Sequence alignment for CL0135

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF00339

B4LEM0_DROVI/17-172--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
H2N0W5_ORYLA/17-173--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
ARD17_CAEEL/7-155--------------------------------------------------------------------------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
ARRD4_MOUSE/18-166--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
O17981_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------
F6SKI7_XENTR/21-176--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
H2L9D1_ORYLA/14-171--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------
E7KUR3_YEASL/144-346--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------A-----------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------R-----------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------L-----------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------R-----------------------------------------------------------------------
Q380N5_ANOGA/183-323--------R-----------------------------------------------------------------------
CRED_ASPOR/181-332--------W-----------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------W-----------------------------------------------------------------------
ARRD5_HUMAN/184-321--------R-----------------------------------------------------------------------
ARRD4_HUMAN/191-318--------T-----------------------------------------------------------------------
Q294M9_DROPS/171-302--------K-----------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------W-----------------------------------------------------------------------
Q294M7_DROPS/174-306--------T-----------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------W-----------------------------------------------------------------------
Q293Z7_DROPS/175-308--------G-----------------------------------------------------------------------
Q9I7K7_DROME/179-320--------W-----------------------------------------------------------------------
A5DM18_PICGU/246-387--------W-----------------------------------------------------------------------
Q294M5_DROPS/171-304--------S-----------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------K-----------------------------------------------------------------------
A0BIT0_PARTE/173-314--------S-----------------------------------------------------------------------
Q4V467_DROME/125-256--------R-----------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------A-----------------------------------------------------------------------
Q66L50_DANRE/187-314--------T-----------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------S-----------------------------------------------------------------------
Q6C993_YARLI/185-326--------W-----------------------------------------------------------------------
O44847_CAEEL/147-273--------S-----------------------------------------------------------------------
A0CWE9_PARTE/173-316--------S-----------------------------------------------------------------------
Q23QU8_TETTS/188-318--------R-----------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------K-----------------------------------------------------------------------
A8WP41_CAEBR/178-317--------K-----------------------------------------------------------------------
Q0E8K8_DROME/169-299--------G-----------------------------------------------------------------------
A0C0J3_PARTE/194-337--------P-----------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------T-----------------------------------------------------------------------
Q23YG0_TETTS/188-318--------K-----------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------S-----------------------------------------------------------------------
ARRB_CAEEL/205-363--------S-----------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------W-----------------------------------------------------------------------
ALY2_SCHPO/345-506--------W-----------------------------------------------------------------------
Q5AM66_CANAL/305-457--------W-----------------------------------------------------------------------
ARRB2_MOUSE/195-350--------D-----------------------------------------------------------------------
A2BIP7_DANRE/186-313--------N-----------------------------------------------------------------------
ARRD1_HUMAN/162-286--------K-----------------------------------------------------------------------
A2QR01_ASPNC/439-613--------W-----------------------------------------------------------------------
Q380P6_ANOGA/182-314--------S-----------------------------------------------------------------------
YC9F_SCHPO/183-325--------W-----------------------------------------------------------------------
Q16H74_AEDAE/171-301--------R-----------------------------------------------------------------------
Q6DH07_DANRE/192-355--------S-----------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------K-----------------------------------------------------------------------
ART1_SCHPO/287-428--------S-----------------------------------------------------------------------
ARRD2_HUMAN/180-307--------N-----------------------------------------------------------------------
Q294M6_DROPS/179-311--------H-----------------------------------------------------------------------
ADCC_DICDI/344-478--------T-----------------------------------------------------------------------
Q6CS19_KLULA/219-373--------W-----------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------W-----------------------------------------------------------------------
Q22NR4_TETTS/187-325--------N-----------------------------------------------------------------------
ROD1_YEAST/232-395--------W-----------------------------------------------------------------------
A0CL31_PARTE/172-315--------K-----------------------------------------------------------------------
APYA_EMENI/180-326--------W-----------------------------------------------------------------------
Q296V0_DROPS/178-310--------A-----------------------------------------------------------------------
Q6CW08_KLULA/282-443--------W-----------------------------------------------------------------------
A8WP33_CAEBR/159-305--------S-----------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------S-----------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------S-----------------------------------------------------------------------
A7TQI8_VANPO/357-526--------W-----------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------L-----------------------------------------------------------------------
Q9W2V2_DROME/420-633--------H-----------------------------------------------------------------------
Q240M9_TETTS/188-318--------K-----------------------------------------------------------------------
A5DUN4_LODEL/264-404--------W-----------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------R-----------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------S-----------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------G-----------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------W-----------------------------------------------------------------------
O17983_CAEEL/173-318--------T-----------------------------------------------------------------------
Q9V393_DROME/233-393--------K-----------------------------------------------------------------------
A0BMC5_PARTE/210-346--------N-----------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------W-----------------------------------------------------------------------
A0D004_PARTE/178-324--------E-----------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------R-----------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------K-----------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------I-----------------------------------------------------------------------
PALF_ASHGO/233-368--------S-----------------------------------------------------------------------
ARRS_MOUSE/200-361--------S-----------------------------------------------------------------------
A8WP37_CAEBR/170-319--------K-----------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------Q-----------------------------------------------------------------------
MU170_SCHPO/266-426--------E-----------------------------------------------------------------------
A5DW17_LODEL/261-403--------W-----------------------------------------------------------------------
A0D012_PARTE/172-315--------K-----------------------------------------------------------------------
ADCA_DICDI/313-441--------T-----------------------------------------------------------------------
Q9I7L0_DROME/174-307--------R-----------------------------------------------------------------------
A7SF55_NEMVE/129-256--------T-----------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------P-----------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------S-----------------------------------------------------------------------
A0E996_PARTE/174-317--------N-----------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------W-----------------------------------------------------------------------
PALF_YEAST/259-394--------P-----------------------------------------------------------------------
Q23672_CAEEL/163-311--------S-----------------------------------------------------------------------
A7TPY5_VANPO/228-381--------W-----------------------------------------------------------------------
Q759V0_ASHGO/221-368--------W-----------------------------------------------------------------------
Q9VGU7_DROME/180-316--------A-----------------------------------------------------------------------
Q6FM62_CANGA/224-379--------W-----------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------V-----------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------A-----------------------------------------------------------------------
ARRD5_MOUSE/170-307--------S-----------------------------------------------------------------------
Q17624_CAEEL/176-340--------C-----------------------------------------------------------------------
A0D9C9_PARTE/194-337--------P-----------------------------------------------------------------------
A0CE97_PARTE/209-345--------N-----------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------A-----------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------K-----------------------------------------------------------------------
A7SL06_NEMVE/167-299--------A-----------------------------------------------------------------------
ARD17_CAEEL/179-307--------S-----------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------L-----------------------------------------------------------------------
ADCB_DICDI/337-465--------T-----------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------K-----------------------------------------------------------------------
Q294M3_DROPS/163-297--------V-----------------------------------------------------------------------
A8WP43_CAEBR/183-324--------G-----------------------------------------------------------------------
A3LXL3_PICST/266-408--------W-----------------------------------------------------------------------
O17981_CAEEL/182-333--------R-----------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------P-----------------------------------------------------------------------
A8X383_CAEBR/164-301--------P-----------------------------------------------------------------------
Q20232_CAEEL/173-309--------Q-----------------------------------------------------------------------
A0BCE6_PARTE/199-335--------H-----------------------------------------------------------------------
Q5AP77_CANAL/170-448--------W-----------------------------------------------------------------------
A0BDM3_PARTE/168-302--------P-----------------------------------------------------------------------
Q23674_CAEEL/182-339--------K-----------------------------------------------------------------------
ARRD5_BOVIN/171-309--------S-----------------------------------------------------------------------
YA4C_SCHPO/180-322--------W-----------------------------------------------------------------------
Q294M1_DROPS/173-305--------P-----------------------------------------------------------------------
A0A0D1DR37_USTMA/181-316--------L-----------------------------------------------------------------------
A7TDW3_VANPO/229-389--------W-----------------------------------------------------------------------
Q6FY06_CANGA/237-406--------W-----------------------------------------------------------------------
A6R1F7_AJECN/559-759--------W-----------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------K-----------------------------------------------------------------------
A7TQH7_VANPO/294-447--------W-----------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------K-----------------------------------------------------------------------
PALF_KLULA/263-398--------D-----------------------------------------------------------------------
Q6CG62_YARLI/321-486--------W-----------------------------------------------------------------------
A0A0D1E8U6_USTMA/601-804--------W-----------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------R-----------------------------------------------------------------------
YOA5_SCHPO/223-379--------R-----------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------W-----------------------------------------------------------------------
E7LU16_YEASV/179-340--------W-----------------------------------------------------------------------
F1QAH2_DANRE/171-293--------.-----------------------------------------------------------------------
F6SKI7_XENTR/196-355--------.-----------------------------------------------------------------------
F6Y0E4_XENTR/163-285--------.-----------------------------------------------------------------------
G4VCF9_SCHMA/96-254--------.-----------------------------------------------------------------------
H2N0W5_ORYLA/194-351--------.-----------------------------------------------------------------------
H3CCN8_TETNG/163-285--------.-----------------------------------------------------------------------
H3DDA7_TETNG/203-325--------.-----------------------------------------------------------------------
ART5_YEAST/332-474--------W-----------------------------------------------------------------------
Q08CX7_XENTR/182-306--------.-----------------------------------------------------------------------
TXNIP_MOUSE/176-299--------.-----------------------------------------------------------------------
Q9VI00_DROME/172-303--------.-----------------------------------------------------------------------

PF07070

E3E849_PAEPS/4-211FNKILASAG-----------------------------------------------------------------------
Q9F2L5_STRCO/29-244FKRLLGSLG-----------------------------------------------------------------------
B7VMX8_VIBTL/6-222LKKTLASFG-----------------------------------------------------------------------
Q87KC8_VIBPA/6-222LKKTLASFG-----------------------------------------------------------------------
D2SH36_GEOOG/3-216FRGMMARLG-----------------------------------------------------------------------
U5VQ01_9ACTN/3-218FKKMLGAFG-----------------------------------------------------------------------
A9B5Z7_HERA2/2-209FRKLLASVG-----------------------------------------------------------------------
Q8CK18_STRCO/3-217FKKLLASLG-----------------------------------------------------------------------
A1S9J4_SHEAM/2-218FKKILAAVG-----------------------------------------------------------------------
F8AWR6_FRADG/3-216MKRMMARLG-----------------------------------------------------------------------
D5XEE5_THEPJ/2-202LKKLLASVG-----------------------------------------------------------------------
F6CIG7_DESK7/3-202.TKLLASIG-----------------------------------------------------------------------
E8U7T1_DEIML/4-201FKRMLASVG-----------------------------------------------------------------------
D9SYU9_MICAI/3-218FKRLMQAMG-----------------------------------------------------------------------
SP0M_BACSU/4-212FKKLAASAG-----------------------------------------------------------------------
D6Y483_THEBD/3-219FKRMLGALG-----------------------------------------------------------------------
D7B3X5_NOCDD/3-216FKRLLAAFG-----------------------------------------------------------------------
A6W415_KINRD/4-215.RNLAARFG-----------------------------------------------------------------------
A5D298_PELTS/2-203LKKLLAGIG-----------------------------------------------------------------------
Q7MGK0_VIBVY/6-223LKKTLASFG-----------------------------------------------------------------------
I0JR17_HALH3/2-206FKKFLASVG-----------------------------------------------------------------------
L0A4L1_DEIPD/4-200LRRTLARVG-----------------------------------------------------------------------
C1D0Z4_DEIDV/4-201LKKMMAAVG-----------------------------------------------------------------------
Q8YPP0_NOSS1/22-229FKNLLASVG-----------------------------------------------------------------------
R4LYD7_9ACTN/3-214FDKVLRGFG-----------------------------------------------------------------------
C6WBH8_ACTMD/3-218FKRMLRAFG-----------------------------------------------------------------------
R4SZZ1_AMYOR/2-217FKRMLSAFG-----------------------------------------------------------------------
Q3IE37_PSEHT/2-218FKKILASVG-----------------------------------------------------------------------
E4N440_KITSK/3-218FKRLLGALG-----------------------------------------------------------------------
D3Q3X8_STANL/19-229.RKLTSGVG-----------------------------------------------------------------------
G2NX38_STRVO/3-217FKRVLGSLG-----------------------------------------------------------------------
E2Q1G0_STRC2/1-209.........-----------------------------------------------------------------------
U5W7Z2_9ACTN/3-218FKRMMQAMG-----------------------------------------------------------------------
D4GQ21_HALVD/1-207MKKVLARIG-----------------------------------------------------------------------
C4L3D6_EXISA/2-213FKKILSSIG-----------------------------------------------------------------------
L0JQI9_NATP1/1-204MKRVLSRLG-----------------------------------------------------------------------
U5LEI3_9BACI/4-214FNKVLASVG-----------------------------------------------------------------------
B7GKU0_ANOFW/25-235FNKVLASIG-----------------------------------------------------------------------
C5D3Y3_GEOSW/2-199LKKLLSKLG-----------------------------------------------------------------------
H2K613_STRHJ/3-217FKRLLGAIG-----------------------------------------------------------------------
Q9KVV0_VIBCH/21-237IKKTLASFG-----------------------------------------------------------------------
Q2J8X7_FRASC/3-216MKRFMSRLG-----------------------------------------------------------------------
D9STE5_CLOC7/4-212FKKVLSSVG-----------------------------------------------------------------------
Q81QV7_BACAN/2-213FQKFLASVG-----------------------------------------------------------------------
X5A5U4_9BACL/4-211FKKVLASVG-----------------------------------------------------------------------
D2B8E4_STRRD/3-215FRKLMAAFG-----------------------------------------------------------------------
F2EZY3_SOLSS/4-214FNKVLASVG-----------------------------------------------------------------------
Q5V309_HALMA/3-209MKDVLSRIG-----------------------------------------------------------------------
Q6LLI7_PHOPR/4-219FRKSFASLG-----------------------------------------------------------------------
E4NWJ2_HALBP/1-207MKKILASVG-----------------------------------------------------------------------
E1SSB8_FERBD/2-218FKKLLASVG-----------------------------------------------------------------------
D7AXU0_NOCDD/3-217LKRLLAGIG-----------------------------------------------------------------------
F4FG08_VERMA/3-218FKKMLSALG-----------------------------------------------------------------------
D3EJD4_GEOS4/4-211FNKMLASVG-----------------------------------------------------------------------
I0H7C6_ACTM4/3-218FKKLLGALG-----------------------------------------------------------------------
B1VNV5_STRGG/3-217FKKLLGALG-----------------------------------------------------------------------
H8MVT2_CORCM/3-210FMKMLARLG-----------------------------------------------------------------------
H8GZW1_DEIGI/5-201.GKMMAAVG-----------------------------------------------------------------------
Q5L337_GEOKA/2-211FKKLLSSIG-----------------------------------------------------------------------
C0ZHJ0_BREBN/2-209FKKLLASVG-----------------------------------------------------------------------
H2JK05_STRHJ/3-217FKRLLGSLG-----------------------------------------------------------------------
Q8EMA6_OCEIH/2-211FNKMLSSIG-----------------------------------------------------------------------
F0LQ35_VIBFN/4-220LKKTLASFG-----------------------------------------------------------------------
Q5L3I0_GEOKA/3-199.KKFLSKFG-----------------------------------------------------------------------
E1V3I8_HALED/2-214FDKLMAAVG-----------------------------------------------------------------------
R4SRA3_AMYOR/2-218FQKVLATFG-----------------------------------------------------------------------
G2NQ97_STREK/3-217FKKLLGSLG-----------------------------------------------------------------------
C7MVV3_SACVD/2-217FQRLLSAFG-----------------------------------------------------------------------
Q47QI1_THEFY/3-218FRRLLTAFG-----------------------------------------------------------------------
B1YLT3_EXIS2/2-212FKKILSQIG-----------------------------------------------------------------------
D2RPW6_HALTV/1-204MKRILSSLG-----------------------------------------------------------------------
D1A596_THECD/3-218FKRVLGTFG-----------------------------------------------------------------------
D2ASM7_STRRD/3-218FKRLLGAFG-----------------------------------------------------------------------
N0B2E1_9BACI/13-223FNKVLASVG-----------------------------------------------------------------------
H6NE63_9BACL/4-211FKKVLASVG-----------------------------------------------------------------------
K0K0P9_SACES/2-217FKRMLSAFG-----------------------------------------------------------------------
Q5E1Q2_VIBF1/4-219FKKTLASLG-----------------------------------------------------------------------
I7BQH2_NATSJ/1-201M...LSSLG-----------------------------------------------------------------------
K0JWS7_SACES/3-218FKRMLRAFG-----------------------------------------------------------------------
V6K362_STRNV/3-217FKRLLGSLG-----------------------------------------------------------------------
A4FGU2_SACEN/3-218FKKLLGALG-----------------------------------------------------------------------
Q5YZ34_NOCFA/2-216FKKLLAAAG-----------------------------------------------------------------------
D9T8R1_MICAI/3-218FKKMLGAFG-----------------------------------------------------------------------
C6CSI9_PAESJ/5-212FNRLLASIG-----------------------------------------------------------------------
D1A1F2_THECD/3-218FKKLLKAMG-----------------------------------------------------------------------
G0G8W7_AMYMS/2-215FQKVLATFG-----------------------------------------------------------------------
U5W8Q8_9ACTN/3-214FARVLRAFG-----------------------------------------------------------------------

PF04425

A3GGA7_PICST/92-585SSDSPIAPLSSVSSN.TQTEYFDVLPSFQMF.QSILKR.DDAQFSEDLQTLPPVYGDTTNSSPTP...............
A5DRA9_PICGU/36-464DGGEFNEDDILRSEQANQAPVWSILPSYHMY.KSLYMGMNAPTE..NIHE.PPTYEDVSHTSVSH...............
Q6BJG5_DEBHA/93-577SNSNETNLLSPASSN.TQTEYFDVLPSFQMF.QSILKR.DDSQFSENLSVNPPIYGDVTNSSPTPPSG........LSPI
A5DPQ0_PICGU/115-602TDVNVNADLTTTLSG.TRTEYFHVLPSFQMF.QSILKR.DDAQFNESLSGEPPTYEDSRSASPVLS...........PSL
Q6BSG0_DEBHA/5-422SKEKLKEKHNERILNEEDDLINNILPSYHMHQSTISKNLTPTNE..NFRVDPPMYEMTPVNSLST...............
Q6BVD1_DEBHA/28-455SQNYFSQKDIELTKTTNEAPVWNILPSYHMYTTTIYKGFNVSDE..SLTE.PPSYETSSIHSAGRL...........SSV
Q5ABB5_CANAL/19-455TPSRQASVSSRNQGDDEANELINILPSYQMYRSTITKNLTPSVE..DLRTAPPSYEVTPDLSTVQ.............LH
Q75E04_ASHGO/51-474AEEDDIDNCAGACAC.ADEEICDVLPSFQMY.NALHRHIPRGNVNADQHDLPPSYQEAYNGSVGG...............
BUL1_YEAST/108-543ANATPVETGRSLTDG.DINNVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEANNSTATG...............
A5E3Q9_LODEL/66-535NNSSATNIVATTSSN.TQTEYFDILPSFEMF.QSILKR.DDQQFQEDLTTVPPRYGDTAHSRSSR.............PT
A3LX53_PICST/9-457LKLSSLSLRRKSKSNGNDSELVNILPSYQMYRSTISKQLIPSRE..DLRTQPPSYELSPISSASS..............Y
Q6FUH4_CANGA/102-545AASVPPNKPNLLKRN.SESRVVDVLPSFEMY.NTLHRHIPQGNVDPDRHDFPPTYQEIESQSSTFG............RP
Q6CSE2_KLULA/69-505SGQSKLKNEDGSEVS.DTHHMIDVLPSFEMY.NALHRNIPRGNVNPDQHDLPPSYLEVESQRQTP...............
Q6FP46_CANGA/103-568VAKSSTELNQMNTDSKDPNMIIDVLPSFEFY.NVLHKHIPQGNVDPDIHDFPPTYQEVQTQRLPA...............
Q5AN22_CANAL/97-598TTTTPIAELSTVSSH.SQTEYFDVLPSFQMF.QSILKR.DDRQFQEDLSSLPPGYGDVTNSSPTPPPLPPPPPARSAPTL
A7TIV7_VANPO/87-537NVPFPGQFTKNSNSS.SSSILVDLLPSFEMY.NTLHRHIPQGNVDPDRHDFPPSYQEVQTQHSSILPI........HERP
E7KSA7_YEASL/88-524.......CTQSRLSH.RANMLVDVLPSFEMY.NALHRHIPQGNVDPDRHDFPPSYQEVRTQRMTI...............
G0VB73_NAUCC/105-559......RNLKNGTHGSTDNLLVDVLPSFDMY.NVLHRHIPQGNVNPDIHDFPPTYQEVQTHRDPV...............
G0VC27_NAUCC/80-515..SNDHPTNTPVEHQARDDILLDILPSFEMY.NSLHRHIPQGNVNPDLHDFPPSYQEIQEGSSSS.............GT
G0VC28_NAUCC/152-590...KDLPVGESLDDLDEDDIVFDVLPSFEMY.NALHRHIPQGNVNPDLHDFPPSYGEIQQGMATT...............

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------------------------
VP26A_HUMAN/8-283--------------------------------------------------------------------------------
PEP8_YEAST/5-364--------------------------------------------------------------------------------
VP26A_ARATH/8-283--------------------------------------------------------------------------------
VPS26_SCHPO/5-279--------------------------------------------------------------------------------
VPS26_DROME/6-280--------------------------------------------------------------------------------
VPS26_CAEEL/7-282--------------------------------------------------------------------------------
DSCR3_MOUSE/1-283--------------------------------------------------------------------------------

PF00339

B4LEM0_DROVI/17-172--------------------------------------------------------------------------------
ARRS_BOVIN/22-180--------------------------------------------------------------------------------
Q9I7L0_DROME/5-150--------------------------------------------------------------------------------
H2N0W5_ORYLA/17-173--------------------------------------------------------------------------------
Q23674_CAEEL/4-159--------------------------------------------------------------------------------
ARD17_CAEEL/7-155--------------------------------------------------------------------------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------------------------
Q9VGU7_DROME/5-155--------------------------------------------------------------------------------
Q20577_CAEEL/7-158--------------------------------------------------------------------------------
P91469_CAEEL/7-159--------------------------------------------------------------------------------
Q9VI00_DROME/5-148--------------------------------------------------------------------------------
Q20232_CAEEL/7-150--------------------------------------------------------------------------------
ARRD4_MOUSE/18-166--------------------------------------------------------------------------------
O17983_CAEEL/6-146--------------------------------------------------------------------------------
PALF_YEAST/39-201--------------------------------------------------------------------------------
ARRB1_BOVIN/18-174--------------------------------------------------------------------------------
Q8SYU5_DROME/5-157--------------------------------------------------------------------------------
O17981_CAEEL/6-159--------------------------------------------------------------------------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------------------------
F6SKI7_XENTR/21-176--------------------------------------------------------------------------------
Q9VI53_DROME/6-155--------------------------------------------------------------------------------
H2L9D1_ORYLA/14-171--------------------------------------------------------------------------------
ARRB_CAEEL/22-186--------------------------------------------------------------------------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------------------------
Q23672_CAEEL/8-142--------------------------------------------------------------------------------
ARRD2_MOUSE/9-158--------------------------------------------------------------------------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------------------------
C5GL98_AJEDR/142-318--------------------------------------------------------------------------------
YNSK_SCHPO/63-242--------------------------------------------------------------------------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------------------------
E7KUR3_YEASL/144-346--------------------------------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407--------------------------------------------------------------------------------
Q9TYQ0_CAEEL/174-315--------------------------------------------------------------------------------
Q7PUR5_ANOGA/187-319--------------------------------------------------------------------------------
Q7PYD9_ANOGA/175-306--------------------------------------------------------------------------------
Q380N5_ANOGA/183-323--------------------------------------------------------------------------------
CRED_ASPOR/181-332--------------------------------------------------------------------------------
Q752Z4_ASHGO/228-382--------------------------------------------------------------------------------
ARRD5_HUMAN/184-321--------------------------------------------------------------------------------
ARRD4_HUMAN/191-318--------------------------------------------------------------------------------
Q294M9_DROPS/171-302--------------------------------------------------------------------------------
Q6BI98_DEBHA/278-420--------------------------------------------------------------------------------
Q294M7_DROPS/174-306--------------------------------------------------------------------------------
Q6BIN4_DEBHA/247-390--------------------------------------------------------------------------------
Q293Z7_DROPS/175-308--------------------------------------------------------------------------------
Q9I7K7_DROME/179-320--------------------------------------------------------------------------------
A5DM18_PICGU/246-387--------------------------------------------------------------------------------
Q294M5_DROPS/171-304--------------------------------------------------------------------------------
Q16ZK0_AEDAE/170-299--------------------------------------------------------------------------------
A0BIT0_PARTE/173-314--------------------------------------------------------------------------------
Q4V467_DROME/125-256--------------------------------------------------------------------------------
Q7SC90_NEUCR/193-351--------------------------------------------------------------------------------
Q66L50_DANRE/187-314--------------------------------------------------------------------------------
Q95NF3_ANOGA/193-351--------------------------------------------------------------------------------
Q6C993_YARLI/185-326--------------------------------------------------------------------------------
O44847_CAEEL/147-273--------------------------------------------------------------------------------
A0CWE9_PARTE/173-316--------------------------------------------------------------------------------
Q23QU8_TETTS/188-318--------------------------------------------------------------------------------
Q6ZM71_DANRE/162-286--------------------------------------------------------------------------------
A8WP41_CAEBR/178-317--------------------------------------------------------------------------------
Q0E8K8_DROME/169-299--------------------------------------------------------------------------------
A0C0J3_PARTE/194-337--------------------------------------------------------------------------------
Q16ZJ7_AEDAE/171-300--------------------------------------------------------------------------------
Q23YG0_TETTS/188-318--------------------------------------------------------------------------------
Q9W7R1_ORYLA/193-351--------------------------------------------------------------------------------
ARRB_CAEEL/205-363--------------------------------------------------------------------------------
Q7RZE0_NEUCR/198-350--------------------------------------------------------------------------------
ALY2_SCHPO/345-506--------------------------------------------------------------------------------
Q5AM66_CANAL/305-457--------------------------------------------------------------------------------
ARRB2_MOUSE/195-350--------------------------------------------------------------------------------
A2BIP7_DANRE/186-313--------------------------------------------------------------------------------
ARRD1_HUMAN/162-286--------------------------------------------------------------------------------
A2QR01_ASPNC/439-613--------------------------------------------------------------------------------
Q380P6_ANOGA/182-314--------------------------------------------------------------------------------
YC9F_SCHPO/183-325--------------------------------------------------------------------------------
Q16H74_AEDAE/171-301--------------------------------------------------------------------------------
Q6DH07_DANRE/192-355--------------------------------------------------------------------------------
A8X4Z9_CAEBR/175-315--------------------------------------------------------------------------------
ART1_SCHPO/287-428--------------------------------------------------------------------------------
ARRD2_HUMAN/180-307--------------------------------------------------------------------------------
Q294M6_DROPS/179-311--------------------------------------------------------------------------------
ADCC_DICDI/344-478--------------------------------------------------------------------------------
Q6CS19_KLULA/219-373--------------------------------------------------------------------------------
Q2UDU8_ASPOR/60-215--------------------------------------------------------------------------------
Q22NR4_TETTS/187-325--------------------------------------------------------------------------------
ROD1_YEAST/232-395--------------------------------------------------------------------------------
A0CL31_PARTE/172-315--------------------------------------------------------------------------------
APYA_EMENI/180-326--------------------------------------------------------------------------------
Q296V0_DROPS/178-310--------------------------------------------------------------------------------
Q6CW08_KLULA/282-443--------------------------------------------------------------------------------
A8WP33_CAEBR/159-305--------------------------------------------------------------------------------
A0DYQ7_PARTE/173-314--------------------------------------------------------------------------------
A0D2Y0_PARTE/206-342--------------------------------------------------------------------------------
A7TQI8_VANPO/357-526--------------------------------------------------------------------------------
Q17EA7_AEDAE/182-314--------------------------------------------------------------------------------
Q9W2V2_DROME/420-633--------------------------------------------------------------------------------
Q240M9_TETTS/188-318--------------------------------------------------------------------------------
A5DUN4_LODEL/264-404--------------------------------------------------------------------------------
A0NDX6_ANOGA/173-303--------------------------------------------------------------------------------
Q16ZJ5_AEDAE/174-305--------------------------------------------------------------------------------
Q7QCL7_ANOGA/170-301--------------------------------------------------------------------------------
A2QTZ8_ASPNC/184-328--------------------------------------------------------------------------------
O17983_CAEEL/173-318--------------------------------------------------------------------------------
Q9V393_DROME/233-393--------------------------------------------------------------------------------
A0BMC5_PARTE/210-346--------------------------------------------------------------------------------
A1C8U8_ASPCL/140-283--------------------------------------------------------------------------------
A0D004_PARTE/178-324--------------------------------------------------------------------------------
Q16ZK1_AEDAE/136-269--------------------------------------------------------------------------------
Q17EA8_AEDAE/183-323--------------------------------------------------------------------------------
Q16ZJ8_AEDAE/186-315--------------------------------------------------------------------------------
PALF_ASHGO/233-368--------------------------------------------------------------------------------
ARRS_MOUSE/200-361--------------------------------------------------------------------------------
A8WP37_CAEBR/170-319--------------------------------------------------------------------------------
Q9GYT5_CAEEL/181-328--------------------------------------------------------------------------------
MU170_SCHPO/266-426--------------------------------------------------------------------------------
A5DW17_LODEL/261-403--------------------------------------------------------------------------------
A0D012_PARTE/172-315--------------------------------------------------------------------------------
ADCA_DICDI/313-441--------------------------------------------------------------------------------
Q9I7L0_DROME/174-307--------------------------------------------------------------------------------
A7SF55_NEMVE/129-256--------------------------------------------------------------------------------
Q16ZK2_AEDAE/273-408--------------------------------------------------------------------------------
A8XYD8_CAEBR/172-316--------------------------------------------------------------------------------
A0E996_PARTE/174-317--------------------------------------------------------------------------------
Q0U5A6_PHANO/182-337--------------------------------------------------------------------------------
PALF_YEAST/259-394--------------------------------------------------------------------------------
Q23672_CAEEL/163-311--------------------------------------------------------------------------------
A7TPY5_VANPO/228-381--------------------------------------------------------------------------------
Q759V0_ASHGO/221-368--------------------------------------------------------------------------------
Q9VGU7_DROME/180-316--------------------------------------------------------------------------------
Q6FM62_CANGA/224-379--------------------------------------------------------------------------------
A7SKJ5_NEMVE/177-307--------------------------------------------------------------------------------
Q6CGL3_YARLI/174-329--------------------------------------------------------------------------------
ARRD5_MOUSE/170-307--------------------------------------------------------------------------------
Q17624_CAEEL/176-340--------------------------------------------------------------------------------
A0D9C9_PARTE/194-337--------------------------------------------------------------------------------
A0CE97_PARTE/209-345--------------------------------------------------------------------------------
Q7PYE1_ANOGA/178-310--------------------------------------------------------------------------------
Q16ZJ6_AEDAE/174-302--------------------------------------------------------------------------------
A7SL06_NEMVE/167-299--------------------------------------------------------------------------------
ARD17_CAEEL/179-307--------------------------------------------------------------------------------
Q17HB8_AEDAE/169-300--------------------------------------------------------------------------------
ADCB_DICDI/337-465--------------------------------------------------------------------------------
Q23FQ6_TETTS/188-318--------------------------------------------------------------------------------
Q294M3_DROPS/163-297--------------------------------------------------------------------------------
A8WP43_CAEBR/183-324--------------------------------------------------------------------------------
A3LXL3_PICST/266-408--------------------------------------------------------------------------------
O17981_CAEEL/182-333--------------------------------------------------------------------------------
Q16ZK3_AEDAE/167-301--------------------------------------------------------------------------------
A8X383_CAEBR/164-301--------------------------------------------------------------------------------
Q20232_CAEEL/173-309--------------------------------------------------------------------------------
A0BCE6_PARTE/199-335--------------------------------------------------------------------------------
Q5AP77_CANAL/170-448--------------------------------------------------------------------------------
A0BDM3_PARTE/168-302--------------------------------------------------------------------------------
Q23674_CAEEL/182-339--------------------------------------------------------------------------------
ARRD5_BOVIN/171-309--------------------------------------------------------------------------------
YA4C_SCHPO/180-322--------------------------------------------------------------------------------
Q294M1_DROPS/173-305--------------------------------------------------------------------------------
A0A0D1DR37_USTMA/181-316--------------------------------------------------------------------------------
A7TDW3_VANPO/229-389--------------------------------------------------------------------------------
Q6FY06_CANGA/237-406--------------------------------------------------------------------------------
A6R1F7_AJECN/559-759--------------------------------------------------------------------------------
Q9XXC4_CAEEL/159-308--------------------------------------------------------------------------------
A7TQH7_VANPO/294-447--------------------------------------------------------------------------------
Q16ID9_AEDAE/216-390--------------------------------------------------------------------------------
PALF_KLULA/263-398--------------------------------------------------------------------------------
Q6CG62_YARLI/321-486--------------------------------------------------------------------------------
A0A0D1E8U6_USTMA/601-804--------------------------------------------------------------------------------
Q9XTU0_CAEEL/176-327--------------------------------------------------------------------------------
YOA5_SCHPO/223-379--------------------------------------------------------------------------------
Q0CQZ7_ASPTN/118-273--------------------------------------------------------------------------------
E7LU16_YEASV/179-340--------------------------------------------------------------------------------
F1QAH2_DANRE/171-293--------------------------------------------------------------------------------
F6SKI7_XENTR/196-355--------------------------------------------------------------------------------
F6Y0E4_XENTR/163-285--------------------------------------------------------------------------------
G4VCF9_SCHMA/96-254--------------------------------------------------------------------------------
H2N0W5_ORYLA/194-351--------------------------------------------------------------------------------
H3CCN8_TETNG/163-285--------------------------------------------------------------------------------
H3DDA7_TETNG/203-325--------------------------------------------------------------------------------
ART5_YEAST/332-474--------------------------------------------------------------------------------
Q08CX7_XENTR/182-306--------------------------------------------------------------------------------
TXNIP_MOUSE/176-299--------------------------------------------------------------------------------
Q9VI00_DROME/172-303--------------------------------------------------------------------------------

PF07070

E3E849_PAEPS/4-211--------------------------------------------------------------------------------
Q9F2L5_STRCO/29-244--------------------------------------------------------------------------------
B7VMX8_VIBTL/6-222--------------------------------------------------------------------------------
Q87KC8_VIBPA/6-222--------------------------------------------------------------------------------
D2SH36_GEOOG/3-216--------------------------------------------------------------------------------
U5VQ01_9ACTN/3-218--------------------------------------------------------------------------------
A9B5Z7_HERA2/2-209--------------------------------------------------------------------------------
Q8CK18_STRCO/3-217--------------------------------------------------------------------------------
A1S9J4_SHEAM/2-218--------------------------------------------------------------------------------
F8AWR6_FRADG/3-216--------------------------------------------------------------------------------
D5XEE5_THEPJ/2-202--------------------------------------------------------------------------------
F6CIG7_DESK7/3-202--------------------------------------------------------------------------------
E8U7T1_DEIML/4-201--------------------------------------------------------------------------------
D9SYU9_MICAI/3-218--------------------------------------------------------------------------------
SP0M_BACSU/4-212--------------------------------------------------------------------------------
D6Y483_THEBD/3-219--------------------------------------------------------------------------------
D7B3X5_NOCDD/3-216--------------------------------------------------------------------------------
A6W415_KINRD/4-215--------------------------------------------------------------------------------
A5D298_PELTS/2-203--------------------------------------------------------------------------------
Q7MGK0_VIBVY/6-223--------------------------------------------------------------------------------
I0JR17_HALH3/2-206--------------------------------------------------------------------------------
L0A4L1_DEIPD/4-200--------------------------------------------------------------------------------
C1D0Z4_DEIDV/4-201--------------------------------------------------------------------------------
Q8YPP0_NOSS1/22-229--------------------------------------------------------------------------------
R4LYD7_9ACTN/3-214--------------------------------------------------------------------------------
C6WBH8_ACTMD/3-218--------------------------------------------------------------------------------
R4SZZ1_AMYOR/2-217--------------------------------------------------------------------------------
Q3IE37_PSEHT/2-218--------------------------------------------------------------------------------
E4N440_KITSK/3-218--------------------------------------------------------------------------------
D3Q3X8_STANL/19-229--------------------------------------------------------------------------------
G2NX38_STRVO/3-217--------------------------------------------------------------------------------
E2Q1G0_STRC2/1-209--------------------------------------------------------------------------------
U5W7Z2_9ACTN/3-218--------------------------------------------------------------------------------
D4GQ21_HALVD/1-207--------------------------------------------------------------------------------
C4L3D6_EXISA/2-213--------------------------------------------------------------------------------
L0JQI9_NATP1/1-204--------------------------------------------------------------------------------
U5LEI3_9BACI/4-214--------------------------------------------------------------------------------
B7GKU0_ANOFW/25-235--------------------------------------------------------------------------------
C5D3Y3_GEOSW/2-199--------------------------------------------------------------------------------
H2K613_STRHJ/3-217--------------------------------------------------------------------------------
Q9KVV0_VIBCH/21-237--------------------------------------------------------------------------------
Q2J8X7_FRASC/3-216--------------------------------------------------------------------------------
D9STE5_CLOC7/4-212--------------------------------------------------------------------------------
Q81QV7_BACAN/2-213--------------------------------------------------------------------------------
X5A5U4_9BACL/4-211--------------------------------------------------------------------------------
D2B8E4_STRRD/3-215--------------------------------------------------------------------------------
F2EZY3_SOLSS/4-214--------------------------------------------------------------------------------
Q5V309_HALMA/3-209--------------------------------------------------------------------------------
Q6LLI7_PHOPR/4-219--------------------------------------------------------------------------------
E4NWJ2_HALBP/1-207--------------------------------------------------------------------------------
E1SSB8_FERBD/2-218--------------------------------------------------------------------------------
D7AXU0_NOCDD/3-217--------------------------------------------------------------------------------
F4FG08_VERMA/3-218--------------------------------------------------------------------------------
D3EJD4_GEOS4/4-211--------------------------------------------------------------------------------
I0H7C6_ACTM4/3-218--------------------------------------------------------------------------------
B1VNV5_STRGG/3-217--------------------------------------------------------------------------------
H8MVT2_CORCM/3-210--------------------------------------------------------------------------------
H8GZW1_DEIGI/5-201--------------------------------------------------------------------------------
Q5L337_GEOKA/2-211--------------------------------------------------------------------------------
C0ZHJ0_BREBN/2-209--------------------------------------------------------------------------------
H2JK05_STRHJ/3-217--------------------------------------------------------------------------------
Q8EMA6_OCEIH/2-211--------------------------------------------------------------------------------
F0LQ35_VIBFN/4-220--------------------------------------------------------------------------------
Q5L3I0_GEOKA/3-199--------------------------------------------------------------------------------
E1V3I8_HALED/2-214--------------------------------------------------------------------------------
R4SRA3_AMYOR/2-218--------------------------------------------------------------------------------
G2NQ97_STREK/3-217--------------------------------------------------------------------------------
C7MVV3_SACVD/2-217--------------------------------------------------------------------------------
Q47QI1_THEFY/3-218--------------------------------------------------------------------------------
B1YLT3_EXIS2/2-212--------------------------------------------------------------------------------
D2RPW6_HALTV/1-204--------------------------------------------------------------------------------
D1A596_THECD/3-218--------------------------------------------------------------------------------
D2ASM7_STRRD/3-218--------------------------------------------------------------------------------
N0B2E1_9BACI/13-223--------------------------------------------------------------------------------
H6NE63_9BACL/4-211--------------------------------------------------------------------------------
K0K0P9_SACES/2-217--------------------------------------------------------------------------------
Q5E1Q2_VIBF1/4-219--------------------------------------------------------------------------------
I7BQH2_NATSJ/1-201--------------------------------------------------------------------------------
K0JWS7_SACES/3-218--------------------------------------------------------------------------------
V6K362_STRNV/3-217--------------------------------------------------------------------------------
A4FGU2_SACEN/3-218--------------------------------------------------------------------------------
Q5YZ34_NOCFA/2-216--------------------------------------------------------------------------------
D9T8R1_MICAI/3-218--------------------------------------------------------------------------------
C6CSI9_PAESJ/5-212--------------------------------------------------------------------------------
D1A1F2_THECD/3-218--------------------------------------------------------------------------------
G0G8W7_AMYMS/2-215--------------------------------------------------------------------------------
U5W8Q8_9ACTN/3-214--------------------------------------------------------------------------------

PF04425

A3GGA7_PICST/92-585PGGLSPTTSATQGNSIDTIINDVSSRLE.................................EYQLEREHEERGDYLFEDD
A5DRA9_PICGU/36-464TSVTTSSITASSLSLHNSDTTAPSSNDP....................................................
Q6BJG5_DEBHA/93-577SSNRDNNLDSMMENVSERINEYALDNNDEEENYFF.............GGDENDTNQA...NEHLINEE...........
A5DPQ0_PICGU/115-602SPQTSATSQSGHENHIDGLLSSTADRLN............................EY...QMNDSAYQEQNFYFDDSND
Q6BSG0_DEBHA/5-422TPSVALSAIQSPTSNSSVDEFPFPNQEI.................................HSGLEGGP...........
Q6BVD1_DEBHA/28-455STARSNSVVAQASSVASTRETEDSNDNS.................................QRLIIADE...........
Q5ABB5_CANAL/19-455DYFASVPTSPTLDPMLSEPLDAESAAVQ....................................................
Q75E04_ASHGO/51-474ISVSSSRVNLTTIQSLDGVQSDSC....INL......................QALSA..QQYSLQTPS...........
BUL1_YEAST/108-543AAGSSADLSHQSLSTDALGATRSSSTSNLEN.....................LIPLRT..EHHSIAAHQSTAV.......
A5E3Q9_LODEL/66-535SPRLHAQLS......IDQNLLQVSRRLEDTLQM..................ERDRQQEQMHEHAMVFVDETGLMPV....
A3LX53_PICST/9-457NEYGGFDGIPSTYSLPTSPVRELFANPL....................................................
Q6FUH4_CANGA/102-545NPAVNGDSSQVSYDIDRNQTLLADNDPIDSRAL.................NNLQPLRT..EHHNINSTLSGVH.......
Q6CSE2_KLULA/69-505DSSDGTTVSQLDEMFLSPSPSLYDANTRVGSSQS...............LQSLNTVSSGVLQNSLQALS...........
Q6FP46_CANGA/103-568LQGSSSSQSGSELNVESPLRMNGSQTSIHGNFRNSSSNTLLPTTSGIFGGSSLQPYST..RHYSLNPNQNNPLHPT....
Q5AN22_CANAL/97-598SPSSSR..........DHTIDEAIQRLNEYGLAQERD..........EMNNDEYLFEE...HNNDPHNNTNNTLSP....
A7TIV7_VANPO/87-537DLMSINPFSHSSSDLTVSNTNSIQGSSSSTNLHAHNS..........LIENSLHPLST..QHLNLQSTTSA.........
E7KSA7_YEASL/88-524LPSNDNSVERSQLTAVPGSENACNNATAHSLTNLHPL..........QTQHLTINST...........RSGGQSL.....
G0VB73_NAUCC/105-559LSHDIADVGAATTATTTPNTTSLDHRVEILQDSTQAAPTL...SSTMVNLNNLHPLNT..RHYNISNGADLNSSQS....
G0VC27_NAUCC/80-515TIRIQNDVDYMQSPESPTSMLEGQTDGEQDIYVTPS...........YALRTLHALET..QHQNLNWER...........
G0VC28_NAUCC/152-590.AYIENNVDLTTYPLQQPPLAHHSNSGHDIHITPSY............ALNALHPLNT..QHLTIQPTNDP.........

PF03643

VPS26_DICDI/8-284--------------------------------------------------------------FGTPCNVEFELDNCQNRK
VP26A_HUMAN/8-283--------------------------------------------------------------FGPICEIDIVLNDGETRK
PEP8_YEAST/5-364--------------------------------------------------------------FKPPIDIEILFDNEESRK
VP26A_ARATH/8-283--------------------------------------------------------------FKPACNISITFTDGKNRK
VPS26_SCHPO/5-279--------------------------------------------------------------FKSPIDVDLHLDNEEERT
VPS26_DROME/6-280--------------------------------------------------------------FGQSADIEIVF.DGAEHK
VPS26_CAEEL/7-282--------------------------------------------------------------FGQSAEIQIRLSNEDTRK
DSCR3_MOUSE/1-283--------------------------------------------------------------MGTTLDIKIKR.......

PF00339

B4LEM0_DROVI/17-172--------------------------------------------------------------VTFYLG------------
ARRS_BOVIN/22-180--------------------------------------------------------------VTIYLG------------
Q9I7L0_DROME/5-150--------------------------------------------------------------CEIDFD------------
H2N0W5_ORYLA/17-173--------------------------------------------------------------VAVYLA------------
Q23674_CAEEL/4-159--------------------------------------------------------------CLVEFA------------
ARD17_CAEEL/7-155--------------------------------------------------------------FEILFN------------
H2RRP6_TAKRU/18-174--------------------------------------------------------------VTVYLG------------
Q9VGU7_DROME/5-155--------------------------------------------------------------VNFVFD------------
Q20577_CAEEL/7-158--------------------------------------------------------------FGIVFD------------
P91469_CAEEL/7-159--------------------------------------------------------------LQVIFD------------
Q9VI00_DROME/5-148--------------------------------------------------------------CSFELD------------
Q20232_CAEEL/7-150--------------------------------------------------------------FDIRLN------------
ARRD4_MOUSE/18-166--------------------------------------------------------------GLVFED------------
O17983_CAEEL/6-146--------------------------------------------------------------CDPQIS------------
PALF_YEAST/39-201--------------------------------------------------------------FRIDID------------
ARRB1_BOVIN/18-174--------------------------------------------------------------LTVYLG------------
Q8SYU5_DROME/5-157--------------------------------------------------------------CMITFD------------
O17981_CAEEL/6-159--------------------------------------------------------------LHVIFD------------
Q9XXI4_CAEEL/4-156--------------------------------------------------------------LRIEYD------------
F6SKI7_XENTR/21-176--------------------------------------------------------------VSVYLG------------
Q9VI53_DROME/6-155--------------------------------------------------------------CELQLD------------
H2L9D1_ORYLA/14-171--------------------------------------------------------------LTLYLG------------
ARRB_CAEEL/22-186--------------------------------------------------------------ITTYLG------------
Q9XXI0_CAEEL/6-159--------------------------------------------------------------FLIEFD------------
Q23672_CAEEL/8-142--------------------------------------------------------------VDISFD------------
ARRD2_MOUSE/9-158--------------------------------------------------------------FVVEID------------

PF13002

A7TSP7_VANPO/130-321--------------------------------------------------------------VTLKLI------------
C5GL98_AJEDR/142-318--------------------------------------------------------------LRMCLT------------
YNSK_SCHPO/63-242--------------------------------------------------------------LKLQLI------------
C5DVA9_ZYGRC/141-332--------------------------------------------------------------VMLTLV------------
E7KUR3_YEASL/144-346--------------------------------------------------------------VTLSLV------------

PF02752

Q7PUI7_ANOGA/236-407-----------------------------------------------------------DGRVNLKAS------------
Q9TYQ0_CAEEL/174-315-----------------------------------------------------------KGALIATMQ------------
Q7PUR5_ANOGA/187-319-----------------------------------------------------------TDPLIVTAT------------
Q7PYD9_ANOGA/175-306-----------------------------------------------------------TKPLFVKVT------------
Q380N5_ANOGA/183-323-----------------------------------------------------------SRPLMVSAT------------
CRED_ASPOR/181-332-----------------------------------------------------------PNKIEYSIS------------
Q752Z4_ASHGO/228-382-----------------------------------------------------------AGRLQYELV------------
ARRD5_HUMAN/184-321-----------------------------------------------------------QGTVCLQIQ------------
ARRD4_HUMAN/191-318-----------------------------------------------------------SGPVSLSAK------------
Q294M9_DROPS/171-302-----------------------------------------------------------TDPLKLELN------------
Q6BI98_DEBHA/278-420-----------------------------------------------------------PNKAQYSVG------------
Q294M7_DROPS/174-306-----------------------------------------------------------SKPLSLRLS------------
Q6BIN4_DEBHA/247-390-----------------------------------------------------------PKKVEYSLN------------
Q293Z7_DROPS/175-308-----------------------------------------------------------TRPITMVAL------------
Q9I7K7_DROME/179-320-----------------------------------------------------------MKPLHLQLQ------------
A5DM18_PICGU/246-387-----------------------------------------------------------PGKVEYRVE------------
Q294M5_DROPS/171-304-----------------------------------------------------------SGPVLSTLI------------
Q16ZK0_AEDAE/170-299-----------------------------------------------------------SRPLLITVE------------
A0BIT0_PARTE/173-314-----------------------------------------------------------TGSTKVKVQ------------
Q4V467_DROME/125-256-----------------------------------------------------------SDPLTLELN------------
Q7SC90_NEUCR/193-351-----------------------------------------------------------DSIVTLGIS------------
Q66L50_DANRE/187-314-----------------------------------------------------------SGPVSLSAK------------
Q95NF3_ANOGA/193-351-----------------------------------------------------------PGELELEVT------------
Q6C993_YARLI/185-326-----------------------------------------------------------PNKVDYEFS------------
O44847_CAEEL/147-273-----------------------------------------------------------NGQPTFKVT------------
A0CWE9_PARTE/173-316-----------------------------------------------------------TGNTKVKIQ------------
Q23QU8_TETTS/188-318-----------------------------------------------------------SGQIKYNIQ------------
Q6ZM71_DANRE/162-286-----------------------------------------------------------NGTVVLNAK------------
A8WP41_CAEBR/178-317-----------------------------------------------------------KGLVSMTVS------------
Q0E8K8_DROME/169-299-----------------------------------------------------------GGQIKCRVS------------
A0C0J3_PARTE/194-337-----------------------------------------------------------LGTISFKFQ------------
Q16ZJ7_AEDAE/171-300-----------------------------------------------------------SNPLYIEVE------------
Q23YG0_TETTS/188-318-----------------------------------------------------------SGQIKYNIT------------
Q9W7R1_ORYLA/193-351-----------------------------------------------------------DKPLHVQAT------------
ARRB_CAEEL/205-363-----------------------------------------------------------SGLLHMEVS------------
Q7RZE0_NEUCR/198-350-----------------------------------------------------------PNKIEYSIM------------
ALY2_SCHPO/345-506-----------------------------------------------------------DERLHYELQ------------
Q5AM66_CANAL/305-457-----------------------------------------------------------PNKVEYSLS------------
ARRB2_MOUSE/195-350-----------------------------------------------------------RRSLHLEAS------------
A2BIP7_DANRE/186-313-----------------------------------------------------------SGNVSMNIS------------
ARRD1_HUMAN/162-286-----------------------------------------------------------TGSVVLTAS------------
A2QR01_ASPNC/439-613-----------------------------------------------------------EDQLHYDIV------------
Q380P6_ANOGA/182-314-----------------------------------------------------------SEPLYISAQ------------
YC9F_SCHPO/183-325-----------------------------------------------------------PLKVNYETS------------
Q16H74_AEDAE/171-301-----------------------------------------------------------SAPMIMTVC------------
Q6DH07_DANRE/192-355-----------------------------------------------------------DKPVLLEAS------------
A8X4Z9_CAEBR/175-315-----------------------------------------------------------KGIVTMTVT------------
ART1_SCHPO/287-428-----------------------------------------------------------DGRVVVEVS------------
ARRD2_HUMAN/180-307-----------------------------------------------------------RGLVSLSAK------------
Q294M6_DROPS/179-311-----------------------------------------------------------THPVELKVT------------
ADCC_DICDI/344-478-----------------------------------------------------------GGNISISCK------------
Q6CS19_KLULA/219-373-----------------------------------------------------------PQKVDYSIS------------
Q2UDU8_ASPOR/60-215-----------------------------------------------------------DNVAQYSIS------------
Q22NR4_TETTS/187-325-----------------------------------------------------------YGLYQQRVF------------
ROD1_YEAST/232-395-----------------------------------------------------------PEKVDYTIS------------
A0CL31_PARTE/172-315-----------------------------------------------------------RGTSSIEVK------------
APYA_EMENI/180-326-----------------------------------------------------------ANKIAYRIG------------
Q296V0_DROPS/178-310-----------------------------------------------------------SGPLAVITS------------
Q6CW08_KLULA/282-443-----------------------------------------------------------PDKLQYEIS------------
A8WP33_CAEBR/159-305-----------------------------------------------------------DGTIQAKFV------------
A0DYQ7_PARTE/173-314-----------------------------------------------------------TGGTKVKIQ------------
A0D2Y0_PARTE/206-342-----------------------------------------------------------GGIVDLKIQ------------
A7TQI8_VANPO/357-526-----------------------------------------------------------EHQLHYDIV------------
Q17EA7_AEDAE/182-314-----------------------------------------------------------TEPLIVTAT------------
Q9W2V2_DROME/420-633-----------------------------------------------------------DGRVGLRAS------------
Q240M9_TETTS/188-318-----------------------------------------------------------SGQINYNIT------------
A5DUN4_LODEL/264-404-----------------------------------------------------------PKKVEYSLS------------
A0NDX6_ANOGA/173-303-----------------------------------------------------------SEPLSINVM------------
Q16ZJ5_AEDAE/174-305-----------------------------------------------------------SAPMLITAE------------
Q7QCL7_ANOGA/170-301-----------------------------------------------------------GGIVKCKII------------
A2QTZ8_ASPNC/184-328-----------------------------------------------------------PQKIIYRVS------------
O17983_CAEEL/173-318-----------------------------------------------------------RGNVIYTLQ------------
Q9V393_DROME/233-393-----------------------------------------------------------PNKIHLEAT------------
A0BMC5_PARTE/210-346-----------------------------------------------------------RGTVELSLK------------
A1C8U8_ASPCL/140-283-----------------------------------------------------------SGKVVYTVS------------
A0D004_PARTE/178-324-----------------------------------------------------------KGSAQITAV------------
Q16ZK1_AEDAE/136-269-----------------------------------------------------------SGPLVVALQ------------
Q17EA8_AEDAE/183-323-----------------------------------------------------------SAPLMVKAT------------
Q16ZJ8_AEDAE/186-315-----------------------------------------------------------SGPMHFSIE------------
PALF_ASHGO/233-368-----------------------------------------------------------SKTVTISVD------------
ARRS_MOUSE/200-361-----------------------------------------------------------DKPLNLSVS------------
A8WP37_CAEBR/170-319-----------------------------------------------------------DGVFSIKLN------------
Q9GYT5_CAEEL/181-328-----------------------------------------------------------GGILEMSLN------------
MU170_SCHPO/266-426-----------------------------------------------------------EAKTTLEVH------------
A5DW17_LODEL/261-403-----------------------------------------------------------VGKLQYCVS------------
A0D012_PARTE/172-315-----------------------------------------------------------QGSSSISAK------------
ADCA_DICDI/313-441-----------------------------------------------------------KGKLHVKTW------------
Q9I7L0_DROME/174-307-----------------------------------------------------------SDPLALQLT------------
A7SF55_NEMVE/129-256-----------------------------------------------------------AAPLHALVY------------
Q16ZK2_AEDAE/273-408-----------------------------------------------------------SGSLVLSVQ------------
A8XYD8_CAEBR/172-316-----------------------------------------------------------RGSVIYELA------------
A0E996_PARTE/174-317-----------------------------------------------------------GGSAQISLQ------------
Q0U5A6_PHANO/182-337-----------------------------------------------------------ANKLAYKIT------------
PALF_YEAST/259-394-----------------------------------------------------------NKTVTISVD------------
Q23672_CAEEL/163-311-----------------------------------------------------------NGPISLKVS------------
A7TPY5_VANPO/228-381-----------------------------------------------------------PGKVEYTIS------------
Q759V0_ASHGO/221-368-----------------------------------------------------------PGKLDYSLS------------
Q9VGU7_DROME/180-316-----------------------------------------------------------HKPMIMDVS------------
Q6FM62_CANGA/224-379-----------------------------------------------------------PKKVEYSIS------------
A7SKJ5_NEMVE/177-307-----------------------------------------------------------SGPLSLVGH------------
Q6CGL3_YARLI/174-329-----------------------------------------------------------DHLVDVDYT------------
ARRD5_MOUSE/170-307-----------------------------------------------------------QGWVSLHVQ------------
Q17624_CAEEL/176-340-----------------------------------------------------------KSKLAAELA------------
A0D9C9_PARTE/194-337-----------------------------------------------------------LGTILFKFQ------------
A0CE97_PARTE/209-345-----------------------------------------------------------SGAVELSVR------------
Q7PYE1_ANOGA/178-310-----------------------------------------------------------SGPLSLIVH------------
Q16ZJ6_AEDAE/174-302-----------------------------------------------------------SDPMDITVE------------
A7SL06_NEMVE/167-299-----------------------------------------------------------SGSLTVTAK------------
ARD17_CAEEL/179-307-----------------------------------------------------------AGSVTGEIR------------
Q17HB8_AEDAE/169-300-----------------------------------------------------------GGTVRCNVG------------
ADCB_DICDI/337-465-----------------------------------------------------------GGTIEMTIT------------
Q23FQ6_TETTS/188-318-----------------------------------------------------------SGEINYSMS------------
Q294M3_DROPS/163-297-----------------------------------------------------------SGPICSSLA------------
A8WP43_CAEBR/183-324-----------------------------------------------------------SKEVKIKVQ------------
A3LXL3_PICST/266-408-----------------------------------------------------------PEKVDYNVN------------
O17981_CAEEL/182-333-----------------------------------------------------------KGYLELRVN------------
Q16ZK3_AEDAE/167-301-----------------------------------------------------------SGMLYASVE------------
A8X383_CAEBR/164-301-----------------------------------------------------------FGCVSLNMS------------
Q20232_CAEEL/173-309-----------------------------------------------------------RGALALRII------------
A0BCE6_PARTE/199-335-----------------------------------------------------------RGMIELGIR------------
Q5AP77_CANAL/170-448-----------------------------------------------------------NDAVHYIIT------------
A0BDM3_PARTE/168-302-----------------------------------------------------------QGISKLECK------------
Q23674_CAEEL/182-339-----------------------------------------------------------NGLVRMELR------------
ARRD5_BOVIN/171-309-----------------------------------------------------------QGTICLQIQ------------
YA4C_SCHPO/180-322-----------------------------------------------------------PNKIEYTIS------------
Q294M1_DROPS/173-305-----------------------------------------------------------TGPLTVKFS------------
A0A0D1DR37_USTMA/181-316-----------------------------------------------------------QDDMRVKVL------------
A7TDW3_VANPO/229-389-----------------------------------------------------------PDKVEYSIS------------
Q6FY06_CANGA/237-406-----------------------------------------------------------PEKVEYSIS------------
A6R1F7_AJECN/559-759-----------------------------------------------------------EDQLHYDIV------------
Q9XXC4_CAEEL/159-308-----------------------------------------------------------DGLFLLKLH------------
A7TQH7_VANPO/294-447-----------------------------------------------------------PDKLQYEVS------------
Q16ID9_AEDAE/216-390-----------------------------------------------------------PNKIHLEAS------------
PALF_KLULA/263-398-----------------------------------------------------------NKTVKISVE------------
Q6CG62_YARLI/321-486-----------------------------------------------------------EDQLHYDIV------------
A0A0D1E8U6_USTMA/601-804-----------------------------------------------------------EDLLSYMVV------------
Q9XTU0_CAEEL/176-327-----------------------------------------------------------YGKVNLQIR------------
YOA5_SCHPO/223-379-----------------------------------------------------------KSATRITVS------------
Q0CQZ7_ASPTN/118-273-----------------------------------------------------------DNKVHYRIS------------
E7LU16_YEASV/179-340-----------------------------------------------------------PDKVDYSIS------------
F1QAH2_DANRE/171-293-----------------------------------------------------------SGNISMDIF------------
F6SKI7_XENTR/196-355-----------------------------------------------------------DKPLHLTAS------------
F6Y0E4_XENTR/163-285-----------------------------------------------------------SGQVLLAAS------------
G4VCF9_SCHMA/96-254-----------------------------------------------------------PGTLRLEVS------------
H2N0W5_ORYLA/194-351-----------------------------------------------------------EKPLQVKLS------------
H3CCN8_TETNG/163-285-----------------------------------------------------------TGTLMLKTR------------
H3DDA7_TETNG/203-325-----------------------------------------------------------SGGVFMHIK------------
ART5_YEAST/332-474-----------------------------------------------------------RDKLQYETS------------
Q08CX7_XENTR/182-306-----------------------------------------------------------.GHVSVTAK------------
TXNIP_MOUSE/176-299-----------------------------------------------------------DGRVSVSAR------------
Q9VI00_DROME/172-303-----------------------------------------------------------SGPVLSTLT------------

PF07070

E3E849_PAEPS/4-211-----------------------------------------------------------IGSAKVDTL------------
Q9F2L5_STRCO/29-244-----------------------------------------------------------VGGPTVDTT------------
B7VMX8_VIBTL/6-222-----------------------------------------------------------IGSAKVDSV------------
Q87KC8_VIBPA/6-222-----------------------------------------------------------IGSAKVDSI------------
D2SH36_GEOOG/3-216-----------------------------------------------------------SGGAGVETV------------
U5VQ01_9ACTN/3-218-----------------------------------------------------------VGGPSVDTV------------
A9B5Z7_HERA2/2-209-----------------------------------------------------------IGNARIETH------------
Q8CK18_STRCO/3-217-----------------------------------------------------------AGGASVETV------------
A1S9J4_SHEAM/2-218-----------------------------------------------------------IGSAKVDTR------------
F8AWR6_FRADG/3-216-----------------------------------------------------------VGNADVETV------------
D5XEE5_THEPJ/2-202-----------------------------------------------------------IGSAKVDLE------------
F6CIG7_DESK7/3-202-----------------------------------------------------------IGSARVNLE------------
E8U7T1_DEIML/4-201-----------------------------------------------------------VGGARVDAR------------
D9SYU9_MICAI/3-218-----------------------------------------------------------VGGPSVETV------------
SP0M_BACSU/4-212-----------------------------------------------------------IGAAKVDTI------------
D6Y483_THEBD/3-219-----------------------------------------------------------VGAPSVDTV------------
D7B3X5_NOCDD/3-216-----------------------------------------------------------DDGPTVDTV------------
A6W415_KINRD/4-215-----------------------------------------------------------AGAASVDTV------------
A5D298_PELTS/2-203-----------------------------------------------------------IGAASVNLE------------
Q7MGK0_VIBVY/6-223-----------------------------------------------------------IGSAKVDSI------------
I0JR17_HALH3/2-206-----------------------------------------------------------VGSAKVDTQ------------
L0A4L1_DEIPD/4-200-----------------------------------------------------------IGNATVDTQ------------
C1D0Z4_DEIDV/4-201-----------------------------------------------------------VGAARVDTR------------
Q8YPP0_NOSS1/22-229-----------------------------------------------------------IGAAKVDTR------------
R4LYD7_9ACTN/3-214-----------------------------------------------------------LGGPTVHTA------------
C6WBH8_ACTMD/3-218-----------------------------------------------------------VGGPSVDTV------------
R4SZZ1_AMYOR/2-217-----------------------------------------------------------VGGPSVDTV------------
Q3IE37_PSEHT/2-218-----------------------------------------------------------IGAAKVDTI------------
E4N440_KITSK/3-218-----------------------------------------------------------VGGPTVDTV------------
D3Q3X8_STANL/19-229-----------------------------------------------------------AG.VTVDTV------------
G2NX38_STRVO/3-217-----------------------------------------------------------VGGPVVDTV------------
E2Q1G0_STRC2/1-209-----------------------------------------------------------MGGPTVDTV------------
U5W7Z2_9ACTN/3-218-----------------------------------------------------------VGGPSVETV------------
D4GQ21_HALVD/1-207-----------------------------------------------------------IGNATVDTV------------
C4L3D6_EXISA/2-213-----------------------------------------------------------IGAAKVDTR------------
L0JQI9_NATP1/1-204-----------------------------------------------------------IGSATVETV------------
U5LEI3_9BACI/4-214-----------------------------------------------------------VGSASVDTK------------
B7GKU0_ANOFW/25-235-----------------------------------------------------------IGAAKVDTK------------
C5D3Y3_GEOSW/2-199-----------------------------------------------------------VGAAKVDLV------------
H2K613_STRHJ/3-217-----------------------------------------------------------VGGPSVDTV------------
Q9KVV0_VIBCH/21-237-----------------------------------------------------------IGSAKVDSV------------
Q2J8X7_FRASC/3-216-----------------------------------------------------------VGGAAVETV------------
D9STE5_CLOC7/4-212-----------------------------------------------------------IGGAKVDTV------------
Q81QV7_BACAN/2-213-----------------------------------------------------------IGNAKVDTV------------
X5A5U4_9BACL/4-211-----------------------------------------------------------IGSAKVDTR------------
D2B8E4_STRRD/3-215-----------------------------------------------------------AG.VEVDTI------------
F2EZY3_SOLSS/4-214-----------------------------------------------------------IGAAKVDTK------------
Q5V309_HALMA/3-209-----------------------------------------------------------IGSATVDTV------------
Q6LLI7_PHOPR/4-219-----------------------------------------------------------IGAAKVDTV------------
E4NWJ2_HALBP/1-207-----------------------------------------------------------IGNASVDTV------------
E1SSB8_FERBD/2-218-----------------------------------------------------------IGAAKVDTL------------
D7AXU0_NOCDD/3-217-----------------------------------------------------------FGGASVETT------------
F4FG08_VERMA/3-218-----------------------------------------------------------VGGPSVDTV------------
D3EJD4_GEOS4/4-211-----------------------------------------------------------IGAAQIDTH------------
I0H7C6_ACTM4/3-218-----------------------------------------------------------VGGPSVDTV------------
B1VNV5_STRGG/3-217-----------------------------------------------------------VGGPSVDTV------------
H8MVT2_CORCM/3-210-----------------------------------------------------------IGSARVDTR------------
H8GZW1_DEIGI/5-201-----------------------------------------------------------IGAARVDTR------------
Q5L337_GEOKA/2-211-----------------------------------------------------------IGAATVDTK------------
C0ZHJ0_BREBN/2-209-----------------------------------------------------------IGSAQVDAR------------
H2JK05_STRHJ/3-217-----------------------------------------------------------VGGPTVDTV------------
Q8EMA6_OCEIH/2-211-----------------------------------------------------------IGSTKLDTQ------------
F0LQ35_VIBFN/4-220-----------------------------------------------------------IGSAKVDSV------------
Q5L3I0_GEOKA/3-199-----------------------------------------------------------IGAAKVDLV------------
E1V3I8_HALED/2-214-----------------------------------------------------------IGNARVDTM------------
R4SRA3_AMYOR/2-218-----------------------------------------------------------SGGAKIDAR------------
G2NQ97_STREK/3-217-----------------------------------------------------------VGAPTVDTV------------
C7MVV3_SACVD/2-217-----------------------------------------------------------VGGPSVDTV------------
Q47QI1_THEFY/3-218-----------------------------------------------------------VGGPSVDTV------------
B1YLT3_EXIS2/2-212-----------------------------------------------------------IGAATVDTR------------
D2RPW6_HALTV/1-204-----------------------------------------------------------IGAATVDTI------------
D1A596_THECD/3-218-----------------------------------------------------------VGGPSVDTV------------
D2ASM7_STRRD/3-218-----------------------------------------------------------VGGPSVDTV------------
N0B2E1_9BACI/13-223-----------------------------------------------------------MGSATVNTK------------
H6NE63_9BACL/4-211-----------------------------------------------------------IGSAKVDTQ------------
K0K0P9_SACES/2-217-----------------------------------------------------------VGGPSVDTV------------
Q5E1Q2_VIBF1/4-219-----------------------------------------------------------IGSANVDTI------------
I7BQH2_NATSJ/1-201-----------------------------------------------------------IGAATVDTV------------
K0JWS7_SACES/3-218-----------------------------------------------------------VGGPSVDTV------------
V6K362_STRNV/3-217-----------------------------------------------------------VGGPTVETV------------
A4FGU2_SACEN/3-218-----------------------------------------------------------IGGPSVDTV------------
Q5YZ34_NOCFA/2-216-----------------------------------------------------------VGGAEVETQ------------
D9T8R1_MICAI/3-218-----------------------------------------------------------VGGPSVDTV------------
C6CSI9_PAESJ/5-212-----------------------------------------------------------IGSAKIDTL------------
D1A1F2_THECD/3-218-----------------------------------------------------------VGGPSVETV------------
G0G8W7_AMYMS/2-215-----------------------------------------------------------SGGARIDAR------------
U5W8Q8_9ACTN/3-214-----------------------------------------------------------VGGPTVDTI------------

PF04425

A3GGA7_PICST/92-585DSEHTHTSSDAESDHADEHTHNENVA....VTMD..RYGHSPLDNIDRLPKLT......NSPIDIAIY------------
A5DRA9_PICGU/36-464....................RVIVAD....ENTN..DWQNTLLDNIHQLKNLTFSNNKYAKSLNVSVH------------
Q6BJG5_DEBHA/93-577...................NTPVATN....DTYG.....ETVLDNIDKLPKLN......NSPIDIQVY------------
A5DPQ0_PICGU/115-602........QPGPASSTPRYRGINEPT....DTYG.....HTVLDNIDRLPKSH......SSPIDVQIY------------
Q6BSG0_DEBHA/5-422...............................NFW..E..NTILANAHKLPNLNRSDNKICQDLEIDMK------------
Q6BVD1_DEBHA/28-455...............................DTN..SWRETILDNVHKLTNLTYFNKEVSNAVKISIQ------------
Q5ABB5_CANAL/19-455................................QDGEQDDETILENAHKLKRLTSTNKEISKSLEVKIR------------
Q75E04_ASHGO/51-474....................HDEPIE....DDLANQDDDNINIEKLYSLPKMV......T.PVEIDIR------------
BUL1_YEAST/108-543...............DEDSLDIPPIL....DDLN..DTDNIFIDKLYTLPKMS......T.PIEITIK------------
A5E3Q9_LODEL/66-535...........TSTADANSQVHNENLAITSDSYG.....HSPLDNIDRLQKAT......KSPFDIQIF------------
A3LX53_PICST/9-457................................DLEGESNETILENAHKLKRISASNKEISKALHIHIF------------
Q6FUH4_CANGA/102-545..............SRSSVDLINPIQ....DDLN..DAKCVFVDKLYTLPKLS......T.PVEISIK------------
Q6CSE2_KLULA/69-505...................TRYEAII....DDLD..DSDNIKIEKLYSLPKVS......T.PIDVNIR------------
Q6FP46_CANGA/103-568............VSGSTAVNDNTNIE....DDVN..DADNIAIDKLYSLPKFS......T.PLEIDIR------------
Q5AN22_CANAL/97-598...........VGSSVNANVHNQNIEVTQDDTYG.....HSPLDNIDKLHKLP......HSPIDIQIY------------
A7TIV7_VANPO/87-537................AAIDNNIPIE....DDLN..GSDNIFIDKLYTLPKLT......T.PVEVDIR------------
E7KSA7_YEASL/88-524............HSSSDTNISQIPFE....DDLN..DSDNIFIDKLYTLPKLS......T.PIEIDIR------------
G0VB73_NAUCC/105-559............RASLTMHDLNMQIE....DDLN..DSDSIIIDRLYTLPKLA......T.PVDVEIR------------
G0VC27_NAUCC/80-515....................FITNTD....DDLN..ESDNIFVDDIYTLPKVA......S.PIQISIK------------
G0VC28_NAUCC/152-590................SVDHIDTPFQ....DDLN..ESDNLFIDKLYTLPKID......T.PVEIEIK------------

PF03643

VPS26_DICDI/8-284TIEVTQD......KGKTEKLFVFIG-----------------N--EPVSGKVSI--------NIKEKTKK-IE-------
VP26A_HUMAN/8-283MAEMKTE......DGKVEKHYLFYD-----------------G--ESVSGKVNL--------AFKQPGKR-LE-------
PEP8_YEAST/5-364HVDIATRSSNSSYKSMKESLPVYED-----------------G--ESLGGIVTL--------RVRD.SKK-VD-------
VP26A_ARATH/8-283QVPTKKD......NGQIVMNPLFQS-----------------Q--ETIAGKINI--------EPYQ.GKK-VE-------
VPS26_SCHPO/5-279FVDYEFE......QGRKDKAPIYES-----------------D--ETVKGTVMI--------RLKD.GRK-LD-------
VPS26_DROME/6-280TAEVKGE......DGKVEKMLLFYD-----------------G--ETVSGKVNV--------TLKKPGSK-LE-------
VPS26_CAEEL/7-282IVKARGD......DGNMHDHFLYYD-----------------G--ESVTGTVHV--------NLKKANHK-FE-------
DSCR3_MOUSE/1-283..................ANKVYHA-----------------G--EMLSGVVVI--------SSKD...S-VQ-------

PF00339

B4LEM0_DROVI/17-172-------------....RRDFIDHL-----------------DYCDPVDGVIVV.-------EPEY---L-KN-------
ARRS_BOVIN/22-180-------------....KRDYIDHV-----------------ERVEPVDGVVLV.-------DPEL---V-KG-------
Q9I7L0_DROME/5-150-------------...NNPHGTYFG-----------------G..EVLTGRVTL.-------KLDK---M-KL-------
H2N0W5_ORYLA/17-173-------------....KRDFVDHC-----------------DFVDPVDGVVVI.-------DPTQ---L-KG-------
Q23674_CAEEL/4-159-------------....KSPPVFSP-----------------G..EKVTGNVKMT-------IPDD---E-FK-------
ARD17_CAEEL/7-155-------------....NPEQAYFA-----------------G..QEISGKVII.-------ENKE---P-KK-------
H2RRP6_TAKRU/18-174-------------....KRDFVDHL-----------------DHVDPVDGVILV.-------DPEY---L-KD-------
Q9VGU7_DROME/5-155-------------...SNPLGLYQA-----------------G..QLISGTAEL.-------ITER---P-KT-------
Q20577_CAEEL/7-158-------------....SPRG.YAP-----------------G..QTVTGQVVL.-------RSNE---P-IT-------
P91469_CAEEL/7-159-------------....QPDEVFLP-----------------G..QPISGRVVL.-------TTKK---K-LS-------
Q9VI00_DROME/5-148-------------....RREPIYYS-----------------G..ETVNGRAIL.-------TTTS---E-KS-------
Q20232_CAEEL/7-150-------------......KDVYYA-----------------G..ETISGSVLL.-------ENTE---N-IK-------
ARRD4_MOUSE/18-166-------------....ESKGCYSS-----------------G..ETVAGHVLL.-------EAAE---P-VA-------
O17983_CAEEL/6-146-------------....FEKEVYFP-----------------G..DEVKGRAWV.-------STTK---N-LK-------
PALF_YEAST/39-201-------------....EPHRVWKP-----------------N..ESITGEAVI.-------DIKR---D-IT-------
ARRB1_BOVIN/18-174-------------....KRDFVDHI-----------------DLVEPVDGVVLV.-------DPEY---L-KE-------
Q8SYU5_DROME/5-157-------------...QNEHGTYFT-----------------G..QVITGKVIV.-------NLNK---T-KK-------
O17981_CAEEL/6-159-------------....QPNEVFFP-----------------G..QPISGRVVLS-------TTEE---K-YK-------
Q9XXI4_CAEEL/4-156-------------....APNDVYFP-----------------G..QAVTGKVII.-------QNRE---W-IK-------
F6SKI7_XENTR/21-176-------------....KRDYVDHV-----------------ESVDPVDGVVLV.-------DPDL---L-KG-------
Q9VI53_DROME/6-155-------------....NPWNTYYA-----------------G..QTVNGQVKF.-------TFDS---P-KK-------
H2L9D1_ORYLA/14-171-------------....KRDYVDHV-----------------SSVEKLDGVVKV.-------DTTD---F-GD-------
ARRB_CAEEL/22-186-------------....KRDFIDRG-----------------DYVDLIDGMVLI.-------DEEY---I-KD-------
Q9XXI0_CAEEL/6-159-------------....HPAAVYSP-----------------G..QNVAGKLTI.-------RNRN---A-LN-------
Q23672_CAEEL/8-142-------------....KQSEPYYP-----------------G..DTVKGTVVL.-------TNKT---P-LD-------
ARRD2_MOUSE/9-158-------------GARTGTEPVFHG-----------------G..QAVAGRVLL.-------ELAG---A-AR-------

PF13002

A7TSP7_VANPO/130-321-----------------QIVHFHKT-----------FVPDTQAIQTCKNCTTKTT-------KIKNWDIQ-KN-------
C5GL98_AJEDR/142-318-----------------RKVSTKKP-----------......VSRDCSACKYQTE-------ELTSWEFL-TE-------
YNSK_SCHPO/63-242-----------------KRITVLHP-----------......AISHCSACAGSKE-------VLQTWDLA-AN-------
C5DVA9_ZYGRC/141-332-----------------QKVHFHKP-----------FMADLHSIQTCMNCQSKTT-------DIRSWDIQ-KN-------
E7KUR3_YEASL/144-346-----------------QKIHFHKP-----------FVPNISSMQTCMNCKTKIT-------NMKSWEIQ-SN-------

PF02752

Q7PUI7_ANOGA/236-407-----------------LNKAAYVH-----------------G--ENVTVTLDIK.......N.DS---R.KI.......
Q9TYQ0_CAEEL/174-315-----------------VDEIGVMP-----------------G--MTSKISLTVE.......N.KT---K.KRKKWMRKK
Q7PUR5_ANOGA/187-319-----------------TPRTGYAP-----------------G--EVIEVTVHVN.......N.QS---S.VD.......
Q7PYD9_ANOGA/175-306-----------------VPFTGYVP-----------------G--QAIPLTIDLH.......N.LS---S.RI.......
Q380N5_ANOGA/183-323-----------------TPKSGYAP-----------------G--ETIELEVFVQ.......N.SS---K.VT.......
CRED_ASPOR/181-332-----------------TPTKAVIF-----------------G--TSIRVDFKLI......PL.LK---G.LT.......
Q752Z4_ASHGO/228-382-----------------VPSRAIAV-----------------G--AQTALQLRLF......PF.QK---G.YR.......
ARRD5_HUMAN/184-321-----------------MERNTFTP-----------------G--EKVVFTTEIN.......N.QT---S.KC.......
ARRD4_HUMAN/191-318-----------------IERKGYCN-----------------G--EAIPIYAEIE.......N.CS---S.RL.......
Q294M9_DROPS/171-302-----------------LPQAGYVP-----------------G--QKIPVTVVVV.......N.NS---S.VA.......
Q6BI98_DEBHA/278-420-----------------LKRKGIAI-----------------G--STITVKLMVI......PI.AK---G.LK.......
Q294M7_DROPS/174-306-----------------LPQGGFVP-----------------G--QTIPIGVLVS.......N.DS---S.IQ.......
Q6BIN4_DEBHA/247-390-----------------VPSKAIAI-----------------G--SNIPISFMLV......PL.LK---G.LR.......
Q293Z7_DROPS/175-308-----------------LPEDFAVR-----------------G--EPLRICVTVM.......N.NS---T.TN.......
Q9I7K7_DROME/179-320-----------------IPRQGYSP-----------------G--AGISVHLKLH.......N.PE---K.LT.......
A5DM18_PICGU/246-387-----------------MPRRGLAV-----------------G--SSVPIRLVIL......PL.AK---G.LK.......
Q294M5_DROPS/171-304-----------------IPFGGYAP-----------------G--QKIHYTLEID.......N.KS---GAYD.......
Q16ZK0_AEDAE/170-299-----------------IPASGYVP-----------------G--QKIPITNTLN.......N.AS---S.VA.......
A0BIT0_PARTE/173-314-----------------LNKPYYTF-----------------G--ENIDIILQVD.......NSQS---S.SA.......
Q4V467_DROME/125-256-----------------LPQTGFVP-----------------G--QTVPANVLIG.......N.ES---K.IR.......
Q7SC90_NEUCR/193-351-----------------LPKWSYGP-----------------L--DPITVFIKLAPNPDMMNK.AK---K.VT.......
Q66L50_DANRE/187-314-----------------IERKGYTP-----------------G--ETIQIFAEIE.......N.CS---S.RV.......
Q95NF3_ANOGA/193-351-----------------LDKQLYLH-----------------G--ERIGVNICIR.......N.NS---N.KM.......
Q6C993_YARLI/185-326-----------------LPSKAVAV-----------------G--SSTPVHLSMT......PL.LK---G.LK.......
O44847_CAEEL/147-273-----------------MPKFTLYP-----------------G--ETTEFKLEVE.......N.HS---S.ST.......
A0CWE9_PARTE/173-316-----------------LNKAQYVF-----------------G--DSIQLNISVD.......NSQS---N.VA.......
Q23QU8_TETTS/188-318-----------------TNGRSFAP-----------------N--ENIQIKLDVD......FS.QY---G.KK.......
Q6ZM71_DANRE/162-286-----------------TDMRGYIA-----------------G--QIIKVSAGIE.......N.KS---D.KT.......
A8WP41_CAEBR/178-317-----------------LPKRGYVA-----------------G--EILPITINIE.......N.NS---K.SP.......
Q0E8K8_DROME/169-299-----------------LDRGGYVP-----------------G--ENILVTAFIS.......N.YS---N.VS.......
A0C0J3_PARTE/194-337-----------------FDKSAYQP-----------------G--EVAKLQVEID......NT.QS---K.VG.......
Q16ZJ7_AEDAE/171-300-----------------IPVSGYVP-----------------G--QKIPITVALN.......N.TS---S.TT.......
Q23YG0_TETTS/188-318-----------------TNSRSYSP-----------------N--EIISMKIDID......FN.QF---N.KN.......
Q9W7R1_ORYLA/193-351-----------------LDKELYYH-----------------G--EPIKVHVNVT.......N.NS---N.KN.......
ARRB_CAEEL/205-363-----------------LDKEMYYH-----------------G--ESISVNVHIQ.......N.NS---N.KT.......
Q7RZE0_NEUCR/198-350-----------------IPKKAVVF-----------------G--STIPLQTRFT......PL.LK---G.LE.......
ALY2_SCHPO/345-506-----------------VSGKSFRL-----------------G--EVVPITFRFL.......L.LD---K.VR.......
Q5AM66_CANAL/305-457-----------------CPTKAIAI-----------------G--SSTPITMTLV......PL.LK---G.LQ.......
ARRB2_MOUSE/195-350-----------------LDKELYYH-----------------G--EPLNVNVHVT.......N.NS---A.KT.......
A2BIP7_DANRE/186-313-----------------TEKMAYYL-----------------G--EGLKVLAEIH.......N.GS---S.RI.......
ARRD1_HUMAN/162-286-----------------TDLRGYVV-----------------G--QALQLHADVE.......N.QS---G.KD.......
A2QR01_ASPNC/439-613-----------------ISGKSFPL-----------------G--SQVPIAFKLT.......P.LA---K.VE.......
Q380P6_ANOGA/182-314-----------------IARCGYIP-----------------G--QTIVMKIDAV.......N.RS---R.TT.......
YC9F_SCHPO/183-325-----------------IPSKVYAI-----------------G--SEIPVNITLY......PL.LK---G.LD.......
Q16H74_AEDAE/171-301-----------------IPMTGYVP-----------------G--QLISVVVDVM.......N.KS---T.KD.......
Q6DH07_DANRE/192-355-----------------LEKEIYYH-----------------G--DPIPVNIKIK.......N.ET---N.KV.......
A8X4Z9_CAEBR/175-315-----------------IPKQAVAS-----------------G--EALPITIDID.......N.CS---K.RA.......
ART1_SCHPO/287-428-----------------IPKLCIGP-----------------S--DLVSVFVSIMP.....NN.GS---K.IR.......
ARRD2_HUMAN/180-307-----------------IDRKGYTP-----------------G--EVIPVFAEID.......N.GS---T.RP.......
Q294M6_DROPS/179-311-----------------LQQQGYVP-----------------G--QFMLIHAQVR.......N.DS---S.SD.......
ADCC_DICDI/344-478-----------------SVKNSFYP-----------------G--EEIELEVEVN.......N.SS---K.KK.......
Q6CS19_KLULA/219-373-----------------VPSKAIAI-----------------G--SSTPINIMVV......PL.LK---G.LK.......
Q2UDU8_ASPOR/60-215-----------------IPDVNIPF-----------------G--ATFPMKLRFA......PL.SK---G.IK.......
Q22NR4_TETTS/187-325-----------------IKRSEFNP-----------------G--ETIPIQLSFE.......N.KG---S.KP.......
ROD1_YEAST/232-395-----------------IPTKAIAI-----------------G--SSTMINILIV......PI.LK---G.LK.......
A0CL31_PARTE/172-315-----------------VEKNIYFP-----------------T--EFLNFSYDID......NS.NC---K.LD.......
APYA_EMENI/180-326-----------------IQNRTVAL-----------------G--TRIDVDYVFA......PL.LR---D.MK.......
Q296V0_DROPS/178-310-----------------VPQTGYVS-----------------G--QILPITCEVD.......N.TS---N.VN.......
Q6CW08_KLULA/282-443-----------------IPSKAIPI-----------------G--GATPLTVKLY......PF.QK---G.YK.......
A8WP33_CAEBR/159-305-----------------TPSQVFKA-----------------G--QTFDTEVTLN.......N.TS---G.NA.......
A0DYQ7_PARTE/173-314-----------------LNKPQYLF-----------------G--ENIDIVMQVD.......NSSS---N.YH.......
A0D2Y0_PARTE/206-342-----------------LNKSNFTP-----------------G--ELAIIQYHLD.......NTFS---S.KP.......
A7TQI8_VANPO/357-526-----------------IASKDIIL-----------------D--AFLPIAFRFS.......P.ID---K.VT.......
Q17EA7_AEDAE/182-314-----------------TPRSGYVP-----------------G--DVIELTMHVN.......N.QS---S.VD.......
Q9W2V2_DROME/420-633-----------------LDKGWYTH-----------------G--EDVQVTVNIR.......N.DS---R.KT.......
Q240M9_TETTS/188-318-----------------TSSRCFSP-----------------Q--ETINLNMDID......FS.QY---S.KQ.......
A5DUN4_LODEL/264-404-----------------CPTRALAI-----------------G--SGTPISIMLV......PL.LK---G.LT.......
A0NDX6_ANOGA/173-303-----------------LPMTGYVP-----------------G--QFILVTVDIS.......N.RS---N.KC.......
Q16ZJ5_AEDAE/174-305-----------------TPISGYVP-----------------G--QTIAVHIEVD.......N.QS---N.KN.......
Q7QCL7_ANOGA/170-301-----------------LDRGGYVP-----------------G--ESIMITATVT.......N.AS---S.VT.......
A2QTZ8_ASPNC/184-328-----------------LPSQAYTF-----------------G--SAIPIKFEFI......PL.CK---G.LE.......
O17983_CAEEL/173-318-----------------SPKCGYVA-----------------G--ENVIVSGQIE.......N.GT---S.KP.......
Q9V393_DROME/233-393-----------------LDKELYHH-----------------G--EKISVNVHVA.......N.NS---N.RT.......
A0BMC5_PARTE/210-346-----------------LNKNNFIP-----------------G--EQMQIEYTLD.......NTRS---Q.RS.......
A1C8U8_ASPCL/140-283-----------------MPSQAFPF-----------------G--SEVPLNFQFI......PL.RK---G.LE.......
A0D004_PARTE/178-324-----------------TDRNVYRI-----------------G--EAIRILIEVI......DE.ER---Y.QK.......
Q16ZK1_AEDAE/136-269-----------------VPATGFVA-----------------G--QRIPVVLEVS.......N.RS---G.CK.......
Q17EA8_AEDAE/183-323-----------------VPKSLYTP-----------------G--ESLEVLLEVH.......N.LS---K.ED.......
Q16ZJ8_AEDAE/186-315-----------------LPVSGYVS-----------------G--QKIPITVNLN.......N.AS---N.IP.......
PALF_ASHGO/233-368-----------------LPESGYVI-----------------G--DTIRIKVHIQ......HY.KE---Y.RN.......
ARRS_MOUSE/200-361-----------------LSKEIYFH-----------------G--EPIPVTVTVT.......N.NT---D.KV.......
A8WP37_CAEBR/170-319-----------------FQKRSFMP-----------------G--ESVEVIVTME.......N.NS---S.KP.......
Q9GYT5_CAEEL/181-328-----------------IPKTGFVP-----------------G--ETVPLNVHLI.......N.HS---S.TS.......
MU170_SCHPO/266-426-----------------TDRSLFFS-----------------G--QIIDFTICYT.......H.NH---H.RR.......
A5DW17_LODEL/261-403-----------------MPRKAIAI-----------------G--TTVPIHLTIV......PI.AK---G.LS.......
A0D012_PARTE/172-315-----------------VEKNLYFP-----------------G--EFVQITYDID......NS.DC---K.LN.......
ADCA_DICDI/313-441-----------------LNKNAYFP-----------------G--ETLVAKMKAN.......N.TS---I.KP.......
Q9I7L0_DROME/174-307-----------------VPQTGFVP-----------------G--QNVPLSVLVT.......N.DS---H.IP.......
A7SF55_NEMVE/129-256-----------------TDRSAYCP-----------------G--ERLTLTTEIR.......N.LP---L.RE.......
Q16ZK2_AEDAE/273-408-----------------IPTNGFVP-----------------G--QIIPALIQVS.......S.RR---H.VT.......
A8XYD8_CAEBR/172-316-----------------SPKLGYVS-----------------G--ETVIINGRIH.......N.KT---S.KP.......
A0E996_PARTE/174-317-----------------INKQGFAI-----------------G--DVIEANLEVD......NT.KT---D.LN.......
Q0U5A6_PHANO/182-337-----------------VPQKNYIV-----------------G--TQITADFVLI......PL.RK---G.VE.......
PALF_YEAST/259-394-----------------IPQAGFMI-----------------G--EIIPIDVKID......HY.KP---F.YA.......
Q23672_CAEEL/163-311-----------------VPTLVFRQ-----------------G--QTAEFHFEVK.......N.HS---S.ST.......
A7TPY5_VANPO/228-381-----------------APSKAVAI-----------------G--SSTPINMLLV......PL.LK---G.LK.......
Q759V0_ASHGO/221-368-----------------IPSRAVAI-----------------G--TNVPLDMILV......PY.VK---G.LK.......
Q9VGU7_DROME/180-316-----------------TSYSAYVP-----------------G--QKIHFHLVLD.......N.QS---D.VQ.......
Q6FM62_CANGA/224-379-----------------VPTKAVAI-----------------G--STTPVNILLV......PL.LK---G.LK.......
A7SKJ5_NEMVE/177-307-----------------TDRGGYCP-----------------G--ESISVSVYIN.......N.RT---S.TN.......
Q6CGL3_YARLI/174-329-----------------YPVSSFGP-----------------L--DPIQVYIKVAANPDIGS..KS---KRVK.......
ARRD5_MOUSE/170-307-----------------MSKNTYVP-----------------G--EKVTFTSEIR.......N.HT---G.KY.......
Q17624_CAEEL/176-340-----------------LSKTGYLP-----------------G--EAIYGNLKIG.......SKHP---K.DI.......
A0D9C9_PARTE/194-337-----------------FDKTAYQP-----------------G--EIAQLQVEID......NS.QS---K.VG.......
A0CE97_PARTE/209-345-----------------LKTNKFFP-----------------G--DKISVDYSVD.......NTRS---Q.RP.......
Q7PYE1_ANOGA/178-310-----------------VPVTGFVS-----------------G--QSVPVTIECD.......N.AS---N.VG.......
Q16ZJ6_AEDAE/174-302-----------------IPGTGYVS-----------------G--QSIPVAVRWK.......NNNG---A..........
A7SL06_NEMVE/167-299-----------------IDRAGFYI-----------------G--DEAQVTVFLD.......N.QS---T.RD.......
ARD17_CAEEL/179-307-----------------ISKCGYTP-----------------G--EKIDVSFKVIN.....LS.SK---...........
Q17HB8_AEDAE/169-300-----------------LDKRAYIP-----------------G--ENILVTGEIY.......N.QS---N.VT.......
ADCB_DICDI/337-465-----------------APKNSYYP-----------------G--EDIELQVHVN.......N.SS---K.KK.......
Q23FQ6_TETTS/188-318-----------------LNSRCFIP-----------------N--EIINIKINAD......LG.QN---G.NK.......
Q294M3_DROPS/163-297-----------------LPASGFTP-----------------L--QEVPFRLEVD.......N.QS---PHYD.......
A8WP43_CAEBR/183-324-----------------LPKSGFIP-----------------G--EFIPIAISIH.......N.HT---K.KP.......
A3LXL3_PICST/266-408-----------------IAKKGLAI-----------------G--SSIPINIIIV......PI.AK---G.LS.......
O17981_CAEEL/182-333-----------------IPKTGFVP-----------------G--ETVPMNIHIL.......N.HS---S.VP.......
Q16ZK3_AEDAE/167-301-----------------LSTSGFVP-----------------G--QFIPVVIQVN.......N.KG---N.NK.......
A8X383_CAEBR/164-301-----------------LTRTAFQI-----------------G--ESIEAVVTIN.......N.RT---R.KG.......
Q20232_CAEEL/173-309-----------------LERTAYVC-----------------G--ENIRVRAQIE.......NRQS---T..........
A0BCE6_PARTE/199-335-----------------TAKNLYKP-----------------G--EVLELEYTLN.......TTRS---Q.RS.......
Q5AP77_CANAL/170-448-----------------FPRKYVTL-----------------G--CEHMINVKLS......PM.VK---D.VV.......
A0BDM3_PARTE/168-302-----------------YSGEEFSF-----------------G--DQINLEISID......LR.ES---K.QY.......
Q23674_CAEEL/182-339-----------------LPKQGFVC-----------------G--ENIPVTMIVD.......N.KT---S.KS.......
ARRD5_BOVIN/171-309-----------------MEKNTFTP-----------------G--ERDIFTTEIN.......N.QT---S.KC.......
YA4C_SCHPO/180-322-----------------VPTKAYAI-----------------G--SYIPIHFVLV......PL.LK---R.LT.......
Q294M1_DROPS/173-305-----------------TPYCGYAP-----------------G--QKIHFVLYIN.......N.ES---S.ID.......
A0A0D1DR37_USTMA/181-316-----------------RDRSCFGP-----------------G--DNITLRIILSS.....DR.IS---P.IK.......
A7TDW3_VANPO/229-389-----------------VPARAIAI-----------------G--STTKIHMHLI......PL.IK---G.LQ.......
Q6FY06_CANGA/237-406-----------------IPSKAVPI-----------------G--SSSPIDISIT......PL.MK---G.LK.......
A6R1F7_AJECN/559-759-----------------ISGKSFPL-----------------G--GQVPIAFKLT.......P.LA---K.VS.......
Q9XXC4_CAEEL/159-308-----------------FSKRAFLA-----------------G--ETIRALAIME.......N.HS---T.KP.......
A7TQH7_VANPO/294-447-----------------IPSRAIPV-----------------G--GITPISIKIF......PF.QK---H.YI.......
Q16ID9_AEDAE/216-390-----------------LDKELYHH-----------------G--ESLSVNVHIA.......N.NS---S.KT.......
PALF_KLULA/263-398-----------------IPCLGYTI-----------------G--EEIPVKVHVT......HY.KQ---Y.FH.......
Q6CG62_YARLI/321-486-----------------IGGKSIPI-----------------G--TKMQVAFKLT.......P.LA---K.VR.......
A0A0D1E8U6_USTMA/601-804-----------------FSGKSFPI-----------------G--QQIPLWLKFV.......P.LG---K.VK.......
Q9XTU0_CAEEL/176-327-----------------IPKKGYVP-----------------G--ETISIETNID.......N.MS---S.RP.......
YOA5_SCHPO/223-379-----------------LPRTDWLA-----------------G--ESVVSKIKIE.......N.HS---K.SS.......
Q0CQZ7_ASPTN/118-273-----------------IPETNIPF-----------------G--STFPVQFFLA......PL.SK---D.LR.......
E7LU16_YEASV/179-340-----------------VPNKAVAI-----------------G--SATPINISIV......PL.SK---G.LK.......
F1QAH2_DANRE/171-293-----------------LPKTGYQQ-----------------G--EGLIVNGEIV.......N.SS---T.RK.......
F6SKI7_XENTR/196-355-----------------LPKEVFYH-----------------G--EPISVSVSVT.......N.NS---D.KT.......
F6Y0E4_XENTR/163-285-----------------SDLRGYVV-----------------G--QAIQIHTELE.......N.KS---G.RD.......
G4VCF9_SCHMA/96-254-----------------LNKEKYYH-----------------G--ESIDINVLVD.......N.NS---N.KT.......
H2N0W5_ORYLA/194-351-----------------LPKETFYH-----------------G--EPLKANVEIT.......N.SS---S.RN.......
H3CCN8_TETNG/163-285-----------------SDLRGYIP-----------------G--QVIRLATEIH.......N.KS---G.KD.......
H3DDA7_TETNG/203-325-----------------TDRMGYMQ-----------------G--ETIQVTLEIT.......N.CS---C.RS.......
ART5_YEAST/332-474-----------------IPSRAVPI-----------------G--STTPVKIKIF......PF.EK---N.IR.......
Q08CX7_XENTR/182-306-----------------IDRKGYTP-----------------G--EVIPIFAEID.......N.CT---T.RA.......
TXNIP_MOUSE/176-299-----------------IDRKGFCE-----------------G--DDISIHADFE.......N.TC---S.RI.......
Q9VI00_DROME/172-303-----------------IPFGGYAP-----------------G--QKIRFTLEID.......NQSS---G.YD.......

PF07070

E3E849_PAEPS/4-211-----------------VDQTVYVP-----------------G--EELSGIIRIK-------GGKI---D-QE-------
Q9F2L5_STRCO/29-244-----------------LAPGAARP-----------------G--GTLSGRVRLV-------GGTV---G-HD-------
B7VMX8_VIBTL/6-222-----------------LQQEVLYP-----------------G--KKASIIVHVY-------GGAQ---P-QE-------
Q87KC8_VIBPA/6-222-----------------LNQDVLYP-----------------G--QSVDVSIHVY-------GGAT---E-QA-------
D2SH36_GEOOG/3-216-----------------LDRPETTP-----------------G--GSVTGTVHVT-------GGSV---P-QD-------
U5VQ01_9ACTN/3-218-----------------LTDPTTRP-----------------G--ASLAGQVNLV-------GGNH---D-VE-------
A9B5Z7_HERA2/2-209-----------------LHNNTTAP-----------------G--GTITGEVHIM-------GGDV---E-QD-------
Q8CK18_STRCO/3-217-----------------LSESNVVP-----------------G--GVVQGEVRIQ-------GGSV---D-QE-------
A1S9J4_SHEAM/2-218-----------------LHQSQLLP-----------------G--QTFSATIVVQ-------GGDV---A-QK-------
F8AWR6_FRADG/3-216-----------------LDRPEVLP-----------------G--GLVTGTVTIK-------GGKV---D-QE-------
D5XEE5_THEPJ/2-202-----------------IPNPQVEL-----------------G--GILEGVVKIK-------GGSV---E-QE-------
F6CIG7_DESK7/3-202-----------------VAGTAVPL-----------------G--GILNGTIRIQ-------GGNV---E-QQ-------
E8U7T1_DEIML/4-201-----------------LERDAVRL-----------------G--EDLRGVVLLS-------GGAV---E-QN-------
D9SYU9_MICAI/3-218-----------------LANPNCRP-----------------G--GELAGRIQVV-------GGDH---P-VD-------
SP0M_BACSU/4-212-----------------LEKDAYFP-----------------G--EEVQGTVHVK-------GGKI---A-QD-------
D6Y483_THEBD/3-219-----------------LANPRVQP-----------------G--GTLTGEVRLK-------GGDF---D-AE-------
D7B3X5_NOCDD/3-216-----------------LPHPHTRP-----------------G--DLLEGSVELT-------GGGS---R-TE-------
A6W415_KINRD/4-215-----------------LDRDVAQP-----------------G--GPVSGRVVVV-------GGSV---A-QD-------
A5D298_PELTS/2-203-----------------IPQPRVPI-----------------G--GTVSGTVKVR-------GGSV---D-QK-------
Q7MGK0_VIBVY/6-223-----------------LQQEVLYP-----------------G--QAANIKVHVY-------GGSS---E-QE-------
I0JR17_HALH3/2-206-----------------LEKAQFVP-----------------G--EDVHGKVVIK-------GGDV---E-QP-------
L0A4L1_DEIPD/4-200-----------------LAQVSVRL-----------------G--EQVEGKVVVR-------GDQA---P-QA-------
C1D0Z4_DEIDV/4-201-----------------LSSAEVRV-----------------G--EELRGTVHVQ-------GGQV---E-QQ-------
Q8YPP0_NOSS1/22-229-----------------LFNNSVIP-----------------G--GILEGEVYIR-------GGDV---A-QD-------
R4LYD7_9ACTN/3-214-----------------LATPDTCP-----------------G--NPLMGAVRVR-------GGDY---D-VA-------
C6WBH8_ACTMD/3-218-----------------LSNPNVRP-----------------G--DVLTGEVRIS-------GGDH---Q-AE-------
R4SZZ1_AMYOR/2-217-----------------LDSPHAVP-----------------G--EVITGQVRIQ-------GGSS---D-AQ-------
Q3IE37_PSEHT/2-218-----------------LETEHLQP-----------------G--QLFNAQIVIT-------AGDV---S-QE-------
E4N440_KITSK/3-218-----------------LSTPTVYP-----------------G--GTVHGQVNLV-------GGDR---D-AE-------
D3Q3X8_STANL/19-229-----------------LTDSHVTP-----------------G--GVLRGEVLFN-------GGER---D-CE-------
G2NX38_STRVO/3-217-----------------LDRRPVRP-----------------G--GVVRGHVRLR-------GGGR---A-CD-------
E2Q1G0_STRC2/1-209-----------------LDPGPAAP-----------------G--SSLTGQVHLK-------GGST---D-FT-------
U5W7Z2_9ACTN/3-218-----------------LANPNCRP-----------------G--GFLEGQVHVM-------GGDH---A-VD-------
D4GQ21_HALVD/1-207-----------------LPSDTVRP-----------------G--ETVDAEVRIE-------GGSA---E-QE-------
C4L3D6_EXISA/2-213-----------------LNESHCTP-----------------G--GELTGVVHIE-------GGSV---E-QS-------
L0JQI9_NATP1/1-204-----------------LP.PTLTA-----------------G--ESVDARVDVT-------GGND---S-QD-------
U5LEI3_9BACI/4-214-----------------LERDSFYP-----------------G--EVAKGVIEIR-------GGKT---E-QK-------
B7GKU0_ANOFW/25-235-----------------LHESHLLL-----------------G--ESVTGVVEVT-------GGNI---E-QQ-------
C5D3Y3_GEOSW/2-199-----------------LHHPHVRL-----------------G--EKLEGEFFIE-------GGTV---E-QR-------
H2K613_STRHJ/3-217-----------------LDGGAALP-----------------G--GTLAGRVLLR-------GGAT---A-VE-------
Q9KVV0_VIBCH/21-237-----------------LQQEVLYP-----------------G--QSVKVIIHVY-------GGAT---A-QV-------
Q2J8X7_FRASC/3-216-----------------LDRPETLP-----------------G--QVVTGLTTVT-------GGKV---E-QK-------
D9STE5_CLOC7/4-212-----------------LSQKSVRI-----------------G--EDLEGVVNIV-------GGNV---E-QT-------
Q81QV7_BACAN/2-213-----------------LEKDEYIV-----------------G--EEILGKVHIT-------GGSV---S-QQ-------
X5A5U4_9BACL/4-211-----------------LEEAQIVA-----------------G--GTLRGVVSVR-------GGQV---E-QQ-------
D2B8E4_STRRD/3-215-----------------LQNSNVRP-----------------G--EVLRGQVNFR-------GGGS---D-YK-------
F2EZY3_SOLSS/4-214-----------------LHKSTYTL-----------------N--ENISGVVEII-------GGST---E-QQ-------
Q5V309_HALMA/3-209-----------------LPTDSVRA-----------------G--ESVRAEVHVE-------GGST---D-QN-------
Q6LLI7_PHOPR/4-219-----------------LKHDVLIP-----------------G--ENLPVVIHVQ-------GGAT---E-QQ-------
E4NWJ2_HALBP/1-207-----------------LPSTTVSP-----------------G--ETVDAEVRVS-------GGDA---E-QS-------
E1SSB8_FERBD/2-218-----------------ILSETLVP-----------------G--ETMLIEIVIE-------GGDV---P-QT-------
D7AXU0_NOCDD/3-217-----------------LHSSVATP-----------------G--GTLRGTVVIE-------GGNV---E-QQ-------
F4FG08_VERMA/3-218-----------------LANPHTRP-----------------G--QTLDGQVNLI-------GGDA---P-AN-------
D3EJD4_GEOS4/4-211-----------------LEKSSYYP-----------------G--EEVRGIIHIK-------GGNV---E-QT-------
I0H7C6_ACTM4/3-218-----------------LSNPSTYP-----------------G--APLTGQVNVV-------GGTQ---D-AD-------
B1VNV5_STRGG/3-217-----------------LEPGPALP-----------------G--AVLTGEVRLR-------GGGS---D-VT-------
H8MVT2_CORCM/3-210-----------------LEHDTVRA-----------------G--GDLRGLVHVQ-------GGHT---P-QR-------
H8GZW1_DEIGI/5-201-----------------LSRPEARV-----------------G--ERLSGVVAVQ-------GGRV---E-QR-------
Q5L337_GEOKA/2-211-----------------LAKAQYVQ-----------------G--ETVEGIVDIR-------GGSI---E-QH-------
C0ZHJ0_BREBN/2-209-----------------LEQDSLIP-----------------G--DMVRGEVHIK-------GGDV---A-QE-------
H2JK05_STRHJ/3-217-----------------LDPGAALP-----------------G--GALSGQVHLK-------GGNA---D-FD-------
Q8EMA6_OCEIH/2-211-----------------LDKEIYMA-----------------G--ETVTGKILVT-------GGKV---E-QE-------
F0LQ35_VIBFN/4-220-----------------LQQEALIP-----------------G--QTVKVTIHVY-------GGAT---A-QA-------
Q5L3I0_GEOKA/3-199-----------------LHRPHVRL-----------------G--ETLEGEFLLE-------GGSV---A-QH-------
E1V3I8_HALED/2-214-----------------LDSDTAEA-----------------G--GVLKGEIHIH-------GGEV---S-QD-------
R4SRA3_AMYOR/2-218-----------------LLDRTVSP-----------------G--RPLRGEVLLL-------GGEV---D-QE-------
G2NQ97_STREK/3-217-----------------LAGGAAVP-----------------G--GSLSGQVRLR-------GGSA---D-FT-------
C7MVV3_SACVD/2-217-----------------LDNPHVLP-----------------G--QVITGQVRIQ-------GGSY---D-AE-------
Q47QI1_THEFY/3-218-----------------LRSPHTRP-----------------G--EFLEGTVELV-------GGES---E-VL-------
B1YLT3_EXIS2/2-212-----------------LEQEHCEP-----------------G--GTIQGVVHIK-------GGNV---D-QE-------
D2RPW6_HALTV/1-204-----------------LP.TTLTA-----------------G--ETVDARVDVT-------GGND---A-QE-------
D1A596_THECD/3-218-----------------LASTHCRP-----------------G--EYLSGEVRIK-------AADY---D-VE-------
D2ASM7_STRRD/3-218-----------------LAVSRVSP-----------------G--GSLTGEVRIK-------GGDF---E-AE-------
N0B2E1_9BACI/13-223-----------------LESDKLVP-----------------G--QEVKGIVEIK-------GGSI---D-QK-------
H6NE63_9BACL/4-211-----------------LHNAQVTV-----------------G--GELSGVVVIQ-------GGQT---E-QQ-------
K0K0P9_SACES/2-217-----------------LDSPHATP-----------------G--QVITGQVRIQ-------GGSG---D-AN-------
Q5E1Q2_VIBF1/4-219-----------------IHHEVLIP-----------------G--QKAQVTIEVT-------GGAT---A-QD-------
I7BQH2_NATSJ/1-201-----------------LP.TTLTA-----------------G--ESVDARVDIT-------GGND---T-QE-------
K0JWS7_SACES/3-218-----------------LTNPNVRP-----------------G--ELLTGEVRIA-------GGDH---P-AD-------
V6K362_STRNV/3-217-----------------LEGGAVLP-----------------G--GTLRGEVRLA-------GGSS---A-YD-------
A4FGU2_SACEN/3-218-----------------LHHPGTRP-----------------G--EVLTGEVRIT-------GGSQ---A-VT-------
Q5YZ34_NOCFA/2-216-----------------LFTPGVQP-----------------G--GVVDGVIRLR-------GGQV---A-QD-------
D9T8R1_MICAI/3-218-----------------LSNPSTRP-----------------G--LMLGGQVNLT-------GGSH---D-VE-------
C6CSI9_PAESJ/5-212-----------------LEKSQYVP-----------------G--EEVRGVVNIR-------GGNA---P-QN-------
D1A1F2_THECD/3-218-----------------LHNPNTTP-----------------G--GTISGDVHLM-------GGEH---D-SD-------
G0G8W7_AMYMS/2-215-----------------LLDSTAAP-----------------G--RPLRGEVLLL-------GGEV---D-QE-------
U5W8Q8_9ACTN/3-214-----------------LPNPATHP-----------------G--GTLTGEVRIA-------GGEY---D-VV-------

PF04425

A3GGA7_PICST/92-585-----------------VTKSVPQP.HH.KNELETRLKEYTSG--DMVNGYIIIT-------NNSN---KPVD-------
A5DRA9_PICGU/36-464-----------------FTKEVGKL.GKKPTYIDPSVYEYKQG--DTVNGHILIE-------NTSD---EKIR-------
Q6BJG5_DEBHA/93-577-----------------VTKRVPQP.NL.PNDLETRLKMYSSG--DLVNGYIIIT-------NTSD---EPVD-------
A5DPQ0_PICGU/115-602-----------------VTKKVPSP.NQ.KNELETRLKEYSSG--DVVNGYIIIT-------NTSD---SVVN-------
Q6BSG0_DEBHA/5-422-----------------VTEKVCQK.GVKPTIIDPSEYEFKQG--DYIHGYVTMK-------NKSP---VPIS-------
Q6BVD1_DEBHA/28-455-----------------FTKEVGEL.GKEPILIDSRLHEYKQG--DLINGFVLIT-------NESN---EPIP-------
Q5ABB5_CANAL/19-455-----------------LTEHIGKV.GEPYTLVDPLTLELKQG--DYIYGFVLIT-------NKTS---NVIP-------
Q75E04_ASHGO/51-474-----------------ITKHPVKP.HK.KPEEESILREYTSG--DIINGYVVIK-------NRSA---QPLK-------
BUL1_YEAST/108-543-----------------TTKHAPIP.HV.KPEEESILKEYTSG--DLIHGFITIE-------NKSQ---ANLK-------
A5E3Q9_LODEL/66-535-----------------VTKDVPRP.NQ.ENELETKLKEYTNG--DHVNGYVIVT-------NTSS---KPVK-------
A3LX53_PICST/9-457-----------------MTETVGKV.GVKPKIIDPLSIEIKQG--DYLYGFVLVT-------NKTK---YDVP-------
Q6FUH4_CANGA/102-545-----------------ITKHAPSP.NQ.KPEEESILKEYTSG--DLVHGYCTIE-------NKSS---QPLQ-------
Q6CSE2_KLULA/69-505-----------------ILKKATKPCEE.KPEEESILKEYTSG--DIINGFVVIE-------NRSQ---HPLR-------
Q6FP46_CANGA/103-568-----------------ITKHVPKP.HE.KPEEESVLKEFTSG--DIIHGYCVIE-------NRST---QPLK-------
Q5AN22_CANAL/97-598-----------------VTKQIPQP.NV.NNDLETRLKEYTSG--DFVNGYITVI-------NNSH---EPIE-------
A7TIV7_VANPO/87-537-----------------ITKHAPQP.HE.KPEEESILKEYTSG--DVIHGYCIIE-------NRSS---QPLK-------
E7KSA7_YEASL/88-524-----------------ITKTASIP.HE.RPEEQSILKEYTSG--DIIHGYCLIE-------NRSS---QPLK-------
G0VB73_NAUCC/105-559-----------------VTKDVSKP.HA.KNEEESILKEYTSG--DIIHGYCTIE-------NRSS---KRLK-------
G0VC27_NAUCC/80-515-----------------LTKQPCVP.HV.KPEEESILKEFTSG--EIIYGYFLVT-------NKSL---EPLP-------
G0VC28_NAUCC/152-590-----------------ITKHAGSP.HT.KPEEESILKEYTSG--DIIHGYCIIE-------NKSS---KALP-------

PF03643

VPS26_DICDI/8-284--HTGIRVEF............VGQIELF---YDRG..........................NHYE.FTSLVRELAPAGE
VP26A_HUMAN/8-283--HQGIRIEF............VGQIELF---NDKS..........................NTHE.FVNLVKELALPGE
PEP8_YEAST/5-364--HLGIKVSV............IGSIDML---KSHGSGNSSSKKVTSSTSSSSSNGSVDVRKNSVDQFLCQSYDLCPAGE
VP26A_ARATH/8-283--HNGVKVEL............LGQIEMY---FDRG..........................NFYD.FTSLVREIDVPGE
VPS26_SCHPO/5-279--HDGVKIEF............IGQIENT---YDKG..........................NIHE.FTRSVQELASPGE
VPS26_DROME/6-280--HQGIKIEF............IGQIELY---YDRG..........................NHHE.FKCLAKALARPGD
VPS26_CAEEL/7-282--HQGIRIEF............IGQIEVY---YDRG..........................NQQD.FISLTRELARPGD
DSCR3_MOUSE/1-283--HQGVSLTMEGTVNLQLSAKSVGVFEAF---YNSV..........................KPIQ.IINSTIDVLKPGK

PF00339

B4LEM0_DROVI/17-172--.RKVFGQL------------ATIYRYG---R-----------------------------EEDEVM..........GV
ARRS_BOVIN/22-180--.KRVYVSL------------TCAFRYG---Q-----------------------------EDIDVM..........GL
Q9I7L0_DROME/5-150--VKAITLNI------------TGYAETR---W-----------------------------IERVT...........TN
H2N0W5_ORYLA/17-173--.RKVYVML------------SCTFRYG---R-----------------------------QDMDVM..........GV
Q23674_CAEEL/4-159--ARKVRMEM------------IGKAYTY---W-----------------------------EGNVRNNHTKIKNGDIAR
ARD17_CAEEL/7-155--VNEILLEL------------KGRARTY---W-----------------------------TKHSGKSR........KH
H2RRP6_TAKRU/18-174--.RKVFVTL------------TCAFRYG---R-----------------------------EDLDVL..........GL
Q9VGU7_DROME/5-155--IRSIFITI------------NGYGETR---W-----------------------------QESEERVGED......GK
Q20577_CAEEL/7-158--ARFLKICI------------HGAAHTK---W-----------------------------SEGERRYRTNCEGK..EE
P91469_CAEEL/7-159--ARAVNIKI------------VGLAHTS---W-----------------------------KNYENSCKLSFHRI..VS
Q9VI00_DROME/5-148--VNEVYILF------------EGEAKVR---W-----------------------------DERRTRTRG.......GK
Q20232_CAEEL/7-150--IRGIRVLL------------RGKVHAT---L-----------------------------K...............VV
ARRD4_MOUSE/18-166--LRGLRLEA------------QGRATSA---W-----------------------------GPSAGA..........RV
O17983_CAEEL/6-146--ATSVEITF------------SGKTITA---H-----------------------------N...............GK
PALF_YEAST/39-201--NVAIKLSL------------VCEVRVK---T-----------------------------GNSPTSKNKRIEKTLEKS
ARRB1_BOVIN/18-174--.RRVYVTL------------TCAFRYG---R-----------------------------EDLDVL..........GL
Q8SYU5_DROME/5-157--LRGIKLQI------------SGYAQAQ---W-----------------------------RIRRHGKAVAIQ....NP
O17981_CAEEL/6-159--ARAVNIKI------------LGLAHTS---W-----------------------------TDYDSVRRVDNDGN..VR
Q9XXI4_CAEEL/4-156--ARFLKICI------------HGGAHTH---W-----------------------------SESRSTYRTNTRGE..RE
F6SKI7_XENTR/21-176--.KKVYVTL------------TCAFRYG---Q-----------------------------EDIDVI..........GL
Q9VI53_DROME/6-155--VRGIIIRF------------LGEANTE---W-----------------------------SEEKSVTTSE......GK
H2L9D1_ORYLA/14-171--.RKAFVQM------------ACAFRYG---S-----------------------------DDLDVM..........GL
ARRB_CAEEL/22-186--NRKVTAHL------------LAAFRYG---R-----------------------------EDLDVL..........GL
Q9XXI0_CAEEL/6-159--ALALKICI------------HGDIETL---W-----------------------------RKFENKGRYDRHGR..WY
Q23672_CAEEL/8-142--ARCVTIKC------------RGKSETY---L-----------------------------INWT............DL
ARRD2_MOUSE/9-158--VGALRLRA------------RGRARAH---W-----------------------------TESRSA..........GS

PF13002

A7TSP7_VANPO/130-321--TVEMSVG-------------SYVFPFS---CLIP--------------------------GSVPATTTLGSTAETEIK
C5GL98_AJEDR/142-318--PAHLKSG-------------IHDYPFS---YLFA--------------------------GNLQPTTQ...GSLGAVS
YNSK_SCHPO/63-242--TT.YRPG-------------TQHWPFS---WLFP--------------------------GSLPASVS...NRYIKLE
C5DVA9_ZYGRC/141-332--AKDLPVG-------------NYSFPFS---CLIS--------------------------GSFPAKSALGSNSETQIK
E7KUR3_YEASL/144-346--TQDLSVG-------------SHSYPFS---YLIP--------------------------GSVPCSSSLGATAETQVK

PF02752

Q7PUI7_ANOGA/236-407..VRKIRLVA------------VQHVDVC---MF..............................................
Q9TYQ0_CAEEL/174-315DNHECVLLSL------------CQQLDFV---AVNR.NDPM.......................................
Q7PUR5_ANOGA/187-319..VRSITVKF------------QRVDTFL---SQVP.VV.........................................
Q7PYD9_ANOGA/175-306..IEGVNMKL------------LQEITYH---AEYP.AS.........................................
Q380N5_ANOGA/183-323..VSVIEIRW------------QKILKFT---SQTR.VIGQTQ.....................................
CRED_ASPOR/181-332..IGQIVSQL------------IESHDLT---LNPEDPD.........................................
Q752Z4_ASHGO/228-382..LASFSASL------------VQYYAFT---DDAG............................................
ARRD5_HUMAN/184-321..IKTVVFAL------------YAHIQYE---GFTP.SAE........................................
ARRD4_HUMAN/191-318..IVP.KAAI------------FQTQTYL---ASG.............................................
Q294M9_DROPS/171-302..VSELRLSL------------VMLVRYF---SLSP............................................
Q6BI98_DEBHA/278-420..LKGMSGVI------------VQRSHTA---HSHG............................................
Q294M7_DROPS/174-306..VEEITARL------------TMVVIYY---SRPP.CP.........................................
Q6BIN4_DEBHA/247-390..LGDIKIQL------------VEYSSCV---GYLP............................................
Q293Z7_DROPS/175-308..VEKLRFSV------------LQYVTYY---SHVP.LR.........................................
Q9I7K7_DROME/179-320..LREAVYSL------------VQISTYV---AHLK.NKPK.......................................
A5DM18_PICGU/246-387..LKSLNGCI------------VQHSHVE---HSWG............................................
Q294M5_DROPS/171-304..LDGIELQL------------KQVCLLK---AETP.HH.........................................
Q16ZK0_AEDAE/170-299..MHGVQSSL------------DRTECYR---SETP.CE.........................................
A0BIT0_PARTE/173-314..IQNFKFQI------------TSQLVIL---YKQQ.KR.........................................
Q4V467_DROME/125-256..VHEVKVGL------------SMMITYY---SDLS..S.........................................
Q7SC90_NEUCR/193-351..INKITLAI------------EEEITFN---PEGD............................................
Q66L50_DANRE/187-314..VVP.KAAL------------YQTQTFF---AKG.............................................
Q95NF3_ANOGA/193-351..VKKIKAMV------------QQGVDVV---LF..............................................
Q6C993_YARLI/185-326..LGSIKMTL------------VEISVLT---TPFG............................................
O44847_CAEEL/147-273..VKKIYAEL------------EAEPFPL---YH..............................................
A0CWE9_PARTE/173-316..VQKFELKI------------SSQLVVL---YRQQ.KR.........................................
Q23QU8_TETTS/188-318..VNNLNVKL------------LGQLIMK---AS..............................................
Q6ZM71_DANRE/162-286..TGHVVASL------------MQKVTYN---TKKP.T..........................................
A8WP41_CAEBR/178-317..VVAVRSKM------------TQLSHFH---ASHG.SAMNV......................................
Q0E8K8_DROME/169-299..IKRTKASL------------TETIEYL---ARGK............................................
A0C0J3_PARTE/194-337..IPIIKGSV------------TSKLRVI---SKQG............................................
Q16ZJ7_AEDAE/171-300..IVGIKSSL------------ERKVTYI---SQYP.RE.........................................
Q23YG0_TETTS/188-318..IKCLNIKL------------IGLLSMK---AS..............................................
Q9W7R1_ORYLA/193-351..IKNIIVSV------------DQVATVV---LF..............................................
ARRB_CAEEL/205-363..VKKLKIYI------------IQVADIC---LF..............................................
Q7RZE0_NEUCR/198-350..LGEITIRL------------LEVHEFI---LQSHSGYG........................................
ALY2_SCHPO/345-506..LYKLSISV------------VESSEYW---CRSR.KFHRVDP....................................
Q5AM66_CANAL/305-457..LGDIKIEL------------IEMYSFV---GSYP............................................
ARRB2_MOUSE/195-350..VKKIRVSV------------RQYADIC---LF..............................................
A2BIP7_DANRE/186-313..IKP.KYCL------------YEKYSFF---AKGR............................................
ARRD1_HUMAN/162-286..TSPVVASL------------LQKVSYK---AKRW.I..........................................
A2QR01_ASPNC/439-613..CHRIKVYV------------TENIQHW---TADK.SVHRFQP....................................
Q380P6_ANOGA/182-314..VTEFRVKL------------VQKLCYS---SQQP.AV.........................................
YC9F_SCHPO/183-325..VGKVTLVL------------KEYCTLF---ITSK.AYS........................................
Q16H74_AEDAE/171-301..ISELKIKL------------RRQVKYF---SHST.SG.........................................
Q6DH07_DANRE/192-355..VKRIRVTV------------DQTTDVV---LY..............................................
A8X4Z9_CAEBR/175-315..AYCVRAEL------------KQNSHYN---ASRN.SLFSHS.....................................
ART1_SCHPO/287-428..VQQLSLSL------------VEYITFI---HPSS............................................
ARRD2_HUMAN/180-307..VLP.RAAV------------VQTQTFM---ARG.............................................
Q294M6_DROPS/179-311..CKKLLIMI------------HLRSTYT---ADQP.SL.........................................
ADCC_DICDI/344-478..IKNVDIQL------------.NKVEYD---GTDV.T..........................................
Q6CS19_KLULA/219-373..LGPIKISL------------VEYSSYS---APYS............................................
Q2UDU8_ASPOR/60-215..LHALTIDV------------IEQHEVK---ISAP.AAYSAQF....................................
Q22NR4_TETTS/187-325..LKSVNVKL------------IREQNFI---KPESGGR.........................................
ROD1_YEAST/232-395..LGPVRISL------------VENSQYC---GSYG............................................
A0CL31_PARTE/172-315..VDKVDSVL------------VNRLRLR---SNSD.SEHI.......................................
APYA_EMENI/180-326..IAFIESQL------------LEVRDLS---VEPN.DGG........................................
Q296V0_DROPS/178-310..LSAVKFEL------------RKLVTFH---TSQP.RS.........................................
Q6CW08_KLULA/282-443..LKKIVVSL------------LQYYAFK---DSAG............................................
A8WP33_CAEBR/159-305..IKSVQYTL------------FRHTHFH---KKWQ.PTPCSNS....................................
A0DYQ7_PARTE/173-314..IQKFKFSI------------SAQLVVL---YKQQ.KR.........................................
A0D2Y0_PARTE/206-342..VTRVEIRL------------INKLIFI---DDDQ............................................
A7TQI8_VANPO/357-526..LHRIRIYL------------TETIDYY---CKGK.KVHRVEPTKKF................................
Q17EA7_AEDAE/182-314..VKCITVKL------------QRVDTFI---SQLP.RV.........................................
Q9W2V2_DROME/420-633..VRKVRVCA------------IQHVDVC---MF..............................................
Q240M9_TETTS/188-318..VNKLTVKL------------LGQLTMK---AN..............................................
A5DUN4_LODEL/264-404..LGDIKIQL------------IEFYSYM---GNVP............................................
A0NDX6_ANOGA/173-303..IAEVKLKL------------RRQVRYS---SQTP.YK.........................................
Q16ZJ5_AEDAE/174-305..LDEISTKL------------MRVVSFV---SQTP.YT.........................................
Q7QCL7_ANOGA/170-301..IKSTKAAL------------TETIQYF---ARDK............................................
A2QTZ8_ASPNC/184-328..IATIHTEV------------KETHKVL---QF..............................................
O17983_CAEEL/173-318..MKIITAKL------------TRRITYR---EELK.AKANAKKK...................................
Q9V393_DROME/233-393..VKKIKVCV------------RQFADIC---LF..............................................
A0BMC5_PARTE/210-346..ISRVEARL------------INKLTFI---DDDE............................................
A1C8U8_ASPCL/140-283..LESINCQL------------VEIEERK---CPL.............................................
A0D004_PARTE/178-324..PEKIIIQL------------ENITQYK---YKNN.IET........................................
Q16ZK1_AEDAE/136-269..IHLIQLKL------------VMVVAYT---SDTP.RV.........................................
Q17EA8_AEDAE/183-323..VSEIIVKF------------QKVVKFL---SQVQ.VIDST......................................
Q16ZJ8_AEDAE/186-315..IHAIRSKL------------VRKVCFI---SQTP.TR.........................................
PALF_ASHGO/233-368..SAGLIATL------------VRICRVH---ST..............................................
ARRS_MOUSE/200-361..VKKIKVSV------------EQIANVV---LY..............................................
A8WP37_CAEBR/170-319..IKSMQFEL------------IRQSHFH---SQHQ.KDFCSLNNCL.................................
Q9GYT5_CAEEL/181-328..VNNIKAQM------------LQQCKFT---GYKSGATYNYGGDFER................................
MU170_SCHPO/266-426..IHNIKARL------------LETHIFH---PNTQ.NHYGGYCMNQAEETFA...........................
A5DW17_LODEL/261-403..LKAMNACI------------VEHYHIE---VDNI............................................
A0D012_PARTE/172-315..IENVDVII------------VNRLNIK---SNSG.SQCH.......................................
ADCA_DICDI/313-441..TRKISLVV------------HHTMQLK---TRL.............................................
Q9I7L0_DROME/174-307..VEQLLISF------------VMLVTYH---SKPPSMP.........................................
A7SF55_NEMVE/129-256..PYETCVYL------------VQSITYK---SSCG.RTR........................................
Q16ZK2_AEDAE/273-408..IRKVTTVL------------IQQTTFS---ARWP.KA.........................................
A8XYD8_CAEBR/172-316..IRIIQAKL------------NRLVTYR---EELQ.GKNKKRNP...................................
A0E996_PARTE/174-317..LLNLTFSV------------QSQLIIL---YPVL.KL.........................................
Q0U5A6_PHANO/182-337..IATIKMEL------------IESRQLF---ADYA.GRR........................................
PALF_YEAST/259-394..PAGLTTTL------------VRICRVG---GA..............................................
Q23672_CAEEL/163-311..INEIFIKF------------GKQVHYH---SRNQ.LTPCRKFDS..................................
A7TPY5_VANPO/228-381..LGPIKIAL------------VESSQFC---GNFG............................................
Q759V0_ASHGO/221-368..LGTVKASI------------VENLTFA---TPYG............................................
Q9VGU7_DROME/180-316..CMDVKVRL------------IKNVSYR---ANSS.GAK........................................
Q6FM62_CANGA/224-379..LGSIRMTL------------IEKYSYG---SKSD............................................
A7SKJ5_NEMVE/177-307..LPGIDLVL------------RQITVYI---ASCG............................................
Q6CGL3_YARLI/174-329..LVKVSIQV------------VEVITYN---PEGD............................................
ARRD5_MOUSE/170-307..IKTVVFAL------------YAHVQYE---GFTP.SAE........................................
Q17624_CAEEL/176-340..LNHMEARL------------VDRVRRV---GAPEISA.........................................
A0D9C9_PARTE/194-337..IPTITGRL------------TNTLRIV---SKQG............................................
A0CE97_PARTE/209-345..VNRIEVRV------------IHKLIFI---DNDE............................................
Q7PYE1_ANOGA/178-310..VEKITINL------------RKLLAFH---VHTP.RR.........................................
Q16ZJ6_AEDAE/174-302..IRGIRIKL------------FKHETYS---ATEP.YE.........................................
A7SL06_NEMVE/167-299..VTDVEICL------------FQFTTYI---YGTD.EN.........................................
ARD17_CAEEL/179-307..TRTTALRF------------VQQTTYK---AKTF.AGH........................................
Q17HB8_AEDAE/169-300..IKAVKYAL------------METIQYY---AHGK............................................
ADCB_DICDI/337-465..VKKIELEL------------QRTISIQ---HEK.............................................
Q23FQ6_TETTS/188-318..VKNFSIKI------------IGLLEMK---AC..............................................
Q294M3_DROPS/163-297..IIGVEVSI------------RQHFVFL---SRKP............................................
A8WP43_CAEBR/183-324..LYYLKAQL------------IQHVHYQ---AQQE.NSHFNSDE...................................
A3LXL3_PICST/266-408..IRKIHGCI------------VQHYHVM---YEEG............................................
O17981_CAEEL/182-333..VTEVKAKI------------IQQCKFI---AYRNGTIFRFDGGSD.................................
Q16ZK3_AEDAE/167-301..MTRIVTML------------VQKAIYS---AKRP.FV.........................................
A8X383_CAEBR/164-301..LKEVALQL------------IMKTQFE---ARSR.YEH........................................
Q20232_CAEEL/173-309..AQSLVIRL------------VQHVEVF---VEKGLLG.........................................
A0BCE6_PARTE/199-335..ITKVEVKL------------NHFLSFT---DDDE............................................
Q5AP77_CANAL/170-448..IKRIKFNV------------LERITYV---SKNL.SREYDYDSEDPYCIHPVSKENKVRERVVSLYELKTKAKQSSGG
A0BDM3_PARTE/168-302..IQEIVMSL------------NKRTTIM---AK..............................................
Q23674_CAEEL/182-339..FKKISLRL------------VQRVTYT---GFRDGFVNSHSQPCIGNE..............................
ARRD5_BOVIN/171-309..IKTVIFAL------------YAHVHYE---GFTP.NAE........................................
YA4C_SCHPO/180-322..IGKISITL------------KEYITLH---VAHG.YNG........................................
Q294M1_DROPS/173-305..ITECEVKL------------KQEVSYE---SHDP.HH.........................................
A0A0D1DR37_USTMA/181-316..VKSISFSI------------RETITFK---GSAK.KTFGSN.....................................
A7TDW3_VANPO/229-389..LGPIKINL------------IENSQYC---GSYS............................................
Q6FY06_CANGA/237-406..LGPVKVQL------------VEVGQLC---SATG............................................
A6R1F7_AJECN/559-759..LHRIKVIV------------SENTQVV---ANNR.TYHRVDG....................................
Q9XXC4_CAEEL/159-308..IINLRFEL------------IQQSHYH---SRPQ.KSLCSLNDCH.................................
A7TQH7_VANPO/294-447..LEKIGVTL------------IQFYSMK---DSSG............................................
Q16ID9_AEDAE/216-390..VKKIKVSV------------RQFADIC---LF..............................................
PALF_KLULA/263-398..PAGLIATL------------VRISRVS---NP..............................................
Q6CG62_YARLI/321-486..CHRIRIYI------------SENIDYY---CRKM.KIHRVEP....................................
A0A0D1E8U6_USTMA/601-804..IYRILATL------------EERTDYF---AKGR.RVARHEVPR..................................
Q9XTU0_CAEEL/176-327..ILKTECYL------------IQQCRFL---AYRYGISGPTDGRRAS................................
YOA5_SCHPO/223-379..IKTLKLCL------------YRRIIGF---DPPS.WKTQQMM....................................
Q0CQZ7_ASPTN/118-273..LGAVTIQV------------VEKHELK---IRAS.AAYSVQY....................................
E7LU16_YEASV/179-340..LGSIKVVL------------FENYQYC---DPFP............................................
F1QAH2_DANRE/171-293..IVP.KYII------------YQKQSFF---AGGQ............................................
F6SKI7_XENTR/196-355..VKKISASV------------EQVSNVV---LY..............................................
F6Y0E4_XENTR/163-285..TGSIVAAL------------VQKIAYK---SK..............................................
G4VCF9_SCHMA/96-254..VKKIKLSV------------RQYTQLC---LH..............................................
H2N0W5_ORYLA/194-351..IKDISLSV------------EQVTNVV---LY..............................................
H3CCN8_TETNG/163-285..TGCVLASL------------IQKVSYK---TR..............................................
H3DDA7_TETNG/203-325..VKP.TFAL------------YERQSFF---AQG.............................................
ART5_YEAST/332-474..LDRIEMAL------------IQYYAMK---DSSA............................................
Q08CX7_XENTR/182-306..VIP.KAAI------------IQSQAFV---ARG.............................................
TXNIP_MOUSE/176-299..VVP.KAAI------------VARHTYL---ANG.............................................
Q9VI00_DROME/172-303..LNGIELKL------------KQIYKFQ---AQTP.HH.........................................

PF07070

E3E849_PAEPS/4-211--IGKIDIEL------------KTEYIVE...HDDK--------------------------------------------
Q9F2L5_STRCO/29-244--VEHVALEL------------VARVETG..DGEHG--------------------------------------------
B7VMX8_VIBTL/6-222--IDNIDLNL------------CCRYVKE...VTAN--------------------------------------------
Q87KC8_VIBPA/6-222--IDNIDMKL------------CCRYIAE...APDD--------------------------------------------
D2SH36_GEOOG/3-216--VTAVRVAL------------QATVEVE...SGDS--------------------------------------------
U5VQ01_9ACTN/3-218--IEHITLGL------------VTRVEVE...GGQG--------------------------------------------
A9B5Z7_HERA2/2-209--IEALYLFL------------VARYTRE...YDDS--------------------------------------------
Q8CK18_STRCO/3-217--IEGLSVGL------------QAKVEVE...SGDQ--------------------------------------------
A1S9J4_SHEAM/2-218--IDGIDLAL------------MTRAKVS...TDNG--------------------------------------------
F8AWR6_FRADG/3-216--VNEIRVAL------------EATVEVE...TDDS--------------------------------------------
D5XEE5_THEPJ/2-202--IEKIYINL------------VLNSKYG...SGDE--------------------------------------------
F6CIG7_DESK7/3-202--VDKIYINL------------ILSSAYK...AGDQ--------------------------------------------
E8U7T1_DEIML/4-201--IERLNFSL------------MTLARHD...DT..--------------------------------------------
D9SYU9_MICAI/3-218--VSYIALGL------------VTRVEVE...SSDS--------------------------------------------
SP0M_BACSU/4-212--IRYIDLQL------------STRYVIV...KDDE--------------------------------------------
D6Y483_THEBD/3-219--IEHITLSL------------VAQVEIE...HGDR--------------------------------------------
D7B3X5_NOCDD/3-216--IAEIVLVL------------VARTEDE...EGEA--------------------------------------------
A6W415_KINRD/4-215--VEEVVVAL------------QARVEVE...SGDS--------------------------------------------
A5D298_PELTS/2-203--IEQIYITL------------VLDSSYK...HDDE--------------------------------------------
Q7MGK0_VIBVY/6-223--IDNIHLKL------------CCRYIAE...VKED--------------------------------------------
I0JR17_HALH3/2-206--IDSIHIFL------------MTEALRE...SGDK--------------------------------------------
L0A4L1_DEIPD/4-200--IEHIELFV------------LAGNSDQ.......--------------------------------------------
C1D0Z4_DEIDV/4-201--VERINVGL------------ATRYKHD...DS..--------------------------------------------
Q8YPP0_NOSS1/22-229--IQDIYLKL------------ATEYQRE...VDDS--------------------------------------------
R4LYD7_9ACTN/3-214--VETIAVGL------------VTRAEAE...DGD.--------------------------------------------
C6WBH8_ACTMD/3-218--IDRVKLTL------------VTRVEVE...RGDE--------------------------------------------
R4SZZ1_AMYOR/2-217--IEEILLSL------------VTRVEVE...HGDH--------------------------------------------
Q3IE37_PSEHT/2-218--IAGLDLLL------------MTRVKAS...NEDG--------------------------------------------
E4N440_KITSK/3-218--INGITLCL------------VARVEVE...YEDG--------------------------------------------
D3Q3X8_STANL/19-229--VEGIALDF------------TAVVEAE...DEGD--------------------------------------------
G2NX38_STRVO/3-217--IEHLALEL------------VARVEAG...DGGE--------------------------------------------
E2Q1G0_STRC2/1-209--VEHITLEL------------VARVETESFDHGEG--------------------------------------------
U5W7Z2_9ACTN/3-218--IEYVAVGL------------MTRVEVE...SGDS--------------------------------------------
D4GQ21_HALVD/1-207--IGKVRFEL------------ETRYRTD...DG..--------------------------------------------
C4L3D6_EXISA/2-213--VDSIYLFF------------NTLYKHE...VNDK--------------------------------------------
L0JQI9_NATP1/1-204--VESISVAL------------VTRYETD...ES..--------------------------------------------
U5LEI3_9BACI/4-214--IDQIYLAL------------NTTYIRE...SDDK--------------------------------------------
B7GKU0_ANOFW/25-235--IDDIYLSL------------CTMYTKE...VDDR--------------------------------------------
C5D3Y3_GEOSW/2-199--IRKLEVEL------------QLIVQTN...GK..--------------------------------------------
H2K613_STRHJ/3-217--VEHIGLEL------------IARVEAE...HADG--------------------------------------------
Q9KVV0_VIBCH/21-237--IDNIELKL------------CCCYIAE...VADE--------------------------------------------
Q2J8X7_FRASC/3-216--IEKVLVAL------------EATVEVE...TDDS--------------------------------------------
D9STE5_CLOC7/4-212--ISRIEVEL------------KTEYLKE...IDDS--------------------------------------------
Q81QV7_BACAN/2-213--IESIYLTL------------STSYIRE...VDDK--------------------------------------------
X5A5U4_9BACL/4-211--IDKIYIYV------------KTQYEKE...DNDR--------------------------------------------
D2B8E4_STRRD/3-215--VEGIFIDF------------TAVVEVE...SGDN--------------------------------------------
F2EZY3_SOLSS/4-214--IDAIYLTL------------HTNFIRE...IDDK--------------------------------------------
Q5V309_HALMA/3-209--IDSVYFAL------------ETEYKSD...EG..--------------------------------------------
Q6LLI7_PHOPR/4-219--IDNINVQL------------CCRYIDE...VPVS--------------------------------------------
E4NWJ2_HALBP/1-207--ISAIDLEV------------ETRYRTE...EG..--------------------------------------------
E1SSB8_FERBD/2-218--INGLELSL------------MTMAEVE...HEGG--------------------------------------------
D7AXU0_NOCDD/3-217--VERLTVGL------------QARVEVE...SGDH--------------------------------------------
F4FG08_VERMA/3-218--IEHLAVGL------------VTRVEIE...SGDS--------------------------------------------
D3EJD4_GEOS4/4-211--VDRIYLKL------------MTEYTRE...SDDK--------------------------------------------
I0H7C6_ACTM4/3-218--IEHITLGL------------VTRMEVE...GGGG--------------------------------------------
B1VNV5_STRGG/3-217--VDRISLLL------------VARVERE...DQDE--------------------------------------------
H8MVT2_CORCM/3-210--IDRIDLHL------------MAQYLQR...DNDR--------------------------------------------
H8GZW1_DEIGI/5-201--IERVNLGL------------ATRYRSD...DS..--------------------------------------------
Q5L337_GEOKA/2-211--IDEIYLAL------------VTTYLRE...IDDK--------------------------------------------
C0ZHJ0_BREBN/2-209--IDEIYMYV------------VTHYEKE...SNDS--------------------------------------------
H2JK05_STRHJ/3-217--IDHITLEL------------VARVEAE...HEHG--------------------------------------------
Q8EMA6_OCEIH/2-211--IDQIYLSV------------NTKYIKE...SDDD--------------------------------------------
F0LQ35_VIBFN/4-220--IDNIELKL------------CCRYIAE...VTMA--------------------------------------------
Q5L3I0_GEOKA/3-199--IRNLDVVL------------QLEVHAE...GK..--------------------------------------------
E1V3I8_HALED/2-214--LDALVLDL------------ASEAIKE...VDDK--------------------------------------------
R4SRA3_AMYOR/2-218--INGLSVKL------------LARVTLP...DERR--------------------------------------------
G2NQ97_STREK/3-217--VESITLEL------------VARVEAE...HEEG--------------------------------------------
C7MVV3_SACVD/2-217--IGEVALSL------------VTRVEME...TGDH--------------------------------------------
Q47QI1_THEFY/3-218--IEEISVCL------------ASAVEVE...AGDT--------------------------------------------
B1YLT3_EXIS2/2-212--IARIYLAF------------NTQYKQE...VGDS--------------------------------------------
D2RPW6_HALTV/1-204--VDGIYFAL------------ETRYETD...ES..--------------------------------------------
D1A596_THECD/3-218--IQRITLAL------------VTRVEVE...VGDH--------------------------------------------
D2ASM7_STRRD/3-218--IEHITLGL------------VTRIETE...HSEG--------------------------------------------
N0B2E1_9BACI/13-223--INEIYLSL------------YTTYIKE...ADEK--------------------------------------------
H6NE63_9BACL/4-211--VDSIYIYI------------KTQYIKE...ENDQ--------------------------------------------
K0K0P9_SACES/2-217--IDQIVLSL------------VTRVEVE...HGDH--------------------------------------------
Q5E1Q2_VIBF1/4-219--IDNIDLKL------------CCQYKKE...VHRK--------------------------------------------
I7BQH2_NATSJ/1-201--IDDIYFAL------------ATRYETD...ES..--------------------------------------------
K0JWS7_SACES/3-218--IDEVKLAL------------VTRVEVE...SGDN--------------------------------------------
V6K362_STRNV/3-217--IDRVTLEL------------VARVEAE...HEEG--------------------------------------------
A4FGU2_SACEN/3-218--IEHVALGL------------VTRIETE...HGGH--------------------------------------------
Q5YZ34_NOCFA/2-216--ISQIAVEF------------VTRAEVE...YDDH--------------------------------------------
D9T8R1_MICAI/3-218--IDHITVGL------------VTRVEID...GAEE--------------------------------------------
C6CSI9_PAESJ/5-212--IDTIQMSV------------MTEYIRE...SNDN--------------------------------------------
D1A1F2_THECD/3-218--IRYVSVAL------------RTRVEVE...SGDS--------------------------------------------
G0G8W7_AMYMS/2-215--IKGLAVTL------------LARVGVP...GDR.--------------------------------------------
U5W8Q8_9ACTN/3-214--IDNIVLSL------------VTRVEAE...DGD.--------------------------------------------

PF04425

A3GGA7_PICST/92-585--FGLFTVSL------------EGTIKAT---ERNT--------------------------------------------
A5DRA9_PICGU/36-464--FDMMYVVF------------EGSFLVA---NA..--------------------------------------------
Q6BJG5_DEBHA/93-577--FGLFVVTL------------DGTIKTT---HSNP--------------------------------------------
A5DPQ0_PICGU/115-602--FGLFTVSL------------EGTIKAT---ERMD--------------------------------------------
Q6BSG0_DEBHA/5-422--FDMVYVVF------------EGMLVVL---ENN.--------------------------------------------
Q6BVD1_DEBHA/28-455--FDMFYVLF------------EGNLTVA---NT..--------------------------------------------
Q5ABB5_CANAL/19-455--FDMFSVQL------------EGCAIFG---K.T.--------------------------------------------
Q75E04_ASHGO/51-474--FEMFYVTL------------EGYATVI---DR..--------------------------------------------
BUL1_YEAST/108-543--FEMFYVTL------------ESYISII---DK..--------------------------------------------
A5E3Q9_LODEL/66-535--FGLFTVSL------------EGTIKSL---ERSA--------------------------------------------
A3LX53_PICST/9-457--FDMFSTVL------------EGCATFG---SNG.--------------------------------------------
Q6FUH4_CANGA/102-545--FEMFYVTL------------EAYTSVI---DK..--------------------------------------------
Q6CSE2_KLULA/69-505--FEMFYVTL------------EGCACVI---DK..--------------------------------------------
Q6FP46_CANGA/103-568--FEMFYVTL------------EAYISIV---DK..--------------------------------------------
Q5AN22_CANAL/97-598--FGLFTVSL------------EGTIKSV---ERNP--------------------------------------------
A7TIV7_VANPO/87-537--FEMFYVTL------------EAYTSVI---DR..--------------------------------------------
E7KSA7_YEASL/88-524--FEMFYVTL------------EAYISVI---DR..--------------------------------------------
G0VB73_NAUCC/105-559--FEMFYVTL------------EAYISII---DR..--------------------------------------------
G0VC27_NAUCC/80-515--FEMFYVTL------------EAYTSIV---DK..--------------------------------------------
G0VC28_NAUCC/152-590--FEMFYVTL------------EAYTSVI---DK..--------------------------------------------

PF03643

VPS26_DICDI/8-284LTENKT.FSYDFSNVEKQ....YESYNGTNVRLRYFVRL-TIGRSF.ASN----IV------------------------
VP26A_HUMAN/8-283LTQSRS.YDFEFMQVEKP....YESYIGANVRLRYFLKV-TIVRRL..TD----LV------------------------
PEP8_YEAST/5-364LQHSQS.FPFLFRDLSKR....YESYKGKNVDVAYYVKV-TVMRKS..TD----IS------------------------
VP26A_ARATH/8-283IYERKT.YPFEFSSVEMP....YETYNGVNVRLRYVLKV-TVTRGY.AGS----IV------------------------
VPS26_SCHPO/5-279MRHAQM.FEFEFKHVDKP....YESYIGKNVKLRYICRV-TVSRKM..KD----VI------------------------
VPS26_DROME/6-280LIQNNS.YPFDFPKVEKQ....FEVYAGSNVRLRYFLRA-TIVRRI..SD----IT------------------------
VPS26_CAEEL/7-282LTQNAQ.FPFEFNNVEKP....FETYMGTNVKLRYFLRV-TVIRRL..TD----LT------------------------
DSCR3_MOUSE/1-283IPSGKTEVPFEFPLLVKGSKVLYETYHGVFVNIQYTLRC-DMRRSLLAKD----LT------------------------

PF00339

B4LEM0_DROVI/17-172KFSKEL-I--------------LCR..EQIVPMTNPNME-M.TPMQ--EK....IV------------------------
ARRS_BOVIN/22-180SFRRDL-Y--------------FSQV.QVFPPVGAS..G-ATTRLQ--ES....LI------------------------
Q9I7L0_DROME/5-150RRRRRR-T--------------FCGR.EDYIASKTFLVG-SNLSSQ--VS....IE------------------------
H2N0W5_ORYLA/17-173AFRRDL-F--------------LVTR.QVYPELQDKEKL-THTKIQ--QK....LL------------------------
Q23674_CAEEL/4-159VRHNCA-D--------------HKGK.IVYCRFETIVWK-S.DGAK--ND....MP------------------------
ARD17_CAEEL/7-155CSHSEP-Y--------------FL...EQFNPGYTHKFT-VVKDGK--EK.ERILP------------------------
H2RRP6_TAKRU/18-174SFRKDL-Y--------------ISTF.QAFPPVPEER.K-PNSRLQ--ER....LL------------------------
Q9VGU7_DROME/5-155TTKSLV-T--------------HTTT.EVYYSTDQPVYG-QAGGSQ--LE....LP------------------------
Q20577_CAEEL/7-158SYTEIV-H--------------YSAE.VDYVSGETIAWS-A.RNGT--EK....LP------------------------
P91469_CAEEL/7-159YRPHGV-Y--------------YSAN.VKYLDYTQLLWT-C.GEGP--KE....LN------------------------
Q9VI00_DROME/5-148TEHYTE-Y--------------FRGK.QQYLYTRTSVFG-S.....--GN....LP------------------------
Q20232_CAEEL/7-150KSGERR-T--------------LKDD.QYVLDEKQLLWG-KDKSDE--SDSVPILA------------------------
ARRD4_MOUSE/18-166CIGGGS-P--------------AASSEVEYLNLRLSLLE-APAGEG--VT....LL------------------------
O17983_CAEEL/6-146KIIKDK-K--------------CKKGEETYVEMKHEVWT-P.EDTE--NT....FP------------------------
PALF_YEAST/39-201TFLYGQ-D--------------YVKT..AFSAKEKKPHV-DKTTIL--NG....LS------------------------
ARRB1_BOVIN/18-174TFRKDL-F--------------VANV.QSFPPAPEDK.K-PLTRLQ--ER....LI------------------------
Q8SYU5_DROME/5-157KKRSKH-Q--------------YSGR.EDYIASTTYLMG-SEQGSN--FN....MD------------------------
O17981_CAEEL/6-159YDSESV-H--------------YSSN.VHYLDQALLLWA-C.KDGS--NE....LS------------------------
Q9XXI4_CAEEL/4-156RFTENV-N--------------YNAT.INYLTGESIAWQ-S.RDGT--DR....LP------------------------
F6SKI7_XENTR/21-176TFRKDL-Y--------------FART.QIYPPVEDP..K-ALTKVQ--ER....LM------------------------
Q9VI53_DROME/6-155TENEVT-Q--------------LKGH.EEYFKIQYYLLG-GKNSSE--TE....LP------------------------
H2L9D1_ORYLA/14-171CFRKDI-W--------------IQQI.QIYPESSKPALS-A...MH--DT....LL------------------------
ARRB_CAEEL/22-186TFRKDL-I--------------SETF.QVYPQTDKSISR-PLSRLQ--ER....LK------------------------
Q9XXI0_CAEEL/6-159RSSEHI-N--------------YTSK.INVLEGIAQPWS-SIENAN--NK....IP------------------------
Q23672_CAEEL/8-142YCKKDL-F--------------RKSE.........MVWV-S.KDGQ--NK....MP------------------------
ARRD2_MOUSE/9-158STAYTQ-S--------------YSER.VEVVNHRATLLA-PDSGDI--AT....LP------------------------

PF13002

A7TSP7_VANPO/130-321YELIAT-VKYKDPR.......RDLPT....F.GKVQSLK-LSMPIAVTRS----IL------------------------
C5GL98_AJEDR/142-318YNLTAC-AVT...................TS.GKEL..C-LNRPIKIKRA----VM------------------------
YNSK_SCHPO/63-242YYLEAT-LCY..G..........TPEGGISP.SKPEVLK-F..PLQLKRA----AI------------------------
C5DVA9_ZYGRC/141-332YELCAV-VTYKD............PRRGASPHQKDQLLQ-LVMPVPVTRS----LP------------------------
E7KUR3_YEASL/144-346YELIAV-VTYIDPHRNSFSSGHSTPRKEGSS.SKKRLLQ-LAMPIAVTRS----IP------------------------

PF02752

Q7PUI7_ANOGA/236-407......-....................SNG.KFKNIVAE-.VDVSK--------HI........................
Q9TYQ0_CAEEL/174-315......-..................MIDRK.SITIAVES-..HGTC--------KT........................
Q7PUR5_ANOGA/187-319......-....................QQH.LEHTVLEE-..RTIG--------RV........................
Q7PYD9_ANOGA/175-306......-....................KTR.RETHTIVK-..HIGD--------GV........................
Q380N5_ANOGA/183-323......-................IPKEESN.VQYEVLEV-..RKIP--------SI........................
CRED_ASPOR/181-332......-....................SIR.NTYKNTRT-..ILND--------EFELDHD...................
Q752Z4_ASHGO/228-382......-....................QVY.DDEAVAHR-..AAME--------HFTDVAG...................
ARRD5_HUMAN/184-321......-..................RRSRL.DSSELLRQ-..EANT--------PV........................
ARRD4_HUMAN/191-318......-....................KTK.TIRHMVAN-..VRGN--------HI........................
Q294M9_DROPS/171-302......-....................EHA.RVERIIIS-.RAKGD--------AV........................
Q6BI98_DEBHA/278-420......-....................VSG.DFEELIGK-.QTMSI--------PD........................
Q294M7_DROPS/174-306......-....................DTN.KDRFVVAE-..KAGE--------GV........................
Q6BIN4_DEBHA/247-390......-....................PAH.SEERVVVS-.KTISQ--------PNE.......................
Q293Z7_DROPS/175-308......-....................VQK.VECIAIAN-..KETG--------SV........................
Q9I7K7_DROME/179-320......-..................RLETK.VERQTVLS-SRHELH--------NL........................
A5DM18_PICGU/246-387......-....................RSP.EYEEIIGK-.QDLKI--------NP........................
Q294M5_DROPS/171-304......-....................KTR.DIEKKLHG-.CCQGE--------RV........................
Q16ZK0_AEDAE/170-299......-....................KTK.VISKTFAS-...VST--------AI........................
A0BIT0_PARTE/173-314......-....................KLS.NYFDLFDQ-..ELNF--------..........................
Q4V467_DROME/125-256......-....................GSK.CERKSVAK-..LKAD--------GV........................
Q7SC90_NEUCR/193-351......-....................EPT.KKVNKIAK-.HTQPV--------GV........................
Q66L50_DANRE/187-314......-....................KVK.EIKQLIAN-..LRGD--------PL........................
Q95NF3_ANOGA/193-351......-....................QNG.SYRNTVAS-..LETS--------EGC.......................
Q6C993_YARLI/185-326......-....................HNK.QVEKVVAN-.KTIEA--------TA........................
O44847_CAEEL/147-273......-........................IYGNTKAK-.GKMHV--------LV........................
A0CWE9_PARTE/173-316......-....................KLS.NYFDIYLQ-..ELNE--------QI........................
Q23QU8_TETTS/188-318......-....................NTQ.RTKYINIF-..EKMV--------NV........................
Q6ZM71_DANRE/162-286......-........................YDLRSVAE-..VEGP--------GV........................
A8WP41_CAEBR/178-317......-................THHTHHK.NDEKCVAE-.SRRNF--------DV........................
Q0E8K8_DROME/169-299......-....................VVQ.TEKRELAV-..LVRG--------KI........................
A0C0J3_PARTE/194-337......-....................HAR.VLYRVCAS-..SSIQ--------GI........................
Q16ZJ7_AEDAE/171-300......-....................KSR.VVGKCLAS-...VWT--------TV........................
Q23YG0_TETTS/188-318......-....................NTQ.REKHVVIY-..EQPM--------SV........................
Q9W7R1_ORYLA/193-351......-....................SND.SYTKCVDY-..EDNG--------DS........................
ARRB_CAEEL/205-363......-....................TTA.SYSCEVAR-..IESN--------EGF.......................
Q7RZE0_NEUCR/198-350......-...................VREH.KKEREISV-.WKIPI--------EREKHW....................
ALY2_SCHPO/345-506......-..............KRRVLLAER.SAKHQNTD-.NLFET--------PD........................
Q5AM66_CANAL/305-457......-....................PMK.TDERIIAK-.KKIPK--------RKKNNNGD..................
ARRB2_MOUSE/195-350......-....................STA.QYKCPVAQ-..LEQD--------DQ........................
A2BIP7_DANRE/186-313......-.....................RK.IHTHDLLK-..EVGE--------SV........................
ARRD1_HUMAN/162-286......-........................HDVRTIAE-..VEGA--------GV........................
A2QR01_ASPNC/439-613......-..............AKKVLLFEK.RADSASTS-.EEIVD--------RNRTNL....................
Q380P6_ANOGA/182-314......-....................ETR.TDALVVAE-..SRCS--------GV........................
YC9F_SCHPO/183-325......-..................STCRK.EFKRALVK-.KTIPG--------L.........................
Q16H74_AEDAE/171-301......-....................KSK.SVLSTLVK-..YQCG--------GV........................
Q6DH07_DANRE/192-355......-....................SAD.KYTKNVLT-..EEFG--------ET........................
A8X4Z9_CAEBR/175-315......-................SCHDHHK.DDSKRVAE-.TRKNI--------KI........................
ART1_SCHPO/287-428......-....................SSPIVRKKKVLR-.YEEDL--------DD........................
ARRD2_HUMAN/180-307......-....................ARK.QKRAVVAS-..LAGE--------PV........................
Q294M6_DROPS/179-311......-....................RTT.SEKIMLVK-..RECG--------PV........................
ADCC_DICDI/344-478......-....................GTS.YQLLTMTK-..KFYP--------KI........................
Q6CS19_KLULA/219-373......-....................NPN.GADRTILK-.VKIQD--------PLHHINNGE.................
Q2UDU8_ASPOR/60-215......-...............NVHFLSSK.REHIIFNE-..RHNL--------DDCI......................
Q22NR4_TETTS/187-325......-....................ENK.QKKLTISD-..INLI--------QI........................
ROD1_YEAST/232-395......-....................GVI.NQERMVAK-.LKLKD--------PLKHVAQIKKKRS.............
A0CL31_PARTE/172-315......-..................LEFQL.NYQHHKGP-..QKGN--------KI........................
APYA_EMENI/180-326......-..................SAHAA.RTETIVCS-.DRYTL--------GEE.......................
Q296V0_DROPS/178-310......-....................EKR.ESKVIISN-..LSIG--------PV........................
Q6CW08_KLULA/282-443......-....................EVY.DDENVIQK-..QMLA--------RFDDLPG...................
A8WP33_CAEBR/159-305......-...............YKCHLHNS.EQFFTYGR-.YGKGE--------KHKT......................
A0DYQ7_PARTE/173-314......-....................KLS.NYFDIFDQ-..ELIF--------..........................
A0D2Y0_PARTE/206-342......-....................IDRVILNQVVFS-..KILP--------GA........................
A7TQI8_VANPO/357-526......-...........LLAEHNGPKLENLGENNNSSK-.AKYLG--------NLLV......................
Q17EA7_AEDAE/182-314......-....................EQR.QEFTVLEE-..RITG--------KI........................
Q9W2V2_DROME/420-633......-....................NNG.KFKNVVAD-..SDNV--------TPPV......................
Q240M9_TETTS/188-318......-....................TAD.KTKVLNIA-..EKSI--------EV........................
A5DUN4_LODEL/264-404......-....................PMH.SAERVIAS-.KKIPK--------KD........................
A0NDX6_ANOGA/173-303......-....................QVR.TVYNTLAK-..FQCS--------GV........................
Q16ZJ5_AEDAE/174-305......-....................RVK.NLSTIVAQ-..VRCA--------GV........................
Q7QCL7_ANOGA/170-301......-....................VMQ.TEKRELAV-..IARG--------KI........................
A2QTZ8_ASPNC/184-328......-....................TLS.RRARVIAE-.DDFYP--------RDWNED....................
O17983_CAEEL/173-318......-.............ADGADGFKSK.LEEQILET-.KIERC--------NV........................
Q9V393_DROME/233-393......-....................STA.QYKSVVAE-..IESE--------DGC.......................
A0BMC5_PARTE/210-346......-....................IERVVENVKVFQ-..QNLG--------GV........................
A1C8U8_ASPCL/140-283......-....................QAI.RSRDILTD-.NYTAA--------GWGD......................
A0D004_PARTE/178-324......-..................RSKII.AEEQISTT-.TKKLG--------SY........................
Q16ZK1_AEDAE/136-269......-....................KVK.TNRQDVTG-..AELD--------QV........................
Q17EA8_AEDAE/183-323......-................QLYAENKLIKYETIEM-..QRTS--------AV........................
Q16ZJ8_AEDAE/186-315......-....................KAR.NEAKTVAK-...MVT--------TV........................
PALF_ASHGO/233-368......-....................GTD.DPMETFRK-..DICQ--------CVAP......................
ARRS_MOUSE/200-361......-....................SSD.YYVKPVAS-..EETQ--------EK........................
A8WP37_CAEBR/170-319......-............KDCPVPPVYTR.NCEKVLNS-.RVYPC--------NV........................
Q9GYT5_CAEEL/181-328......-...........NEKMSDKIQRIK.FDTKKVVK-.VCQKL--------EV........................
MU170_SCHPO/266-426......-.....SCGYLKRYQKTKTKTRAK.STWKIANK-..SVYS--------NL........................
A5DW17_LODEL/261-403......-....................RSP.EFERLCGK-.QQLHF--------PD........................
A0D012_PARTE/172-315......-..................LEFQL.SALSQNGL-..QKGL--------KI........................
ADCA_DICDI/313-441......-....................YHR.CITNAIYK-..QQYD--------GF........................
Q9I7L0_DROME/174-307......-....................NTT.SERLVVNT-..FKGD--------AV........................
A7SF55_NEMVE/129-256......-...................SVNK.QVKVLQRS-..SMSL--------EL........................
Q16ZK2_AEDAE/273-408......-....................RQR.IESVVVSK-..NVSP--------GI........................
A8XYD8_CAEBR/172-316......-..............ANAKGFKSQ.AEKTVLET-.KIERC--------QI........................
A0E996_PARTE/174-317......-....................RIS.NYFGLSKQ-..AHNI--------VV........................
Q0U5A6_PHANO/182-337......-..................ISHQT.DVQVAVTE-.GDMPP--------NSANRVP...................
PALF_YEAST/259-394......-....................GKD.DPMETFRK-..DICQ--------SISP......................
Q23672_CAEEL/163-311......-............HSCPLSVYHQT.NSSNCIGE-..ATAL--------KVN.......................
A7TPY5_VANPO/228-381......-....................TII.NQERIVTK-.MKVKD--------PLNYASEN..................
Q759V0_ASHGO/221-368......-....................GSK.AEERTVSK-.IKLSD--------PLGHL.....................
Q9VGU7_DROME/180-316......-...................EQLK.VTESRVAD-..KHCG--------EV........................
Q6FM62_CANGA/224-379......-....................PKQVEKERKVTQ-.MKIRN--------PLKELARNV.................
A7SKJ5_NEMVE/177-307......-....................KQR.RRTNEILR-..HNHP--------GV........................
Q6CGL3_YARLI/174-329......-....................EPV.EKRRKVVK-.NTKQV--------DQ........................
ARRD5_MOUSE/170-307......-..................RRRRA.DSSELLRQ-..MANA--------RI........................
Q17624_CAEEL/176-340......-....................ASP.WRTLLVRK-.LESNQ--------ET........................
A0D9C9_PARTE/194-337......-....................HSK.LIHRSCGT-..SMIP--------GL........................
A0CE97_PARTE/209-345......-....................VERVIEDQVVVS-..QNWD--------GL........................
Q7PYE1_ANOGA/178-310......-....................ETK.RKKELVTT-..ISMG--------PV........................
Q16ZJ6_AEDAE/174-302......-....................KSR.TDSQNAVK-..IENR--------DH........................
A7SL06_NEMVE/167-299......-....................EYQ.VKDRLIDS-..VKRE--------GV........................
ARD17_CAEEL/179-307......-...................EHIK.NVVRVISK-..IDKG--------EV........................
Q17HB8_AEDAE/169-300......-....................LLH.QERRELAA-..IVRD--------RI........................
ADCB_DICDI/337-465......-....................GVP.TQVLKVSK-..NFFP--------KI........................
Q23FQ6_TETTS/188-318......-....................RRY.RDQVVTQF-..EKST--------TF........................
Q294M3_DROPS/163-297......-....................VKRNFYTKTLTK-.ELITD--------RT........................
A8WP43_CAEBR/183-324......-..............HCHKHCDHK.TAETKMSE-.VEKSF--------EV........................
A3LXL3_PICST/266-408......-....................TSP.EYEQLHGK-.QNMPI--------PD........................
O17981_CAEEL/182-333......-............TLMSGSSQQTK.YDTKPVIT-.QTQPM--------TV........................
Q16ZK3_AEDAE/167-301......-....................YQK.VDRTIVCK-..NVTP--------GI........................
A8X383_CAEBR/164-301......-..................VNEKK.LAEQLIEM-..VPLG--------AV........................
Q20232_CAEEL/173-309......-....................ENK.MMSCVVFE-..HKSP--------AI........................
A0BCE6_PARTE/199-335......-....................NERVIENKTLYS-..NVLP--------GL........................
Q5AP77_CANAL/170-448HLEAYK-QEVMKCPENNLLFSCYEVENDNN.NGNGNGNG-..NGNK--------NVKQK.....................
A0BDM3_PARTE/168-302......-....................EPK.VIVEQISK-..LSLP--------GV........................
Q23674_CAEEL/182-339......-........KEKITYATRLNAQTR.VEERQISE-.TNIDI--------KI........................
ARRD5_BOVIN/171-309......-..................RRSRV.DSSELLRQ-..EANT--------HI........................
YA4C_SCHPO/180-322......-..................LPASK.DEVRTVRS-.LQTEE--------L.........................
Q294M1_DROPS/173-305......-....................EYR.YDKHLIAR-..KQFG--------NV........................
A0A0D1DR37_USTMA/181-316......-................KAASQKT.ETLSSKSK-..SFGK--------KV........................
A7TDW3_VANPO/229-389......-....................PVT.YQERLITK-.LKIKD--------PLGHVELFSNKL..............
Q6FY06_CANGA/237-406......-....................VSS.LDDRLVSK-.TKIKD--------PFGHLAKLRKKKYTAK.......SLT
A6R1F7_AJECN/559-759......-..............SKKVLLFEK.RADSQSTS-..AFPG--------SVCRVTAGGGVAYDARREAAEGIEYV
Q9XXC4_CAEEL/159-308......-............SDCPIESKYRR.DGETVLRG-.ANYSC--------DV........................
A7TQH7_VANPO/294-447......-....................QLY.NDEVVALK-..QSMT--------DFEGFI....................
Q16ID9_AEDAE/216-390......-....................STA.QYKCTVAE-..VESE--------QATV......................
PALF_KLULA/263-398......-....................RNT.EQIETFRK-..DICQ--------GVAP......................
Q6CG62_YARLI/321-486......-..............ARKYLVFEH.KPDGGIQD-..SLLP--------NLDG......................
A0A0D1E8U6_USTMA/601-804......-............KWTLMKVAHAS.ATEPILPI-.LSDSA--------DALDNSPLAPMARA...........A
Q9XTU0_CAEEL/176-327......-...........SLSENDRYLSRK.RDEIKIVS-.VIHEM--------HI........................
YOA5_SCHPO/223-379......-..............SHLNLSRKN.SEVSKTCK-.CLQKE--------TIRCNKKS..................
Q0CQZ7_ASPTN/118-273......-...............NVHFLTST.REHLVLSE-..RYDS--------SDDY......................
E7LU16_YEASV/179-340......-....................PVI.SENRQVTE-.LNLED--------PLNESSEEFNGN..............
F1QAH2_DANRE/171-293......-....................RAV.HTTEILKE-..KGEP--------LV........................
F6SKI7_XENTR/196-355......-....................SSD.YYIKTVAL-..EDSQ--------DK........................
F6Y0E4_XENTR/163-285......-....................RVV.YDLRTIAE-..VEGA--------PV........................
G4VCF9_SCHMA/96-254......-....................NNN.RYNCVVDE-..LETD--------ESF.......................
H2N0W5_ORYLA/194-351......-....................SND.KYVKSVAK-..EETD--------DS........................
H3CCN8_TETNG/163-285......-....................RPL.FDLRTIAE-..VEGA--------GV........................
H3DDA7_TETNG/203-325......-....................KRT.VHARNILK-..VMAE--------AI........................
ART5_YEAST/332-474......-....................QIY.DDEIAVMK-.ITHLA--------DF........................
Q08CX7_XENTR/182-306......-....................TMK.QKKSVVAT-..LAGD--------AV........................
TXNIP_MOUSE/176-299......-....................QTK.VFTQKLSS-..VRGN--------HI........................
Q9VI00_DROME/172-303......-....................KTR.EKEHSLNK-.SCQQE--------RV........................

PF07070

E3E849_PAEPS/4-211------------KT...........VTTCC.IARIKVSD.GFHLKQ----------------------------------
Q9F2L5_STRCO/29-244------------DG...........EGVVV.FGRHTVGG.PFRLAA----------------------------------
B7VMX8_VIBTL/6-222------------SQGQEGG.HKRRMHQTYS.LAKWSLPY.AFVIQP----------------------------------
Q87KC8_VIBPA/6-222------------RGAREGH.SMRRVPQTHV.LAKWNLPY.AFTIHP----------------------------------
D2SH36_GEOOG/3-216------------SW...........REEVT.FGTVAVAG.AARVEP----------------------------------
U5VQ01_9ACTN/3-218------------EY...........GATGE.FHRVGVSG.PLRLAE----------------------------------
A9B5Z7_HERA2/2-209------------KI...........TQDHT.IGQYPLTQ.RFQLQP----------------------------------
Q8CK18_STRCO/3-217------------EY...........KQDVE.FTKVRLGG.AFQLKA----------------------------------
A1S9J4_SHEAM/2-218------------DY...........FKNHC.LARWRVAE.RFEIQP----------------------------------
F8AWR6_FRADG/3-216------------TW...........YENVS.FGTRSIGG.KFTIAA----------------------------------
D5XEE5_THEPJ/2-202------------TK...........PVSRT.VGTVKVTD.KLTLAP----------------------------------
F6CIG7_DESK7/3-202------------TR...........NIRRI.IGTVTVGE.KMVVRP----------------------------------
E8U7T1_DEIML/4-201------------.............TSAHA.VARVTLGE.RVTLRA----------------------------------
D9SYU9_MICAI/3-218------------EY...........DVNQE.FGRAQVTG.AFRLEP----------------------------------
SP0M_BACSU/4-212------------EH...........RKYAT.IHSFRVTG.SFTIQP----------------------------------
D6Y483_THEBD/3-219------------ER...........RGVGE.FYRYQVSG.PTVLRK----------------------------------
D7B3X5_NOCDD/3-216------------.............TGGAE.CTRVPVAA.GVSLDA----------------------------------
A6W415_KINRD/4-215------------EW...........REDVV.FGSARVGA.GFTTVP----------------------------------
A5D298_PELTS/2-203------------TR...........HLRQE.IGTVKVSD.GMLVKA----------------------------------
Q7MGK0_VIBVY/6-223------------RGSSSQGQQTRRVPQSHV.LASWSLPY.AFVIKP----------------------------------
I0JR17_HALH3/2-206------------KI...........KEKVA.IQKYPIAH.QETIKE----------------------------------
L0A4L1_DEIPD/4-200------------.............VNMHE.VQRARVCG.PLEIAP----------------------------------
C1D0Z4_DEIDV/4-201------------.............YVNHT.LQSEVVVP.AFTIRP----------------------------------
Q8YPP0_NOSS1/22-229------------TV...........TEECV.MVNYRLLE.HLTIQP----------------------------------
R4LYD7_9ACTN/3-214------------..............ALLE.FHRAWVAA.GFTLAP----------------------------------
C6WBH8_ACTMD/3-218------------EH...........VRNVE.FAGVVVAE.KVVVGA----------------------------------
R4SZZ1_AMYOR/2-217------------ER...........AGTAE.FLRVSAGR.KVRVTA----------------------------------
Q3IE37_PSEHT/2-218------------DY...........FTNHV.IEQWRITD.IGTVEP----------------------------------
E4N440_KITSK/3-218------------EA...........HRTQE.FAPLRVSG.PLRLAA----------------------------------
D3Q3X8_STANL/19-229------------E............QVEYD.FHGADVCE.PFLLEA----------------------------------
G2NX38_STRVO/3-217------------EG...........AGGVV.FDRLRLSG.GFRLDT----------------------------------
E2Q1G0_STRC2/1-209------------EG...........EGVVV.FDRFTVAE.GIRLAA----------------------------------
U5W7Z2_9ACTN/3-218------------EY...........NTDQE.FHRQRLTG.SFKLDA----------------------------------
D4GQ21_HALVD/1-207------------.............YREVD.IAQYTLAE.SLTVQP----------------------------------
C4L3D6_EXISA/2-213------------ST...........YSTFT.IEKILLNEAPFMIGP----------------------------------
L0JQI9_NATP1/1-204------------.............YGTAK.FEADALTN.SFTIDP----------------------------------
U5LEI3_9BACI/4-214------------KY...........TAAGV.IDKYRIAE.TLVIQP----------------------------------
B7GKU0_ANOFW/25-235------------KV...........MKQAV.IEKWKIAQ.SFVIRA----------------------------------
C5D3Y3_GEOSW/2-199------------.............AYRRT.VAVIPVSP.SFTIQP----------------------------------
H2K613_STRHJ/3-217------------ES...........EGTVA.FERFTVGG.GFRLGE----------------------------------
Q9KVV0_VIBCH/21-237------------RGQQQGQ.PMRRVPHTYT.LANWSLPY.AFTIEA----------------------------------
Q2J8X7_FRASC/3-216------------TW...........HEQVT.FGTQQIGG.GFTIHP----------------------------------
D9STE5_CLOC7/4-212------------KV...........RCTAN.LLRLVVAR.DLVIAP----------------------------------
Q81QV7_BACAN/2-213------------KI...........TTTTYDLERVRLTE.PFSVEP----------------------------------
X5A5U4_9BACL/4-211------------KV...........THEVE.IARILITE.GLLLQA----------------------------------
D2B8E4_STRRD/3-215------------EH...........KSTYS.FLRKQITG.PFHLAA----------------------------------
F2EZY3_SOLSS/4-214------------KI...........KDEAV.LHKYKLNE.PFTIQA----------------------------------
Q5V309_HALMA/3-209------------.............YKDAI.IDQWQLTE.PFTIEA----------------------------------
Q6LLI7_PHOPR/4-219------------RGDSEH..RKEKRPQTCV.LATWSLPE.SFVIGV----------------------------------
E4NWJ2_HALBP/1-207------------.............YRDTT.VGRMRLSE.SFDIEP----------------------------------
E1SSB8_FERBD/2-218------------ES...........RQPVR.LHHWHLDD.RFTVAA----------------------------------
D7AXU0_NOCDD/3-217------------ES...........TRDLE.FHRVQIGG.GVTLAP----------------------------------
F4FG08_VERMA/3-218------------EY...........AGVME.FHRHPISG.AFQLAP----------------------------------
D3EJD4_GEOS4/4-211------------KY...........IESYT.IAKVNVSS.RLTLKP----------------------------------
I0H7C6_ACTM4/3-218------------DY...........SAVAD.FHRLTVSG.PMRLAA----------------------------------
B1VNV5_STRGG/3-217------------EH...........EGTVV.LERFTVGG.GFRLAE----------------------------------
H8MVT2_CORCM/3-210------------RS...........ALNAV.VRTWRVAN.PFTLQP----------------------------------
H8GZW1_DEIGI/5-201------------.............TVTHT.LFSQPVVP.GFTIRP----------------------------------
Q5L337_GEOKA/2-211------------KH...........EEKAV.LARYKVSG.SLTIGP----------------------------------
C0ZHJ0_BREBN/2-209------------KT...........KEECT.LVKYRLSE.RVQLKP----------------------------------
H2JK05_STRHJ/3-217------------ES...........EGAVV.FERFTVGG.GFRLGE----------------------------------
Q8EMA6_OCEIH/2-211------------KR...........YHVNLIIDKFKIAE.SFTIQP----------------------------------
F0LQ35_VIBFN/4-220------------RGREEGG.STRRMPQAHT.LASWSLPY.AFTIAA----------------------------------
Q5L3I0_GEOKA/3-199------------.............AYRRT.AAVIPVAS.SFTIQP----------------------------------
E1V3I8_HALED/2-214------------KV...........HLPHS.WATLRLSE.AMTIEP----------------------------------
R4SRA3_AMYOR/2-218------------PG...........VEDLE.FGSQQLAG.NERIGP----------------------------------
G2NQ97_STREK/3-217------------ES...........EGTVS.FGRFTVSG.GFVLTE----------------------------------
C7MVV3_SACVD/2-217------------EF...........TGTAE.FFRVVAQQ.GVWVPA----------------------------------
Q47QI1_THEFY/3-218------------EG...........VSRVE.FARFPVTG.AFPLGP----------------------------------
B1YLT3_EXIS2/2-212------------KT...........FTTFT.LDRFVLNEAPFTIEA----------------------------------
D2RPW6_HALTV/1-204------------.............ARTGT.IDSFRIAD.PFTIEP----------------------------------
D1A596_THECD/3-218------------EG...........AGGME.FHRVDVSG.PFRLPK----------------------------------
D2ASM7_STRRD/3-218------------EH...........TGLGE.FFRTEVSG.PFKLGV----------------------------------
N0B2E1_9BACI/13-223------------KY...........TNNAL.IDQVRIND.PFVIKK----------------------------------
H6NE63_9BACL/4-211------------KV...........RKTAE.VAKIRVTE.GFLVQA----------------------------------
K0K0P9_SACES/2-217------------EF...........AGVSE.FLRIPVAQ.GVRVAA----------------------------------
Q5E1Q2_VIBF1/4-219------------SENGSQ...TQMIKQTHV.LADWSLPY.AFTIEP----------------------------------
I7BQH2_NATSJ/1-201------------.............TRTAK.IETVRVGD.SFTIDP----------------------------------
K0JWS7_SACES/3-218------------EH...........NRNVE.FARAVVAR.NVQVGP----------------------------------
V6K362_STRNV/3-217------------ES...........EGFVG.FARYEVGG.GFRLGE----------------------------------
A4FGU2_SACEN/3-218------------DG...........DAFVE.FHRVVVAG.RFELAE----------------------------------
Q5YZ34_NOCFA/2-216------------EG...........VREIG.FGRVGVTG.PLHLPA----------------------------------
D9T8R1_MICAI/3-218------------EY...........DALVE.FHRVQVAG.GLHLRE----------------------------------
C6CSI9_PAESJ/5-212------------RF...........RQHGE.IGRYDVST.PFTLEA----------------------------------
D1A1F2_THECD/3-218------------EY...........NTNME.YAKVQLTG.PFQLRK----------------------------------
G0G8W7_AMYMS/2-215------------.............TEDLP.FETRQLVG.GEVIRA----------------------------------
U5W8Q8_9ACTN/3-214------------..............ALIE.FHRVSVAG.HFTLPA----------------------------------

PF04425

A3GGA7_PICST/92-585------------------HAEANEAHKYNKILMKKFLKM--YDFNA--------SYGYTDVPNSAGIE.....YEAFSID
A5DRA9_PICGU/36-464------------------....KNKKDRVPVKVKQFLQM--FDFTA--------SWNHGNIDRLITESSH.PYTCPNIVD
Q6BJG5_DEBHA/93-577------------------NANPADIHKYDKVLIKKFLKM--YDLNA--------SYGYTQIPNSAGIE.....YEAFTKD
A5DPQ0_PICGU/115-602------------------NDGTQSPHRYKKVLMKKFLKM--YDLNA--------SYGYTHIPSSVGVE.....YKEYTRD
Q6BSG0_DEBHA/5-422------------------...RGLMDVKKPSKVHKFLTM--LDLFA--------SWSYANIARLSTDDGDPHDWCYGETD
Q6BVD1_DEBHA/28-455------------------....LDVNDRKPSKVERFLQM--FDFSA--------SWNHAYINRLITEYAN.AYECPLITD
Q5ABB5_CANAL/19-455------------------...NNSTLVEQPSHIDRFLNM--FDFNA--------SWNDAFLDRLVTEHND.PTHIGTIYD
Q75E04_ASHGO/51-474------------------........MKGKRTVKRFLRM--VDISA--------SWSYSSVESANGYA.....YTQSYKD
BUL1_YEAST/108-543------------------........VKSKRTIKRFLRM--VDLSA--------SWSYSKIALGSGVD.....FIPADVD
A5E3Q9_LODEL/66-535------------------..NP.LQQRYRKILMKKILKM--YDLCA--------GYSYGYVPSSAGIE.....FVPFTED
A3LX53_PICST/9-457------------------..NLQSSVVRPPTTVVRFLTM--FDFNA--------SWNDAALDRLVSDNNN.PMVPTIIID
Q6FUH4_CANGA/102-545------------------........QKGKRTLKRFLRM--VDLSA--------SWSYSSIEVSSGIE.....IEYGGVD
Q6CSE2_KLULA/69-505------------------........KQGKRTVKRFLRM--VDLSA--------SWSYSNIDLATGFQ.....YVPGDID
Q6FP46_CANGA/103-568------------------........QKGKRTIKRFLRM--VDMSA--------SWSYSSMQVSSGIE.....YVPGDVD
Q5AN22_CANAL/97-598------------------.HAMGLTHKFSKILMKKFLKM--YDLNA--------SYGYVQVPNSAGIQ.....YEPFSHD
A7TIV7_VANPO/87-537------------------........QKGKRTVKRFLRM--VDLSA--------SWSYTNMCLATGVN.....LVAGDVD
E7KSA7_YEASL/88-524------------------........QKGKRTLKRFLRM--VDLSA--------SWSYTNITPSTGIN.....IVPGERD
G0VB73_NAUCC/105-559------------------........KKGKRVVKRFLRM--VDLSA--------SWSYTTIDLGSGIN.....VLPGQLD
G0VC27_NAUCC/80-515------------------........QRRKRTLKRFLRM--VDMSA--------SWSYTNISMGTGKK.....MPPGEID
G0VC28_NAUCC/152-590------------------........TKGKRTVKRFLRM--VDLSA--------SWSYTNIFMGTGWK.....MTPGEID

PF03643

VPS26_DICDI/8-284------------KE-YDIWVI.............NF...V-----------KPP..........................
VP26A_HUMAN/8-283------------KE-YDLIVH.............QL...A-----------TYP..........................
PEP8_YEAST/5-364------------KI-KRFWVY.............LYNSVT-----------TAPNTLSANETKATTNDIAGGNYAADNAS
VP26A_ARATH/8-283------------EY-QDFVVR.............NY...V-----------PLP..........................
VPS26_SCHPO/5-279------------RE-KDLWVY.............RF...E-----------NEP..........................
VPS26_DROME/6-280------------KE-VDIAVH.............TL...C-----------SYP..........................
VPS26_CAEEL/7-282------------KE-LDLVVH.............AL...S-----------SYP..........................
DSCR3_MOUSE/1-283------------KT-CEFIVHSAPQKGKLTPSPVDF...T-----------ITP..........................

PF00339

B4LEM0_DROVI/17-172------------RK-LGSHAH-------------PFT--F-----------HFP--------------------------
ARRS_BOVIN/22-180------------KK-LGANTY-------------PFL--L-----------TFP--------------------------
Q9I7L0_DROME/5-150------------A.-.GIHTY-------------NFV--C-----------LIP--------------------------
H2N0W5_ORYLA/17-173------------RK-LGDNAF-------------PFF--F-----------EFP--------------------------
Q23674_CAEEL/4-159------------S.-.GPHIF-------------PFS--F-----------QLP--------------------------
ARD17_CAEEL/7-155------------A.-.GIHQV-------------PFS--Y-----------TLP--------------------------
H2RRP6_TAKRU/18-174------------KK-LGQHAH-------------PFY--F-----------TIP--------------------------
Q9VGU7_DROME/5-155------------T.-.GKYVF-------------PFR--A-----------TIP--------------------------
Q20577_CAEEL/7-158------------S.-.GHHVF-------------PFA--F-----------PLP--------------------------
P91469_CAEEL/7-159------------A.-.GEYAW-------------PFS--Y-----------TLP--------------------------
Q9VI00_DROME/5-148------------P.-.GTHTY-------------NFC--I-----------PLP--------------------------
Q20232_CAEEL/7-150------------R.-.GVHQF-------------SFN--F-----------DLP--------------------------
ARRD4_MOUSE/18-166------------QP-.GKHEF-------------PFR--F-----------QLP--------------------------
O17983_CAEEL/6-146------------S.-.GDYEW-------------NFS--F-----------ELP--------------------------
PALF_YEAST/39-201------------K.-.GEHRF-------------PFR--I-----------RIP--------------------------
ARRB1_BOVIN/18-174------------KK-LGEHAY-------------PFT--F-----------EIP--------------------------
Q8SYU5_DROME/5-157------------A.-.GTYTY-------------TFA--C-----------PIP--------------------------
O17981_CAEEL/6-159------------A.-.GDYVW-------------PFS--Y-----------TLP--------------------------
Q9XXI4_CAEEL/4-156------------A.-.GTNVF-------------PFA--F-----------NLP--------------------------
F6SKI7_XENTR/21-176------------KK-LGNNAY-------------PFL--L-----------QFP--------------------------
Q9VI53_DROME/6-155------------P.-.GTHTY-------------PFT--C-----------ALP--------------------------
H2L9D1_ORYLA/14-171------------KK-AGDNSY-------------PFS--F-----------EIP--------------------------
ARRB_CAEEL/22-186------------RK-LGANAF-------------PFW--F-----------EVA--------------------------
Q9XXI0_CAEEL/6-159------------G.-.GVNIF-------------PFL--F-----------QLP--------------------------
Q23672_CAEEL/8-142------------E.-.GGYIW-------------TFE--I-----------KLP--------------------------
ARRD2_MOUSE/9-158------------A.-.GRHEF-------------PFS--F-----------QLP--------------------------

PF13002

A7TSP7_VANPO/130-321------------R---GPDKN-------------SLR--V-----------FPP--------------------------
C5GL98_AJEDR/142-318------------P---GPDKY-------------SMR--I-----------FPP--------------------------
YNSK_SCHPO/63-242------------P---SPDTI-------------HKR--I-----------FPP--------------------------
C5DVA9_ZYGRC/141-332------------R---GPDKN-------------SLR--V-----------FPP--------------------------
E7KUR3_YEASL/144-346------------R---GPDKN-------------SLR--V-----------FPP--------------------------

PF02752

Q7PUI7_ANOGA/236-407..............-GPGDTL-------------HASYSL............LPVRGTTKNWIAVEGALFSSNSA.....
Q9TYQ0_CAEEL/174-315.............K-AGVGPQ-------------TKEIEF...........SVP..........................
Q7PUR5_ANOGA/187-319............AG-RNDAVF-------------E..ENI...........LIG..........................
Q7PYD9_ANOGA/175-306............AP-ESQKQY-------------E..QRL...........VVP..........................
Q380N5_ANOGA/183-323............EG-ENDARF-------------V..ESF...........VVG..........................
CRED_ASPOR/181-332.......NALEIID-EAAEGY-------------QFSRYL...........DLP..........................
Q752Z4_ASHGO/228-382.......CDPARGN-LLVDAV-------------RLQLPF...........SVP..........................
ARRD5_HUMAN/184-321............TR-FNTTKV-------------V..STF...........NLP..........................
ARRD4_HUMAN/191-318............AS-GSTDTW-------------N.GKTL...........KIP..........................
Q294M9_DROPS/171-302............LK-QCTRSL-------------T..IGL...........PVP..........................
Q6BI98_DEBHA/278-420...........SNS-LSADRW-------------DVKSTF...........KVPS.........................
Q294M7_DROPS/174-306............SK-NSRKQF-------------T..FDL...........KVP..........................
Q6BIN4_DEBHA/247-390..........NDPE-FQMDKW-------------EVDNYL...........KVP..........................
Q293Z7_DROPS/175-308............QK-KSERSF-------------A..HEL...........LMP..........................
Q9I7K7_DROME/179-320............PR-GELQNF-------------QHLHML...........QVP..........................
A5DM18_PICGU/246-387............GH-AEEDYW-------------DIRTQF...........HLP..........................
Q294M5_DROPS/171-304............LR-FSKRII-------------K..GSL...........LIP..........................
Q16ZK0_AEDAE/170-299............NN-DVFSRL-------------Q..QQL...........DIP..........................
A0BIT0_PARTE/173-314............AA-GEQKEV-------------K..TIL...........SLPNGK.......................
Q4V467_DROME/125-256............LR-NSRKMY-------------D..FQL...........MIP..........................
Q7SC90_NEUCR/193-351.............K-LTETGY-------------VTNLGL...........VFPARDLRDP...................
Q66L50_DANRE/187-314............HS-GKTETW-------------DG.KML...........KIP..........................
Q95NF3_ANOGA/193-351...........PIQ-PGSS.L-------------QKVMYL............TPLLSSNKQRRG................
Q6C993_YARLI/185-326...........DGY-EGHDLW-------------EVDDFF...........PIP..........................
O44847_CAEEL/147-273............AP-YSTQKF-------------T..IPF...........TIP..........................
A0CWE9_PARTE/173-316............QA-HSQKQI-------------A..TKI...........HLPTGK.......................
Q23QU8_TETTS/188-318............KV-EKT.HI-------------NENVQL...........QVP..........................
Q6ZM71_DANRE/162-286............KG-GNKSEW-------------N..QQI...........IVP..........................
A8WP41_CAEBR/178-317............AP-HSRGQV-------------V..LSM...........KIP..........................
Q0E8K8_DROME/169-299............RP-GAKDEW-------------H..NEL...........YVP..........................
A0C0J3_PARTE/194-337............ES-GQSALN-------------EHKKDM...........NLPLVD.......................
Q16ZJ7_AEDAE/171-300............TT-DKSATY-------------S..QNL...........EIP..........................
Q23YG0_TETTS/188-318............KV-EKS.QI-------------KQEVQI...........QIP..........................
Q9W7R1_ORYLA/193-351............VS-AGAT.L-------------KKVYTL............LPLLANNRERRG................
ARRB_CAEEL/205-363...........PVG-PGGT.L-------------SKVFAV............CPLLSNNKDKRG................
Q7RZE0_NEUCR/198-350........QDVIED-TGQEGW-------------VMNTGL...........DLP..........................
ALY2_SCHPO/345-506............EG-DGLSSA-------------VFNFNV...........ALP..........................
Q5AM66_CANAL/305-457......EEEEEEEV-DMFDQW-------------QIDTII...........NIP..........................
ARRB2_MOUSE/195-350............VS-PSST.F-------------CKVYTI............TPLLSDNREKRG................
A2BIP7_DANRE/186-313............EP-NSKKTI-------------T..TVL...........TIP..........................
ARRD1_HUMAN/162-286............KA-WRRAQW-------------H..EQI...........LVP..........................
A2QR01_ASPNC/439-613.......LGNLSSD-AGVGPT-------------EMEFNV...........QLPS.........................
Q380P6_ANOGA/182-314............TS-GEVVKH-------------Q..QNL...........LIP..........................
YC9F_SCHPO/183-325.............P-MVDDYW-------------QDQIMV...........KIP..........................
Q16H74_AEDAE/171-301............DR-NKSAGY-------------E..RRL...........LVP..........................
Q6DH07_DANRE/192-355............VE-ANSS.F-------------EKSLDI............TPLLANNKEKRG................
A8X4Z9_CAEBR/175-315............TA-RTHGRE-------------Q..LMM...........KIP..........................
ART1_SCHPO/287-428............MK-LTSEGL-------------SKSLSK...........PFPDI........................
ARRD2_HUMAN/180-307............GP-GQRALW-------------QG.RAL...........RIP..........................
Q294M6_DROPS/179-311............AH-HAQKIY-------------T..ETL...........RIP..........................
ADCC_DICDI/344-478............KQ-NTACKQ-------------M..VVI...........ELP..........................
Q6CS19_KLULA/219-373.....YDATNTTEF-DFQDKW-------------EINTSV...........RIP..........................
Q2UDU8_ASPOR/60-215.........APESE-EPDLEW-------------CITKTI...........SLP..........................
Q22NR4_TETTS/187-325............VP-PKSVKE-------------NVGIHF...........KIPD.........................
ROD1_YEAST/232-395LNEAADEGVDTDTG-EFQDKW-------------EVRALL...........NIP..........................
A0CL31_PARTE/172-315............QP-IQKQDY-------------Q..LQLIN.......LKNPP..........................
APYA_EMENI/180-326...........YSS-KALESY-------------QFSRTL...........QLP..........................
Q296V0_DROPS/178-310............NG-GESRTF-------------T..QQL...........EIP..........................
Q6CW08_KLULA/282-443.......CDPTQDN-LLIDQI-------------KLNSVL...........QFP..........................
A8WP33_CAEBR/159-305..........PVAP-YTEGKF-------------K..IPF...........TIP..........................
A0DYQ7_PARTE/173-314............EA-GDEKEI-------------K..TTF...........KLPQGK.......................
A0D2Y0_PARTE/206-342............NQ-GERLEA-------------QI.AKF...........EIP..........................
A7TQI8_VANPO/357-526..........DDST-GDLVNK-------------EFEYQV...........FVP..........................
Q17EA7_AEDAE/182-314............AK-RQDAKL-------------E..ENI...........LIG..........................
Q9W2V2_DROME/420-633..........DRTV-AAGASL-------------NTTVTL............RPQRGPTKNWIA................
Q240M9_TETTS/188-318............KV-EQS.KM-------------KQEVQF...........QVP..........................
A5DUN4_LODEL/264-404...........PSE-LEFDKW-------------EFETFM...........RLP..........................
A0NDX6_ANOGA/173-303............DA-KGSAGY-------------E..RRF...........LVP..........................
Q16ZJ5_AEDAE/174-305............QR-RNKGSY-------------V..QHL...........LVP..........................
Q7QCL7_ANOGA/170-301............RA-GHRDEW-------------QN.ESL...........YVP..........................
A2QTZ8_ASPNC/184-328.......EFRITSD-NEGCWH-------------SLTRFL...........RLP..........................
O17983_CAEEL/173-318............PA-RSSKDF-------------A..FSF...........DIP..........................
Q9V393_DROME/233-393...........QVA-PGFT.L-------------SKVFEL............CPLLANNKDKWG................
A0BMC5_PARTE/210-346............NS-GQKLER-------------QN.ASL...........EIP..........................
A1C8U8_ASPCL/140-283.........VIPSS-DGADWY-------------HIIRRL...........QLP..........................
A0D004_PARTE/178-324............KV-LNQQEV-------------VLFAQLKNHNNNDQYNMIQP..........................
Q16ZK1_AEDAE/136-269............DD-PDVVRY-------------E..ESI...........LVP..........................
Q17EA8_AEDAE/183-323............AR-QTNANF-------------E..KHF...........LVG..........................
Q16ZJ8_AEDAE/186-315............TR-DKSDQY-------------T..QDL...........VIP..........................
PALF_ASHGO/233-368..........LYVE-PETHTC-------------SVGMNL...........NVP..........................
ARRS_MOUSE/200-361............VQ-PNST.L-------------TKTLVL............VPLLANNRERRG................
A8WP37_CAEBR/170-319............PP-GETEQV-------------M..VAV...........DLP..........................
Q9GYT5_CAEEL/181-328............PA-KNEHKF-------------V..LEL...........RIP..........................
MU170_SCHPO/266-426............AP-TLKNTI-------------H..AQI...........KIP..........................
A5DW17_LODEL/261-403...........TST-LPYDKW-------------VIKTHF...........KVP..........................
A0D012_PARTE/172-315............QP-ASQIGC-------------S..LQLV........NTKQP..........................
ADCA_DICDI/313-441............QP-CFYGKR-------------Y..LPF...........SIP..........................
Q9I7L0_DROME/174-307............QR-NCKKLF-------------S..YEI...........RVP..........................
A7SF55_NEMVE/129-256..............-......-------------...DEF...........EVP..........................
Q16ZK2_AEDAE/273-408............RL-PDGGVL-------------AE.DNL...........QVP..........................
A8XYD8_CAEBR/172-316............QP-DEIMPF-------------E..FSF...........VIP..........................
A0E996_PARTE/174-317............KG-GQKRQL-------------EYKLKLEQ.......DSNDP..........................
Q0U5A6_PHANO/182-337......EGVEEADE-MFDESH-------------RFSMTL...........DLP..........................
PALF_YEAST/259-394..........IYIN-PETLQF-------------QSRVYL...........KVP..........................
Q23672_CAEEL/163-311...........VAP-YSTKSI-------------I..LPF...........TIP..........................
A7TPY5_VANPO/228-381.....INPSNEEDS-EFKDRW-------------ELDLNL...........PIP..........................
Q759V0_ASHGO/221-368........SGEPDS-HAEDRW-------------DLSMTI...........AVP..........................
Q9VGU7_DROME/180-316............LK-HNKAKF-------------D..EFL...........TVP..........................
Q6FM62_CANGA/224-379.....NFQDDEDNS-EFKDSW-------------DLQAYL...........KIP..........................
A7SKJ5_NEMVE/177-307............RP-HSEQHL-------------PG.LLV...........QIP..........................
Q6CGL3_YARLI/174-329..............-KLARDF-------------KFELSM...........DYPQYEPKDK...................
ARRD5_MOUSE/170-307............PA-FNSTTV-------------V..SAF...........NLP..........................
Q17624_CAEEL/176-340............PA-KTKGAI-------------EQSGLFL.........LTVPPVCPSTKGDYE...............
A0D9C9_PARTE/194-337............QA-GQSALN-------------EQRKNM...........TLSLVD.......................
A0CE97_PARTE/209-345............LA-GQSKDR-------------IV.SLL...........ELP..........................
Q7PYE1_ANOGA/178-310............EA-GNSQTW-------------Q..QFL...........QIP..........................
Q16ZJ6_AEDAE/174-302............QQ-DVEGKF-------------E..RNL...........LIP..........................
A7SL06_NEMVE/167-299.............A-RGKEVI-------------IDDVTI...........TIP..........................
ARD17_CAEEL/179-307............PG-GSTTEW-------------QE.ESI...........TIP..........................
Q17HB8_AEDAE/169-300............KS-GIRDVL-------------QN.GHL...........TVP..........................
ADCB_DICDI/337-465............QQ-NQQSTQ-------------I..VVM...........ETP..........................
Q23FQ6_TETTS/188-318............KI-NSK.QV-------------SQEIQL...........QIP..........................
Q294M3_DROPS/163-297............LR-LSKRQY-------------E..SSI...........CVP..........................
A8WP43_CAEBR/183-324............NC-CSEGII-------------Q..VAL...........VLP..........................
A3LXL3_PICST/266-408...........QET-LPDDKW-------------TISTHY...........KVP..........................
O17981_CAEEL/182-333............TP-GNEHKF-------------V..LEF...........RLP..........................
Q16ZK3_AEDAE/167-301............RL-PEGGVL-------------AA.ENL...........QVP..........................
A8X383_CAEBR/164-301............RS-RCRMEF-------------EK.CLL...........RIP..........................
Q20232_CAEEL/173-309............AA-NSQGKY-------------DSTLEQP.........IRLP..........................
A0BCE6_PARTE/199-335............SA-GKRSEG-------------LK.SSI...........TLP..........................
Q5AP77_CANAL/170-448.........NKDQP-MIATPL-------------D..INV...........SLPFLTTMSDSLIMTSAIEEEGSDSPHTS
A0BDM3_PARTE/168-302............IQ-GIVQTI-------------KKSILL..............FDF.......................
Q23674_CAEEL/182-339............DK-NEKQEV-------------E..KPI...........PLP..........................
ARRD5_BOVIN/171-309............TA-FNTTKI-------------V..STF...........HLP..........................
YA4C_SCHPO/180-322.............E-EFSDHY-------------ELTKNL...........ELP..........................
Q294M1_DROPS/173-305............LR-WSRKVY-------------R..GYL...........DLP..........................
A0A0D1DR37_USTMA/181-316............YK-GDVHTF-------------D..LVC...........QIP..........................
A7TDW3_VANPO/229-389..KGRNIPNSVPPM-DYQDAW-------------DITAEF...........QIP..........................
Q6FY06_CANGA/237-406DPNFNTGSDDDSDM-DFQDKW-------------DINTTI...........EIP..........................
A6R1F7_AJECN/559-759NPRNTNLLGDLEES-FEVGPT-------------EMEFNV...........QLPT.........................
Q9XXC4_CAEEL/159-308............AP-GEVKYI-------------N..VEI...........DLP..........................
A7TQH7_VANPO/294-447.......KINERTG-SLIDKV-------------EIDSMI...........KMP..........................
Q16ID9_AEDAE/216-390.........RIQTS-KATTNQ-------------EPVVEL............QPRIRSLTLMDVIRTEPQL.........
PALF_KLULA/263-398..........LYTD-PETHEA-------------VIMLKL...........KVP..........................
Q6CG62_YARLI/321-486..........VQEL-MAGGAT-------------ELEFDV...........VIP..........................
A0A0D1E8U6_USTMA/601-804AGEDQDSDALPSIL-DPTGPW-------------ELATEL...........SIP..........................
Q9XTU0_CAEEL/176-327............EP-RTEHKA-------------K..MRL...........KIP..........................
YOA5_SCHPO/223-379......NCYNWNGI-AALETY-------------TTECHI...........QIP..........................
Q0CQZ7_ASPTN/118-273.........ATREG-AFEIEW-------------TAEKQV...........CLP..........................
E7LU16_YEASV/179-340.SCFVNNPFFQPDH-SFQDKW-------------EIDTIL...........QIP..........................
F1QAH2_DANRE/171-293.............S-STRENL-------------Y..KVL...........PLP..........................
F6SKI7_XENTR/196-355.............V-PSKASY-------------NHTFTL............LPLLAYNREKRE................
F6Y0E4_XENTR/163-285............KA-WKRAVW-------------D..EQI...........LVP..........................
G4VCF9_SCHMA/96-254...........PIL-PSQTGW-------------CKVYKL............RPLLANNRHKRG................
H2N0W5_ORYLA/194-351.............V-PSGTTL-------------KKEYTL............HPLLAYNKDRRG................
H3CCN8_TETNG/163-285............KA-GKHAEW-------------R..EQI...........IVP..........................
H3DDA7_TETNG/203-325............EG-GKKKAV-------------T..QLI...........NLP..........................
ART5_YEAST/332-474.............G-PLTDKL-------------DVDCPF...........TIP..........................
Q08CX7_XENTR/182-306............PA-GKRETW-------------H.GRAL...........KIP..........................
TXNIP_MOUSE/176-299............IS-GTCASW-------------R.GKSL...........RVQ..........................
Q9VI00_DROME/172-303............LR-LSKKKI-------------E..GTL...........AIP..........................

PF07070

E3E849_PAEPS/4-211------------GQ.ELETPF-------------SFRLPL-----------ETP-----------------------VT.
Q9F2L5_STRCO/29-244------------GE.ETSIPF-------------TVTLPW-----------ETP-----------------------ATE
B7VMX8_VIBTL/6-222------------GE.TRDFEC-------------EFDVPL-----------NTP-----------------------VT.
Q87KC8_VIBPA/6-222------------GE.ERTFDV-------------KLDVPW-----------NTP-----------------------VT.
D2SH36_GEOOG/3-216------------GA.RHALPF-------------SLPVPW-----------QCP-----------------------VTA
U5VQ01_9ACTN/3-218------------KQ.QLSLPF-------------EFVVPW-----------ETP-----------------------ITA
A9B5Z7_HERA2/2-209------------GA.QQRIPF-------------SINLPL-----------DTP-----------------------LT.
Q8CK18_STRCO/3-217------------GV.VHAVPF-------------GLEIPW-----------ETP-----------------------ITM
A1S9J4_SHEAM/2-218------------GE.VREIPF-------------SGQLHP-----------ETP-----------------------FTA
F8AWR6_FRADG/3-216------------NQ.ETSGRF-------------ELPVPW-----------QTP-----------------------ITD
D5XEE5_THEPJ/2-202------------GQ.EKTIPV-------------NFEIPL-----------DIP-----------------------IS.
F6CIG7_DESK7/3-202------------GE.EKVYPV-------------SFQIPF-----------GLP-----------------------IS.
E8U7T1_DEIML/4-201------------GE.TRELPF-------------HLTVPY-----------HAP-----------------------IS.
D9SYU9_MICAI/3-218------------GQ.RHDVPF-------------RFQVPW-----------ETP-----------------------LTD
SP0M_BACSU/4-212------------GE.EHQFPF-------------TFTLPL-----------DTP-----------------------IT.
D6Y483_THEBD/3-219------------GE.NRVLPF-------------QMSVPW-----------ETP-----------------------ITE
D7B3X5_NOCDD/3-216------------GE.HLSIPF-------------SHPVPW-----------QAP-----------------------LTE
A6W415_KINRD/4-215------------GQ.RTELPF-------------ALALPW-----------QTP-----------------------ITA
A5D298_PELTS/2-203------------NSPEVSIPV-------------QLRLPY-----------SIP-----------------------IS.
Q7MGK0_VIBVY/6-223------------SE.ERVFDV-------------ALDIPF-----------NTP-----------------------IT.
I0JR17_HALH3/2-206------------GE.TKEIPF-------------SIQLPY-----------HTP-----------------------AS.
L0A4L1_DEIPD/4-200------------GE.ERVLPF-------------EFVLSY-----------HTP-----------------------LS.
C1D0Z4_DEIDV/4-201------------GE.TREFPF-------------TLRVGP-----------GTP-----------------------LS.
Q8YPP0_NOSS1/22-229------------KE.EVVIPF-------------SLNLPD-----------EMP-----------------------LT.
R4LYD7_9ACTN/3-214------------GE.HQDIPF-------------TITPPW-----------ETP-----------------------LTH
C6WBH8_ACTMD/3-218------------GQ.QYSLPF-------------QFQIPL-----------ETP-----------------------LTV
R4SZZ1_AMYOR/2-217------------GQ.LTTVPF-------------QLALPW-----------ETP-----------------------ISA
Q3IE37_PSEHT/2-218------------GE.VKTIPF-------------QARLHS-----------ETP-----------------------ITE
E4N440_KITSK/3-218------------GE.RRAVPF-------------ALPVPW-----------EAP-----------------------LTV
D3Q3X8_STANL/19-229------------GV.EYAVEF-------------DVEVPW-----------ETP-----------------------IST
G2NX38_STRVO/3-217------------RE.HRDVPF-------------TLHIPW-----------ETP-----------------------LTE
E2Q1G0_STRC2/1-209------------GE.QRAVPF-------------GVPLPW-----------ETP-----------------------VTE
U5W7Z2_9ACTN/3-218------------HA.RHDIPF-------------RFDVPW-----------ETP-----------------------ITE
D4GQ21_HALVD/1-207------------DE.QETRDV-------------SLDIPH-----------GTP-----------------------VT.
C4L3D6_EXISA/2-213------------GE.VKEIPF-------------TVNVPF-----------NTP-----------------------LS.
L0JQI9_NATP1/1-204------------DE.ERSFTV-------------SIDIPY-----------HTP-----------------------VT.
U5LEI3_9BACI/4-214------------NE.TREIPF-------------SIQIPE-----------DSP-----------------------LT.
B7GKU0_ANOFW/25-235------------GE.KKQITF-------------SFALPL-----------DTP-----------------------IT.
C5D3Y3_GEOSW/2-199------------GE.RKVLPF-------------SYVLPL-----------HLP-----------------------IT.
H2K613_STRHJ/3-217------------QE.ERELAF-------------SVPLPW-----------ETP-----------------------VTE
Q9KVV0_VIBCH/21-237------------GE.TRNFDI-------------ELSIPW-----------NTP-----------------------VT.
Q2J8X7_FRASC/3-216------------EQ.QISGRF-------------ELPVPW-----------QTP-----------------------ITD
D9STE5_CLOC7/4-212------------NE.RKQIPF-------------GFTVPK-----------HTP-----------------------VS.
Q81QV7_BACAN/2-213------------NE.KREIPF-------------SFKMPV-----------ETP-----------------------LT.
X5A5U4_9BACL/4-211------------GE.TREIPF-------------EMTVPE-----------RAP-----------------------VS.
D2B8E4_STRRD/3-215------------GA.PQSAPF-------------EIPVPW-----------ETP-----------------------ISA
F2EZY3_SOLSS/4-214------------DE.KRQIPF-------------SFSLPP-----------VVP-----------------------VT.
Q5V309_HALMA/3-209------------GE.KRRFET-------------TIDIPR-----------ETP-----------------------VT.
Q6LLI7_PHOPR/4-219------------NE.AREFDV-------------NLELPF-----------NTP-----------------------VT.
E4NWJ2_HALBP/1-207------------GE.ETTYDA-------------EITIPW-----------ETP-----------------------LT.
E1SSB8_FERBD/2-218------------NE.RRSERF-------------ELTLPL-----------ETP-----------------------ITA
D7AXU0_NOCDD/3-217------------GQ.RFEVPF-------------ELFVPW-----------ETP-----------------------VTV
F4FG08_VERMA/3-218------------KQ.QLSIPF-------------QLVVPW-----------ETP-----------------------ITD
D3EJD4_GEOS4/4-211------------GD.QQEIPF-------------AFPLPL-----------ETP-----------------------LT.
I0H7C6_ACTM4/3-218------------GQ.QLSIPF-------------QIDMPW-----------ETP-----------------------ITT
B1VNV5_STRGG/3-217------------EA.EHAVPF-------------SVTLPW-----------ETP-----------------------ITE
H8MVT2_CORCM/3-210------------RE.EREIPF-------------SLRIPA-----------HAP-----------------------IT.
H8GZW1_DEIGI/5-201------------GE.TREFPF-------------ELPVPH-----------GTP-----------------------LS.
Q5L337_GEOKA/2-211------------NE.TKTIPF-------------QFALPY-----------DVP-----------------------VT.
C0ZHJ0_BREBN/2-209------------KE.EVVLPF-------------AFQLPY-----------ETP-----------------------LT.
H2JK05_STRHJ/3-217------------GE.HRSVPF-------------RISLPW-----------ETP-----------------------VTE
Q8EMA6_OCEIH/2-211------------GE.AKEIPF-------------NFDLSP-----------QTP-----------------------LT.
F0LQ35_VIBFN/4-220------------GE.TRDFDV-------------ELAVPW-----------NTP-----------------------VT.
Q5L3I0_GEOKA/3-199------------GE.RKVLPF-------------SYALPL-----------HLP-----------------------IS.
E1V3I8_HALED/2-214------------GE.HRTLPF-------------ELPLPL-----------LSP-----------------------LS.
R4SRA3_AMYOR/2-218------------GQ.QVRIPF-------------EVALPW-----------ETP-----------------------ISS
G2NQ97_STREK/3-217------------GA.EHSIPF-------------DVALPW-----------ETP-----------------------ITE
C7MVV3_SACVD/2-217------------EQ.FVVVPF-------------QIMVPW-----------ETP-----------------------ITA
Q47QI1_THEFY/3-218------------GQ.RHSIPF-------------RYPVPW-----------QAP-----------------------ITA
B1YLT3_EXIS2/2-212------------DV.EREIPF-------------TLQVPF-----------NTP-----------------------LS.
D2RPW6_HALTV/1-204------------DE.DRSFSV-------------SIDVPY-----------HTP-----------------------VT.
D1A596_THECD/3-218------------GQ.DRAVPF-------------QLAIPW-----------ETP-----------------------ITE
D2ASM7_STRRD/3-218------------GE.ERTVPF-------------QVPVPW-----------ETP-----------------------LTE
N0B2E1_9BACI/13-223------------QE.TKQIPF-------------SFELPI-----------DTP-----------------------IS.
H6NE63_9BACL/4-211------------GE.RREIPF-------------SFIIPD-----------YAP-----------------------IS.
K0K0P9_SACES/2-217------------NQ.PLTVPF-------------QLPIPW-----------ETP-----------------------ITA
Q5E1Q2_VIBF1/4-219------------KQ.ERKFEL-------------ELDLPL-----------NTP-----------------------IT.
I7BQH2_NATSJ/1-201------------DE.ERTRTV-------------SIDVPV-----------HTP-----------------------VT.
K0JWS7_SACES/3-218------------GQ.RLALPF-------------QFPVPL-----------ETP-----------------------LTV
V6K362_STRNV/3-217------------ED.SYRVPF-------------EVTLPW-----------ETP-----------------------VNQ
A4FGU2_SACEN/3-218------------GE.DRVIPF-------------EFPVPL-----------EAP-----------------------VTE
Q5YZ34_NOCFA/2-216------------GA.VLEFRF-------------GARAPM-----------ETP-----------------------ITF
D9T8R1_MICAI/3-218------------GQ.QLSLPF-------------QVAMPW-----------ETP-----------------------VTD
C6CSI9_PAESJ/5-212------------GE.TKEVPF-------------SFRLPY-----------QTP-----------------------LT.
D1A1F2_THECD/3-218------------GA.RHSLPF-------------TLQIPW-----------EAP-----------------------LTH
G0G8W7_AMYMS/2-215------------GQ.QIRVPF-------------EVPLPW-----------ETP-----------------------VTS
U5W8Q8_9ACTN/3-214------------GA.REDIPF-------------QMSVPW-----------ETP-----------------------ITH

PF04425

A3GGA7_PICST/92-585ASDGCVIGLPNERVLKPSTKY-------------KKFFTF-----------RFP--------------------------
A5DRA9_PICGU/36-464PIDNAKLAV.KDRTIHPGNVY-------------KRFFTF-----------KIP--------------------------
Q6BJG5_DEBHA/93-577LHDGCELGLPNERVLRPHTKY-------------KKFFTF-----------KFP--------------------------
A5DPQ0_PICGU/115-602.NEGCILGLPNERILQPHQKY-------------KKFFTF-----------TFP--------------------------
Q6BSG0_DEBHA/5-422PYDNTVLSIDVKRFFQPNVTY-------------KRFFTF-----------KIP--------------------------
Q6BVD1_DEBHA/28-455SYDDTKMGF.SNRKLLPGVTY-------------KRFFTF-----------KIP--------------------------
Q5ABB5_CANAL/19-455PIDGTYYHLDHRKILEPGITY-------------KKYFTF-----------KIP--------------------------
Q75E04_ASHGO/51-474.YDNCILGLSNTRVLEPGVKY-------------KKFFTF-----------KFP--------------------------
BUL1_YEAST/108-543.YDGSVFGLNNSRVLEPGVKY-------------KKFFIF-----------KLP--------------------------
A5E3Q9_LODEL/66-535SYDGCEIGLPDDRILQPHRKY-------------KKFFTF-----------RFP--------------------------
A3LX53_PICST/9-457PIDGTHVQLDPRKILEPNITY-------------KKFFAF-----------KVP--------------------------
Q6FUH4_CANGA/102-545.YDNSIIGLNNNRILEPGKKY-------------KKFFMF-----------KLP--------------------------
Q6CSE2_KLULA/69-505.QDGCVLGLNNDRFLQPGVRY-------------KKFFTF-----------KFP--------------------------
Q6FP46_CANGA/103-568.FDDSILGLSNSRTFLPKTKY-------------KKYFMF-----------KIP--------------------------
Q5AN22_CANAL/97-598TSDGSVIGLPTDRLLQPNIKY-------------KKFFTF-----------KFP--------------------------
A7TIV7_VANPO/87-537.YDHSIIGLNNNRVLEPGKKY-------------KKFFTF-----------KLP--------------------------
E7KSA7_YEASL/88-524.FDDAIIGLSNSRELKPNTKY-------------KKFFMF-----------KLP--------------------------
G0VB73_NAUCC/105-559RYDNTIIGLENNRILEPNTKY-------------KKFFMF-----------KLP--------------------------
G0VC27_NAUCC/80-515.FDKTIIGLPNSRILEPMTTY-------------KKYFMF-----------KLP--------------------------
G0VC28_NAUCC/152-590.FDNAVIGLRNSRILEPGTRY-------------KKYFMF-----------KLP--------------------------

PF03643

VPS26_DICDI/8-284.............ESN............SN--I-KMEVGIEDCL------------------------------------
VP26A_HUMAN/8-283.............DVN............NS--I-KMEVGIEDCL------------------------------------
PEP8_YEAST/5-364DNTQTKSTQGEAADVNQVLPISHSNNEPKP--V-RLDIGIENCL------------------------------------
VP26A_ARATH/8-283.............PIN............NS--I-KMEVGIEDCL------------------------------------
VPS26_SCHPO/5-279.............ETN............SL--I-RMDVGIDECL------------------------------------
VPS26_DROME/6-280.............EMN............NP--I-KMEVGIEDCL------------------------------------
VPS26_CAEEL/7-282.............DND............KS--I-KMEVGIEDCL------------------------------------
DSCR3_MOUSE/1-283.............ETL............QN--V-KERA......------------------------------------

PF00339

B4LEM0_DROVI/17-172----------------------------PN..S.PSSVTLQQEG------------------------------------
ARRS_BOVIN/22-180----------------------------DY..L.PCSVMLQPAP------------------------------------
Q9I7L0_DROME/5-150----------------------------TE..C.PSSF......------------------------------------
H2N0W5_ORYLA/17-173----------------------------DN..L.PCSVSLQPGP------------------------------------
Q23674_CAEEL/4-159----------------------------HW..A.PPSF......------------------------------------
ARD17_CAEEL/7-155----------------------------KS..L.PSSF......------------------------------------
H2RRP6_TAKRU/18-174----------------------------QN..L.PCSVTLQPGP------------------------------------
Q9VGU7_DROME/5-155----------------------------PN..A.PTSF......------------------------------------
Q20577_CAEEL/7-158----------------------------IE..C.PPSF......------------------------------------
P91469_CAEEL/7-159----------------------------LN..I.PPSF......------------------------------------
Q9VI00_DROME/5-148----------------------------LE..C.PSSV......------------------------------------
Q20232_CAEEL/7-150----------------------------QS..SLPCSL......------------------------------------
ARRD4_MOUSE/18-166----------------------------SE..PLATSF......------------------------------------
O17983_CAEEL/6-146----------------------------KD..C.PPSF......------------------------------------
PALF_YEAST/39-201----------------------------RGRGM.LSSI......------------------------------------
ARRB1_BOVIN/18-174----------------------------PN..L.PCSVTLQPGP------------------------------------
Q8SYU5_DROME/5-157----------------------------SH..C.PSSF......------------------------------------
O17981_CAEEL/6-159----------------------------LN..V.PPSF......------------------------------------
Q9XXI4_CAEEL/4-156----------------------------IN..C.APSF......------------------------------------
F6SKI7_XENTR/21-176----------------------------DY..L.PCSVSLQPAP------------------------------------
Q9VI53_DROME/6-155----------------------------PN..L.PSSF......------------------------------------
H2L9D1_ORYLA/14-171----------------------------TN..L.PCSVSLQPGP------------------------------------
ARRB_CAEEL/22-186----------------------------PK..S.ASSVTLQPAP------------------------------------
Q9XXI0_CAEEL/6-159----------------------------AN..L.PPSF......------------------------------------
Q23672_CAEEL/8-142----------------------------ID..C.PPTH......------------------------------------
ARRD2_MOUSE/9-158----------------------------IS..L.VTSF......------------------------------------

PF13002

A7TSP7_VANPO/130-321----------------------------TE--L-TATAVLPNVV------------------------------------
C5GL98_AJEDR/142-318----------------------------TN--L-VGRATLPSVV------------------------------------
YNSK_SCHPO/63-242----------------------------TN--L-VANITLPSTL------------------------------------
C5DVA9_ZYGRC/141-332----------------------------TE--L-TATAVLPNVV------------------------------------
E7KUR3_YEASL/144-346----------------------------TE--L-TAAAVLPNVV------------------------------------

PF02752

Q7PUI7_ANOGA/236-407...........DPSSSAYNSKLATSAPRGMLSA-PATS...AEE....................................
Q9TYQ0_CAEEL/174-315................................P-NLPP...TSI....................................
Q7PUR5_ANOGA/187-319................................S-TVPS...DEE....................................
Q7PYD9_ANOGA/175-306.................................-TVIP...TCG....................................
Q380N5_ANOGA/183-323.................................-PVPS...TET....................................
CRED_ASPOR/181-332................................K-TLTRCLQDT.....................................
Q752Z4_ASHGO/228-382................................P-DLKRITQDCD....................................
ARRD5_HUMAN/184-321.................................-LLLSV.SSST....................................
ARRD4_HUMAN/191-318.................................-PVTP...SIL....................................
Q294M9_DROPS/171-302.................................-STPP...TCV....................................
Q6BI98_DEBHA/278-420..............................SLK-ELTQ...TCD....................................
Q294M7_DROPS/174-306.................................-ATPP...TCF....................................
Q6BIN4_DEBHA/247-390................................D-SLSKCTQDCD....................................
Q293Z7_DROPS/175-308................................E-GAQP...TDD....................................
Q9I7K7_DROME/179-320.................................-QTAA...TLT................................V...
A5DM18_PICGU/246-387................................E-SLSKLTQSCE....................................
Q294M5_DROPS/171-304.................................-SVPP...SSR....................................
Q16ZK0_AEDAE/170-299.................................-SIAP...TG.....................................
A0BIT0_PARTE/173-314............................PTKAS-AIFP...QSS....................................
Q4V467_DROME/125-256.................................-STPP...SCF....................................
Q7SC90_NEUCR/193-351........................DGIVKRGKP-GFPMYEVTSF................................T...
Q66L50_DANRE/187-314.................................-PISP...SIL....................................
Q95NF3_ANOGA/193-351.....................IALDGQIKRQDQ-CLAS...TTLL............................AQ.PD..
Q6C993_YARLI/185-326................................P-SLSKVTQDAE....................................
O44847_CAEEL/147-273................................T-DLTA...SF.....................................
A0CWE9_PARTE/173-316............................PDNYT-SIFP...QST....................................
Q23QU8_TETTS/188-318................................G-NVTL...SC.....................................
Q6ZM71_DANRE/162-286.................................-ALPH...SSL....................................
A8WP41_CAEBR/178-317.................................-AIVP...SF.....................................
Q0E8K8_DROME/169-299.................................-PLPP...TNL....................................
A0C0J3_PARTE/194-337............................AGRHK-PLDP...TT.....................................
Q16ZJ7_AEDAE/171-300.................................-SVAP...TG.....................................
Q23YG0_TETTS/188-318................................G-DVTL...SS.....................................
Q9W7R1_ORYLA/193-351.....................IALDGKLKHEDT-NLAS...SSVV............................KE.GV..
ARRB_CAEEL/205-363.....................LALDGQLKHEDT-NLAS...STIL............................DS.KT..
Q7RZE0_NEUCR/198-350................................R-TLGKCVQDV.....................................
ALY2_SCHPO/345-506................................T-CLVKERDRLT..............................F.D...
Q5AM66_CANAL/305-457................................S-SLSKCTQDVD....................................
ARRB2_MOUSE/195-350.....................LALDGQLKHEDT-NLAS...STIV............................KE.GA..
A2BIP7_DANRE/186-313.................................-PSLT...ASI....................................
ARRD1_HUMAN/162-286.................................-ALPQ...SAL....................................
A2QR01_ASPNC/439-613...............................CQ-EMRNRDESQRL.............................H.F...
Q380P6_ANOGA/182-314.................................-AVPP...TYT....................................
YC9F_SCHPO/183-325................................D-SLGECTQDC.....................................
Q16H74_AEDAE/171-301.................................-PEPP...SR.....................................
Q6DH07_DANRE/192-355.....................LALDGRLKDEDT-NLAS...TTII............................RT.GM..
A8X4Z9_CAEBR/175-315.................................-KLAP...SF.....................................
ART1_SCHPO/287-428..............................DFE-DANITGFTT.....................................
ARRD2_HUMAN/180-307.................................-PVGP...SIL....................................
Q294M6_DROPS/179-311.................................-ATAP...TCE....................................
ADCC_DICDI/344-478.................................-.......STTQC...........................VG.LIH.
Q6CS19_KLULA/219-373................................P-NLSKCVQDCL....................................
Q2UDU8_ASPOR/60-215................................Q-DLAA...CTQ................................D...
Q22NR4_TETTS/187-325..............................DPK-LILP...SY.....................................
ROD1_YEAST/232-395................................A-SLTKCSQDCR....................................
A0CL31_PARTE/172-315................................Q-HLTP...SI.....................................
APYA_EMENI/180-326................................Q-ALGHCVQDT.....................................
Q296V0_DROPS/178-310.................................-ALPP...TNL....................................
Q6CW08_KLULA/282-443................................D-DLKRATQDCD....................................
A8WP33_CAEBR/159-305................................A-EATT...PSF....................................
A0DYQ7_PARTE/173-314............................PRNPT-SIFP...QSS....................................
A0D2Y0_PARTE/206-342................................K-NLKA...SV.....................................
A7TQI8_VANPO/357-526................................N-TFAN...KQAL.............................H.P...
Q17EA7_AEDAE/182-314.................................-PGIP...SDD....................................
Q9W2V2_DROME/420-633.....................LEDTLQRSTEPE-EITGAIAASAIRSPHFVMQNAQLLGGCGHPLGSPALVTPHPHLWQP
Q240M9_TETTS/188-318................................S-DIPL...SS.....................................
A5DUN4_LODEL/264-404................................A-SLSKCCQDV.....................................
A0NDX6_ANOGA/173-303.................................-PEPP...TR.....................................
Q16ZJ5_AEDAE/174-305.................................-PLPP...TSK....................................
Q7QCL7_ANOGA/170-301.................................-PLPP...TNL....................................
A2QTZ8_ASPNC/184-328................................N-DPKECLQSL.....................................
O17983_CAEEL/173-318.................................-AVVS...TIR....................................
Q9V393_DROME/233-393.....................LALDGQLKHEDT-NLAS...STLI............................TN.PA..
A0BMC5_PARTE/210-346................................K-SLRA...TI.....................................
A1C8U8_ASPCL/140-283................................R-NRRKCRQSH.....................................
A0D004_PARTE/178-324.................................-.......ST.....................................
Q16ZK1_AEDAE/136-269.................................-QTPV...TST................................D...
Q17EA8_AEDAE/183-323.................................-PITP...TED....................................
Q16ZJ8_AEDAE/186-315.................................-ATAP...TG.....................................
PALF_ASHGO/233-368................................L-DAFP...TLV....................................
ARRS_MOUSE/200-361.....................IALDGKIKHEDT-NLAS...STII............................KE.GI..
A8WP37_CAEBR/170-319................................R-GIPA...TF.....................................
Q9GYT5_CAEEL/181-328.................................-SVTP...TIN....................................
MU170_SCHPO/266-426.................................-EFCR...SVN....................................
A5DW17_LODEL/261-403................................E-NLKQITQSCE....................................
A0D012_PARTE/172-315...............................QI-VLTP...ST.....................................
ADCA_DICDI/313-441................................V-DLKP...SSS....................................
Q9I7L0_DROME/174-307.................................-ATPP...TCF....................................
A7SF55_NEMVE/129-256.................................-DVVP...TMR....................................
Q16ZK2_AEDAE/273-408.................................-WVQP...TSR....................................
A8XYD8_CAEBR/172-316.................................-PVVA...TIR....................................
A0E996_PARTE/174-317................................K-SIFP...QST....................................
Q0U5A6_PHANO/182-337................................K-SLKNCRQSV.....................................
PALF_YEAST/259-394................................L-DAFS...TLT....................................
Q23672_CAEEL/163-311................................E-EAKT...PSF....................................
A7TPY5_VANPO/228-381................................A-SLSKCTQDCS....................................
Q759V0_ASHGO/221-368................................P-SLSKCCQDCT....................................
Q9VGU7_DROME/180-316.................................-PTTP...STQ....................................
Q6FM62_CANGA/224-379................................P-DLMKCSPDCF....................................
A7SKJ5_NEMVE/177-307.................................-PLPP...TMS....................................
Q6CGL3_YARLI/174-329........................DSIVAKERQ-DVPTIAMSGF................................T...
ARRD5_MOUSE/170-307.................................-LVLSV.SSGS....................................
Q17624_CAEEL/176-340....................DPSKIEHILSPYG-KLLESPSTAT..............................L.R...
A0D9C9_PARTE/194-337............................QGRNQ-PLDP...TT.....................................
A0CE97_PARTE/209-345................................K-ELKA...SL.....................................
Q7PYE1_ANOGA/178-310.................................-PLPP...SNL....................................
Q16ZJ6_AEDAE/174-302.................................-SLPP...SS.....................................
A7SL06_NEMVE/167-299.................................-QLRP...TS.....................................
ARD17_CAEEL/179-307.................................-SLPP...KLG....................................
Q17HB8_AEDAE/169-300.................................-PLPP...TNL....................................
ADCB_DICDI/337-465................................Q-TLLN...SIY....................................
Q23FQ6_TETTS/188-318................................S-NVLL...SS.....................................
Q294M3_DROPS/163-297................................M-DTPR...STL....................................
A8WP43_CAEBR/183-324................................N-PLIP...SF.....................................
A3LXL3_PICST/266-408................................E-NLARITQSCV....................................
O17981_CAEEL/182-333.................................-SVTP...TIC....................................
Q16ZK3_AEDAE/167-301.................................-WVLP...SSC....................................
A8X383_CAEBR/164-301................................D-AAPP...TQNY.............................N.RG..
Q20232_CAEEL/173-309.................................-VVPP...TLV....................................
A0BCE6_PARTE/199-335................................N-DLAA...TV.....................................
Q5AP77_CANAL/170-448RRGSAVSMTDNNTTPSNNNPLSPFLGAVETNGA-SI.....NEIGD...........................HT.LF..
A0BDM3_PARTE/168-302.............................HNRM-ELST..........................................
Q23674_CAEEL/182-339.................................-PLPP...STK....................................
ARRD5_BOVIN/171-309.................................-PVLSVSGSGS....................................
YA4C_SCHPO/180-322................................S-SLVECLQDC.....................................
Q294M1_DROPS/173-305.................................-SIPP...TSV....................................
A0A0D1DR37_USTMA/181-316................................R-THTL...MTI....................................
A7TDW3_VANPO/229-389................................A-SLSKCTQDCN....................................
Q6FY06_CANGA/237-406................................P-NLLACVQDCT....................................
A6R1F7_AJECN/559-759...............................CA-ELKKRDPIRSL.............................H.F...
Q9XXC4_CAEEL/159-308................................N-GLPP...TF.....................................
A7TQH7_VANPO/294-447................................D-DLKKATQDCD....................................
Q16ID9_AEDAE/216-390..............SGRDELATELPGRWSRNMV-DGKYRIADPS................................Q...
PALF_KLULA/263-398................................L-DTFP...SLD....................................
Q6CG62_YARLI/321-486.................................-EKVGRDKKERL.............................H.P...
A0A0D1E8U6_USTMA/601-804...............................AC-GTTRINLSTN....................................
Q9XTU0_CAEEL/176-327.................................-CTCP...TF.....................................
YOA5_SCHPO/223-379.................................-DKEA...TIT....................................
Q0CQZ7_ASPTN/118-273................................G-TLDT...VTQ................................Q...
E7LU16_YEASV/179-340................................N-SLSNCVQDCD....................................
F1QAH2_DANRE/171-293................................P-EIS....STI....................................
F6SKI7_XENTR/196-355.....................IALDGKLKHEDT-NLAS...STLL............................KE.GI..
F6Y0E4_XENTR/163-285.................................-ALPQ...SIL....................................
G4VCF9_SCHMA/96-254.....................LALDGKLKHEDT-NLAS...STII............................CN.PN..
H2N0W5_ORYLA/194-351.....................IALDGRLKHEDT-NLAS...SSIV............................KQ.EV..
H3CCN8_TETNG/163-285.................................-PLPQ...SAL....................................
H3DDA7_TETNG/203-325................................M-ELPS...SIF....................................
ART5_YEAST/332-474................................D-NLKQITQDCC....................................
Q08CX7_XENTR/182-306.................................-PLGP...SIL....................................
TXNIP_MOUSE/176-299.................................-KIRP...SIL....................................
Q9VI00_DROME/172-303.................................-AVPP...SSR....................................

PF07070

E3E849_PAEPS/4-211.....HAKQ..PVWLETALDIGMAL.DPTDRDSLKIEPHPYMST------------------------------------
Q9F2L5_STRCO/29-244LYGRQL.GV..VLGVRTELAVAGAR.DSGDPDPFAVAPLPAQEA------------------------------------
B7VMX8_VIBTL/6-222.....IGDS..KVWLETGLDIAMAI.DPSDKDTLTVRPDPLLDG------------------------------------
Q87KC8_VIBPA/6-222.....IGDA..KVWLETGLDVAMAL.DPTDKDILTVRPDPLMDA------------------------------------
D2SH36_GEOOG/3-216IDGWQLRGM..RVGLRTRLDIAGSV.DPGDLDPVTVLPLPVQRT------------------------------------
U5VQ01_9ACTN/3-218VHGQHLRGM..TMGVRTEVSIARAI.DKGDLDPVSVHPLPIQER------------------------------------
A9B5Z7_HERA2/2-209.....MGHQ..PVFIRTGLSISGGV.DAGDVDQLQIQPHPSQAT------------------------------------
Q8CK18_STRCO/3-217IDGQALRGM..NIGVTTELEIARAV.DSGDLDAINVHPLPAQKA------------------------------------
A1S9J4_SHEAM/2-218...LPVRNNQCHVWLQTGADIDSAI.DPTDADVIDILPTPLLGH------------------------------------
F8AWR6_FRADG/3-216VGGWHLRGM..KIGVKTTVDIPGAI.DPGDLDPVSVRPLPVQEA------------------------------------
D5XEE5_THEPJ/2-202.....KGRT..RYYLKTGLDIEQAL.DPTDLDDIKILPNKYMKM------------------------------------
F6CIG7_DESK7/3-202.....RGRT..RYFLQTGLDIPQAI.DPVDHDPIQIVPNREFKM------------------------------------
E8U7T1_DEIML/4-201.....APGV..RLWLHTDADIAGAS.DPGDEDSVRILPNAPTQA------------------------------------
D9SYU9_MICAI/3-218LYGQHLHGM..TMGLRTELEVARAM.DKGDLDPVAVHPLPAHER------------------------------------
SP0M_BACSU/4-212.....VGKV..EVAVVTDLDIQGGI.DKSDHDRIFVEAHPWIEN------------------------------------
D6Y483_THEBD/3-219VDGQHLTGM..AVGVRTELAIAKAV.DKGDLDPIAVMPLPSQRA------------------------------------
D7B3X5_NOCDD/3-216AGGSPLPGV..LAGLRTEVIVDGDA.DKGDLDRVHVHPLPIQDR------------------------------------
A6W415_KINRD/4-215ISGWHLRGV..HVGVATRLVIAGAV.DPGDLDGLTVAPLPVQQA------------------------------------
A5D298_PELTS/2-203.....KGRS..KYYFITGLDIKSAV.DPKDQDEIVVLPNTYMQM------------------------------------
Q7MGK0_VIBVY/6-223.....IGDA..KVWLETGLDIALAI.DPTDKDILTVRPDPMMDG------------------------------------
I0JR17_HALH3/2-206.....LGRL..PLWFETGLDIPMAL.DPEDRDPIKVSPHPYIEK------------------------------------
L0A4L1_DEIPD/4-200.....LRGT..RVGVQTGVSVRLAV.DLNDHDLLEVQPSAPVQT------------------------------------
C1D0Z4_DEIDV/4-201.....LPGS..DVWVFTDADIAGGV.DPGDQDPLRVLPSAGMEA------------------------------------
Q8YPP0_NOSS1/22-229.....FGHI..PVYVRTGLDIKSAI.NPRDRDYLEVRTHPLMQR------------------------------------
R4LYD7_9ACTN/3-214AHGKHLPGM..SLGLRTEVTTEEHV.DCGDVDIIAIHPLPLQEL------------------------------------
C6WBH8_ACTMD/3-218VHGRHLHGM..TMGLRTELDVRGAI.DPGDLDPFAVHPLPSQEH------------------------------------
R4SZZ1_AMYOR/2-217VGGRELPGM..VVGVRTELVIAGAP.DKGDLDPVLVGPLESQDR------------------------------------
Q3IE37_PSEHT/2-218...INAGYNQSYVWLETGLDIDLAL.DPSDKDHLHVYPNEAVKT------------------------------------
E4N440_KITSK/3-218VDGHHLSGM..ALGVRTDVDIAGQL.DRGDTDPLAVQPLPVQQR------------------------------------
D3Q3X8_STANL/19-229VGGLVLPGL..ELGVATALQLEGGV.DKGDLDDLRVEPLPGHVA------------------------------------
G2NX38_STRVO/3-217LSGQPL.GV..VLGFRIELASAGAK.DHSDPEELIVRPLPVQEA------------------------------------
E2Q1G0_STRC2/1-209LYGQAL.GI..VLGVRTEMAVAGAK.DKGDLDPLTVRPLPVQEA------------------------------------
U5W7Z2_9ACTN/3-218VYGQHLHGM..TMGLRTELEVARAV.DKGDLDAVAVHPLPAQER------------------------------------
D4GQ21_HALVD/1-207.....LGNV..DVWVETELDIELAV.DPEDKDYLNVQPTPRLQA------------------------------------
C4L3D6_EXISA/2-213.....VSQS..KSWIETGLDIAQAV.DPKDEDAITVQPNAAQQV------------------------------------
L0JQI9_NATP1/1-204.....SDRT..DVWLDTGLDIDWAV.DPDDRDPIEIEPDPLRET------------------------------------
U5LEI3_9BACI/4-214.....LGRT..KVWISTGLDIKNAV.DPGDKDYISIKPNRLMDG------------------------------------
B7GKU0_ANOFW/25-235.....VGRT..RVWLHTGLDIKNAV.DPTDEDYIRVQPNRMMNE------------------------------------
C5D3Y3_GEOSW/2-199.....RPSV..GYTFVTRLDIADGV.DAFDQDAIRILPPLSLEK------------------------------------
H2K613_STRHJ/3-217LRGQPL.GI..VLGVRTEVAVAGAR.DKGDLDPLAVRPLPVQEA------------------------------------
Q9KVV0_VIBCH/21-237.....IGDA..KVWLETGLDIALAL.DPTDKDILTVRPEPMMDG------------------------------------
Q2J8X7_FRASC/3-216IGGWHLHGM..KIGVRTKLAIPGAV.DPGDLDAVNVHPLPVQEA------------------------------------
D9STE5_CLOC7/4-212.....MSRR..NVWVETELEIPLAL.DPEDRDYIDVRPSRVMDV------------------------------------
Q81QV7_BACAN/2-213.....LGMK..TVWIHTGLDIKRSI.DPSDRDYIQVLPNALLNS------------------------------------
X5A5U4_9BACL/4-211.....YRNT..PVWLMTGLDIKMAL.DPSDHDYLEVLPSDNMQV------------------------------------
D2B8E4_STRRD/3-215IGGHPLRGM..QLGVSTELALAGAL.DKGDLDPLFVNPLPAQDH------------------------------------
F2EZY3_SOLSS/4-214.....TGNS..RVWIQTGLDIKNAV.DPKDKDFIEIQPTRLANG------------------------------------
Q5V309_HALMA/3-209.....TRST..AVEIETGLDISMAV.DPGDEDYIEVEPTHRTQA------------------------------------
Q6LLI7_PHOPR/4-219.....IGDA..KVWLETYLDIPLAR.DPKDTDTLTVRPEPLMDG------------------------------------
E4NWJ2_HALBP/1-207.....LGST..EVWVETELEIDMAV.DPEDVDYLDVQPTPRMQA------------------------------------
E1SSB8_FERBD/2-218...LRCTRGFSEVWLETGLDIAQGL.DGRDHDPLRIAPTAAMSQ------------------------------------
D7AXU0_NOCDD/3-217HRGRHLHRM..NVGVNTRLHVAGAV.DPGDLDPVAVEPLPSQLA------------------------------------
F4FG08_VERMA/3-218VYGQRLRGM..TMGLRTELSIARAV.DKGDLDQVSVHPLPVHER------------------------------------
D3EJD4_GEOS4/4-211.....ISRQ..PVWIHTGLDIDNAI.DPKDRDFIDVEPNEDASI------------------------------------
I0H7C6_ACTM4/3-218VYGQTLRGM..VMGVRTEVAIARAV.DKGDLDAVHVHPLPIQQK------------------------------------
B1VNV5_STRGG/3-217LHGQHL.GP..VLGIRTELEIAGAR.DKGDLDALAVGPLPAQEA------------------------------------
H8MVT2_CORCM/3-210.....ERGT..PVWIKTALDIDNAL.NPEDSDRIHVLPHPSLQT------------------------------------
H8GZW1_DEIGI/5-201.....LPGS..EVWLVTDADIEGAA.DPGDTDGVWIRPSEDMET------------------------------------
Q5L337_GEOKA/2-211.....LGSS..RVWLQTGLDIKMAL.DPQDRDHLAIEPHPLVAA------------------------------------
C0ZHJ0_BREBN/2-209.....MGRQ..PVYLRTGLDIKNAI.DPGDSDFIEVRPHPLMTK------------------------------------
H2JK05_STRHJ/3-217LHGQPL.GI..VLGVRTELAVSGAK.DKGDLDQLAVRPLPAQEA------------------------------------
Q8EMA6_OCEIH/2-211.....VRDK..NVWIDTGLDIKKAV.DPGDIDYIQVNPSLIVGA------------------------------------
F0LQ35_VIBFN/4-220.....IGDA..KVWLETGLDIAMAI.DPADKDMLTVRPDPFMDG------------------------------------
Q5L3I0_GEOKA/3-199.....RPTV..RYTFVTRLDIADGA.DAYDQDAIHILPPTALEQ------------------------------------
E1V3I8_HALED/2-214.....VGRQHPKTWVATRADIAMAL.DPRDKDPLRILPGPVQRA------------------------------------
R4SRA3_AMYOR/2-218VFGKPLNGM..AVGLQTSLDIANSVTDPVDVDAAAIEPLPAQKR------------------------------------
G2NQ97_STREK/3-217LYGQDL.GI..VLGVRTELAVAGAR.DKGDLDRLSVAPLPAQEA------------------------------------
C7MVV3_SACVD/2-217VGDRVLPGM..TVGVCTDLVIAGAP.DKGDLDPVYVHPLPSQNA------------------------------------
Q47QI1_THEFY/3-218AGGGPLPGA..RVGLRTDVAIAHAV.DKGDLDPVLIHPLPVQDR------------------------------------
B1YLT3_EXIS2/2-212.....VSQS..KSWIETGLDIAQAV.DPSDHDAVVVKANDYQSV------------------------------------
D2RPW6_HALTV/1-204.....MGKT..EVWLDTGLDIDWAV.DPDDTDPVEIEPDPLRRT------------------------------------
D1A596_THECD/3-218VYGQHLHGM..AMGVRTELAVAKAV.DKGDLDPVSIVPLPSQER------------------------------------
D2ASM7_STRRD/3-218VQGQPLNGM..AMGVRTELAIAKAV.DKGDLDPFSVAALPSQEA------------------------------------
N0B2E1_9BACI/13-223.....LGKT..QIWVATGLDIKNAV.DPSDKDFLKVIPDSLTQT------------------------------------
H6NE63_9BACL/4-211.....LRGA..NVWIETGLDIANAV.DPTDRDHIEIVPYGHMQT------------------------------------
K0K0P9_SACES/2-217VGGHPLPGM..TVGVRTELVISGAP.DKGDLDPVVVSPLPSQDR------------------------------------
Q5E1Q2_VIBF1/4-219.....IGDA..KVWVQTGLDISLGL.DPTDKDPITVRPDDLFDG------------------------------------
I7BQH2_NATSJ/1-201.....MGTT..SVWLDTGLDIDWAV.DPDDRDALEIEPDPLRRA------------------------------------
K0JWS7_SACES/3-218VHGTPLHGM..TMGLRTELEVRGAV.DPGDLDPVAVHPIRSQEH------------------------------------
V6K362_STRNV/3-217LHGEPL.GI..HLGVRTEVDVAGAK.DKGDFDPFAVRPLPVQEA------------------------------------
A4FGU2_SACEN/3-218FYGRHLHGM..TLGVRTELSVAKAV.DKGDLDPVSVHPLPAQER------------------------------------
Q5YZ34_NOCFA/2-216YNGRHLPGT..TVALRTIVEIRGAT.DAADTDPIGVGALPAQHV------------------------------------
D9T8R1_MICAI/3-218LYGQNLHDM..TMGLRTEVAIRGAI.DKGDLDPVYVHPLPVQER------------------------------------
C6CSI9_PAESJ/5-212.....IGRA..PVWVKTELEVRGGV.DPGDNDRIDVLPTSAINT------------------------------------
D1A1F2_THECD/3-218MYGQPLHGT..TVGVATELEVARAV.DATDLDPIAVHPLPAQER------------------------------------
G0G8W7_AMYMS/2-215VYAKPLAGM..AVGVRAELDLAAAVSDPFDADAVAIEPLPAQKR------------------------------------
U5W8Q8_9ACTN/3-214LAGKPLSGM..TMGVRTELSVAKAV.DKGDLDEVAIHPLPVQEK------------------------------------

PF04425

A3GGA7_PICST/92-585-----------------NRLLDNSCI.HSILPHILPPPSMGVDS----------TCFYNRGQSIQMNKALGYGFLNIRGT
A5DRA9_PICGU/36-464-----------------AQLLDSECS.HNLSGHTHIPPSLGSSR----------QEQAKYSSKQMQTMR...........
Q6BJG5_DEBHA/93-577-----------------HKLLDNNCI.HDVLPHILPPPSMGLDK----------TCFYNRGGTIVLNKALGYGFLNVRGT
A5DPQ0_PICGU/115-602-----------------EKLLDNNCM.HSILPHVLPPPSFGFDK----------SSFYHRGENVSLNKALGYGYLDIRGT
Q6BSG0_DEBHA/5-422-----------------EKLLDNTCEEHTFSIHTEIPPSIGISR----------TSTTPSSLLVSNNGQ...........
Q6BVD1_DEBHA/28-455-----------------ENLLDSECG.HSLSDHTQIPPSLGKSR----------SEDYVNLTYKPDATK...........
Q5ABB5_CANAL/19-455-----------------EKLLDSACE.HSLIKHLQIPPTFGVCK----------NEVISSLRHKWKDQQ........NGA
Q75E04_ASHGO/51-474-----------------MQLLDVSCK.HEQFSHCLVPPSFGIDK----------YKSNGKYATIQTNPLLGYGHLGTKGS
BUL1_YEAST/108-543-----------------LQLLDVTCK.QEHFSHCLLPPSFGIDK----------YRNNCKYSGIKVNRVLGCGHLGTKGS
A5E3Q9_LODEL/66-535-----------------QRLLDNDCP.DAIFLHLLPPPSVGVDK----------TSFYNRGEGIVINKALGYGSLNLRGT
A3LX53_PICST/9-457-----------------EKLLDVTCE.HGFVKHLQIPPTLGISK----------NEVITSLRQKYKESD........LES
Q6FUH4_CANGA/102-545-----------------TQLLDVTCK.QEHYAHCLLPPSFGIDK----------YRNNCKYSVIKVNHVLGCGHLGTKGS
Q6CSE2_KLULA/69-505-----------------NQLLDISCK.HEMFCHCLLPPSFGVDK----------YKHHARYSNIKLNSMLGYGHLGTKGS
Q6FP46_CANGA/103-568-----------------DQLLDVTCR.QEIFPHCSLPPSLGIDK----------WKDNGKYSIIKVNNVLGCGHLGTKGS
Q5AN22_CANAL/97-598-----------------HRLLDNACI.NSLLPHLLPPPSMGIDR----------TCFYNRGEAIQLNKALGYGFLNVRGT
A7TIV7_VANPO/87-537-----------------SQLLDITCK.QEQFAHCLLPPSLGLDK----------YRNNGRYSGIKVNSVLGCGHLGIKGS
E7KSA7_YEASL/88-524-----------------TQLLDVTCK.QEQFSHCLLPPSFGIDK----------YKNNCKYSGIKVNSVLGCGHLGTKGS
G0VB73_NAUCC/105-559-----------------NQLLDVTCK.HEQYAHCLLPPSFGIDS----------YKNGGKYSQIKVNSVLGCGHLGVKGS
G0VC27_NAUCC/80-515-----------------NQLLDTTCK.QEHFSHCLLPPSLGWI.----------NKNGCVYSGIEVNNVLGFGHIGTKGS
G0VC28_NAUCC/152-590-----------------NQLLDTTCK.QEHFSHCLLPPSFGIDK----------YRNGCKYSGIKVNNVLGSGHLGTKGS

PF03643

VPS26_DICDI/8-284------------------HIEFEYNK-SKY....HLKDV.......IIGKIYFLLVR...IKIKYMEIALIKRESTGS.G
VP26A_HUMAN/8-283------------------HIEFEYNK-SKY....HLKDV.......IVGKIYFLLVR...IKIQHMELQLIKKEITGI.G
PEP8_YEAST/5-364------------------HIEFEYAK-SQY....SLKEV.......IVGRIYFLLTR...LRIKHMELSLITRESSGLQT
VP26A_ARATH/8-283------------------HIEFEYNK-SKY....HLKDV.......ILGKIYFLLVR...IKIKNMDLEIRRRESTGA.G
VPS26_SCHPO/5-279------------------HIEFEYSK-NKY....HLKDV.......IIGKIYFILVR...IKVQRMEVSIIRRETIGT.S
VPS26_DROME/6-280------------------HIEFEYNK-SKY....HLRDT.......IIGKIYFLLVR...IKIKHMEIAIIKKESTGT.G
VPS26_CAEEL/7-282------------------HIEFEYNK-NKY....HLQDV.......IVGKIYFLLVR...IKIKYMEIAILKTEVVGS.G
DSCR3_MOUSE/1-283------------------......SL-PKFFIRGHLNSTNCAITQPLTGE...LVVEHSDAAIRSIELQLVRVETCGC.A

PF00339

B4LEM0_DROVI/17-172------------------DDLGKPLG-VEY--------------------------------------------------
ARRS_BOVIN/22-180------------------QDVGKSCG-VDF--------------------------------------------------
Q9I7L0_DROME/5-150------------------..EGSHGR-VRY--------------------------------------------------
H2N0W5_ORYLA/17-173------------------LDEGKKCA-VEF--------------------------------------------------
Q23674_CAEEL/4-159------------------..EGDLGF-IRY--------------------------------------------------
ARD17_CAEEL/7-155------------------..EGEFGH-IRY--------------------------------------------------
H2RRP6_TAKRU/18-174------------------EDTGKACG-VDF--------------------------------------------------
Q9VGU7_DROME/5-155------------------..NGAHGQ-IKH--------------------------------------------------
Q20577_CAEEL/7-158------------------..EGFHGH-VRY--------------------------------------------------
P91469_CAEEL/7-159------------------..EGKYGY-LRY--------------------------------------------------
Q9VI00_DROME/5-148------------------..VAQYGK-IFY--------------------------------------------------
Q20232_CAEEL/7-150------------------..ESRHCT-IRY--------------------------------------------------
ARRD4_MOUSE/18-166------------------..TGKYGS-IQY--------------------------------------------------
O17983_CAEEL/6-146------------------..EGKYGF-IRY--------------------------------------------------
PALF_YEAST/39-201------------------..KFERGS-ITY--------------------------------------------------
ARRB1_BOVIN/18-174------------------EDTGKACG-VDY--------------------------------------------------
Q8SYU5_DROME/5-157------------------..EGAYGH-IRY--------------------------------------------------
O17981_CAEEL/6-159------------------..EGKYGY-LRY--------------------------------------------------
Q9XXI4_CAEEL/4-156------------------..EGCHGH-IRY--------------------------------------------------
F6SKI7_XENTR/21-176------------------TDVGKACG-VDF--------------------------------------------------
Q9VI53_DROME/6-155------------------..EGEFGH-VRY--------------------------------------------------
H2L9D1_ORYLA/14-171------------------DDKGKACG-VDF--------------------------------------------------
ARRB_CAEEL/22-186------------------GDTGKPCG-VDY--------------------------------------------------
Q9XXI0_CAEEL/6-159------------------..EGTHGN-VRY--------------------------------------------------
Q23672_CAEEL/8-142------------------..EGYAGG-TNY--------------------------------------------------
ARRD2_MOUSE/9-158------------------..EGKHGS-VRY--------------------------------------------------

PF13002

A7TSP7_VANPO/130-321------------------YPKSSF--------------------------------------------------------
C5GL98_AJEDR/142-318------------------HPIGNF--------------------------------------------------------
YNSK_SCHPO/63-242------------------HPHGAA--------------------------------------------------------
C5DVA9_ZYGRC/141-332------------------YPKSTF--------------------------------------------------------
E7KUR3_YEASL/144-346------------------YPKSTF--------------------------------------------------------

PF02752

Q7PUI7_ANOGA/236-407...................KNVFAIY-VSY--------------------------------------------------
Q9TYQ0_CAEEL/174-315...................HANRLVT-VSY--------------------------------------------------
Q7PUR5_ANOGA/187-319....................RCRIIM-TRY--------------------------------------------------
Q7PYD9_ANOGA/175-306....................DQNLIS-VAY--------------------------------------------------
Q380N5_ANOGA/183-323...................THSRIVA-VEY--------------------------------------------------
CRED_ASPOR/181-332....................DTKGIK-VRH--------------------------------------------------
Q752Z4_ASHGO/228-382...................VGASLIR-VRH--------------------------------------------------
ARRD5_HUMAN/184-321...................QDGEIMH-TRY--------------------------------------------------
ARRD4_HUMAN/191-318....................DCCIIR-VDY--------------------------------------------------
Q294M9_DROPS/171-302...................ELSNLIQ-IAY--------------------------------------------------
Q6BI98_DEBHA/278-420...................LKNNIIQ-VKH--------------------------------------------------
Q294M7_DROPS/174-306...................NLCSIIQ-IAY--------------------------------------------------
Q6BIN4_DEBHA/247-390....................IQNFIK-VRH--------------------------------------------------
Q293Z7_DROPS/175-308...................QLSGVIT-IVY--------------------------------------------------
Q9I7K7_DROME/179-320...................AGCACLQ-LNY--------------------------------------------------
A5DM18_PICGU/246-387...................PKSGAIS-VKH--------------------------------------------------
Q294M5_DROPS/171-304....................TDSIIT-VSY--------------------------------------------------
Q16ZK0_AEDAE/170-299....................NCSVLT-IDY--------------------------------------------------
A0BIT0_PARTE/173-314...................LKTKRII-FQY--------------------------------------------------
Q4V467_DROME/125-256...................HLCRIIK-IGY--------------------------------------------------
Q7SC90_NEUCR/193-351...................TSSTLYK-IEF--------------------------------------------------
Q66L50_DANRE/187-314....................DCSIIH-VEY--------------------------------------------------
Q95NF3_ANOGA/193-351..................QRDAFGVI-ISY--------------------------------------------------
Q6C993_YARLI/185-326....................VPNLIK-VTH--------------------------------------------------
O44847_CAEEL/147-273....................HTCGSS-LKY--------------------------------------------------
A0CWE9_PARTE/173-316...................IKTKRVS-YQY--------------------------------------------------
Q23QU8_TETTS/188-318....................QGSLIQ-VNY--------------------------------------------------
Q6ZM71_DANRE/162-286...................SDGNLIQ-ICY--------------------------------------------------
A8WP41_CAEBR/178-317....................TCPIID-VDY--------------------------------------------------
Q0E8K8_DROME/169-299...................HGCHLIK-ISY--------------------------------------------------
A0C0J3_PARTE/194-337....................NGKIVQ-NNY--------------------------------------------------
Q16ZJ7_AEDAE/171-300....................KCSVLV-IDY--------------------------------------------------
Q23YG0_TETTS/188-318....................QGQMIQ-VQY--------------------------------------------------
Q9W7R1_ORYLA/193-351..................LKEVMGIM-VSY--------------------------------------------------
ARRB_CAEEL/205-363..................SKESLGIV-VQY--------------------------------------------------
Q7RZE0_NEUCR/198-350....................NAHGIK-VRH--------------------------------------------------
ALY2_SCHPO/345-506...................TTYKYIK-VRH--------------------------------------------------
Q5AM66_CANAL/305-457....................LSTNVR-VRH--------------------------------------------------
ARRB2_MOUSE/195-350..................NKEVLGIL-VSY--------------------------------------------------
A2BIP7_DANRE/186-313...................LNCRILK-VEY--------------------------------------------------
ARRD1_HUMAN/162-286...................PGCSLIH-IDY--------------------------------------------------
A2QR01_ASPNC/439-613..................DTTYENIQ-INH--------------------------------------------------
Q380P6_ANOGA/182-314...................DGAPLFS-VNY--------------------------------------------------
YC9F_SCHPO/183-325....................DLNCIR-VHH--------------------------------------------------
Q16H74_AEDAE/171-301....................TTSIIQ-IEY--------------------------------------------------
Q6DH07_DANRE/192-355..................DKEMLGIL-VSY--------------------------------------------------
A8X4Z9_CAEBR/175-315....................QCPIIG-VEY--------------------------------------------------
ART1_SCHPO/287-428....................TSDLYS-VQY--------------------------------------------------
ARRD2_HUMAN/180-307....................HCRVLH-VDY--------------------------------------------------
Q294M6_DROPS/179-311...................HLSKVVR-VSY--------------------------------------------------
ADCC_DICDI/344-478.................SIAETKMIR-VEY--------------------------------------------------
Q6CS19_KLULA/219-373....................ILTNIK-VRH--------------------------------------------------
Q2UDU8_ASPOR/60-215...................VSSKMMT-IKH--------------------------------------------------
Q22NR4_TETTS/187-325....................NGGAFS-CRY--------------------------------------------------
ROD1_YEAST/232-395....................ILSNIK-VRH--------------------------------------------------
A0CL31_PARTE/172-315....................IGNCVN-SIY--------------------------------------------------
APYA_EMENI/180-326....................EDMGVR-VSH--------------------------------------------------
Q296V0_DROPS/178-310...................SNCGIIA-LDY--------------------------------------------------
Q6CW08_KLULA/282-443...................VGADLIK-VRH--------------------------------------------------
A8WP33_CAEBR/159-305....................ASGMMT-HGY--------------------------------------------------
A0DYQ7_PARTE/173-314...................VKTKRII-FQY--------------------------------------------------
A0D2Y0_PARTE/206-342....................KNQTIL-NQY--------------------------------------------------
A7TQI8_VANPO/357-526..................DTGYEKIK-SQH--------------------------------------------------
Q17EA7_AEDAE/182-314...................SHCRVIQ-VKY--------------------------------------------------
Q9W2V2_DROME/420-633GSQGQGQPGNPNSGGGNEERNVFAIY-VSY--------------------------------------------------
Q240M9_TETTS/188-318....................QGELVQ-VVY--------------------------------------------------
A5DUN4_LODEL/264-404....................DGEHVK-VRH--------------------------------------------------
A0NDX6_ANOGA/173-303....................SDTIIR-LEY--------------------------------------------------
Q16ZJ5_AEDAE/174-305....................TCQVLT-VNY--------------------------------------------------
Q7QCL7_ANOGA/170-301...................RGCHLIR-IQY--------------------------------------------------
A2QTZ8_ASPNC/184-328....................STNFLH-VEH--------------------------------------------------
O17983_CAEEL/173-318....................SSRLLA-VEY--------------------------------------------------
Q9V393_DROME/233-393..................QRESLGIM-VHY--------------------------------------------------
A0BMC5_PARTE/210-346....................KTSVIR-NQY--------------------------------------------------
A1C8U8_ASPCL/140-283....................PNSTMP-IRH--------------------------------------------------
A0D004_PARTE/178-324....................NGEIIK-SHY--------------------------------------------------
Q16ZK1_AEDAE/136-269...................DSCKIIQ-IVY--------------------------------------------------
Q17EA8_AEDAE/183-323...................RQSKILK-IGY--------------------------------------------------
Q16ZJ8_AEDAE/186-315....................KCSIIS-VEY--------------------------------------------------
PALF_ASHGO/233-368...................VPNQGFT-FQY--------------------------------------------------
ARRS_MOUSE/200-361..................DRTVMGIL-VSY--------------------------------------------------
A8WP37_CAEBR/170-319....................ESAMIS-MGY--------------------------------------------------
Q9GYT5_CAEEL/181-328...................QFSPVIT-VEY--------------------------------------------------
MU170_SCHPO/266-426....................LKDQLK-IDY--------------------------------------------------
A5DW17_LODEL/261-403...................IKSGMIV-VKH--------------------------------------------------
A0D012_PARTE/172-315....................TGNFVN-SSY--------------------------------------------------
ADCA_DICDI/313-441....................LGKHIT-SSY--------------------------------------------------
Q9I7L0_DROME/174-307...................NLCGIIQ-IAY--------------------------------------------------
A7SF55_NEMVE/129-256....................NCGIVS-ICY--------------------------------------------------
Q16ZK2_AEDAE/273-408....................CSKVIK-ISY--------------------------------------------------
A8XYD8_CAEBR/172-316....................NSKCIN-VEY--------------------------------------------------
A0E996_PARTE/174-317...................LFSDRII-YHY--------------------------------------------------
Q0U5A6_PHANO/182-337....................DTENIR-LTH--------------------------------------------------
PALF_YEAST/259-394...................TVGKFFS-FQY--------------------------------------------------
Q23672_CAEEL/163-311....................STGLVN-FGY--------------------------------------------------
A7TPY5_VANPO/228-381....................ILRNIK-VRH--------------------------------------------------
Q759V0_ASHGO/221-368....................ILNNIK-VRH--------------------------------------------------
Q9VGU7_DROME/180-316...................SEKDPIR-VSY--------------------------------------------------
Q6FM62_CANGA/224-379....................TLERIK-CRH--------------------------------------------------
A7SKJ5_NEMVE/177-307....................SCRCIQ-VTY--------------------------------------------------
Q6CGL3_YARLI/174-329...................AKSSLYK-VEY--------------------------------------------------
ARRD5_MOUSE/170-307...................QENEIMR-TSY--------------------------------------------------
Q17624_CAEEL/176-340..................FRKIPFLK-VEY--------------------------------------------------
A0D9C9_PARTE/194-337....................NGKVVM-NNY--------------------------------------------------
A0CE97_PARTE/209-345....................KTNTIK-NQY--------------------------------------------------
Q7PYE1_ANOGA/178-310...................VNCGIID-VDY--------------------------------------------------
Q16ZJ6_AEDAE/174-302....................VSPLIT-IAY--------------------------------------------------
A7SL06_NEMVE/167-299....................LYGIIT-TAY--------------------------------------------------
ARD17_CAEEL/179-307....................KCKILS-VTY--------------------------------------------------
Q17HB8_AEDAE/169-300...................LGCHLIR-IQY--------------------------------------------------
ADCB_DICDI/337-465....................QSGIIK-IEY--------------------------------------------------
Q23FQ6_TETTS/188-318....................QGQLIQ-MNY--------------------------------------------------
Q294M3_DROPS/163-297...................NTNYIVF-LHY--------------------------------------------------
A8WP43_CAEBR/183-324....................KTNIIE-VDY--------------------------------------------------
A3LXL3_PICST/266-408...................LKNNIIQ-VRH--------------------------------------------------
O17981_CAEEL/182-333...................RFSPVIT-VEY--------------------------------------------------
Q16ZK3_AEDAE/167-301....................YSFVVQ-IAY--------------------------------------------------
A8X383_CAEBR/164-301..................GGECSIIA-IHF--------------------------------------------------
Q20232_CAEEL/173-309...................GVCRLIQ-IYY--------------------------------------------------
A0BCE6_PARTE/199-335....................KMQFIK-NHY--------------------------------------------------
Q5AP77_CANAL/170-448.................PDSNFRHIE-IKH--------------------------------------------------
A0BDM3_PARTE/168-302....................TGQLIK-VDY--------------------------------------------------
Q23674_CAEEL/182-339....................TCEIID-VEY--------------------------------------------------
ARRD5_BOVIN/171-309...................QDSEIMN-TQY--------------------------------------------------
YA4C_SCHPO/180-322....................DLDGIK-IRH--------------------------------------------------
Q294M1_DROPS/173-305...................KPTCPIS-VNY--------------------------------------------------
A0A0D1DR37_USTMA/181-316...................QTAKHIE-VSY--------------------------------------------------
A7TDW3_VANPO/229-389....................VLKNIK-VRH--------------------------------------------------
Q6FY06_CANGA/237-406....................VLNNVK-IRH--------------------------------------------------
A6R1F7_AJECN/559-759..................DTTHEQLQ-IHH--------------------------------------------------
Q9XXC4_CAEEL/159-308....................ESPMIS-MGY--------------------------------------------------
A7TQH7_VANPO/294-447...................IIGEIIR-IRH--------------------------------------------------
Q16ID9_AEDAE/216-390...................RENLGII-VQY--------------------------------------------------
PALF_KLULA/263-398...................LKNKFFT-FQY--------------------------------------------------
Q6CG62_YARLI/321-486..................NTSFKNIK-VHH--------------------------------------------------
A0A0D1E8U6_USTMA/601-804...................HSKSNIA-VHH--------------------------------------------------
Q9XTU0_CAEEL/176-327....................DSTLIH-VEY--------------------------------------------------
YOA5_SCHPO/223-379....................VGSNFE-VDH--------------------------------------------------
Q0CQZ7_ASPTN/118-273...................VKTPNIN-IYH--------------------------------------------------
E7LU16_YEASV/179-340....................VRSNIK-VRH--------------------------------------------------
F1QAH2_DANRE/171-293...................HNCRILK-VEY--------------------------------------------------
F6SKI7_XENTR/196-355..................DRTVMGIL-VDY--------------------------------------------------
F6Y0E4_XENTR/163-285...................QGCNLIH-IDY--------------------------------------------------
G4VCF9_SCHMA/96-254..................HKENLGMT-VQY--------------------------------------------------
H2N0W5_ORYLA/194-351..................LKEIQGML-VSY--------------------------------------------------
H3CCN8_TETNG/163-285...................AGCSLID-IEY--------------------------------------------------
H3DDA7_TETNG/203-325....................NCSIIK-LEY--------------------------------------------------
ART5_YEAST/332-474...................LQDNLIR-VMH--------------------------------------------------
Q08CX7_XENTR/182-306....................QCRIIR-VEY--------------------------------------------------
TXNIP_MOUSE/176-299....................GCNILK-VEY--------------------------------------------------
Q9VI00_DROME/172-303....................TEGIIS-VSY--------------------------------------------------

PF07070

E3E849_PAEPS/4-211-------------------VFEAVHL.LGF--------------------------------------------------
Q9F2L5_STRCO/29-244-------------------VLEALGR.LGC--------------------------------------------------
B7VMX8_VIBTL/6-222-------------------IFNELEA.QGL--------------------------------------------------
Q87KC8_VIBPA/6-222-------------------ILSAFEA.QGL--------------------------------------------------
D2SH36_GEOOG/3-216-------------------VLQALDS.LGF--------------------------------------------------
U5VQ01_9ACTN/3-218-------------------ILEAFAR.LGF--------------------------------------------------
A9B5Z7_HERA2/2-209-------------------IIQAIQQ.IGF--------------------------------------------------
Q8CK18_STRCO/3-217-------------------ILDAFIG.LGF--------------------------------------------------
A1S9J4_SHEAM/2-218-------------------VLNAMQE.LGF--------------------------------------------------
F8AWR6_FRADG/3-216-------------------ILAALGD.LGF--------------------------------------------------
D5XEE5_THEPJ/2-202-------------------LFDAVSA.LGF--------------------------------------------------
F6CIG7_DESK7/3-202-------------------FFDALKV.LGF--------------------------------------------------
E8U7T1_DEIML/4-201-------------------FLDALSA.LGF--------------------------------------------------
D9SYU9_MICAI/3-218-------------------LLEALLR.LGF--------------------------------------------------
SP0M_BACSU/4-212-------------------VLEAIEN.LGF--------------------------------------------------
D6Y483_THEBD/3-219-------------------VLDAFPR.LGF--------------------------------------------------
D7B3X5_NOCDD/3-216-------------------VLEAMLR.LGA--------------------------------------------------
A6W415_KINRD/4-215-------------------VVDALGS.LGW--------------------------------------------------
A5D298_PELTS/2-203-------------------FFDAVRL.LGF--------------------------------------------------
Q7MGK0_VIBVY/6-223-------------------IFTALEE.QGL--------------------------------------------------
I0JR17_HALH3/2-206-------------------VLDALENRLGF--------------------------------------------------
L0A4L1_DEIPD/4-200-------------------LLDAAEL.LGL--------------------------------------------------
C1D0Z4_DEIDV/4-201-------------------VIGAALR.LGF--------------------------------------------------
Q8YPP0_NOSS1/22-229-------------------VLLAIEH.LGF--------------------------------------------------
R4LYD7_9ACTN/3-214-------------------VMDDLAG.LGF--------------------------------------------------
C6WBH8_ACTMD/3-218-------------------VLAAFDA.LGF--------------------------------------------------
R4SZZ1_AMYOR/2-217-------------------VLEAFGE.LGF--------------------------------------------------
Q3IE37_PSEHT/2-218-------------------CMQAMEK.LGF--------------------------------------------------
E4N440_KITSK/3-218-------------------VLEALSA.LGF--------------------------------------------------
D3Q3X8_STANL/19-229-------------------VIEALER.LGF--------------------------------------------------
G2NX38_STRVO/3-217-------------------VLGALGR.LGF--------------------------------------------------
E2Q1G0_STRC2/1-209-------------------VLEAFGQ.LGF--------------------------------------------------
U5W7Z2_9ACTN/3-218-------------------ILDAFLR.LGF--------------------------------------------------
D4GQ21_HALVD/1-207-------------------VFDALDD.LGF--------------------------------------------------
C4L3D6_EXISA/2-213-------------------ILDAMDE.LGF--------------------------------------------------
L0JQI9_NATP1/1-204-------------------LFDALES.LGF--------------------------------------------------
U5LEI3_9BACI/4-214-------------------VFQAVSD.LGF--------------------------------------------------
B7GKU0_ANOFW/25-235-------------------VFRVMEN.LGF--------------------------------------------------
C5D3Y3_GEOSW/2-199-------------------LFHAFEK.LGF--------------------------------------------------
H2K613_STRHJ/3-217-------------------VLEALGA.LGF--------------------------------------------------
Q9KVV0_VIBCH/21-237-------------------IFSALEA.QGL--------------------------------------------------
Q2J8X7_FRASC/3-216-------------------VLAALGD.LGF--------------------------------------------------
D9STE5_CLOC7/4-212-------------------VLDAVINVLGF--------------------------------------------------
Q81QV7_BACAN/2-213-------------------VLESVNQ.LGF--------------------------------------------------
X5A5U4_9BACL/4-211-------------------VFGALDE.LGF--------------------------------------------------
D2B8E4_STRRD/3-215-------------------VLGALDN.LGF--------------------------------------------------
F2EZY3_SOLSS/4-214-------------------VLTAIQN.MGF--------------------------------------------------
Q5V309_HALMA/3-209-------------------VFDALDS.LGF--------------------------------------------------
Q6LLI7_PHOPR/4-219-------------------VFTALEN.AGL--------------------------------------------------
E4NWJ2_HALBP/1-207-------------------VFDAAEE.LGF--------------------------------------------------
E1SSB8_FERBD/2-218-------------------VLAAVEA.CGF--------------------------------------------------
D7AXU0_NOCDD/3-217-------------------VLDSLAS.LGF--------------------------------------------------
F4FG08_VERMA/3-218-------------------ILEAFLQ.LGF--------------------------------------------------
D3EJD4_GEOS4/4-211-------------------VFDAVES.LGF--------------------------------------------------
I0H7C6_ACTM4/3-218-------------------ILDAFSQ.LGF--------------------------------------------------
B1VNV5_STRGG/3-217-------------------ILEAFGQ.LGY--------------------------------------------------
H8MVT2_CORCM/3-210-------------------VIEAVQK.LGF--------------------------------------------------
H8GZW1_DEIGI/5-201-------------------VIQAAQD.LGF--------------------------------------------------
Q5L337_GEOKA/2-211-------------------FLEAARQ.LGF--------------------------------------------------
C0ZHJ0_BREBN/2-209-------------------VLDAVQQ.IGF--------------------------------------------------
H2JK05_STRHJ/3-217-------------------VLEALGQ.LGF--------------------------------------------------
Q8EMA6_OCEIH/2-211-------------------ILEAVDS.LGF--------------------------------------------------
F0LQ35_VIBFN/4-220-------------------IFTALEE.QG