGM..TVGVRTEL
Q5E1Q2_VIBF1/4-222------------------------------------------------------LNTPIT......IGDA..KVWVQTGL
I7BQH2_NATSJ/1-204------------------------------------------------------VHTPVT......MGTT..SVWLDTGL
K0JWS7_SACES/3-220------------------------------------------------------LETPLTVVHGTPLHGM..TMGLRTEL
V6K362_STRNV/3-220------------------------------------------------------WETPVNQLHGEPL.GI..HLGVRTEV
A4FGU2_SACEN/3-218------------------------------------------------------LEAPVTEFYGRHLHGM..TLGVRTEL
Q5YZ34_NOCFA/2-219------------------------------------------------------METPITFYNGRHLPGT..TVALRTIV
D9T8R1_MICAI/3-218------------------------------------------------------WETPVTDLYGQNLHDM..TMGLRTEV
C6CSI9_PAESJ/5-215------------------------------------------------------YQTPLT......IGRA..PVWVKTEL
D1A1F2_THECD/3-221------------------------------------------------------WEAPLTHMYGQPLHGT..TVGVATEL
G0G8W7_AMYMS/2-216------------------------------------------------------WETPVTSVYAKPLAGM..AVGVRAEL
U5W8Q8_9ACTO/3-217------------------------------------------------------WETPITHLAGKPLSGM..TMGVRTEL

PF04425

A3GGA7_PICST/92-585-----------------------------------------------------NRLLDNSCI.HSILPHILPPPSMGVDS
A5DRA9_PICGU/36-464-----------------------------------------------------AQLLDSECS.HNLSGHTHIPPSLGSSR
Q6BJG5_DEBHA/93-577-----------------------------------------------------HKLLDNNCI.HDVLPHILPPPSMGLDK
A5DPQ0_PICGU/115-602-----------------------------------------------------EKLLDNNCM.HSILPHVLPPPSFGFDK
Q6BSG0_DEBHA/5-422-----------------------------------------------------EKLLDNTCEEHTFSIHTEIPPSIGISR
Q6BVD1_DEBHA/28-455-----------------------------------------------------ENLLDSECG.HSLSDHTQIPPSLGKSR
Q5ABB5_CANAL/19-455-----------------------------------------------------EKLLDSACE.HSLIKHLQIPPTFGVCK
Q75E04_ASHGO/51-474-----------------------------------------------------MQLLDVSCK.HEQFSHCLVPPSFGIDK
BUL1_YEAST/108-543-----------------------------------------------------LQLLDVTCK.QEHFSHCLLPPSFGIDK
A5E3Q9_LODEL/66-535-----------------------------------------------------QRLLDNDCP.DAIFLHLLPPPSVGVDK
A3LX53_PICST/9-457-----------------------------------------------------EKLLDVTCE.HGFVKHLQIPPTLGISK
Q6FUH4_CANGA/102-545-----------------------------------------------------TQLLDVTCK.QEHYAHCLLPPSFGIDK
Q6CSE2_KLULA/69-505-----------------------------------------------------NQLLDISCK.HEMFCHCLLPPSFGVDK
Q6FP46_CANGA/103-568-----------------------------------------------------DQLLDVTCR.QEIFPHCSLPPSLGIDK
Q5AN22_CANAL/97-598-----------------------------------------------------HRLLDNACI.NSLLPHLLPPPSMGIDR
A7TIV7_VANPO/87-537-----------------------------------------------------SQLLDITCK.QEQFAHCLLPPSLGLDK
E7KSA7_YEASL/88-524-----------------------------------------------------TQLLDVTCK.QEQFSHCLLPPSFGIDK
G0VB73_NAUCC/105-559-----------------------------------------------------NQLLDVTCK.HEQYAHCLLPPSFGIDS
G0VC27_NAUCC/80-515-----------------------------------------------------NQLLDTTCK.QEHFSHCLLPPSLGWI.
G0VC28_NAUCC/152-590-----------------------------------------------------NQLLDTTCK.QEHFSHCLLPPSFGIDK

PF13002

A7TSP7_VANPO/130-321---TEL-TATAVLPN-------------------------------------------------------VVYPKS----
C5GL98_AJEDR/142-318---TNL-VGRATLPS-------------------------------------------------------VVHPIG----
YNSK_SCHPO/63-242---TNL-VANITLPS-------------------------------------------------------TLHPHG----
C5DVA9_ZYGRC/141-332---TEL-TATAVLPN-------------------------------------------------------VVYPKS----
E7KUR3_YEASL/144-346---TEL-TAAAVLPN-------------------------------------------------------VVYPKS----

PF00339

O17981_CAEEL/6-159-..LNV-.P----PS-------------------------------------------------------FEGKYG....
O17983_CAEEL/6-146-..KDC-.P----PS-------------------------------------------------------FEGKYG....
O17984_CAEEL/4-157-..CSV-LP----PS-------------------------------------------------------FEGNNG....
O45782_CAEEL/7-155-..KSL-.P----SS-------------------------------------------------------FEGEFG....
O76685_CAEEL/6-159-..INV-.P----PS-------------------------------------------------------FEGKYG....
ARRS_BOVIN/22-180-..DYL-.P----CS-------------------------------------------------------VMLQPAPQDV
ARRB1_BOVIN/18-174-..PNL-.P----CS-------------------------------------------------------VTLQPGPEDT
ARRB_CAEEL/22-186-..PKS-.A----SS-------------------------------------------------------VTLQPAPGDT
P91469_CAEEL/7-159-..LNI-.P----PS-------------------------------------------------------FEGKYG....
Q20232_CAEEL/7-150-..QSS-LP----CS-------------------------------------------------------LESRHC....
Q20577_CAEEL/7-158-..IEC-.P----PS-------------------------------------------------------FEGFHG....
Q23672_CAEEL/8-142-..IDC-.P----PT-------------------------------------------------------HEGYAG....
Q23674_CAEEL/4-159-..HWA-.P----PS-------------------------------------------------------FEGDLG....
Q8SYU5_DROME/5-157-..SHC-.P----SS-------------------------------------------------------FEGAYG....
ARRD2_MOUSE/9-158-..ISL-.V----TS-------------------------------------------------------FEGKHG....
Q9I7L0_DROME/5-150-..TEC-.P----SS-------------------------------------------------------FEGSHG....
PALF_YEAST/39-201-RGRGM-.L----SS-------------------------------------------------------IKFERG....
Q9VGU7_DROME/5-155-..PNA-.P----TS-------------------------------------------------------FNGAHG....
Q9VI00_DROME/5-148-..LEC-.P----SS-------------------------------------------------------VVAQYG....
Q9VI53_DROME/6-155-..PNL-.P----SS-------------------------------------------------------FEGEFG....
Q9XXI0_CAEEL/6-159-..ANL-.P----PS-------------------------------------------------------FEGTHG....
Q9XXI4_CAEEL/4-156-..INC-.A----PS-------------------------------------------------------FEGCHG....
B4LEM0_DROVI/17-172-..PNS-.P----SS-------------------------------------------------------VTLQQEGDDL
F6SKI7_XENTR/21-176-..DYL-.P----CS-------------------------------------------------------VSLQPAPTDV
H2L9D1_ORYLA/15-171-..TNL-.P----CS-------------------------------------------------------VSLQPGPDDK
H2N0W5_ORYLA/18-173-..DNL-.P----CS-------------------------------------------------------VSLQPGPLDE
H2RRP6_TAKRU/18-174-..QNL-.P----CS-------------------------------------------------------VTLQPGPEDT
Q8VD69_MOUSE/22-166-..SEP-LA----TS-------------------------------------------------------FTGKYG....

PF03643

VPS26_DICDI/8-284.GPNVF-NESETLTK-------------------------------------------------------FEIMDGAPVR
VP26A_HUMAN/8-283.GPSTT-TETETIAK-------------------------------------------------------YEIMDGAPVK
PEP8_YEAST/5-364QTSNVM-TDS.TAIR-------------------------------------------------------YEIMDGSSVK
VP26A_ARATH/8-283.GANTH-VETETLAK-------------------------------------------------------FELMDGAPVR
VPS26_SCHPO/5-279.SPNQY-SNSETITR-------------------------------------------------------FQIMDGNPNR
VPS26_DROME/6-280.GPTMF-NENETIAK-------------------------------------------------------YEIMDGAPVK
VPS26_CAEEL/7-282.GPNTF-KESETVAK-------------------------------------------------------FEIMDGAPVR
DSCR3_MOUSE/1-283.AEGYA-RDATEIQN-------------------------------------------------------IQIADGDICR

PF02752

Q7PUI7_ANOGA/236-407MLSAPA-TS...AEE.......................................................KNVFAI----
Q9TYQ0_CAEEL/174-315...PNL-PP...TSI.......................................................HANRLV----
Q7PUR5_ANOGA/187-319...STV-PS...DEE........................................................RCRII----
Q7PYD9_ANOGA/175-306....TV-IP...TCG........................................................DQNLI----
Q380N5_ANOGA/183-323....PV-PS...TET.......................................................THSRIV----
CRED_ASPOR/181-332...KTL-TRCLQDT.........................................................DTKGI----
Q752Z4_ASHGO/228-382...PDL-KRITQDCD......................................................V.GASLI----
ARRD5_HUMAN/184-321....LL-LSV.SSST......................................................Q.DGEIM----
ARRD4_HUMAN/191-318....PV-TP...SIL........................................................DCCII----
Q294M9_DROPS/171-302....ST-PP...TCV.......................................................ELSNLI----
Q6BI98_DEBHA/278-420.SLKEL-TQ...TCD.......................................................LKNNII----
Q294M7_DROPS/174-306....AT-PP...TCF.......................................................NLCSII----
Q6BIN4_DEBHA/247-390...DSL-SKCTQDCD........................................................IQNFI----
Q293Z7_DROPS/175-308...EGA-QP...TDD.......................................................QLSGVI----
Q9I7K7_DROME/179-320....QT-AA...TLT......................................................VAGCACL----
A5DM18_PICGU/246-387...ESL-SKLTQSCE.......................................................PKSGAI----
Q294M5_DROPS/171-304....SV-PP...SSR........................................................TDSII----
Q16ZK0_AEDAE/170-299....SI-AP...TG.........................................................NCSVL----
A0BIT0_PARTE/173-314TKASAI-FP...QSS.......................................................LKTKRI----
Q4V467_DROME/125-256....ST-PP...SCF.......................................................HLCRII----
Q7SC90_NEUCR/193-351RGKPGF-PMYEVTSF......................................................TTSSTLY----
Q66L50_DANRE/187-314....PI-SP...SIL........................................................DCSII----
Q95NF3_ANOGA/193-351RQDQCL-AS...TTLLAQ.................................................PDQRDAFGV----
Q6C993_YARLI/185-326...PSL-SKVTQDAE........................................................VPNLI----
O44847_CAEEL/147-273...TDL-TA...SF.........................................................HTCGS----
A0CWE9_PARTE/173-316DNYTSI-FP...QST.......................................................IKTKRV----
Q23QU8_TETTS/188-318...GNV-TL...SC.........................................................QGSLI----
Q6ZM71_DANRE/162-286....AL-PH...SSL.......................................................SDGNLI----
A8WP41_CAEBR/178-317....AI-VP...SF.........................................................TCPII----
Q0E8K8_DROME/169-299....PL-PP...TNL.......................................................HGCHLI----
A0C0J3_PARTE/194-337GRHKPL-DP...TT.........................................................NGKIV----
Q16ZJ7_AEDAE/171-300....SV-AP...TG.........................................................KCSVL----
Q23YG0_TETTS/188-318...GDV-TL...SS.........................................................QGQMI----
Q9W7R1_ORYLA/193-351HEDTNL-AS...SSVVKE.................................................GVLKEVMGI----
ARRB_CAEEL/205-363HEDTNL-AS...STILDS.................................................KTSKESLGI----
Q7RZE0_NEUCR/198-350...RTL-GKCVQDV.........................................................NAHGI----
ALY2_SCHPO/345-506...TCL-VKERDRLTF.....................................................DTTYKYI----
Q5AM66_CANAL/305-457...SSL-SKCTQDVD........................................................LSTNV----
ARRB2_MOUSE/195-350HEDTNL-AS...STIVKE.................................................GANKEVLGI----
A2BIP7_DANRE/186-313....PS-LT...ASI.......................................................LNCRIL----
ARRD1_HUMAN/162-286....AL-PQ...SAL.......................................................PGCSLI----
A2QR01_ASPNC/439-613..CQEM-RNRDESQRLH...................................................FDTTYENI----
Q380P6_ANOGA/182-314....AV-PP...TYT.......................................................DGAPLF----
YC9F_SCHPO/183-325...DSL-GECTQDC.........................................................DLNCI----
Q16H74_AEDAE/171-301....PE-PP...SR.........................................................TTSII----
Q6DH07_DANRE/192-355DEDTNL-AS...TTIIRT.................................................GMDKEMLGI----
A8X4Z9_CAEBR/175-315....KL-AP...SF.........................................................QCPII----
ART1_SCHPO/287-428.DFEDA-NITGFTT.........................................................TSDLY----
ARRD2_HUMAN/180-307....PV-GP...SIL........................................................HCRVL----
Q294M6_DROPS/179-311....AT-AP...TCE.......................................................HLSKVV----
ADCC_DICDI/344-478......-.....STTQCVG..............................................LIHSIAETKMI----
Q6CS19_KLULA/219-373...PNL-SKCVQDCL........................................................ILTNI----
Q2UDU8_ASPOR/60-215...QDL-AA...CTQ......................................................DVSSKMM----
Q22NR4_TETTS/187-325.DPKLI-LP...SY.........................................................NGGAF----
ROD1_YEAST/232-395...ASL-TKCSQDCR........................................................ILSNI----
A0CL31_PARTE/172-315...QHL-TP...SI.........................................................IGNCV----
APYA_EMENI/180-326...QAL-GHCVQDT.........................................................EDMGV----
Q4PCS7_USTMA/465-633...ADA-LS...IS.........................................................RGRHV----
Q296V0_DROPS/178-310....AL-PP...TNL.......................................................SNCGII----
Q6CW08_KLULA/282-443...DDL-KRATQDCD.......................................................VGADLI----
A8WP33_CAEBR/159-305...AEA-TT...PSF........................................................ASGMM----
A0DYQ7_PARTE/173-314RNPTSI-FP...QSS.......................................................VKTKRI----
A0D2Y0_PARTE/206-342...KNL-KA...SV.........................................................KNQTI----
Q5KC81_CRYNJ/436-587.GLLSI-R...............................................................RTKLV----
A7TQI8_VANPO/357-526...NTF-AN...KQALH...................................................PDTGYEKI----
Q17EA7_AEDAE/182-314....PG-IP...SDD.......................................................SHCRVI----
Q9W2V2_DROME/420-633TEPEEI-TGAIAASAIRSPHFVMQNAQLLGGCGHPLGSPALVTPHPHLWQPGSQGQGQPGNPNSGGGNEERNVFAI----
Q240M9_TETTS/188-318...SDI-PL...SS.........................................................QGELV----
A5DUN4_LODEL/264-404...ASL-SKCCQDV.........................................................DGEHV----
A0NDX6_ANOGA/173-303....PE-PP...TR.........................................................SDTII----
Q16ZJ5_AEDAE/174-305....PL-PP...TSK........................................................TCQVL----
Q7QCL7_ANOGA/170-301....PL-PP...TNL.......................................................RGCHLI----
A2QTZ8_ASPNC/184-328</