Sequence alignment for CL0136

PF06769

Q8DX49_STRA5/4-83-------FTEEA--WKDY---------VSWQQE-------------DKKILKRINRLIE-DIK--RD.-PFEGIGKPEPL
YOEB_STRCO/5-84-------FTSHG--WEDY---------VHWAES-------------DRKVTKRINRLIA-DIA--RD.-PFKGVGKPEPL
Q87NP8_VIBPA/11-90-------WTDDA--WDDY---------LYWQTQ-------------DKKTLKRINKLIN-DVK--RS.-PFEGIGKPEPL
YOEB_SHIFL/5-84-------WSEES--WDDY---------LYWQET-------------DKRIVKKINELIK-DTR--RT.-PFEGKGKPEPL
Q93KY2_STRVR/5-84-------FEDQG--WDDY---------TSWLKN-------------DRKMLARINKLIE-DVR--RD.-PFTGIGKPEPL
Q8Z0C7_NOSS1/2-81-------FQPEF--LEDL---------EFWVET-------------NQRVALKALDLVK-ETC--RD.-PFKGKGKPEPL
YOEB_MYCBO/6-85-------FDPDA--WEDF---------LFWLAA-------------DRKTARRITRLIG-EIQ--RD.-PFSGIGKPEPL
Q8NV15_STAAW/8-88-------FSPQA--FEDY---------KYFQQN-------------DKKMVKKINELLK-SID--RNG-ALEGIGKPEKL
Q88AQ0_PSESM/3-82-------FTLSG--WDDY---------THWKDA-------------DQAISLSIDSLIS-QCL--RT.-PFKGTGKPRPL
A9CID9_AGRT5/5-88-------WTLSS--WDDY---------EFWQRT-------------DARMVEKINDLIR-NAK--RT.-PFAGLGKPEPL
Q8DNR3_STRR6/5-84-------FTEDA--WADY---------CYWQNQ-------------DKKTLKRINKLIK-DIQ--RD.-PFTGIGKPEPL
Q88IR0_PSEPK/3-82-------FTKEG--WEDY---------CHWQNA-------------DLTILGNINRLID-VCL--RT.-PFTGIGKPEPL
Q8KPS4_SYNE7/6-85-------WTNEA--WEDY---------LYWQGQ-------------DKKTLNRINKLIT-ETL--RS.-PFEGIGKPEAL

PF05016

A3RE14_VIBVU/4-93-----FQLTNKA..KSDL---------RDIALFTSRRWG.R..EQ.RNIYLKQFDDSFW-LLA--.EN-PDIGKA..CDE
Q93DV0_9BACT/5-90-----IVFRLEA..QTEF---------DEAIDWYEQQAE.L.....GLEFLDCVADSLT-RIA--.AM-PESYEM.....
Q52338_9BACT/4-93-----YILTAEA..EADL---------RGIIRYTRREWG.A..AQ.VRRYIAKLEQGIA-RLA--.AG-EGPFKD..MSE
Q8E846_SHEON/5-93-----YHLTPDA..QSDL---------IGIHRFTLAQWG.A..TQ.SKTYLSGLKQTIQ-LLA--.ET-PTLGKN..RPE
Q8U5C1_AGRT5/4-111-----YRLSDAA..QSDI---------IEILGWTHATFG.A..AA.RKRYEKLLATALR-DVA--.VD-PLRAGTNIRAE
Q8K898_STRP3/6-98-----VTMSDDA..KADL---------LSIYYYVCDELCAP..QA.ADNLLERLSQAML-SLS--.IF-PERCAI.....
Q82UW5_NITEU/5-97-----VRFTLEA..KADI---------ERLYRFL...AE.HDFDV.AERTLETIDSAWS-LLE--.QF-PFSCRK.....
RELE1_CAUCR/5-93-----VLVSVRA..KRDF---------NRLIVWLVERDPRA.....AARLGPLLEAALD-SLT--.EA-PSRGRS.....
Q8YNK4_NOSS1/5-84-----IEITTRA..AKQL---------KKLSEDI............KLKIEEKIQELSN-NPR--.SN-DVVKLE.....
Q8XGL8_SALTI/5-85-----LEFDPRA..LKEW---------HKLGDTV............KAQLKKKLADVLL-NPR--.ID-SARLNG.....
RELE1_METJA/5-87-----VEIHKRV..LKDL---------KDL................PPSNLKKFKELIE-TLK--.TN-PIPKEK.....
Q82UA5_NITEU/5-91-----VRLRPEA..EQDL---------ADAAAWYEEQRQGL.....GHKFLDEVTTTLS-NIA--.ET-PLAYPNVHRGT
Q7MFK6_VIBVY/2-89-----ILWEEES..LNDR---------EKIFEFLYDFNPDA.....AEKTDNLIEAKVE-NLL--.EQ-PLMGVQ..RDG
A9CIM9_AGRT5/6-92-----IRWTLRA..LRRL---------DEIGAHIE.QDN.P..AA.AARVISRIVSAAD-MLV--.EQ-PAIGRV..GRI
Q8TUL7_METAC/5-82-----IVWSKPA..AEQL---------RKLDRPL............AKRIFRKVSELQE-DPF--.RY-VTKLVG.....
Q9PBR6_XYLFA/4-95-----VIFAPEA..ILNI---------QRLRNFLHPKNT.D...A.ARRAGEAIMRGAR-MLG--.AQ-PHIGRP.....
Q8RG22_FUSNN/6-88-----VKFSEAA..IKEL---------KKLDKPT............ATMIKLWVIQNLE-NTI--.NP-RQHGKS.....
O27942_ARCFU/4-86-----VVVHRKA..TQEL---------KRL................KKAHLKKFGVLLE-TLK--.TD-PIPWKR.....
Q8ZLI2_SALTY/6-91-----IEYSGQF..QKDV---------KRAQK..............RHKDVGKLKTLMT-LLI--.HH-PFP...LPAIY
Q7MKD5_VIBVY/6-94-----YKLSKLA..QAHL---------RKIKSYTVNNFS.E..MQ.WRSYKDTLLTGFQ-MLA--.DN-PAVGRS..CDE
Q93S35_9ACTO/5-86-----IEYTDPA..VKAL---------RKLDRAQ............ARRITAYIRE.LT-GLD--.DP-HQRGKG.....
Q8GQM5_SERMA/4-92-----YNLSVLA..DEDI---------YHIVRYTLHRFG.L..TQ.AKRYHDELIKVFE-LLA--.QN-TGLGAE..CHW
Q937D2_PSESD/5-94-----VVFSPEA..EEQL---------AELYRYIAAAAS.P..DV.AARYTEAIVTYCE-SLR--.TF-PLRGTM..RDD
Q8W6N1_9CAUD/4-84-----IEFTKQA..AQAL---------KAMPRNI............SATIRAKIDALAV-DPY--.AP-NPNAKK.....
O25552_HELPY/4-90-----IETSKKF..DKDL---------KILVK..............N.GFDLKL...LY-KVV--.GN-LATEQPLAPKY
Q8E851_SHEON/2-90-----YKLSNLA..AEDF---------ERIFEYTLLNFG.V..KQ.ADDYTVSMHNALL-AIT--.EQ-PLIGHE..CLE
Q8E1X3_STRA5/8-106-----IIYAPDV..LEKL---------KEIRDYISQNYSSTSGQHKMEQIISDIEKLEV-FPE--.VG-FDADEK.....
Q849T7_HAEIF/5-85-----LIFDKRA..LKEW---------NKLGETL............RQQFKNKLAERMI-NPR--.IQ-ADKLKG.....
Q9I5J9_PSEAE/6-101-----IRFTDTA..EQSI---------EDQVHHLAPFQGEQAALQSVLSLLDEIEEKIS-LAP--.KG-YPVSQQ.....
Q841X2_CAMFE/6-90-----LLYTSKF..KKSV---------KKLNK....................EDIKAVI-EIL--.DK-LCEDEPLDLKY
Q8P678_XANCP/4-94-----IALAARV..ADDA---------RRLVAYLLEHDA.A...S.VQRKLAGIFQAID-ALA--.DN-PLMGRA.....
Q7UT85_RHOBA/58-145-----VSWTEYA..VSDL---------LAIRDYIG.RDS.D..KF.ADLIFERIVEQTE-RLL--.EY-PDAGSI..VPE
Q92TH9_RHIME/5-95-----VQWSRAA..LDDL---------KDQVLFIA.RED.P..DS.AARVAGRVRDTAA-AL.--.GE-MATGRP..GRV
Q7WXG2_CUPNH/4-95-----VRLTPLA..EAEL---------EAIADYIA.RDN.P..RR.ALSFVRELRDRCL-SLA--.DM-PLAFPL..VPR
Q8RGS3_FUSNN/5-87-----VEYSKTA..MNTI---------KKMDSST............SKLIRTWIEKNLI-NTE--.NP-RIKGKA.....
Q8PTV6_METMA/5-89-----VKLHPDA..VKFL---------VSLNPET............KERLKSGIKNLEM-DPF--.KS-RPHADI.....
Q8GNE5_9PROT/6-97-----VYWTQSS..QSDL---------EYIIEYLKRDSVSL.....AKKMFLEIKEACD-ALY--.VF-PERKRV.....
Q8TQ58_METAC/5-86-----VVLSPDF..EKET---------KIFFKK.............DPVLYGRFKKTVN-SIL--.EN-PECGKP.....
Q7MYA1_PHOLL/2-89-----YKLTDQA..AEDF---------AGIYDYTFLQFG.E..TQ.ADHYTEALEAFFD-TLA--.EM-PHIGRE..YPS
Q93R08_STRMU/13-108-----VKFTQPA..IDDL---------DDIYNYYETELS.K..LS.ADKVIKSLREATN-LLT--..F-SPEGGIDFNKR
O73969_PYRHO/5-94-----VIILPKV..SKKS---------KKYL...............SKSQLEKLSKFFK-TLE--.FD-PLPVER...YD
Q92X99_RHIME/7-94-----FRLAPTA..KADL---------RKIWRYTARRWS.L..EQ.AETYQDQLYTAFE-GLA--.VG-TKKGRN..VD.
Q7N5L6_PHOLL/4-85-----VIWSKAA..IKQL---------TRIDTRY............QKTIKQKVSSLTD-FPL--.VA-LDIRKL.....
Q87CU9_XYLFT/4-93-----YILTAAA..ETDL---------RSIIRYTRKQWG.D..AQ.MRRYIATLEQDMA-SLA--.AG-RGVFRN..MSV
Q7NMF6_GLOVI/3-90-----VLWRRSA..IEDL---------DVAREYLQ.SRN.P..AA.ARRVIDRIEEATR-RLA--.VM-PYLGKT..GHV
Q88JZ3_PSEPK/4-96-----LIVTEGA..AKGL---------ERCRRFLSDKDP.Q...V.ARRAAQAIERQFA-RLE--.ES-PEVGRP.....
Q7X2F1_AERS4/5-85-----LEFDPRA..WKEW---------KKLGDTV............RQQFKKKLAEVLE-RPR--.VE-ANRLHG.....
Q7X105_XANCI/4-90-----LFWTPEA..IQDR---------DDIYDYIE.ADN.P..VA.ALDLDELFEEKAA-LLV--.DH-PSLGRV..GRV
Q7NJC2_GLOVI/4-91-----YILNVLA..AQDL---------DEIADRFV.AAS.V..EA.GERFFEEFDRKCL-QLV--.TF-PNSGRS..YGT
PARE2_MYCTU/5-92-----LRVHNGV..EDDL---------FEAFSYYADAAPDQIDRL.YNLFVDAVTKRIP-QAP--.NA-FAPLFK.....
Q7MYS9_PHOLL/5-97-----VMLTKNA..EADL---------EDIYDYIVENDS.S..EK.ADYVLDQLLKTAD-SLA--.NF-PEKGNY..PKE
RELE_SHIFL/5-85-----LDFDERA..LKEW---------RKLGSTV............REQLKKKLVEVLE-SPR--.IE-ANKLRG.....
Q87CA4_XYLFT/5-87-----IDYTDTA..KQQL---------RKLDKHM............ARRIVDFMDERIA-GLE--.NP-RSSGKA.....
Q7N4Z1_PHOLL/4-95-----VIVTPAA..TRDI---------NRLIDFLYQRDT.V...A.AKSALSIISKHIQ-ALE--.SN-VLSGRP.....
Q9Z4G4_9ZZZZ/4-92-----IFWTMLA..SQDR---------KRIRKYIA.EQN.L..MA.AIELDERIGYSAS-SLA--.GQ-PYKGRN..GRV
Q8XUG4_RALSO/3-90-----LAITPLA..EQDL---------ESIADYIA.QDN.P..AR.AVTFVRDLREQCQ-RLV--.MN-PPGYRL..RPE
Q7X3U4_9ENTR/5-85-----LKFVPSA..EKEW---------KRLGHPV............REQFKKKLAERLE-NPR--.VP-SAQLHG.....
Q8ZPF9_SALTY/5-85-----LAFNESA..LKEW---------KKLGHTI............QEQFKKKLRERLE-NPR--.VP-ASQLHG.....
Q8G2B7_BRUSU/3-91-----VIVSPAA..RDYI---------KSEIAYLKLRSPSA.....AVQLSEDLKRLKR-DLG--.RF-SQM........
Q930F0_RHIME/3-90-----LVWARYA..LDDR---------DTIFSYIE.REN.P..RA.AVHVDEEIVSAVR-RLL--.DF-PESGRP..GRI
Q92ME5_RHIME/5-93-----LVFTPAA..LADL---------EETFWFV.AADN.P..RR.ARSYVAEIEQACR-NLC--.ET-PLMGRG..RPD
Q8PJV2_XANAC/4-95-----VIFAPAA..IGDM---------QRLREFLKPKSP.D...A.ARRAGEAIRRGVQ-ALG--.AH-PRMGRL.....
RELE4_CAUCR/20-106-----VVWTQRA..MADV---------YAIVGHISEQSR.P..LA.AQRLAKRLFDTGA-SLA--.TY-PERGRV..STQ
Q7WY46_PSEAI/4-109-----YRISHDA..QADI---------VDILRFTHNHFG.D..AA.RRRYQALIGAALE-AVA--.TD-PQQVGSISREE
Q8YKY3_NOSS1/6-100-----LIIKDRA..TEDL---------RHLANYILVNGN.A..DV.AVKFLNAAETTFA-QLQ--.KN-PGMGKV..TQL
A9CK22_AGRT5/5-88-----IEYHTLV..QKEM---------RKINPEV............RRRIRSFLHERLA-ALD--.DP-RQIGAT.....
Q7X2E3_AERS4/11-92-----VELTDTA..KKQL---------ARLDKTQ............SQRITKYLRR.IM-MLE--.NP-RDAGKA.....
Q82X24_NITEU/5-83-----ISIRQSA..VKSL---------EKIPGPD............RLRIIKAIDLLKE-HPG--.AG-SILKGE.....
Q8CYQ7_STRR6/7-87-----LVPTRRF..IKQL---------KKLDRYT............QKLITNYLQTNV.-.LE--.DP-RRHGKA.....
Q7TXN8_MYCBO/5-85-----VRFTTTA..RRDL---------HKLP...............PRILAAVVEFAFG-DLS--REP-LRVGKP.....
Q7N9Q9_PHOLL/5-86-----IDFDERA..LKEW---------YKLDQSI............RDQFKKKLRKLQN-NPY--.ID-SARLHG.....
Q8CMA1_VIBVU/4-92-----IIWTEPA..LSDL---------NDIAEYIA.LEN.I..VA.AKQLVQAIFSKVE-RLE--.AF-PESGRI..PPE
Q8R8H0_THETN/10-91-----VKLAKEA..VKFT---------EKCNSNT............KEKIKEAIEKIAQ-SPY--.VG-KNIKKL.....
Q9I708_PSEAE/3-93-----LKWTRKA..AADL---------DAIYDHYVVLIG.......PEKALKAVQDIVE-QVK--.PL-QQVANQGAGRP
Q981R5_RHILO/3-91-----VEFSDEA..ESDL---------ERIAAYIA.KDN.P..RR.ALSFIQELRGKCE-ALA--.ET-PKGSPL..VPR
O68848_VIBCL/6-94-----YKLSQLA..QEHL---------LKIKHYTIENFA.E..AQ.WQKYKSTLLSGFQ-TLA--.DN-PGLGKS..CED
Q7WTS8_9RHOB/4-90-----LEWKAAA..VADL---------LAIVDYIS.DDN.P..DA.AFALMEEIQDKVA-QLP--.AH-PKRCRP..GRV
PARE1_CAUCR/4-91-----YRLSRRA..KADL---------DDIWTYSEQRWG.V..EQ.AADYARELQATIE-MIA--.EH-PGMGQP..DEN
Q82VJ2_NITEU/2-87-----AE........ADL---------DNIIDYIA.QDN.P..TR.TEEFGQELRDKIL-PLT--.QN-PKMGRT..GRP
Q7NJK8_GLOVI/3-91-----VTWTSKS..LEDL---------ARLHAFLRPVNS.Q..A..AAAVVRNLTAGAK-RLE--.RF-PQLGTA..LPE
Q7N4Q8_PHOLL/5-85-----VKFTEDA..LKEW---------KRLDKSV............QQQFAKKLKKCCV-EPH--.IP-SVKLRG.....
RELE3_METJA/3-84-----VLFAKTF..VKDL---------KHVPGHI............RKRIKLIIEECQN-SNS--.LN-DLKLDI.....
A9CGP9_AGRT5/3-91-----LIWTRRY..LREL---------DAIGVYIA.ERN.P..RA.AAKVVRAIHQTTA-RLL--SDN-PHLGRS..GEI
Q9KML4_VIBCH/13-98-----LEYSTQF..KKDF---------KKITK..............M.PISDIIE..VG-NVI--.SK-LQRGEKLEPKN
Q8XE95_ECO57/2-89-----YKLSGKA..VEDF---------RGIYDYTLGKFG.D..EQ.ADRYTDSLGTFLD-TLS--.QM-PEIGQD..YDA
Q88BL8_PSESM/4-90-----IRWADEA..STDL---------VEIIDYIE.QRN.P..IA.AEALNANILKAVE-GLP--.SA-PYLFRH..GRE
Q87UB8_PSESM/5-85-----LEFDARA..LKEW---------RKLGDTV............RQQLKKKLATILV-APR--.VE-ANRLHA.....
Q7NP90_GLOVI/3-91-----VVITAAA..RADL---------VAIGSFIR.LHN.L..ER.AIIFVDELLDRCL-ALA--.DM-PRAFPL..VPR
Q9ZKW0_HELPJ/4-89-----IELKKKF..TKDL---------KKHIL..............NQKIELEV...FD-LVV--.EN-LRNQIPLDKRF
PARE4_CAUCR/6-94-----YRLSRKA..EQDL---------IDIYVAGVGLFG.V..AQ.AERYQDTLEAAFG-AIA--.AF-PHIGRE..RPE
Q8KUB3_ENTFL/4-90-----IFYTNQF..KKDF---------KKAKK..................QGKNLEKLK-EVL--.VL-LQEQQTLPPKY
RELE_MYCTU/9-89-----VAITATA..ARDL---------QRLP...............EKIAAACVEFVFG-PLL--NNP-HRLGKP.....
Q97SQ0_STRPN/4-92-----IRYHKQF..KKDF---------KLAMK..............R.GLKAEL...LE-EVL--.NF-LVQEKEHPARN
Q9ZH42_MORMO/5-85-----LAFDRRA..LKEW---------QKLGHTI............REQFKKKLAERLE-NPR--.VP-AARLHG.....
Q8EGZ3_SHEON/4-96-----IVFTATA..LRDL---------ERLREFLRSKNP.P...A.AQRAASAIINTIR-KLE--.SY-PDIGRP.....
Q8X2Z4_ECO57/4-91-----ILWLPSA..RDDL---------RQIITYIA.KEN.P..PA.ARRLKIRIETSVL-PLS--.EH-PYLYPP..SER
Q8PBQ3_XANCP/5-100-----VRFTQYA..RNDL---------ARLYDWLLQRAE.SGFTV.VERALQAIRDGVT-VLA--.LA-PLSCRK.....
RELX_ECOLX/5-85-----VKFREDA..LKEW---------QKLDKAI............QQQFAKKLKKCCD-NPH--.IP-SAKLRG.....
Q7N0D1_PHOLL/3-91-----VYWTLKA..QNDL---------ERIYHFACQYSK.S..H..ANNVLDHLIISTT-DLA--.LQ-PKIGIP..QPR
Q82WV5_NITEU/4-90-----LFWTPEA..LQDR---------DAIYDYIE.VDN.P..RA.ALALDELFSEKAQ-RLP--.DH-PALGHP..GRV
Q8PBT4_XANCP/4-97-----ARWRPLA..LRDV---------DEAAAWYGAEGG.L..AL.ELAFTKALESAVT-TLM--.RN-PAAGSS..RHA
Q98KV7_RHILO/3-92-----FRLSLAA..EEDI---------IGIAEQGVRLFG.A..VQ.ARQYHDELFAIFD-LIA--.AG-PRMARE..RLE
Q8YV81_NOSS1/7-86-----LRIARTA..EKDL---------LDLQ...............PKQFKQVVSKILS-LQG--.TP-RPQDCK.....
Q7NIV5_GLOVI/2-60-----L............---------........................RRVEGVVL-RLA--.DF-PNSGRP..GRR
RELE_HAEIN/9-100-----VSYSKQF..VRDL---------TDLAKRSPNVLI.......GSKYITAIHCLLN-RLP--...-......LPENY
Q93TU1_9GAMM/5-88-----IEFDDKA..KKDL---------AALDKSV............AKRITAFLRERVA-HLD--.DP-RSIGEA.....
Q82XK4_NITEU/4-93-----FILRQKA..MDDL---------LSIGRYTRKEWG.K..TQ.QIRYLTQLDRAFH-ELA--.DK-PGLGRA..CDD
RELE4_METJA/4-86-----IEIMPSL..DKIL---------QKLSKR.............DKKKLKAILKKME-EIT--.QN-PHHYKN.....
Q82UB7_NITEU/3-92-----VSISNSA..FNDL---------ETMISYYTAEGV....PDVGFKFAQEIIEHIQ-ILA--.DH-PDMGRI.....
Q7X3B4_9BACT/4-92-----IERTGQF..KRDY---------KREAK..............G.QHRATLDADLV-PVL--.VA-LADDQPLEPRH
RELE2_METJA/6-87-----YLLKKSF..IKDL---------KELPKNI............QEKIKKLVFEEIP-NKN--.NP-PEIPNV.....
Q7N737_PHOLL/4-92-----IDYASQF..KRDY---------KREKK..............G.RHREVLDDVLM-LMI--.EL-LASDSLLEPKY
Q8REK0_FUSNN/5-87-----VMIPDKV..NKKI---------LKFDRNT............RKLLYDYINKNLK-DTD--.DP-RLHGKA.....
Q7N4Q3_PHOLL/3-89-----VIWTPEA..KQDR---------ADVWDYIA.ADN.P..YA.AARMDEQFSDAAS-NLA--.RH-PMLGRP..GKM
Q8PR82_XANAC/4-92-----IIWSVPA..LADL---------DAIADYIA.IDN.A..PA.AAALVKRVFGHVE-QLI--.EH-PDSGSR..PQE
Q9F7Y3_PSEFL/5-88-----IEFDRAA..EREL---------GKLDPQI............AKRILLFLHERVS-NLD--.DP-RSIGEA.....
Q8KKD2_HELPX/4-88-----IEYHNLF..RKDY---------KKYLK..............N.GFDSKL...LD-EVV--.LE-LRQQKSLDPKY
PARE3_CAUCR/4-92-----VIRTRPV..SGDL---------DRVFRDVCENNG....VKVASAQLNRIESVFH-RLS--.AF-PRLGRD..RSD
Q7N4M0_PHOLL/4-95-----LIWSPPA..LADI---------QRLYGFLAKKDK.D...T.ARRAIKTIRAGVK-MLA--.RQ-PEAGRP.....
Q8P397_XANCP/6-93-----RDWTVPA..ATQL---------AHAQDHYH.ALN.P..TA.AAAMARQVREATR-TLA--.EQ-PGRGRA..GRV
Q7NNQ3_GLOVI/4-98-----VTQHAAA..RNDL---------IEHFVYLAENAG.L..DI.AERFLLNAEASFN-ALA--.EQ-PMLG.......
Q7N553_PHOLL/5-85-----LQFEKRA..LKEW---------KKLGHPI............KEQLKRKLAERLE-NPH--.VP-SARLSG.....
Y4KP_RHISN/6-92-----IRWTLRA..LRRL---------DEIGAYIE.KDD.P..DA.AARVVARIGTAVD-ALA--.EY-PASGRP..GRI
RELE2_CAUCR/4-88-----VVWTWRA..LADL---------TAIRDYIG.QFS.P..LA.AQRMALRLKTAAD-SLA--.EY-PERGRL..ATA
Q7UFD3_RHOBA/4-90-----YLLSHSA..NANL---------DEI......AGD.A..SN.AVAILEALHNTFQ-VLA--.NH-PGVGTL..RED
Q7NDJ5_GLOVI/6-93-----IFWAPTA..LEDL---------AALRANYP.ASY.P..EV.KSKALSRLEAVLG-NLA--.VF-PDMGRP..GSI
Q82UB0_NITEU/5-85-----LEFKKSA..LKEW---------EKLGHTI............KEQFKKKLKERLE-NPH--.VH-SAALPG.....
Q7NFJ7_GLOVI/3-90-----IFWSKQA..ISDL---------AAVRDYLE.AHY.P..IG.AKIVVARIEGAIE-RLG--.VY-PAMGRT..GRR
O70048_9ZZZZ/3-92-----LRIAEST..RGDL---------QAIQEYYRAEGV....PQIGDDFVAATLGHCE-MLQ--.RH-PEAGRV.....
Q7TZ73_MYCBO/5-94-----YLLSPAA..QAHL---------EEIWDCTYDRWG.V..DQ.AEQYLRELQHAID-RAA--.AN-PRIGRA..CDE
O82928_ECO57/3-91-----LKWSSKA..LSDL---------ARLYDFLVLASK.P..A..AARTVQSLTQAPV-ILL--.TH-PRMGEQ..LFQ
Q8R718_THETN/7-85-----IIVNKKV..LKEL---------EKHDRKT............VERVIKAIEKLPF-EGD--.VK-KLKTSK.....
Q9PBR0_XYLFA/4-92-----IKQLGQF..KRDL---------KREAK..............G.QHRATLEDDLL-PVI--.DA-LAKDMPLEPRH
Q9KMA0_VIBCH/6-86-----LKFLPAA..QKEW---------SKLAPTI............QSQFKKKLKERLE-NPH--.VP-SAKLRG.....
Q08799_VIBCL/5-85-----LEFKKSA..LKEW---------KKLAVPL............QQQFKKKLIERLE-NPH--.VP-SAKLSG.....
O29172_ARCFU/5-84-----AQFSEEF..LKIA---------KKLKEK.............DPELLKRLQSKVE-EII--.KQ-PEHYKP.....
Q82UC9_NITEU/5-85-----LKFLPSA..KKEW---------DKLDSSI............KTQFKNKLKKCLE-NPH--.IQ-PNKLRG.....
Q8DUM3_STRMU/4-90-----IKQTRQF..KKSL---------KKVVK..............QGKDINKLFAIVE-LLC--.QK-SE....LPLAL
Q82T19_NITEU/4-92-----YLLSPEA..KTDI---------TNIRQYTTQQWG.K..TQ.ADKYILRLRERMR-WLA--.DN-PMLGRA..RDE
Q82YR6_ENTFA/5-87-----VVYMPQA..QKQL---------KKMDRNQ............ARIIVAWIRKNLE-GTT--.DP-RQHGKG.....
Q8X366_ECO57/4-91-----VLWLESA..DTDL---------DDITSYIA.RFD.I..DA.AERLWQRLRGCVL-PLS--.EH-PYLYPP..SDR
Q92Q75_RHIME/9-89-----LEFLPSA..RKEW---------DKLGATI............RQQLVKKLRERLE-RPR--.IP-SAALHG.....
O25554_HELPY/4-88-----LNLKKSF..QKDF---------DKLLL..............N.GFDDSV...LN-EVI--.LT-LRKKEPLDPQF
Q7N9R3_PHOLL/3-93-----VRFTNKA..REHI---------RAIKLYSMRRWG.A..NV.AEAYSTSLRVTMT-EIL--DRH-PSPGRD..RSE
Q92ZZ9_RHIME/4-97-----IIPRQLA..RSDV---------EAAIDYYAREAG.T..EV.THGFIGALQAAYA-SIA--.SH-PEAGSL..RYA
Q88AZ2_PSESM/6-103-----LRFTDVA..QQSL---------EDQVEHLAVYQGFSPAAQRIDTLIDAIQDKLL-STP--.LG-YPVSPQ.....
Q7MZK3_PHOLL/3-88-----LSISPLA..EHDL---------EEIGDWIA.QDN.P..VR.ALSFTKELYQQCL-LLA--.EA-PAIYRE..RPE
Q82WH4_NITEU/8-100-----VLFTRGA..EQDL---------ELIYDYIVESDC.K..AN.ADSVLDRLLEVVE-NLA--.TF-PSRGTW..PKE
Q8D9P7_VIBVU/3-90-----VVWSPLA..LQKL---------GDAAEFIS.LDN.P..VA.AESWVNEVFDKTE-LLS--.NM-PEMGRM..VPE
Q87YW5_PSESM/3-90-----VEWLKTA..LKNL---------DDEAAYIS.LEN.P..AA.AVAFVEALQISVK-QLA--.SF-PALGRE..GRI
Q93KR9_YEREN/2-90-----YKLSELA..DEDI---------YNIASYTIRHFG.V..TQ.AKLYHENLAKVFE-LLA--.KN-LELGAE..CNW
RELE3_CAUCR/4-92-----VELGPRA..RRDL---------TKLRRWLLNRAPSA.....ADRAIDLILSRAE-QLA--.QH-SDLGRR.....
Q8TTQ0_METAC/4-84-----IIYSPAA..KRDL---------KRLPADV............QDRVHDALEEIAD-DPY--.AH-VKKLKT.....
Q7P822_FUSNV/4-90-----IKYHTKF..KKDY---------KLIIK..............R.GYNLKL...LE-EII--.DN-LANEKTLLPKN
Q9REP2_ZYMMB/4-88-----VLLERQF..KKDA---------KK...................NFLEFVTPAWA-EIL--.NC-LCQDVELPPKY
Q8VUA4_LACCU/4-104-----LRFKPRATFNADL---------KRLASL.............DKSIIDEVRAAID-LLL--.EQ-QQLPSEFEDHE
Q7MBA0_PHOLL/3-91-----IIWRKIA..EADR---------ERIFDYIA.QNN.P..SA.ALELDADFDAKIE-LAA--.QR-PKLYRP..GRV
Q7NFL9_GLOVI/4-91-----VLKTRQA..ERDI---------EDIWFYIALEDLQA.....ADRWLEGMSAQAQ-LVA--.SQ-PRMGRV..RPE

PF05973

Q4KIY8_PSEF5/12-94------RWLLNL...KDP.........QG..KTR------------VLARIRAA.QLG.-...--...-.RFGDCEPV..
D1N777_9BACT/14-103------REIRKF...PPD.........VQ...AQ------------TDRIVKLLEKFG.-PV.--EIP-GKTKQWE....
Q5NZR3_AROAE/12-94------AWFAEL...RDP.........QA..AAR------------IKMRIGRA.ELG.-...--...-.NFGDCEPV..
A4BMU1_9GAMM/12-94------AWLDHL...KDI.........NG..RAR------------IQARIQRL.ALG.-...--...-.NPGKHRDL..
Q1NTH7_9DELT/12-94------RWRARL...KDD.........RA..RAL------------IASRLDRL.AFG.-...--...-.HEGDVVSV..
Q1II49_KORVE/20-110------EVLKSW...PKP.........IR...WD------------FGQSLREMQLGRS-ARL--NVR-PMQSVGA....
A8LS22_DINSH/13-109------PEFDAL...PQE.........VQ...DA------------ILARALLLEREG.-PM.--LGR-PHADTLTGS.K
Q3B592_PELLD/22-109------EWLKQL....PA.........ID...RK------------IIGEDIKTVQYG.-WP.--LGM-PLVRKME....
A2RKX2_LACLM/21-112------EFLDGL...PTK.........DS...DK------------LVAVIKNIEDLGL-LTG--IRK-EWVKRLD....
B9LZK5_GEOSF/14-103------EEILAM...PAG.........FL...GR------------YFRYTDRMELYG.-PD.--LGM-PHTRAMG....
Q5DQT5_ACIBA/12-106------EWLEQQ...DEA.........TQ...EK------------VLAALVVLQQQG.-PS.--LGR-PLVDTVYDS.K
A4KI96_MYCTU/72-158------KEFDKL...PDQ.........AR...AA------------LIVLMQRYLVGD.-...--LAA-GSIKPIR....
Q87UD1_PSESM/18-100------GWLDTV...RDT.........RS..KAR------------ITTRVDRA.ALG.-...--...-.HFGITEPV..
Q1CAI8_YERPA/18-100------EYLKSL...RDS.........IA..KAK------------ISSRVNRI.ASG.-...--...-.NFGDHKPC..
Q3B4N0_PELLD/19-108------KDIEAW...PES.........IK...ID------------YARLIELLMDYG.-PD.--LRM-PHSKAMG....
A4N165_HAEIF/15-111------NWLETL...AED.........DV...LK------------IYAALELLSTEG.-PQ.--LSR-PYSDTLQGS.K
Q7N4L8_PHOLL/12-94------NWIDAL...KDI.........RV..KTK------------IQARIRRL.KNG.-...--...-.NSGDIEPV..
A2T3W3_PARAH/16-109------KDLMEL...PAD.........VR...SF------------IGFALHFAQHGEQ-HP.--AAK-VLKGFGG....
Q1NRL4_9DELT/14-103------ADILAL...PET.........LQ...AR------------YAALSRRIVACG.-PN.--LGE-PHTKAFG....
A0AYP2_BURCH/25-107------AWFAGL...PDR.........VA..RRR------------IQARIDRL.SMG.-...--...-.NPGDWKSA..
Q7MYA5_PHOLL/9-98------EDLLAF...PTD.........AR...KD------------AGYQLHRIQHGID-PE.--DWK-PFSDIGS....
Q1NJV9_9DELT/13-106------KDLMAL...SPN.........VR...RF------------VGYALSLAQAGDR-HD.--AAK-VLKGFGG....
Q218P2_RHOPB/12-101------DAVRLF...PDD.........AR...RA------------VGFQIDRLQRGLD-PD.--DWR-PMKTIGA....
A5UE73_HAEIE/18-110------EYLLSL...AQNESK..DSRIKL...NK------------IRDYVKLLSELG.-TS.--VGK-PYVKHLD....
Q9L3R6_NOSS1/13-107------MWWVEL...EES.........TQ...VA------------IDVVVRLIEARG.-AK.--LPF-PYSSKINSS.R
Q1I6T8_PSEE4/11-93------RWLIGL...RDT.........TA..RAR------------IVARINRL.KEG.-...--...-.LAGDVSPV..
Q1ZQ16_PHOAS/17-112------DFLEHI...SEK.........LR...LT------------IFNKFNAYKIHGD-VYH--CQH-LKILNAKIWKY
Q214V0_RHOPB/12-94------AWLRRL...SDP.........DA..IAK------------VTARIDRL.RLG.-...--...-.NPGDAEPV..
A6TF46_KLEP7/12-108------AWFELQ...SRA.........LK...ED------------MLATMLILSEFA.-PQ.--LGR-PYVDTVKDS.T
Q879T9_XYLFT/13-95------DWLKGL...KDG.........LA..RQR------------LIKRLRKV.QLG.-...--...-.NFGDVQPV..
A3T340_9RHOB/13-108------DERDAL...PQA.........VS...DK------------LDAMILLIEQYG.-PD.--LGR-PAVDRLNAS.A
Q5QWX8_IDILO/29-111------QWLSGI...KDQ.........TI..KGR------------IISHINRL.IEG.-...--...-.SSCDVKPI..
Q73LP9_TREDE/35-120------EYFRKA...SPS.........QK...RK------------FLMLVKKIGDFG.-...--...-KIFDKTKFRYE
A1VUI1_POLNA/18-100------AWISGL...RDK.........VG..QKQ------------VLARLARL.SLG.-...--...-.HWGDCKPV..
Q4CA57_CROWT/15-107------KDFRKF...PSE.........AQ...DI------------VLDALTIAAEGAK-SS.--LAK-PFKGAGS....
A1TA54_MYCVP/8-96------RWYAGL...SES.........EL...AQ------------ADQALDRLTAEGI-T..--LGM-PHNRYLS....
Q88BV0_PSESM/16-105------NDLRAF...PIS.........AR...RE------------AGFQLDRVQVGNE-PD.--DWK-PMTTVGP....
Y1419_HAEIN/13-95------SWLSKL...KNL.........RA..KAK------------INARIKRL.QFG.-...--...-.NFGDIKSV..
Q11SD2_CYTH3/31-121------EFFVKQ...KAK.........VK...DK------------IIWTFELIEELKR-...--VPE-SYLKHIEN...
A1ATP5_PELPD/24-106------VWLETL...RDV.........SG..RAK------------IRVRLDRA.RLG.-...--...-.NLGDHKAV..
Q0AG07_NITEC/12-100------DDLKNF...PEE.........AR...KA------------VGFELFAVQQGLM-PS.--DFK-PMLSVGP....
A6VT19_MARMS/12-107------EWFEAL...DDI.........DK...EN------------VLATLLLLQQKG.-PQ.--LSR-PYADAVNGS.K
A3EUI7_9BACT/2-83------RAVLFA...R.A.........TA..ALL------------VLSRLDRI.GTG.-...--...-.IFGNVKAV..
Q0KBP4_CUPNH/12-94------RWYSAL...RDH.........VA..RIR------------IQVRVDRL.LNG.-...--...-.NPGDAKAL..
A4L2W0_LACRE/20-111------EYLDSL...DVK.........AK...AK------------LLARINMVATYGL-SAG--IQH-NWVKPLE....
Q3R5P6_XYLFA/15-104------DDLRTF...PVN.........VR...RE------------AGYQLHQVQNGRD-PD.--DWK-PMPTVGR....
A0ZK22_NODSP/13-109------PEFGRL...PTE.........VQ...DE------------LLATAELLEKFG.-SQ.--LKR-PHVDTLNGS.E
A0PBA6_PASPI/12-107------EWFDAL...DDT.........DR...AN------------VLASMMVLRDRG.-PM.--LSR-PYADTVNGS.S
Q1NW10_9DELT/13-107------DWWSEL...SET.........EQ...ES------------LAATVQLLEERG.-PN.--LGF-PHSSGINGS.K
A1A1Y8_BIFAA/62-159------DWLNTL...DHK.........SR...VQ------------ILAAVSLLEEQG.-PD.--LKR-PIVGKIKGSSL
A7MHM7_CROS8/12-107------CWLARQ...PQP.........LQ...ED------------VLTALGLLKIKG.-PH.--LGC-PYADTLKGS.R
A7MNF3_CROS8/12-100------EELYAL...DPV.........MQ...AK------------VLRGLEKLEREG.-FR.--LRY-PDSRALS....
B2TE07_BURPP/34-116------AWLATL...ADL.........RA..RAK------------ILVRIRRA.ERG.-...--...-.HFGDVKLL..
Q6MCH9_PARUW/20-102------IWIKEI...KEI.........HT..RAK------------ILTRLDRL.KLG.-...--...-.NFGDCKTL..
Q8FLW2_COREF/12-94------RWLRKL...KNR.........RA..AAR------------ALVRIDRL.AAN.-...--...-.NPGDVKPV..
Q2IJ28_ANADE/15-99------DFLDGL...PPK.........DR...AY------------IVGDIAALRDYG.-...--IHA-PISTRTIKGGG
Q63YL2_BURPS/21-103------KWLDGL...RDP.........VG..SAA------------INLRIERA.KLG.-...--...-.NLGQWRAV..
Q8Z379_SALTI/21-110------EDLLAF...PIT.........VR...KA------------VGYQLHKIQYGIE-PD.--DWK-PFSEIGA....
Q2Y597_NITMU/19-112------RDFRAF...PDA.........VK...DE------------MGYALHQAQIGGK-SL.--SAK-PLQGFGG....
A3YBX5_9GAMM/13-95------KWLTKL...KDR.........NA..KSA------------ILMRIMRV.ENG.-...--...-.NFGDVKSV..
A6V7R5_PSEA7/16-108------KDFKEF...PVP.........VQ...KD------------MGVSLFVVQLGGT-PD.--SAK-PWKGLGS....
A5G8E6_GEOUR/19-99------EWFMGL....DT.........VA..AAK------------ITTVKLKM.EQG.-...--...-.NFSNVKW...
A0B522_BURCH/11-93------KWLRGL...RDH.........IA..RAQ------------IAKRIQRL.ARG.-...--...-.QYGDVKSV..
B3ECU3_CHLL2/15-97------HWLKRL...KNL.........QA..RAK------------VIARIRSA.EKG.-...--...-.NFGDCKPV..
Q08L06_BORPT/12-94------KWFAKL...RDE.........RA..ATA------------IASRLDRL.AFG.-...--...-.HAGDVEPV..
A7JT82_PASHA/5-87------QWLENL...KDP.........LA..VVT------------IARRIERA.ESG.-...--...-.NFGDTKYI..
A0YXM7_LYNSP/22-104------DWIDSL...QDR.........KA..RLK------------IKLRLDRV.EEG.-...--...-.NLGDYRSV..
Q2YCU5_NITMU/19-108------SDLRTF...PVL.........AR...RE------------TGFQLHLVQHGIE-PD.--HWK-PMNTIGQ....
A3ETT9_9BACT/12-95------RWLSRL...SDQ.........VG..RAR------------ILARLKRIRTAG.-...--...-.NMGDVKPV..
B3E763_GEOLS/12-94------NWLDNL...RDI.........QA..KAR------------VLVRIERL.ASG.-...--...-.NAGDVKPV..
Q6LL51_PHOPR/28-117------DEILSM...PPK.........IQ...AR------------MIKLLELIELYG.-AN.--LGP-PHTNSMG....
Q6G4P3_BARHE/12-93------KWLDSL...KDE.........IA..QAH------------IVKRIARI.ETG.-...--...-.FLGNVKF...
A8GK40_SERP5/17-106------VDLLAF...PTD.........AR...KA------------AGFELSKVQRGVE-PG.--SWK-PMSGCGA....
Q66F52_YERPS/24-113------KELSDL...DAI.........NR...AE------------FLVAIDVFELHG.-PG.--SGV-PNVEKIG....
A3IVA5_9CHRO/17-97------KWFNSL....DV.........QA..AAK------------ITVALSRL.ELG.-...--...-.NTSNIKW...
Q8YUE8_NOSS1/22-104------DWFDSL...RDR.........KA..KAK------------IRARLDRV.ENG.-...--...-.NLGDCKSV..
A4SDX0_PROVI/12-94------AWLSAL...KDQ.........KA..KAR------------ILCRIQSA.MHG.-...--...-.NFGDCEPV..
Q1NKC1_9DELT/18-100------EWLRKM...RDV.........KA..KSA------------IIRRVNRM.ELG.-...--...-.NFGDHRPC..
A2WEG9_9BURK/26-113------AWLKAL....GP.........AE...RA------------TIGEEIKTVQLG.-WP.--LGM-PLVRKMS....
Q89YJ9_BACTN/14-102------EFFENL...DAG.........TQ...DK------------ILYVLMLLQTQDR-...--IPL-KFMRLIE....
B7KPZ3_METC4/17-98------SWFDDL....DP.........QA..AAK------------VTVAVARM.EAG.-...--...-.NLSNVKSV..
Q0WEK0_YERPE/7-96------RELVRL...PVG.........IQ...AV------------LIKAMDELEACG.-HE.--LRE-PYVRDMG....
A9BSX0_DELAS/12-94------DWVDSI...RDI.........PT..RIR------------LRRRLGKA.MRG.-...--...-.NLGDVKSV..
A7HGK8_ANADF/12-105------QWIEGL...SHR.........EQ...KA------------VLQVVKILEQVG.-VA.--LGE-PYPSALKGT..
B0URD9_METS4/24-112------EWLKDQ....TP.........DD...RK------------VIGQDIATVEFG.-WP.--VGM-PTCRPMG....
Q64S39_BACFR/34-125------DFLNHL...PSK.........IK...DK------------IIYNIAKAKFV..-...--IDP-ELFKKLDD...
Q3KEQ5_PSEPF/13-95------TWHASI...RDL.........RA..KVA------------IARRIDRA.SAG.-...--...-.NLGDIKPV..
Q1N6Z8_9SPHN/13-108------AEFEEL...PEA.........VQ...DE------------LLASAKLLAAFG.-PQ.--LSR-PHADTLNDS.S
A8ZRU3_DESOH/22-104------KWFSSL...KES.........TV..KIR------------VLARLARV.ENG.-...--...-.NFGDFKQI..
Q8D9T6_VIBVU/14-104------REFAKL...PKD.........AQ...KA------------FRTYVEETLKKGE-YSS--LDT-EKFKSVH....
B1Z7X4_METPB/27-120------KDLAAF...PDE.........VR...SA------------FGHALHEAQCGLE-PY.--AAK-ALKGFGG....
Q7N374_PHOLL/14-103------NEILAL...PDT.........LQ...AR------------YIRYSERMREHG.-AN.--LGE-PHTEAFG....
A1U4X0_MARAV/39-131------EWLLSL....SK.........DD...RS------------LIGTDLKTVEYG.-WP.--LGM-PLVRGFSGK.A
B4SF39_PELPB/12-94------KWLSAL...QDR.........TA..KAR------------ILVRIDRL.GLG.-...--...-.LTGDTKPV..
A6TTH9_ALKMQ/20-111------EFISSQ...SPK.........EQ...AK------------ILREIDLLSEFG.-LS.--LGM-PHIKKIQG...
Q5DY06_ECOLX/13-109------NWFDAQ...TVA.........LK...ED------------LLAAMLILAEYG.-PQ.--LGR-PFADTVNDS.Q
Q31SJ4_SHIBS/12-100------DELLEL...PDN.........LR...GR------------MTRLIERLEQEG.-NK.--MKM-PHSRVIG....
A7JPP0_PASHA/17-111------EWFGQQ...DES.........TQ...ER------------VLACLIYLRKFG.-YS.--LGR-PYADTVYQS.K
Q7TZ51_MYCBO/86-182------AWLNGL...DRE.........TY...EL------------VFAAIEVLEEEG.-PA.--LGC-PLVDTVRGS.R
A7DVA5_VIBVU/13-95------DWLREL...KDP.........QA..RGS------------IAARVQRL.TQG.-...--...-.LNGDVKPV..
Q3AS48_CHLCH/14-104------KFISEL...DSK.........AA...KK------------IFYNIDLAEQT..-...--NDP-KLFKKLQ....
Q5P365_AROAE/30-118------DDLQDF...PAD.........AR...RA------------AGFELFAVQRGLM-PT.--DFK-PMLAVGP....
Q4UJX1_RICFE/21-102------DWLEKL....DV.........ET..HSR------------IINRLVRL.EYG.-...--...-.VYGDYKQI..
Q2W5K8_MAGSA/14-104------AEIAAL...PKD.........MQ...AR------------FLRIAGMIESAG.-LEG--MGH-PHVKSLE....
A3DFG3_CLOTH/17-104------EYIDGL...PKN.........EK...AE------------GLTILEKLEKEG.-LEA--LEV-LNTRQLR....
Q847G3_PSEPU/12-94------TWERKL...RDK.........KA..KLI------------IAARVLRV.AHG.-...--...-.LVGDVQPV..
Q6ZEF9_SYNY3/12-94------RWFKSL...RDC.........QA..KAR------------IDIRIRRL.SLV.-...--...-.NAGDVKSV..
Q2Y569_NITMU/17-110------KDLMVF...PTK.........VR...KF------------FGHALDFAQHGDR-HG.--AAK-VLKGFSG....
Q3B553_PELLD/29-119------DYLTSL...PDK.........DR...QK------------VAWVLTLIRDFQI-...--VPK-EYFKKLQS...
Q4BVR3_CROWT/12-94------NWFKGL...KDR.........RA..KAR------------VQARIDRL.EMG.-...--...-.NFGDVSPV..
A7GVS7_CAMC5/13-102------NEILSL...PKN.........LQ...AR------------AFKMMQMLEIYG.-NT.--IGE-PHTKNIG....
Q9S1D8_YERPE/12-106------DWLNEQ...EDA.........LQ...EK------------VLADLKKLQVYG.-PE.--LPR-PYADTVKGS.R
Q07IW5_RHOP5/12-94------RWLRKL...RDR.........RA..RAK------------ILLRIERL.ELG.-...--...-.NPGDVASV..
A1JN81_YERE8/7-96------RELFKL...PAG.........IQ...AA------------LIKALDELEVYG.-HE.--LRE-PVVRDIG....
Q2TR61_ACIBA/20-102------EWLDGI...KDN.........MT..RIR------------LNRRLDKV.QRG.-...--...-.NWGDIKPL..
A0YT26_LYNSP/13-107------QWWLTL...DEA.........TQ...DE------------IDIAVELLQERG.-PN.--LRF-PQSSGVQGS.R
O53332_MYCTU/11-104------RWFFAL...NRD.........AM...AS------------VTGAIDLLEMEG.-PT.--LGR-PVVDKVNDS.T
Q2RPR9_RHORT/12-94------EWLAGL...ADE.........KA..GAR------------IAQRIVRL.RNG.-...--...-.LFGDVKPV..
Q8YY18_NOSS1/22-114------KNIRSF...PEE.........VR...AS------------VGYALQLVQAGET-PM.--DAK-PFKGVGS....
Q1I3E1_PSEE4/13-103------REYKDL...PQD.........VQ...DD------------FGKDLRRIQYGQD-PVR--PIK-SLTDSVG....
B3E292_GEOLS/31-120------DFLSSL...PTN.........YEKDGVA------------IRRLFAYVALNG.-PRL--LPP-EICHTIA....
A7ZGL1_ECO24/12-100------EEATAL...PVK.........IR...VK------------FDRLIGKLEYDA.-RL.--LRE-QDTKPLG....
Q7N9V6_PHOLL/12-101------KELSKL...PVG.........LK...VS------------MIEAIEELEAAG.-TD.--LKE-PKVRDIG....
A2PNJ7_VIBCL/13-102------DQILDM...PPK.........IQ...AR------------MIKLLELMEKHG.-AN.--LGP-PHTESMG....
A3IZL8_9CHRO/20-112------DWLNQL...KRQ.........DKKGFAK------------CVARIQQLQDFGH-E..--LRR-PASDFLR....
B1K7F4_BURCC/17-106------EGVASL...PTT.........LL...AR------------YFALADRMERYG.-PH.--LGE-PHSQSMG....
B4SC33_PELPB/39-129------DFLGCL...DKK.........HY...EK------------ILFNIRKAQTQ..-...--HDP-ELFKKLN....
A7ZDX4_CAMC1/11-94------KWLHKL...NNP.........IV..KVS------------ILRRLEQIETKD.-...--...-.HLGDYKFI..
Q6ALJ1_DESPS/15-97------KWLKKL...KET.........EA..KLT------------ILARIDRV.KIG.-...--...-.HFGDQKQL..
A5CZG1_PELTS/31-118------EYLDSL...PKD.........ES...AL------------GYAILEMLANRG.-FEA--LEA-LETRQVR....
A6VS62_MARMS/25-113------EWLLSL....TK.........ED...RS------------AIGQDIKTAAYG.-WP.--VGM-PICRSMG....
A0LZX5_GRAFK/14-104------DFYNSQ...DDK.........IQ...RK------------IEYVLDLVRYEKR-...--VPK-KFYKLLKN...
Q145G4_BURXL/15-104------HDLLAF...PEE.........MR...RR------------AGFQLGKIQAGLD-PD.--DWK-PFDSIGP....
O07029_9LACT/16-107------QFLDQL...PDK.........DA...AK------------LIATIQNIENNGL-LVA--ERQ-LWVKKLE....
A1VDE6_DESVV/12-94------KWLSGL...KDM.........AG..RAR------------ILVRIRSA.EAG.-...--...-.NFGDCEPV..
A5FU34_ACICJ/16-105------DDLRDF...PIS.........AR...RE------------AGHQLDQVQQGHD-PD.--DWK-PMRTIGQ....
B3E6M8_GEOLS/17-110------KDLKEM...PED.........VR...RF------------FGVALFMAQAGGK-HP.--DAK-PLKGFSG....
A4SDW2_PROVI/21-102------EWFDSL....DA.........VT..AAR------------VVVYVERV.IQG.-...--...-.NHSNVAPI..
A1WN68_VEREI/20-105------EWLKKL...RDP.........IA..KGQ------------VVKRVGRI.EAG.-...--...-.NFGDHKPCRE
A6QD20_SULNB/19-108------AETFAL...PPK.........IL...AK------------MLHIFELIEMAG.-AQ.--LGE-PYTKPLN....
A7BLF9_9GAMM/18-100------EWLLNL...RDK.........KA..KAK------------VLTRLDRV.TAG.-...--...-.NFGDHKYL..
A7VXT9_9CLOT/20-112------IFISRL...EPK.........MQ...QK------------IRTQIKVLTAPQC-S..--FQP-PLVKAFRLD.R
Q24S02_DESHY/18-111------DFLDKL...DKKAATSKANRVRL...KK------------IYEYLDILEKLG.-.P.--IGE-PYTKHLD....
A3IUC1_9CHRO/20-108------KWLDSL...PNK.........VQ...TK------------CFVKLERLAQLGY-E..--IRR-PEADLLR....
Q7MAX4_PHOLL/12-104------SEIDGL...SEE.........LQ...GK------------FYALIDTLSDK..-PHD--LRE-PHCKLLEK...
Q3KJ93_PSEPF/12-94------SWLVKL...ADS.........RA..RMR------------IQVRIDRM.AEG.-...--...-.NFGDVKAI..
A9W8J5_METEP/32-120------EWLREL....PL.........ED...KR------------VVGFDVRRVQLG.-WP.--IGL-PVCRPMA....
A3RSU0_RALSL/12-94------DWFCSL...RDK.........AA..QRR------------IQVRIDRL.QMG.-...--...-.HLGDMKAV..
A6VNM6_ACTSZ/12-94------DWLRGL...KDL.........SG..KAA------------IIARINRA.ANG.-...--...-.NFGDHKSV..
A8ZUV5_DESOH/22-104------KWLNSL...KDR.........FA..RAR------------IRVRLNRV.RLG.-...--...-.NFGDCKPV..
A3N206_ACTP2/18-110------EFLLRL...LKERQE..GSRERL...HK------------ISHHLSILHLHG.-TR.--AGE-NYIKHLE....
B4ST98_STRM5/11-93------TWIDAL...KDV.........TG..RAR------------ILARIGRL.SEG.-...--...-.HLGDHRYL..
Q13FU4_BURXL/21-103------EWLKRL...RDG.........QA..KVA------------VARRVIRI.EQG.-...--...-.NFGDHKFC..
B8FNX0_DESHD/18-112------DYIAEL...DEKANTSKDSRVRL...KK------------IYQYFELLKIYG.-TR.--AGL-PSSKYIE....
A8L8P9_FRASN/3-102------EWLHVLRQSDPA.........TY...RS------------VNIAIDMLAEIG.-PG.--LGR-PLVDTLQGS.T
Q0YSE0_9CHLB/13-104------DFINSL...SPK.........LR...AK------------ALRAIELLKEFG.-FR.--LGE-PHSKTLAG...
A6GSB7_9BURK/12-94------NWLDGL...RDI.........NA..RAR------------IQVRIERL.ATG.-...--...-.NAGDVKPV..
A6GR64_9BURK/49-137------AWLKAL...KPE.........SD...KK------------IVGADILAVQWG.-WP.--LGL-PLVDHLG....
Q1NV93_9DELT/17-98------NWFDEL....ES.........RA..AAK------------VTTALIRL.QLG.-...--...-.NTSNVKSV..
B7KSA7_METC4/12-94------TWIDDL...RDV.........RA..VAR------------IAKRIDRL.ALG.-...--...-.NPGDVKPV..
A3EUW1_9BACT/35-115------DWFQSL....DP.........IA..AAK------------ISVAKIRM.EQG.-...--...-.NLSNVKW...
Q64MD6_BACFR/17-108------EFLDGL...PSK.........VR...EK------------IVSNIRKSTFV..-...--LDP-ELFKKLDD...
Q3AR08_CHLCH/21-102------DWFNYL....DS.........VS..AAR------------VAMYLERV.AQG.-...--...-.NFSNVAPI..
Q02AH7_SOLUE/9-98------QCLREF...PED.........AR...HD------------AGYQLDKVQRGEQ-PD.--DFK-PMVSVGK....
A4W5D5_ENT38/12-94------RWEQNV...NDP.........RA..KTL------------IAARLFRL.ANG.-...--...-.LPGDVRPV..
Q1VPX8_9FLAO/16-106------KFLLAQ...PKK.........VQ...DK------------IFKVIEIIETYQH-...--VPK-TYLAPMKT...
Q01YW8_SOLUE/16-108------KDFEKF...PEG.........AR...SI------------FLAALTIAAEGAK-AD.--LAK-PMHGLGS....
Q7N9A1_PHOLL/12-100------QEIKSL...PAK.........VG...VK------------LVRLIGKLEKDP.-RS.--LRE-PDTKHLG....
Q2RNU1_RHORT/33-123------AELAML...PAD.........QR...AR------------FVWIATLLREAG.-PQK--VRE-PYVKPLG....
Q12AL6_POLSJ/17-110------RDLDAM...PED.........VK...DV------------FGHAIDLAQAGGK-HQ.--DAK-VMTGFGS....
Q82UW3_NITEU/21-103------KWLDGL...KDR.........PT..RIR------------LIRRLDKA.RQG.-...--...-.LLGDVKSV..
A1URJ8_BARBK/18-100------DWHSEV...RDI.........KA..RIA------------IDRRIMRV.ELG.-...--...-.NFGDHKPL..
B3EMQ2_CHLPB/12-94------KWLDGL...RDV.........RV..RAR------------ILVRIERL.SAG.-...--...-.NPGDVKTV..
B0TA13_CAUSK/14-104------TEIAAL...PKD.........MQ...AS------------FLRLAERIEAVG.-LER--IGQ-PHVKHLH....
Q9PCS5_XYLFA/14-96------AWINSL...RDR.........KA..AAR------------IQARLDRL.ALG.-...--...-.NPGDVKPV..
A6TIF1_KLEP7/12-100------KEFTAL...PAA.........IR...AK------------MARLLMKLEANP.-RQ.--LRE-PDTKPLG....
A1VID1_POLNA/19-99------HWFDGL....PS.........QA..AAK------------VTVAKLRM.ELG.-...--...-.NTSSIKW...
A3J9T6_9ALTE/13-102------GGILAM...PPK.........IQ...AR------------MIRLLEMIEMHG.-AN.--LGE-PHTKSIG....
Q9PD07_XYLFA/12-94------KWREKL...KDA.........RA..RSA------------IASRLDRL.AFG.-...--...-.HVGDAEPV..
B3EPE2_CHLPB/14-103------ADIEKW...PAS.........IK...AD------------YRSISLLIMEYG.-PQ.--VRM-PHTKAMG....
A3EQ97_9BACT/12-94------KWRERL...KDQ.........QA..RAL------------IASRLDRL.AFG.-...--...-.HTGDIEPV..
A0ZJ88_NODSP/54-148------QSWLML...DGA.........TQ...VS------------IDIAVKLLEEKG.-PN.--LPF-PRSSDVKGS.R
Q5P930_AROAE/15-104------DDLRAF...PLA.........AR...RE------------AGHQIDQVQRGRE-PD.--DWK-PMSTVGQ....
Q3JDX2_NITOC/12-94------CWLKKL...RDR.........RA..AVR------------ISARIDRL.AFG.-...--...-.NPGNVQPI..
A1U427_MARAV/12-94------KWERKL...RDQ.........RG..KAL------------IAARIFRL.ANG.-...--...-.LAGDVKPV..
A3JL44_9ALTE/18-100------KWLDRL...KDI.........SG..RAR------------IQTRIQRL.ALG.-...--...-.NPGKHRNL..
B1ZLX5_METPB/12-94------DWFDGL...MDR.........QA..QAR------------IDVRVRRL.SLG.-...--...-.NPGDVRHL..
A7FEQ3_YERP3/12-100------DEIADL...PPI.........IR...AK------------MIRLIDKLKMNA.-TA.--LRE-PDSKPVR....
A7HQS5_PARL1/14-111------AEFADL...SLA.........VR...EE------------LLARALMLEEFG.-PA.--LGR-PAVDTLNAS.K
Q6N368_RHOPA/26-107------DWLDGL....DV.........MA..AAK------------VTTAVARL.SLG.-...--...-.NLSNVKSV..
A5VYQ7_PSEP1/12-94------AWLSSL...RDL.........SA..RLA------------IGRRLERA.AAG.-...--...-.NLGDFKWL..
B1YYE7_BURA4/17-106------AGVFAL...PKT.........LT...AR------------FFAIADRMEQYG.-PN.--LGE-PHTRPMG....
Q3SUP3_NITWN/18-110------KTFEDF...PQG.........AQ...DD------------ILAALTVAADGSF-PG.--NVK-PMKGLGS....
A7M637_BACOV/16-104------AFMETL...TEK.........EQ...DK------------IQYGLLLLKTQER-...--LST-KFVKFVQ....
B1JYX5_BURCC/20-109------ADLRGF...PLP.........AR...RE------------AGHQIDQVQRGLA-PD.--DWK-PMRTIGV....
A1ACR9_ECOK1/13-102------DDLRAF...PES.........SR...QE------------IGYQLDRIQQGLN-PY.--DWK-PFSTIGP....
Q73S09_MYCPA/13-110------AWMDAL...DDE.........EY...DN------------LIAALEQLEEHG.-PI.--TRR-PFVDTLEGS.R
A9BXV4_DELAS/19-99------TWFNGL....DG.........QA..AAK------------VAVAMARM.ELG.-...--...-.NTSNIEW...
Q1NR35_9DELT/12-94------VWFDNL...RDR.........QA..RVR------------IQARIDRA.ELG.-...--...-.NFGDCKPV..
Q2RX83_RHORT/12-94------KWRTRL...KDV.........RA..RAI------------IAARLDRL.SQG.-...--...-.HTGDSEPV..
A6GLV3_9BURK/12-94------QWLESL...DDK.........LL..KGA------------ILGRLRRI.ELG.-...--...-.LKGDVKTV..
Q1M5S2_RHIL3/20-110------KAMKAL...PKE.........IA...LQ------------FATDLQRVQEGKS-PLS--DFK-HLKGIGQ....
Q9PHG3_XYLFA/18-100------EWRDKV...KDI.........KV..RIA------------IDRRLYNL.ELG.-...--...-.NFGDHKPC..
C1DE87_AZOVD/12-94------RWFSGL...RDR.........RA..AVR------------VQARIDRA.EDG.-...--...-.NFGDCEPV..
Q87CU6_XYLFT/12-101------MCLRQF...PED.........AC...SD------------AGYQLDKIQRGEQ-PK.--DFK-PMPSIGK....
A8GWQ1_RICB8/24-112------EWLLEL....EP.........KD...CK------------TIGTDIKTIEYS.-WP.--VGM-PICKSLG....
A9AIJ2_BURM1/16-109------RDLKAM...PEA.........VQ...DT------------FGYALYLAQTRGK-HD.--QAK-PLRGFGS....
Q3QYK0_XYLFA/12-100------EDIRNF...PTS.........AR...QA------------LGRQLLRLQEGLD-PQ.--DWK-PMKTIGS....
A6W1R7_MARMS/13-95------QWLSKL...KDR.........QA..LLA------------INMRIIRA.ING.-...--...-.NFGDSKVI..
A3ITS2_9CHRO/22-103------NWFEQL....DM.........QT..QVR------------IDVRLDRV.RLG.-...--...-.NFGDAKSV..
Q89TC5_BRAJA/52-145------DDLRAF...PDE.........VR...RV------------MGFAINDAQNGDE-HP.--RAK-ALKGFGG....
Q2J903_FRASC/7-103------AWVNEL...DPR.........SR...AL------------VVDAIDRLADAG.-PS.--LGR-PLVDRLVGS.E
Q6LK89_PHOPR/13-103------KEFKAL...PDQ.........IQ...KR------------FANDLNAIAQNKA-PFS--KFK-HLTDSVG....
A3N344_ACTP2/16-98------HWLKTL...KNP.........IA..RIT------------IARRIERA.GFG.-...--...-.NFGDHKAL..
A7JRF2_PASHA/19-108------DDIREF...PDN.........IK...RE------------LGFDLDLVQQGLL-PR.--DFK-AMANLGS....
Q7N7C8_PHOLL/17-110------KDLLNL...PKD.........VQ...RF------------FGFALDFAQRGEK-HD.--AVK-VMKGFGG....
A5I9N6_LEGPC/14-103------EAILTM...PPK.........IQ...AR------------MIKLLELIETHG.-AN.--LGP-PHTEAMG....
Q3R3H1_XYLFA/12-105------KDLMAM...PDD.........VQ...DI------------FGYALHLAQTGEK-HD.--QAK-SLKGFGS....
A2W0N6_9BURK/21-103------EWLNAV...RDK.........PA..QAR------------IRERLRRV.QTG.-...--...-.NFGDCEPV..
Q48B35_PSE14/12-94------AWERRL...KDQ.........KA..KAA------------IAARIFRV.ANG.-...--...-.LMGDVSPV..
A1WNI4_VEREI/25-112------DWLKNL....PA.........IE...RK------------AIGEDIKTVQFG.-WP.--LGM-PLVRKMG....
Q1QGV2_NITHX/19-110------KDLRAF...PAA.........VR...SE------------IGQSLFEAQLGEH-PR.--NAK-PLKGFG.....
Q4K3L2_PSEF5/15-104------RDLRAF...PED.........AR...RA------------AGFQLDLLQQGEQ-PY.--DCR-SVKTIGP....
B4SEJ0_PELPB/18-108------DYLDTL...SEK.........EV...QK------------VLWVLRLVKELPT-...--VST-EYFKKLQN...
A3JL75_9ALTE/13-101------EELAGM...PPK.........IQ...AR------------MIRLMELMEKHG.-AN.--LGE-PHTKSLG....
Q97QQ7_STRPN/18-110------DYMREL...TSKKGK..DSRIKL...NK------------INDYIELLSQHG.-TR.--AGE-PYIKHLD....

PF05015

HIGB1_VIBCH/1-93-----MALEFKD---KWL---------EQFYEDDKR.HRLI-----PSSIENALFRKLE-ILD---AA-QAESDLRIPP.
Q9PFE9_XYLFA/13-105-----VIKSFRH---KGI---------QQFFLEGS..TAGI-----QTKHAAKLRIQLT-ALE---SA-KHPKDMNAP..
O67947_ACEEU/3-101-----FNVNDLS---KDL---------RAFWNSNGQNTSKI-----NANYAKRLRLALT-HLY---YA-RTQGDIAFPAP
Q46559_DICNO/28-119-----MIKSFAH---KGL---------KRFFEDDD..TRGI-----QPHHAEKLRVLLY-AMD---IA-ETIQELDIE..
Q98K96_RHILO/1-95-----MIVGFRD---GWL---------RAFFVDDTR.SRNI-----PSDLESRLFRKLQ-MID---DA-TVDQDLRVPP.
Y1250_HAEIN/5-97-----KREHFRD---DYL---------YRFYQYGDT.HSKI-----PSNLYKVLARKLD-MIS---AS-ENINDLRSPP.
Q9PCR9_XYLFA/1-96-----MEVKFED---PSL---------ERLEANQK.....Y-----TAGLVKVFHRRIQ-FIR---AS-PDERAFYAMK.
Q52305_9ZZZZ/1-92-----MIKSFKH---KGL---------KLLFEKGV..TSGV-----PAQDVDRINDRLQ-AID---TA-TEIGELNRQ..

PF06296

Q1GRC7_SPHAL/1-94MR..........--....---------.......------------......RAESGLV-DAD--LGG-GVIKQRVARP.
A9BUS1_DELAS/16-135MRIFKNAWFARY--ARKQ---------D.ISDKS------------MVQAIERAEQGLI-DAD--LGG-GVIKQRVARP.
B1ZE24_METPB/1-120MKAFLPPDFAKR--AAKE---------G.VSDGS------------LREAVARADRGLI-DAQ--LGL-SLIKQRIPRR.
Q0BB87_BURCM/6-118RRVFKTKWFHKA--AGKA---------G.IADRD------------LCRAVRELARGQG-I.D--LGG-NVWKKRLDDN.
Q7MZ40_PHOLL/1-113MRVFKTKWFSKA--AKSH---------A.IKDSE------------LCQAIEAAMQGKA-D.D--LGG-GVYKKRLNQN.
A1IQ13_NEIMA/1-120MRIFKNQWIVKF--AKKH---------K.INDSE------------LLEAVERADNGLI-DAD--LGG-GVIKQRIARQ.
A6WJD0_SHEB8/2-121GRIFKTAEFTSW--ANDE---------G.LEDAA------------LLAAVDEMDRGLI-DAN--LGG-SVVKKRVPRL.
Q2RVX2_RHORT/2-121TRILKRKDFARW--QEGE---------K.LPDAA------------LCKAVQEMENGLI-DAD--LGG-HLYKKRVARP.
Q8X3N0_ECO57/1-124MGVYKARRFSQS--TKKL---------G.IHDKV------------LMAAAEEVMQGIW-EAD--LGS-GVIKKRLPLQ.
Q130T9_RHOPS/1-120MRVFLTKPFARF--ARRE---------R.ITDLQ------------LRATVERAEQGLI-DAD--LGA-GLIKQRLARS.
Q3B4L4_PELLD/1-122MRVFLNKWFCRW--TKDE---------R.VPAAT------------IWAVAEEVVAGNV-EAD--LGG-LLFKKRIPRQ.
Q45933_COXBE/1-120MRIFKTRYFHRW--AKSE---------N.LSDSQ------------LKTAISELMKGLH-DGD--LGS-YIYKKRIPIL.
Q32X74_PSEFL/3-115PRLFKTKRFAMQ--AGKA---------W.VGDEE------------LREAFTEMLDGQA-D.N--LGG-GVWKKRLNAN.
Q7N530_PHOLL/1-120MKVFKNAWFERF--ARKQ---------R.IPDEV------------LLDAIERANRGQI-DAD--LGG-GVIKQRVARK.
A0LNU9_SYNFM/1-120MRVFKTKWFVRY--ARRE---------R.IKDQS------------LCEAIERAERGMI-DAD--LGG-GVIKQRVGRA.
Q8ZL23_SALTY/1-113MRTFKTRWFNRE--AKPH---------T.IKDDE------------LSEAINAVLQGKA-D.N--LGG-GVYKKRLNQN.
Q3B1W0_PELLD/44-163VEIFKNKWFNKF--AKHE---------G.ISDSA------------LLEAIDAAERGLI-DAD--YGG-GVIKQRIARP.
A7BV94_9GAMM/1-120MRIFKLKLFHKW--AFKE---------G.LTDES------------LQKAIKEMENGLI-DAD--LGG-NVYKKRVGIQ.
A1VVB2_POLNA/4-123KKVFKTKSFARW--ARKL---------..ISDSE------------LCVAALEIEKNLY-EAD--LGG-GVCKKRIAVP.
A3WDJ1_9SPHN/14-133TRIFANRWFAKF--AAKE---------K.ISDAT------------LADAVHRAESGLI-DAD--LGS-GLIKQRLARE.
Q12GA8_POLSJ/2-121KRVFKTKTFDRW--ARKV---------..VSDLL------------LCQAASEIEQGLF-EAD--LGG-GVCKKRVAVP.
Q3AQ54_CHLCH/1-122MRVFKNKWFNHW--ASRE---------G.ISDDV------------LFGAAKEIIIGNV-EAN--LGG-YLFKKRLPRQ.
A6DKJ2_9BACT/1-122MRVILTKSVKKW--LDKE---------KNVRNAN------------IIAAAEEVVLGSF-EAN--LGG-NLYKKRISNST
Q329F3_SHIDS/1-113MRVFKTKWFARE--ARSH---------A.ITDEE------------LCRAILETEQGKA-D.A--LGG-GVFKKRLHQN.
A6TFW5_KLEP7/12-124MRIFKTKWFARE--ASSH---------G.ISDDE------------LYQAIQSALQGKV-V.D--LGG-GVYKKRLNKN.
A7BYY7_9GAMM/1-120MRTVATKKFDQW--TEKQ---------G.VSVDD------------LKEAADELANGLY-EAD--LGG-HLFKKRVGVG.
A3RPT5_RALSL/6-118QRIFKTKWFNKA--AQAA---------S.ISDAE------------LHRVARQLMQGLG-D.D--LGG-NVWKKRLDQN.
Q92MY0_RHIME/3-122VRIFKNAWFERF--TRKQ---------R.IADAA------------LVDAVRRAERGQI-DAD--LGG-GVIKQRVARA.
A1WRZ7_VEREI/2-121MRVFKTRHFQRW--MRKT---------E.LTDAA------------LCKAVEEMAGGSI-DAD--LGG-GVVKKRVGLA.
B4SB86_PELPB/1-120MRIFKNRWFAKF--AKDE---------G.ISDEK------------LCKAVKDAENGLI-DAD--YGG-GVIKQRIARL.
C5AZC2_METEA/15-127SRAFKTAVFARS--ARKA---------R.IRDSE------------LCEALREVMAGQA-D.D--LGG-GVFKKRLNKN.
A5V2L0_SPHWW/1-120MSVFMSKSFARF--ARKA---------G.LASEA------------LIEAASAVAAGQA-DAD--LGS-GVFKQRVARS.
A7HZB0_PARL1/1-120MKIYLAKTFARW--ARKE---------R.LAKED------------LCRAAREIGDGLV-DAR--LGG-LLVKKRIART.
B4SBL9_PELPB/1-120MKIFKNKWFAKF--AREK---------G.ILDTD------------LCETVKDAESGLI-DAD--YGG-GVIKQRIARP.
A9L1Q5_SHEB9/2-121GRIFKTPDFVTW--AKDE---------G.VNDKA------------LLDAVKEIEAGLI-DAN--LGG-NVIKKRVARE.
Q1I9J7_PSEE4/1-120MDVYKRREFARW--QVRE---------C.VPDNV------------LCKAVAEMQSGLV-DAS--LGG-LLYKKRVAGW.

PF12910

A1ACN0_ECOK1/10-55M......RTISY---------------SEA-RQN------------LSATMMKAVEDHA-PIL..ITR.Q..NGE-----
A1WU36_HALHL/1-46M......ETISY---------------TDA-RNH------------LKELIDRVGTDHT-PVR..IER.R..GGS-----
A1WV52_HALHL/1-46M.....IETINI---------------HEA-KTH------------LSRILDRVSQGES-VI...IAR.A..GQP-----
A1WV58_HALHL/1-46M......DAISY---------------TAA-RRQ------------LASTMDKVCEDHA-PII..ITR.N..KAQ-----
A2P9T6_VIBCL/1-44M......HTLTA---------------NDA-KRN------------FGELLLSAQR.EP-VI...ISK.N..NKN-----
A3DB70_SHEB5/1-46M......AIYSF---------------TEV-RSN------------FKSICDTVVNDCE-PVV..IHR.R..GNE-----
A3UQS0_VIBSP/1-46M......NIVSF---------------TEA-RNS------------LKSVLDRVVDDSD-VTV..ITR.R..DSE-----
A3V913_9RHOB/1-45M......KTINI---------------HEA-KTH------------LSKLVEAAAKGEA-FV...IAK.S..GRP-----
A3VLT0_9RHOB/1-46M......KYASS---------------TDL-RKN------------LSAMMDKVIDDHE-PLM..VTR.T..GGK-----
A3W8L0_9RHOB/9-54M......DVMTY---------------SDA-RAQ------------LKGVMDRAIHDKQ-EVI..VTR.K..KGE-----
A3ZAD9_9SYNE/1-45M......RKVNM---------------HEA-KTH------------LSRLVDEAAAGES-FL...ICK.A..GQA-----
A4BLZ6_9GAMM/1-45M......KTINI---------------HEA-KTH------------LSRIIERVARGES-VI...IGK.A..GKP-----
A4BRI9_9GAMM/1-45M......TAITA---------------SEA-RSN------------LYRLIDEVASSHQ-PLL..ISG....KRN-----
A4BVI7_9GAMM/1-46M.....KRIVNV---------------HEA-KTH------------LSRLLDEAHAGTE-II...LAK.A..GKP-----
A4J2N2_DESRM/1-47M...HMQEVLNA---------------TEV-RKE------------WGSFIDTVVREKP-KM...VKR....NRD-----
A5CZB0_PELTS/1-48M......FRVSV---------------HEA-KNK------------LTALRREAAAGKE-FLLADVRR.K..DDS-----
A5CZB2_PELTS/1-51M.....LQVNSI---------------SQA-RTE------------FQKLFKQAVLHNR-EFLTENAK.ETTSGE-----
A5D516_PELTS/1-47M.....LEELKF---------------TEA-RGG------------FSALYSRVFNHYR-PVI..IRR.R..QAE-----
A5GD14_GEOUR/1-46M......HAITY---------------SEA-RHA------------LKDVMDEACSNHE-PIL..ITR.R..KGE-----
A5GDY5_GEOUR/1-45M......TTLSA---------------TEA-RKC------------LYSLVDDVAESHH-PVQ..IVG....KRH-----
A5TRR0_FUSNP/1-46M......IATNY---------------SEV-RNN------------LKAYCDKATKDYE-TII..ITR.K..NNE-----
A6DZ93_9RHOB/1-46M......DVFTY---------------TDA-RAS------------LKEVMDRVIHDRT-EVV..VTR.K..NRE-----
A6FHK8_9GAMM/1-46M......SVVTF---------------SEA-RNN------------FKSICDSAVDDCE-PVH..IHR.R..GGE-----
A6TF68_KLEP7/1-45M......RTVNY---------------SEA-RQN------------LADVLESAVTGVP-VT...ITR.R..GHK-----
A6UIL0_SINMW/1-46M.....IETVNI---------------HQA-KTN------------LSRLIEKAAKGEP-FI...IAK.A..GKP-----
A6X3S6_OCHA4/1-44M.......RVSV---------------TEA-KGQ------------LTELVKRAEAGDE-VI...LTR.R..GHE-----
A8FZZ5_SHESH/1-46M......RIISF---------------TEA-RNG------------LKAVLDGVVNDAD-TTV..ITR.R..DSE-----
A8GU11_RICRS/1-45M......NKWQL---------------HEA-KNK------------LSNIIDIAMHGTP-QC...ITK.R..GKE-----
A8IME7_AZOC5/1-52MIRPRAMDVLSY---------------SDT-RAN------------LKEVMDRVVEDHA-PVV..ITR.Q..KAE-----
A8ZWS8_DESOH/1-45M......PTLTA---------------TEA-RSK------------LYGLIDETAASHE-PII..IKG....KRG-----
B0K692_THEPX/1-47M...NEMFTVNA---------------TDA-RNE------------WSDFINSVIREKP-KI...IKR....TKD-----
B0NMA5_BACSE/1-46M......RTANY---------------SEL-RNN------------LKHYLDGVINDSE-PLL..VHR.A..GNE-----
B0T841_CAUSK/1-45M......RTVNI---------------HEA-KTH------------LSRLVEQAADGES-FI...IAK.A..GKP-----
B0VBV1_ACIBY/1-45M......NQWNY---------------SNA-RAQ------------LTMIMDQAIAGHP-VE...ITR.R..GRE-----
B1G8Y4_9BURK/1-46M......NVLTY---------------SEA-RAG------------FKPAMDEVCRDHA-PML..ITR.Q..SGE-----
B1TGL1_9BURK/1-45M......QTVNI---------------HDA-KTH------------FSRLVDAAASGEE-IV...IAK.A..GKP-----
B1YFG3_EXIS2/1-46M......SIVIY---------------SDA-RKN------------FKQILDQVHDDKE-AVI..ISR.K..NNE-----
B2AJI9_CUPTR/1-45M......QTVNI---------------HEA-KTH------------LSRLIEEVAAGDE-VV...IAK.A..GKP-----
B2I1D0_ACIBC/1-45M......EQINY---------------ANA-RSQ------------FSKVMERVLLGYA-VK...ITR.K..EKD-----
B2J2I7_NOSP7/1-46M......TAISA---------------TEA-RAN------------FQELINRAEYKGE-RIV..IQR.H..GKP-----
B2J5Y7_NOSP7/1-45M......ETVNI---------------HQA-KTN------------LSKLLSRVELGEE-II...ISN.R..GVP-----
B2PVB1_PROST/1-46M......KTISF---------------SDA-RNN------------LKSVLDSVVDNAD-TTI..ITR.R..DSE-----
B2TF86_BURPP/1-45M......LTVNI---------------HEA-KTN------------FSRLVDAAAGGEE-IL...IAK.A..GKP-----
B3RCW4_CUPTR/1-45M......QTINI---------------HEA-KTH------------LSRLVDQAANGEP-FV...IAK.A..GKP-----
C7QT44_CYAP0/1-46M......KAITS---------------NQA-KEQ------------LDELIDRVILDVE-PTI..VCN.D..QGK-----
B5EPP6_ACIF5/1-45M......STLTA---------------SEA-RAN------------LYRLIDQAAESHQ-PIY..IAG....KRT-----
B5JSV7_9GAMM/1-46M......RVINF---------------SDA-RNK------------LKSVLDQVVSDAD-YTV..ITR.R..DSE-----
B5JWA5_9GAMM/1-50MV..IYMDTVSV---------------NQF-RDK------------LKTFVEQVVTNHS-PIK..VTR.R..AGD-----
B6VMW8_PHOAA/1-45M......KIINF---------------TDA-RAK------------LSDIHKTAVSGEP-VI...IRH.K..SFG-----
B8FQ08_DESHD/1-49M...TMLTELQF---------------TEA-RSQ------------FSTLYDSVFNSFS-PAI..VKR.K..QTE-----
B8GV80_THISH/1-45M......ETVNI---------------HEA-KTQ------------LSKLLDGVSKGKP-FI...IAK.A..GKP-----
B8KV21_9GAMM/1-45M......TTVNV---------------TEA-RAK------------LYKLIDDTAANHE-PVI..ITG....KRG-----
B9L8I3_NAUPA/1-46M......EVVTM---------------SEA-RNN------------LKEIFEKVYFNHD-EVI..IHR.K..GKE-----
C0GDA4_9FIRM/1-46M......IAISY---------------SAI-RQR------------FKEFCDKATNDFE-TII..ITR.E..RGE-----
D6SQ06_9DELT/1-47M.....AIQTTY---------------THA-RAK------------LSSLLDAVTQDRE-VVI..IQR.R..GQE-----
D6STR0_9DELT/1-45M......DTINV---------------HEA-KTH------------LSRLIQKVLQGEE-VI...IAK.K..GRP-----
D0KW14_HALNC/1-45M......AILNA---------------TEA-RSK------------LYSLIDEANDSHQ-PIV..IKG....KRG-----
D0KX96_HALNC/1-46M......NAISY---------------TAA-RAN------------FAKTMEKVCNDHH-PII..ITR.K..QEA-----
D2SEQ1_GEOOG/1-47M......TVANV---------------HQA-KTN------------LSKLLDAAERGEE-VI...ITR.RGGGVT-----
C1DNZ6_AZOVD/1-46M.....METISL---------------ADA-KNN------------LSRLVDAASDGRE-II...IAK.H..GRP-----
C7LS61_DESBD/1-45M......HQVNI---------------HDA-KTN------------LSRLIEQAVNGEP-FI...IAK.S..GKP-----
C7LS62_DESBD/1-46M......LQTTY---------------TDA-RAN------------FASLCDEVTENQE-IVI..IRR.R..KGQ-----
D3PM77_MEIRD/1-47M.....AIETSY---------------SLA-REQ------------LATLLDRVTNDLE-VVI..INR.R..NGK-----
C3K1T8_PSEFS/19-64M......ETINY---------------TNA-RAH------------LSETMDRVNEDHV-PLL..VTR.Q..KGE-----
C3PMR0_RICAE/1-45M......EIYNT---------------SEA-RSK------------LYKLIDYVSDVHK-PVY..IKG....KRN-----
D2B388_STRRD/1-47M...TSLHYDSY---------------TEA-RAH------------LKDLLDAAARGQT-AT...LRR....DTA-----
C4KD62_THASP/1-47M.....TIETTY---------------SQA-REQ------------FKTLMDRAVDDRE-VVV..VRR.R..SGG-----
C4LCD3_TOLAT/1-45M......KTLTA---------------TEA-RTN------------LYRLIDQTAESHQ-PIA..ISG....KRA-----
C4UEE8_YERAL/1-44M......ITLTF---------------SDV-RQK------------FSSVLDTAVN.QP-VT...ITR.R..SAP-----
C4YXE4_9RICK/1-46M......EAISY---------------TKA-RNN------------FADIMERVCVDHT-SVV..VTR.Q..KQK-----
C4ZB44_EUBR3/1-45M......LAVKS---------------MDV-REN------------FKSLCDKVFRGET-LI...VSR.P..KNE-----
C4ZJ95_THASP/1-44M......RTVSA---------------TEA-KQG------------LAGVLDLAAH.EP-VV...IRR.Q..KRD-----
YEFM_SYNY3/1-46M......KAITT---------------TQA-KDH------------LDELINAVISDLE-PTI..VSN.N..QGQ-----
Q0AX75_SYNWW/1-49M.....LEEKSI---------------SLA-KQD------------FPNIVRQAAKGHE-TI...TRNFKSLNHE-----
Q0AZ30_SYNWW/1-44M......QTINA---------------TEI-RNN------------FSYYIDTVVRDKP-IA...VKR....NRD-----
Q0KJA8_9SPHN/1-45M......DTVNI---------------HEA-KTH------------LSRLLERVLRGNA-VV...IAR.S..GKP-----
Q1IT03_KORVE/1-45M......KKINI---------------HEA-KTH------------LSRLVDEAAKGKP-FI...IAK.A..GKP-----
Q1NP70_9DELT/1-46M......LQTTY---------------SHA-RAT------------FASLCDQVTENRE-IVV..IRR.R..KGE-----
Q1NRQ5_9DELT/1-46M......EVSSY---------------TEA-RNN------------LKAILDRACDDYE-PTI..VTR.K..SGQ-----
Q1NU91_9DELT/25-69M......QTVSV---------------AEA-KSH------------LSALLDAVLAGEE-IV...ITR.R..GKP-----
Q1NX73_9DELT/1-46M.....SAIVNV---------------HEA-KTQ------------FSRLLDQAHAGQE-II...LAK.A..GKP-----
Q1QB64_PSYCK/1-50ME..YVVRVISF---------------SEA-RKH------------LKSVLDTVNDDAN-ATI..VTR.R..DAD-----
Q28SG2_JANSC/6-49M.......NVSV---------------SDA-KAN------------FSELVRRAEAGES-IV...LTR.N..GKP-----
Q2W6L4_MAGSA/1-45M......STVNI---------------HAA-KTH------------LSRLIEEAAAGGE-VI...IAK.A..GKP-----
Q31NY1_SYNE7/1-46M......KVVSF---------------SDA-RKN------------LKTVLDEVVNDAD-YTI..ITR.R..NAE-----
Q3MBC7_ANAVT/1-47M.....PSQTNY---------------TEA-CNN------------FDKIYEEAVNSRE-PVI..VNR.E..GAE-----
Q3SES5_THIDA/1-45M......LTVNI---------------HDA-KTQ------------LSKLVEQAAQGEA-FI...IAK.A..GKP-----
Q46ND9_CUPPJ/1-46M......RTVHF---------------SDA-RNN------------LKAVIDQAIDDHD-AVL..ITR.R..DAP-----
Q48B26_PSE14/1-46M......QILSF---------------SQA-RAG------------LKQAMDDVCRDHE-PAV..ITR.Q..RGN-----
Q5NZB8_AROAE/1-45M......NTLTA---------------SEA-RAN------------LYRLIDQTVESHE-PII..ITG....KRN-----
Q5P6K8_AROAE/1-45M......HVVNI---------------HEA-KTH------------LSRLLEIVERGEE-VV...IAR.A..GQP-----
Q5P6U3_AROAE/1-46M......RVVNF---------------SEA-RNN------------LKNVIDQVIDDAD-YTV..IAR.R..DAP-----
Q72B94_DESVH/1-47M.....LQAVTY---------------AEA-RQR------------LAAIMDNVSDSHQ-PTI..ITR.Y..KAR-----
Q7N280_PHOLL/1-46M......KVLTY---------------SEA-KQN------------LSETMTNVVNDCS-PVI..ITR.K..NGE-----
Q87UE9_PSESM/1-45M......QTHNI---------------HAA-KTH------------FSQLVDAAAGGET-II...IAK.A..GIP-----
Q8YV80_NOSS1/1-47M.....IDPVSA---------------TEA-RAK------------FQEIINRVEYGKE-RIL..IER.H..GKP-----
Q9Z5W8_FRANO/1-47M......QTVNY---------------STF-RNE------------LSDSMDRVTKNHS-PMI..VTRGS..KKE-----

PF02604

Q3AS06_CHLCH/5-78T------DIKPV---------------TYL.KAN------------AADLFAQINDTRR.PVI--ITQ-N--GEP.----
Q0A5I5_ALHEH/1-74M------KVELV---------------TNL.KRQ------------ATKILAELRASKE.PVL--ITE-H--GQP.----
B1JW05_BURCC/1-78M------PTVNM---------------HDA.KSR------------LSSLVEALESGREAEVV--IAR-N--GHP.----
Q8KPS5_SYNE7/17-90M------KVVSF---------------SDA.RKN------------LKTVLDEVVNDAD.YTI--ITR-R--NAE.----
Q1MDP7_RHIL3/1-70M------KTVSI---------------RDA.KNR------------LTELAREVEEGET..IV--VTR-N--GRP.----
Q7P2C4_FUSNV/1-71M------LAINY---------------TTL.RTN------------LKSYFDKAVDNDE.DII--ITR-K--NER.----
A7HZ68_PARL1/7-79T------AISSI---------------SAL.KQS------------PARIIEEAGAGP...VA--ILN-H--NKP.----
A5U6L9_MYCTA/1-74M------RILPI---------------STI.KGK------------LNEFVDAVSSTQD.QIT--ITK-N--GAP.----
A1VNA4_POLNA/1-72M------HTWQL---------------QEA.KSR------------FSELVDLTLSEGP..QL--VTR-R--GQD.----
Q1RJA1_RICBR/1-68M------EQLNA---------------TEA.KRE------------FGELLIKAQI..E.PIS--IIK-N--GKP.----
Q4FS93_PSYA2/7-79T------QTASI---------------SEL.KNN------------PSALIKQSDGES...IA--ILN-H--NKP.----
Q88JZ5_PSEPK/7-79E------AAVSI---------------SEL.KKN------------PSRILAEAAGAP...VA--LLD-Q--DRV.----
Q7CY23_AGRT5/1-74M------ANVRF---------------TEF.RQN------------FATHFDRVLETRA.PLL--VTR-Q--GKE.----
Q3MBC7_ANAVT/2-75P------SQTNY---------------TEA.CNN------------FDKIYEEAVNSRE.PVI--VNR-E--GAE.----
Q3A951_CARHZ/2-77E------KIIGV---------------DQL.RPR------------LGEYLEEVDKGEV..FI--ITY-R--SNP.----
A8GN91_RICAH/1-70M------N.ISA---------------TEL.NKN------------PGKIIDQALREP...IV--INK-Q--GRP.----
Q8GEI6_ERWPY/8-80N------TAASI---------------TDL.KRD------------PMGTVRAAEGET...IA--ILN-R--NEP.----
Q83AB4_COXBU/1-74M------NVVTF---------------SEL.RAQ------------LKKILDLSADQHE.PVV--VKR-P--NKE.----
P73973_SYNY3/1-74M------ETINY---------------QQF.SEK------------LPTLVEKIGNEQE.PLC--LEL-P--NYL.----
A3LCG6_PSEAI/1-74M------RTISY---------------TEA.RQN------------LSATMMKTVEDRA.PIL--ITR-Q--NGE.----
A5G9X2_GEOUR/8-81Q------DIRPM---------------SEF.RTG------------IASFLKQVHDTKR.PMI--ITQ-H--GKG.----
Q1QFA3_NITHX/2-74S------STVTA---------------AEV.SKN------------FGAYQDAAVREP...VV--ITK-N--GRP.----
Q1NJK0_9DELT/1-74M------KTLSL---------------SEA.KMK------------LSALVETLQISNE.EVL--ITK-N--GRP.----
A2VFU8_MYCTU/1-74M------SEVAS---------------REL.RND------------TAGVLRRVRAGED..VT--ITV-S--GRP.----
Q1BZZ9_YERPA/1-69M------KIETI---------------SYV.KKN------------AASL.....DLEE.PIL--VTQ-N--GVP.----
Q9F5E8_AGRRH/5-75S------GSYST---------------SDL.SRK------------SGDIIAEALR...HPVT--ITQ-R--NKP.----
Q3BKG0_9PROT/1-71M------HAWQV---------------QDA.KAR------------FSELLRSAAAEGP..QA--ITV-R--GRT.----
A3ET18_9BACT/1-72M------ETVGA---------------YEA.KTH------------LTQLLDRVAKGEK..IT--ITR-H--GIP.----
A4KGH0_MYCTU/1-74M------AVVPL---------------GEV.RNR------------LSEYVAEVELTHE.RIT--ITR-H--GHP.----
C1AHM0_MYCBT/8-83V------EAIGI---------------REL.RQH------------ASRYLARVEAGEE..LG--VTN-K--GRL.----
A2VPH2_MYCTU/12-86M------TSVGV---------------RAL.RQR------------ASELLRRVEAGET..IE--ITD-R--GRP.----
Q92JV5_RHIME/2-75E------EAVSA---------------ADA.NRK------------FSLILRSVREGHS..YV--VTS-H--GRP.----
A3KKH7_STRAM/2-71A------YEIPV---------------TQA.RAE------------LADLINRVVYGGE.RVV--VTR-H--GKP.----
Q8Y121_RALSO/1-74M------QSWQM---------------QAA.KAR------------FSDVVKRAADDGP..QE--ITV-H--GRP.----
A5UG66_HAEIG/9-80E------QAASI---------------TDL.KRN------------PMGVMRESENGV...IA--ILN-R--NQP.----
B1ZAQ8_METPB/1-74M------GSIGF---------------TEL.RRN------------LAEHLDRVESDRV.ELI--VSR-R--DRE.----
A6FHK8_9GAMM/1-74M------SVVTF---------------SEA.RNN------------FKSICDSAVDDCE.PVH--IHR-R--GGE.----
Q92K09_RHIME/1-70M------Q.VTI---------------RNP.KTN------------LSKLIEAAKAGEE..VV--IAK-G--TVP.----
Q5H0A8_XANOR/10-84L------EKSPA---------------ADIKVKG------------WPSLMRKVRSHGA..VV--ITN-H--NHP.----
A1KP50_MYCBP/1-72M------S.ISA---------------SEA.RQR------------LFPLIEQVNTDHQ.PVR--ITS-R--AGD.----
A4X3L4_SALTO/1-74M------RTVPY---------------SEV.RQN------------LAKMLDHVVDDAE.EVV--VTR-S--GRE.----
Q8F586_LEPIN/1-76M------KSIGI---------------KDL.KNN------------LSSYLEFVKKGET..II--IYD-R--NNP.----
Q72GP3_THET2/5-76K------RVLSA---------------TEA.RVH------------FGEVLRRVEEGEV..IV--VEG-R--GRP.----
A7C5N8_9GAMM/1-74M------EQISV---------------HEI.KTN------------LTTVFDRINYNHE.VMI--VKR-N--ETQ.----
A6NUB6_9FIRM/2-75P------TIRPI---------------SDL.RNN------------ANEISDFCRQTHE.PVY--ITR-N--GSG.----
A7HJE8_FERNB/5-77T------DFYSL---------------ADA.KAK------------FSEVVEISEN...VDVV--ITK-N--GKP.----
Q87UE9_PSESM/1-73M------QTHNI---------------HAA.KTH------------FSQLVDAAAGGET..II--IAK-A--GIP.----
Q0FUX1_9RHOB/1-74M------NVMTY---------------TDA.RNG------------LAKALDKVVEDRE.ELV--ITR-T--GRE.----
A1U627_MARAV/7-79R------LAATI---------------SEL.KAN------------PNEVLNQANGEP...IV--ILS-H--NKP.----
A2SME8_METPP/3-75S------TSVGA---------------FEA.KTH------------LSALLERVERGEE..IV--ITR-H--GRP.----
Q5N582_SYNP6/25-97M------QTVGA---------------FEA.KTH------------LSSLLDSVCQGEQ..IV--ITR-H--GCP.----
Q3A3M7_PELCD/5-78E------SVKPI---------------TYF.KAH------------SAEVLGHLDQDGN.ALV--ITQ-N--GEA.----
Q1RJ58_RICBR/1-73M------EVFNT---------------SEA.KNK------------LYELMNYVSEVHK.PIY--IKG-R--KSK.----
A3JC22_9ALTE/1-74M------NIISV---------------NKF.REN------------LKSLVEQVISTHE.PLK--VTR-R--AGE.----
A8GU35_RICRS/7-79N------LAVSI---------------SEF.KKS------------PTALLDKASGEP...VA--LLN-H--NKP.----
Q2J9K2_FRASC/1-74M------TTLPF---------------TDA.RNR------------LSELLDDVERTHD.RVE--ITR-H--GHA.----
Q8KCZ1_CHLTE/23-91S------DIRPL---------------SEF.RAN------------TAALITQVRKTGR.PLV--LTQ-H--GKS.----
A8GU11_RICRS/1-72M------NKWQL---------------HEA.KNK------------LSNIIDIAMHGTP..QC--ITK-R--GKE.----
Q1M8R1_RHIL3/1-75M------E.WQL---------------QDA.KNQ------------FSKVVQKARQEGP..QV--VTV-R--GER.----
Q9Z5W8_FRANO/1-75M------QTVNY---------------STF.RNE------------LSDSMDRVTKNHS.PMI--VTR-G--SKKE----
Q1N5J5_9GAMM/1-73M------AGITA---------------TEA.RSN------------LYRLIDETAESHQ.PIV--ITG-K--RNK.----
A7BS83_9GAMM/2-72Q------AEWAL---------------KEA.KNQ------------LNLLIKQAGTGNP..QF--ITQ-H--GKP.----
Q5DXZ3_ECOLX/7-76E------KSVNI---------------TEL.RKN------------PAKYFIDQP......VA--VLS-N--NRP.----
Q4C411_CROWT/2-74R------QKLNI---------------TNN.PED------------LNNLIKSVTEDDV.IYE--IQN-Q--ND..----
VAPB4_MYCTU/2-74S------ATIPA---------------RDL.RNH------------TAEVLRRVAAGEE..IE--VLK-D--NRP.----
A6H2C6_FLAPJ/1-74M------VVANI---------------SDF.RKD------------IKSYFDRVAINFE.TLI--INR-G--KDS.----
A5LVR7_STRPN/31-105M------EAVLY---------------STF.RNH------------LKDYMKKVNDEFE.PLT--VVN-K--NPDE----
Q2Y598_NITMU/1-65M------KAIAA---------------KEA.KNN------------FGEMLDTVQR..E.PLT--IEK-H--GRA.----
Q8YV80_NOSS1/2-75I------DPVSA---------------TEA.RAK------------FQEIINRVEYGKE.RIL--IER-H--GKP.----
A5E9E6_BRASB/13-85E------GAWTL---------------AGA.KAR------------LSELVDRAQAGP...QV--ITR-N--GKP.----
A3WTD0_9BRAD/1-75M------R.VPV---------------TEA.KGQ------------LTELVRRAEAGDE..VI--LTR-H--GHA.----
Q2J2M4_RHOP2/1-69M------KTINL---------------REA.KAT------------LSAVVEAAEAGEP..VT--ITR-H--GKP.----
A9BWR5_DELAS/1-73M------KSWPV---------------QDA.QDH------------FNELLEACLTDGP..QV--LTR-R--GAD.----
Q4C7V9_CROWT/2-73A------KYITL---------------NQA.QKK------------LSQLPDEIID..E.PMI--ITD-K--DKP.----
Q1LA07_RALME/7-80M------KSMAL---------------SVV.RAD------------FEKTIVSVCKNSE.PLV--IKR-R--RGA.----
B4SDY6_PELPB/5-78E------RVRPI---------------SYL.KSH------------AAEIVRDFEENRS.PLI--VTQ-N--GEA.----
A3XEP7_9RHOB/7-79N------VAVSV---------------SDL.KKS------------PTSVLEQANGES...IA--VLN-H--NRV.----
Q3SUJ2_NITWN/10-83V------KSVSA---------------REA.KYG------------FGKLIDTARA..E.PVT--VEK-H--GRA.----
B0KAJ7_THEP3/22-97S------YMISV---------------SDLGRGK------------ASKIIEKVAKKKE.HYI--VVK-N--NKP.----
Q48B26_PSE14/1-74M------QILSF---------------SQA.RAG------------LKQAMDDVCRDHE.PAV--ITR-Q--RGN.----
Q6G6L3_STAAS/1-75M------IITSP---------------TEA.RKD------------FYQLLKNVNNNHE.PIY--ISG-N--NAEN----
A9L6D3_SHEB9/1-68M------NTLSA---------------NEA.KIH------------FGDLLLKAQQ..A.PIQ--INK-N--GKP.----
Q8YUZ9_NOSS1/1-76M------KKVTL---------------TEL.SNN------------IEHLLDEVVETGI.PIE--INK-N--GK..----
Q1RH38_RICBR/1-73M------KTIGM---------------FKT.KTH------------LPELIKDVEAGEE..LC--ITN-R--GRK.----
A5GA73_GEOUR/8-81N------DIIPI---------------AEF.KTG------------ISKWFKSLQKSGH.PLI--ITQ-N--GKP.----
A3Y9U0_9GAMM/1-68M------NTLTA---------------NDA.KRN------------FGELL..LSAQRE.PVK--ISK-N--NKD.----
Q57IR8_SALCH/1-72M------RTVNY---------------SEA.RQN------------LAEVLESAVTGGP..VT--ITR-R--GHK.----
Q0AZM5_SYNWW/1-74M------LIKSS---------------SAL.RND------------YDSLVKLAHEKAE.PIY--ITR-N--GEG.----
A7VC40_9CLOT/2-70I------QIRPV---------------SDL.RNK------------FPEI.ETIVNSGK.PVY--LTK-N--GYG.----
Q02AM0_SOLUE/9-77T------IVVSA---------------LQA.RSN------------FGKLLRRVEDEGR.SLV--IEK-R--GTP.----
Q2RG18_MOOTA/60-129E------EILGV---------------EEA.RRK------------LGRLVTQVAQKRE.PII--IIH-K--AKE.----
Q217W8_RHOPB/1-75M------RHVAV---------------TDA.KSQ------------LDDLLAEVEATGD.DVV--ITR-D--GVA.----
Q7A3T0_STAAN/1-74M------IIKNY---------------SYA.RQN------------LKALMTKVNDDSD.MVT--VTS-T--DDK.----
Q8R721_THETN/2-77E------KVIGI---------------DKL.RPK------------LGEYLKEVEKGDV..II--VSS-R--SEP.----
Q4UNJ2_RICFE/1-69M------KSISS---------------KEA.QNH------------FGELMNQAVK..S.PVV--INK-Y--GKP.----
A9BIX2_PETMO/6-72F------TFYSL---------------AEA.KAK------------LSQVVDEVENKD...IV--ITK-N--GVP.----
Q7NI03_GLOVI/2-73Q------STWQL---------------QEA.KNQ------------FSKVVDLAVTVGP..QI--VTR-H--GEP.----
Q82VL3_NITEU/3-75I------TTLSS---------------REL.NQD------------IGRAKRAARNGP...VI--ITD-R--GKP.----
Q4ULJ1_RICFE/2-73K------NAITA---------------FDA.KTH------------FSKLLDRASKGEE..IL--ITK-R--GKA.----
A6VV50_MARMS/5-78S------QIKPI---------------SYL.KAH------------AAEVVRNLSTNMQ.PMV--ITQ-N--GEA.----
A4GRN0_LEIXC/1-74M------QTMSV---------------SEA.KDK------------LSNLVEGVEATHD.AVV--ITR-H--GKP.----
A0YN28_LYNSP/3-76F------HQIAL---------------NDA.IAN------------LSQLCDRVVDDRD.IVI--ITR-S--DGE.----
A3ILX9_9CHRO/2-73T------KYINI---------------TEV.QQK------------LLELSNDLND..E.PLI--ITK-E--GKP.----
Q5NZI4_AROAE/7-79D------FSVSM---------------SEF.KKN------------PAQVLRTAGEKP...VA--VLN-H--NRP.----
A5TRR0_FUSNP/1-74M------IATNY---------------SEV.RNN------------LKAYCDKATKDYE.TII--ITR-K--NNE.----
A6DJA3_9BACT/1-74M------NAMTY---------------TEA.RQN------------LAKTMESVCNNHD.PVI--ITS-K--RER.----
Q47D13_DECAR/1-72M------NTWPV---------------QDA.KAR------------FSEFLAACLSEGP..QM--VTK-R--GTE.----
Q1NJ13_9DELT/7-79N------MTTSV---------------TEL.KRN------------FAAILKQADDCP...VA--ILN-H--NRP.----
A7BYH2_9GAMM/1-74M------DAVTV---------------NHA.TQH------------LNHLIGQVISNVE.PTI--ICN-D--QGE.----
A5V171_ROSS1/3-74T------KTISS---------------TIA.QNN------------FGRILDDVIQNDS.RYV--IKR-R--GSS.----
B3EPA2_CHLPB/1-72M------ENWQI---------------QKA.KNQ------------FSDLVRKAQEKGP..QT--ITR-H--GKA.----
Q4C3A5_CROWT/6-76K------DIRSL---------------TEF.KRN------------TSELVENLKRTKH.PLV--LTV-N--GKA.----
Q8RAX6_THETN/1-73M------MQVSS---------------TEF.KNN------------VGKFLKLSEKED...IL--ILK-N--GKP.----
Q4C9G6_CROWT/1-73M------ETIST---------------TEV.TQT------------FPSVMSKVQKEP...VI--IRE-N--DCE.----
Q58CI7_PSEAI/1-69M------RVETI---------------SYL.KRH------------AADL.....DLDE.PMV--VTQ-N--GVP.----
Q8VUA3_LACCU/2-76T------LALTQ---------------SDF.RAN------------LKKYLDQVNDEDE.TVY--IAR-S--NSR.----
Q1MP08_LAWIP/5-77Q------DIKPI---------------SYI.KAN------------SAKVLEQVNISG..PMI--ITQ-N--GEA.----
A3YC32_9GAMM/10-82D------YSVNI---------------SEF.KQN------------PMLAISVAGGLP...LA--IIN-K--NEP.----
A1SK49_NOCSJ/1-74M------TTLSL---------------AAA.RAS------------LSKLVEAAVTTHE.RFE--VTR-N--GDR.----
A0M6Q7_GRAFK/1-73M------KIVNF---------------SNF.RSN------------LKYWFDKVVDDVN.ELI--IKR-K--GGK.----
Q3AS52_CHLCH/4-71E------QVTSL---------------TDF.RNN------------PDYYFEELSKNQQ.PLL--LTR-R--NKS.----
Q2RKQ8_MOOTA/2-70E------RIAGI---------------NEV.RPK------------LTSFIETLKNDSP..VV--ITI-N--SEP.----
Q0ANU3_MARMM/14-87P------RILSI---------------SEA.RAA------------LKDLVERVTADKA.PAI--ITR-Q--GGE.----
A7NJ95_ROSCS/1-71M------KIASV---------------AEV.KAK------------FSAYLKASEEEL...VV--ITR-N--GKA.----
Q7N4P2_PHOLL/1-74M------DTINY---------------SAF.RTH------------FASPLDKVNDNHK.PIL--ITH-Q--NGK.----
Q6LIQ3_PHOPR/1-74M------EIYTY---------------SEA.RQN------------LKSVMDKVESNCE.EAL--IHR-R--DGE.----
Q01ZP0_SOLUE/33-106P------RETTY---------------TSL.REN------------LASVLDEVVDNQD.TVI--VRR-R--GAR.----
Q746J1_THET2/26-100C------KASPL---------------QEA.KAR------------FSEVVERALKGEP..QL--VLR-R--GKK.----
A5UPR7_ROSS1/1-75M------EEIGI---------------REL.KAR------------ASEVVRAVKERRA.RYV--ITR-R--GRP.----
Q79A04_ECOLX/1-69M------QSINF---------------RTA.RGN------------LSEVLNNVEAGEE..VE--ITR-R--GRE.----
A8GY91_RICB8/1-70M------SNITT---------------SVA.RKH------------FSEIINRSSYGKE.RIV--LSR-R--GKD.----
A7C393_9GAMM/36-109M------PQLTM---------------AEA.SQH------------FSDLIKSTTTQKQ.RTL--ITQ-S--GHG.----
Q92JE6_RICCN/1-64M------NSISG---------------TSF.RKN------------LSSVLNTVENDHV.PYL--IKR-K--NHK.----
Q0YRF7_9CHLB/5-72T------SIKPI---------------SFL.KTH------------ASEVIREVSANRG.TMI--ITH-N--GEA.----
A1AYB3_PARDP/1-71M------KELQL---------------RDA.KAT------------LSAVVDQAVAGEP..TV--ITR-H--GRK.----
A7BEP1_9ACTO/5-79A------TTLST---------------REL.RAN------------LSDVLGRASYGGE.RIG--VTK-N--GRL.----
A5MYY9_CLOK5/1-73M------KTFNV---------------TSV.RSD------------IYNIINQTIVNSE.PIQ--ITS-K--NGD.----
Q3APS3_CHLCH/1-74M------NAVSL---------------NEL.RNN------------PQQVMDMVCDRHE.PVI--VIR-K--NGE.----
Q1QFA2_NITHX/11-83S------NIWTL---------------ADA.EVR------------FSEIIDRAQTRP...QV--ITR-R--GHP.----
Q027P6_SOLUE/1-75M------REIQA---------------SEA.KAH------------LPRLLDDVERGET..LI--ITR-H--GRA.----
A3N1K9_ACTP2/1-71M------KIITS---------------REF.NQN------------LGKAQKAALTAP...VI--ITN-R--GEP.----
A5GAD7_GEOUR/18-91E------DIRSV---------------TDL.KRN------------TREILDQIHKTGR.PVI--LTV-N--GRA.----
Q3Y3W5_ENTFC/1-75M------EAVAY---------------SNF.RQN------------LRSYMKQVNEDAE.TLI--VTS-K--DVED----
A1VIA9_POLNA/12-89M------HTVSL---------------SEF.RAN------------ASAMLDRVEQGET..VR--ILR-H--GKP.----
Q6N8R9_RHOPA/1-72M------KQVGI---------------FEA.KTH------------LSSLLDEVENGAE..VT--ITR-H--GKP.----
A1TVL6_ACIAC/6-78S------DVVPF---------------TQA.RSR------------LSELADQAKAGAE..KI--ITK-N--GES.----
A5GD14_GEOUR/1-74M------HAITY---------------SEA.RHA------------LKDVMDEACSNHE.PIL--ITR-R--KGE.----
Q8GNE6_9PROT/6-79Q------DIKPI---------------SYL.KSN------------TAQVVSSATETQR.AIY--ITQ-N--GEA.----
A5G3C0_GEOUR/1-74M------TKIST---------------AEA.RND------------FADVINRASFGKE.RFV--LTR-R--GKK.----
A6F080_9ALTE/7-80E------DVIPL---------------SDL.KIN------------PGKVVGRAQDTHR.PIL--LTS-R--GRG.----
A3IUU6_9CHRO/1-73M------KIVSA---------------SKA.RAN------------LFSLVEEVNKDHL.PRM--ITS-K--KGD.----
Q3ARA3_CHLCH/1-69M------IAISP---------------TEL.KRN------------LYKYLEQAQSEQ...VI--IQC-K--NAE.----
Q21DC9_RHOPB/1-74M------SHISY---------------SEL.RKN------------LASYMDEVCDSRA.PLH--VTR-Q--NAR.----
A5GBX7_GEOUR/12-83E------REWQL---------------QEA.KNR------------LSQVVDSALHDGP..QT--ITL-R--GKP.----
A3EPH7_9BACT/1-74M------KSVGA---------------YEM.KTH------------LSRLLEEVEKGDR..IV--ITR-H--GRP.----
A3VLT0_9RHOB/1-74M------KYASS---------------TDL.RKN------------LSAMMDKVIDDHE.PLM--VTR-T--GGK.----

PF06769

Q8DX49_STRA5/4-83KY---------HYSGAWSRRI-------T---------------EEHRLIYM---------IE...--------.D-GEI
YOEB_STRCO/5-84KG---------DLSGYWSRRI-------D---------------DTHRLVYK---------PT...--------.D-DQL
Q87NP8_VIBPA/11-90KE---------NLSGFWSRRI-------D---------------DTNRLVYA---------VD...--------.D-QAI
YOEB_SHIFL/5-84KH---------NLSGFWSRRI-------T---------------EEHRLVYA---------VT...--------.D-DSL
Q93KY2_STRVR/5-84KY---------HLPGAWSRRI-------D---------------DEHRLVYL---------VT...--------.D-KEI
Q8Z0C7_NOSS1/2-81KY---------LDPDTWSRRL-------T---------------QEHRIVYL---------VK...--------.D-DEI
YOEB_MYCBO/6-85QG---------ELSGYWSRRI-------D---------------DEHRLVYR---------AG...--------.D-DEV
Q8NV15_STAAW/8-88KS---------NLTGYYSRRI-------N---------------HEHRLVYT---------VD...--------.D-NHI
Q88AQ0_PSESM/3-82TG---------DLTGYWSRRI-------T---------------KEHRLVYF---------YE...--------.G-GVL
A9CID9_AGRT5/5-88KG---------DMAGYWSRRI-------T---------------AEHRFVYR---------VSGSG--------SE-QRL
Q8DNR3_STRR6/5-84KY---------DYQGAWSRRI-------D---------------AENRLIYM---------MD...--------.G-DSV
Q88IR0_PSEPK/3-82KG---------DLSGLWSRRI-------T---------------REHRLVYF---------FE...--------.A-GML
Q8KPS4_SYNE7/6-85RE---------NLTGFWSRRI-------D---------------DTNRLVYA---------VA...--------.D-DYL

PF05016

A3RE14_VIBVU/4-93IR..........D.GYRKFPQ-------G................SHVIFYR..Q......IGSQN--------IE-.II
Q93DV0_9BACT/5-90VY...........EDVRRAVV-------QR..............FPYSVFYQ..V......E.QQQ--------IV-.VL
Q52338_9BACT/4-93LF...........PALRMARC-------E................HHYVFCL..P......RAGEP--------AL-.VV
Q8E846_SHEON/5-93VR..........M.NVFSFPY-------S................SHVIYYI..Q......HEH.Q--------FV-.VF
Q8U5C1_AGRT5/4-111LG..........E.DVRSYHL-------RYSRERAKSETGLVKNPRHLLLYR..A......LRPGL--------VG-.VG
Q8K898_STRP3/6-98..IED...LIGKGYTFRQLIV-------K................KYRIVYH.........VLEDE--------VI-.IV
Q82UW5_NITEU/5-97....................I-------DDANPFLREFIISFGNSGYVVLFE..I......EDSNT--------VT-.VL
RELE1_CAUCR/5-93.....................-------.VGPTTRE.ISIPFGQSAYVIRYR.........LLGSS--------VH-.VT
Q8YNK4_NOSS1/5-84...........GEEDTYRIRV-------G................NYRILYE..I......KDDLL--------IV-KVV
Q8XGL8_SALTI/5-85............LPDCYKIKL-------KS..............SGYRLVYQ..V......RDDVV--------IV-FVV
RELE1_METJA/5-87..FDIK..RLKGSDEVYRVRI-------G................KFRVQYV..V......LWDDR--------II-IIR
Q82UA5_NITEU/5-91RRAV.....IRRF........-------.................PFGIYFQ..V.......KKAT--------II-.VV
Q7MFK6_VIBVY/2-89IH..........G........-------.................RLLIIPE..ISMVISYWVEGD--------II-RVM
A9CIM9_AGRT5/6-92KG..........T.REAVLSD-------I................SYIIAYR..VG....RD....--------IE-.IL
Q8TUL7_METAC/5-82.............SPNYRLRI-------G................DYGVILE..I......QGSLL--------VI-LVL
Q9PBR6_XYLFA/4-95....................V-------DDMPDEYREWLIDFGDSGYVARYH..I......D.GDT--------VT-.IL
Q8RG22_FUSNN/6-88..LT......ANYSGKWRYRV-------G................NYRLLAE..I......YDDEI--------LI-LIF
O27942_ARCFU/4-86..FDVK..KIEGEENTYRIRI-------G................DFRVIYF..L......DKPTK--------TV-HIL
Q8ZLI2_SALTY/6-91KDHPL....QGSYSGYRDAHI-------E...............PDWILIYK..I........TDE--------CL-RFE
Q7MKD5_VIBVY/6-94IY..........P.SGFYFPV-------G................KHTAYFT..K......EGG.F--------IL-.VV
Q93S35_9ACTO/5-86..LT......GPLAGLWRYRV-------G................DYRIICD..L......NADRL--------AI-IAL
Q8GQM5_SERMA/4-92IC..........Q.DMRRFQY-------K................KHGIYII..K......QGD.E--------ML-.IS
Q937D2_PSESD/5-94VR..........P.GLRITNY-------RK.............RA..VIAFD..V.......AGDL--------VS-.II
Q8W6N1_9CAUD/4-84..L........AGQPGYRLRV-------G................DWRVLYE..I......EDGRV--------VI-VVL
O25552_HELPY/4-90KDHPL....KGGLKDFRECHL-------K...............PDLLLVYQ..I......KKQEN--------TL-FLV
Q8E851_SHEON/2-90IA..........K.ELRRHNH-------H................KHAIFYK..K......QPD.G--------IY-.IL
Q8E1X3_STRA5/8-106................YGSKI-------SKYHSTR....GYTLSKDYIVLYH..I......EEEEN--------RV-VID
Q849T7_HAEIF/5-85............ENDLYKIKL-------RS..............AGYRLVYQ..V......RDQEI--------TI-IVV
Q9I5J9_PSEAE/6-101..AS.....LLGVLSYRELNT-------G................PYRVFYE..F......HEEQG--------EV-AVI
Q841X2_CAMFE/6-90CDHPL....QGALKGFRDCHI-------R...............PDLVLIYE..K......RYDML--------IL-KAI
Q8P678_XANCP/4-94....................V-------HGGFREL...VIGRDASGYLALYR..Y......APLDD--------TV-YVL
Q7UT85_RHOBA/58-145FG..........REDVSEIQV-------N................SYRVVHQ..IF....DD...E--------VR-.VL
Q92TH9_RHIME/5-95IG..........T.YEKSITR-------L................PYVIAYA..LM...NHGGRQS--------VM-.IL
Q7WXG2_CUPNH/4-95CED........RGVRHRV..H-------G................NYQIFYR..VV....GDPPAR--------ID-.VL
Q8RGS3_FUSNN/5-87..LT......GDLKGLWRYRI-------G................DYRILAE..I......QDDKI--------VI-LIL
Q8PTV6_METMA/5-89..KKLK..GTKKRNDLYRLRI-------G................DYRMIYS..V........EEN--------TI-FIL
Q8GNE5_9PROT/6-97..VPEL..HSIGIIHYREIIY-------K................RWRIVFK..I........EQT--------SV-YVV
Q8TQ58_METAC/5-86..LR......NVLKGLRRVHI-------G................HFVLIYE..I......DNTNE--------TI-TFL
Q7MYA1_PHOLL/2-89VP............GVMLVEF-------H................RHTVFYT..I......RDT.D--------IL-.IA
Q93R08_STRMU/13-108IGQE......VIQGQSLKMFV-------A...............QQYLIFYI..V.......VHSE--------VR-.IM
O73969_PYRHO/5-94VKPVKGKRSEIGKGKLYRFRI-------G................DYRVFYT..I......LWDEK--------AV-VIV
Q92X99_RHIME/7-94VR..........P.GYLKYPA-------G................AHIVYFR..D......RGD.R--------ID-.II
Q7N5L6_PHOLL/4-85..S........GFDNRYRLRV-------G................DYRVLFE..L.....LDGEPN--------IL-EIQ
Q87CU9_XYLFT/4-93LF..........P.ALRMGRC-------E................HHYVFCL..P......REGAP--------AL-.IV
Q7NMF6_GLOVI/3-90EE..........T.RELVVPR-------T................PYRLIYR..IV....DE...R--------LE-.II
Q88JZ3_PSEPK/4-96....................F-------PDLPELRE.LIIEFGDSGYVALYR..Y......ERADD--------TA-YVL
Q7X2F1_AERS4/5-85............LPDCYKIKL-------RG..............AGYRLVYQ..V......QDDRV--------LV-FVV
Q7X105_XANCI/4-90AG..........T.CELVA.H-------R................SYLLIYD..VA....GD...L--------VR-.VL
Q7NJC2_GLOVI/4-91LR..........T.GLRGLPL-------G................EYIIFYR..VL....DD...G--------IE-.IL
PARE2_MYCTU/5-92.....................-------.................HYRHIYLRPFRYYVAYRTTDE--------AI-DIL
Q7MYS9_PHOLL/5-97LQAL.....GIRDFRQTF..F-------K................PYRVIYQ..IT....GK...Q--------VV-.IF
RELE_SHIFL/5-85............MPDCYKIKL-------RS..............SGYRLVYQ..V......IDEKV--------VV-FVI
Q87CA4_XYLFT/5-87..LT......GPLGGFWRYRV-------G................DFRVVCA..I......QDSVL--------RV-LVV
Q7N4Z1_PHOLL/4-95....................T-------EIYPLFEL..IIPFGGTGYILLYR..E......LPGSN--------TR-YIL
Q9Z4G4_9ZZZZ/4-92EG..........T.RELVI.H-------P................HFVLVYE..VD....SQ.WGK--------VY-.IL
Q8XUG4_RALSO/3-90LG.........DDIRSCA..Y-------G................RYVIFFV..AA....PD...E--------VI-.VI
Q7X3U4_9ENTR/5-85............RKDQYKIKL-------KS..............AGYRLVYL..V......QEHTI--------TI-MVM
Q8ZPF9_SALTY/5-85............RKDQYKIKL-------RG..............AGYRLVYS..V......EDEII--------TV-TVI
Q8G2B7_BRUSU/3-91..GHFT..EELPVPGIRRFVM-------G................AYLIDYE..I........RAD--------AI-LIF
Q930F0_RHIME/3-90AG..........T.RELVIPR-------T................PYIAAYM..VM....ED...R--------IR-.IL
Q92ME5_RHIME/5-93LR..........P.NLFIFPL-------WR.............RV..LIAYE..L.......PDNR--------VD-.IL
Q8PJV2_XANAC/4-95....................I-------EDLPEQYREWLIDFGDSGYVARYR..H......A.GDT--------VT-.IL
RELE4_CAUCR/20-106GR............REIVA.I-------S................PYVLRYR..IV....GD...R--------VV-.IG
Q7WY46_PSEAI/4-109LG..........A.GLRSIHL-------VYCHSMPN..VGKVVRPRHFVFYR..V......ATDQV--------LE-.VV
Q8YKY3_NOSS1/6-100VVSK.....LGEIRQWRVKDF-------Q................DYLVFYR..IQ....NT...T--------IE-.IL
A9CK22_AGRT5/5-88..LQ.....GSELGNFWRYRV-------G................DYRIICD..I......QDQKL--------VV-LVV
Q7X2E3_AERS4/11-92..LT......GNLRTYWRYRV-------G................DYRVVCD..I......RDNDL--------VI-VAV
Q82X24_NITEU/5-83............FSGLRRIRV-------G................MYRVVYE..I......QDNLL--------TI-LVV
Q8CYQ7_STRR6/7-87..LV......GNRVGQWRYRI-------G................NYRVIVQ..I......VDDEL--------VV-ATL
Q7TXN8_MYCBO/5-85..LR......RELAGTFSARR-------G................TYRLLYR..I......DDEHT--------TV-VIL
Q7N9Q9_PHOLL/5-86...........NLAGCFKIKL-------RS..............SGFRLVYQ..V......IEEEI--------VI-LVI
Q8CMA1_VIBVU/4-92LEH........LSYREVV..V-------N................PCRIFYK..QD....GD...K--------VF-.IL
Q8R8H0_THETN/10-91..K.......DKFPPLYRYRV-------G................NIRIIYQ..I......QKGEK--------II-FIV
Q9I708_PSEAE/3-93SEVPGV..RTLTLERW.....-------.................PFSAPFR.........VKGKE--------IQ-.IL
Q981R5_RHILO/3-91YEQ........HGIRRRV..H-------G................GYLIFYR..VE....RE...Q--------IV-.II
O68848_VIBCL/6-94IY..........Q.NGFYFPV-------G................KHMAYYT..K......EAN.F--------IL-.IV
Q7WTS8_9RHOB/4-90EG..........T.RELVV.R-------P................NYLVVYA..ET....PA...V--------VT-.IL
PARE1_CAUCR/4-91LR..........A.GYRRCAS-------G................SHVVFYR..V......GVR..--------VE-.II
Q82VJ2_NITEU/2-87GSS........AFVRELVA.H-------R................NYIVFYR..VL....DE.ACT--------VE-.IL
Q7NJK8_GLOVI/3-91FA..........PRDVRRLII-------V................DYEMRYE..L.......KDDA--------VF-.IL
Q7N4Q8_PHOLL/5-85............MPNCYKIKL-------RA..............SGFRLVYE..V......IDNVL--------II-VVV
RELE3_METJA/3-84..KK.....IKGYHNYYRIRV-------G................NYRIGIE..V........NGD--------TI-IFR
A9CGP9_AGRT5/3-91EG..........T.RELVVPG-------L................PYIVAYR..VT....EE...Q--------VD-.IV
Q9KML4_VIBCH/13-98VDHPL....TGNWVGFRDCHI-------K...............PDLVLIYR..V......FNDQ.--------.L-QLA
Q8XE95_ECO57/2-89IP............EVKKIAF-------R................FHTVYYV..I......RVD.D--------IL-.IA
Q88BL8_PSESM/4-90TG..........T.RECVL.H-------P................NYLVVYQ..VG....AD...T--------ID-.VL
Q87UB8_PSESM/5-85............LPDCYKIKL-------RS..............SGYRLVYQ..V......IDQEV--------VV-FVV
Q7NP90_GLOVI/3-91YEQ........FNIRRCV..Y-------R................DYLIFYR..VR....GS...L--------IE-.IV
Q9ZKW0_HELPJ/4-89KDHAL....SGTYKGCRERHI-------K...............PDVLLVYR..V......KG..N--------VL-TLV
PARE4_CAUCR/6-94LR..........P.PVRVHPC-------K................SHIILYV..L......D.ERG--------AL-.IV
Q8KUB3_ENTFL/4-90KDHAL....TGNYIGTRECHI-------E...............PDWLLIYK..I......DGDKL--------IL-TLA
RELE_MYCTU/9-89..LR......NDLEGLHSARR-------G................DYRVVYA..I......DDGHH--------RV-EII
Q97SQ0_STRPN/4-92RDHSLT..ASKHFQGVRECHT-------Q...............PDWLLVYK..V......DKSEL--------IL-NLL
Q9ZH42_MORMO/5-85............HADRYKIKL-------RA..............SGYRLVYQ..V......IDEKV--------VL-LVI
Q8EGZ3_SHEON/4-96....................I-------DDNDFSFRELLIDFGDTGYLAMYQ..Y......DGGER--------LT-.VL
Q8X2Z4_ECO57/4-91VS..........GLREIVT.H-------P................NYIILYR..V......A.ASS--------IE-.IV
Q8PBQ3_XANCP/5-100....................A-------VPADPFLRELVIGFGASGYVLLFE..V......ESNQV--------VT-.VL
RELX_ECOLX/5-85............IKDCYKIKL-------RA..............SGFRLVYQ..V......IDEQL--------II-AVV
Q7N0D1_PHOLL/3-91YK..........PREVRKVLF-------S................DYEVHYE..I.......SNDT--------IY-.IV
Q82WV5_NITEU/4-90AG..........T.RELIA.H-------Q................NYIIIYD..VT....GE...L--------VR-.VL
Q8PBT4_XANCP/4-97VVLK.....LPQI.RVWPLKR-------F................PYLLFYN..ER....AT...D--------IV-.IW
Q98KV7_RHILO/3-92LS..........P.PMRIHPF-------K................AHLVVYR..I......EADGD--------VF-.IV
Q8YV81_NOSS1/7-86..AL......KGYEGGYRVDQ-------G................EYRILYT..I......DDETQ--------LV-DVF
Q7NIV5_GLOVI/2-60PG..........I.RELVVPR-------T................PYIVEYR..VE....AD...A--------VV-.VV
RELE_HAEIN/9-100QDHAL....VGEWKGYRDCHI-------Q...............GDLVLIYQYVI......QDEFD--------EL-KFS
Q93TU1_9GAMM/5-88..LK.....GSKLGDFWKYRV-------G................DWRIIAS..I......EDEAL--------RI-LVV
Q82XK4_NITEU/4-93IR..........E.GYFKYGV-------G................KHVIFYR..H......TGKDQ--------IE-.II
RELE4_METJA/4-86..LR......HPLNDFKRVHI-------D...............KSFVLVFT..V......DENNK--------TV-IFV
Q82UB7_NITEU/3-92..VP.....EFQLPHIREIIF-------A................PFRVVYL..........REKG--------AI-KVI
Q7X3B4_9BACT/4-92RDHAL....TGDWKDHRDCHV-------K...............PDLVLIYQ..K......PDAD.--------TL-RLV
RELE2_METJA/6-87..KK.....LKGADSYYRIRV-------G................DYRIGFK..........YENG--------KI-VFY
Q7N737_PHOLL/4-92CDHAL....SGDWKDFRDCHI-------K...............PDLILIYQ..K......PDAD.--------TL-CLV
Q8REK0_FUSNN/5-87..LT......GNLKGLWRYRI-------M................DYRLIVD..I......QDEQL--------II-VAV
Q7N4Q3_PHOLL/3-89PG..........T.RELFP.N-------E................SYRLVYE..IN....GE...I--------VW-.IL
Q8PR82_XANAC/4-92LKR........SRYRQIV..E-------P................PCRVFYR..VD....GQ...R--------IV-.VV
Q9F7Y3_PSEFL/5-88..LK.....GSRLGDFWKYRV-------G................DYRLISS..I......EDGAL--------RI-LVI
Q8KKD2_HELPX/4-88KDHML....KGEWYPCRECHI-------K...............PNILLVYI..V......RN..N--------TL-WLL
PARE3_CAUCR/4-92LR..........P.GLRTFSV-------K................PWQVLYR.........LNGED--------VV-.IL
Q7N4M0_PHOLL/4-95....................A-------DDMDPAFREWLIDFGSSGYIALYR..I......E.GET--------AT-.IF
Q8P397_XANCP/6-93AG..........T.REWTVKH-------T................PYVLVYR..V.......RDDA--------LQ-.LL
Q7NNQ3_GLOVI/4-98VALTLRHFELAGLRKWRVKDF-------D................NVLIFYQ..PH....PD...G--------VS-.IV
Q7N553_PHOLL/5-85............RSNRYKIKL-------RS..............SGNRLVYE..V......NDNKI--------IL-LVI
Y4KP_RHISN/6-92KS..........T.RELVLAD-------I................PYIIPYR..IS....RD....--------VE-.IL
RELE2_CAUCR/4-88TL............RELVV.V-------P................PYVIRYY..VA....DG...L--------VH-.IV
Q7UFD3_RHOBA/4-90LL..........P.GIRVFSP-------PRP............ANNYVIFFY..P.......ISGG--------IE-.VA
Q7NDJ5_GLOVI/6-93EG..........T.REFAISG-------T................PFVLVYR..R.......EPQR--------LV-.VL
Q82UB0_NITEU/5-85............AKNIYKIKL-------RQ..............PGYRLVYS..V......EDQTI--------TV-TVI
Q7NFJ7_GLOVI/3-90EG..........T.RELVVTQ-------T................PFVVVYR..PH....EG...Y--------IE-.IL
O70048_9ZZZZ/3-92..VP.....EFNLDNIRELIH-------A................PFRVVYL..........RQST--------ET-VLI
Q7TZ73_MYCBO/5-94IR..........P.GYRKLSA-------G................SHTLFYR..V......TGEGT--------ID-.VV
O82928_ECO57/3-91FE..........PREVRRIFA-------G................EYEIRYE..L.......NGQT--------IY-.VL
Q8R718_THETN/7-85............KEKLYRLRV-------G................DYRIIFE..V......DNENF--------VI-KVK
Q9PBR0_XYLFA/4-92RDHAL....LGNWKDLRDCHI-------K...............LDLVLIYT..R......VDSK.--------TL-TLV
Q9KMA0_VIBCH/6-86............YDAVYKIKL-------RT..............AGYRLAYE..V......IDDEI--------VV-YVL
Q08799_VIBCL/5-85............AENIYKIKL-------RQ..............SGYRLVYQ..V......ENDII--------VV-TVL
O29172_ARCFU/5-84..LR......GQMKGLRRAHV-------G................KFVIIFK..V........EED--------TV-KFV
Q82UC9_NITEU/5-85............FDNAYKIKL-------RS..............AGYRLVYE..I......NNQEV--------VV-FVI
Q8DUM3_STRMU/4-90RNHEL....KGRWRGIRELHI-------E...............SDWLLAYQ..V......LDDEL--------VL-LLI
Q82T19_NITEU/4-92IK..........E.GYRSFSE-------G................DHVIFYR..M......AGS.A--------IE-.VI
Q82YR6_ENTFA/5-87..LT......GNRSGEWRYRI-------G................NYRILAN..I......CDSEI--------II-QIF
Q8X366_ECO57/4-91VP..........GLREIVA.H-------P................NYIILYR..V......T.TSS--------VE-.VV
Q92Q75_RHIME/9-89............MPDHYKIKL-------RQ..............LGYRLVYR..V......DDGSV--------TV-LVV
O25554_HELPY/4-88QDHAL....KGKWKPFRECHI-------K...............PDVLLVYL..V......KD..D--------EL-ILL
Q7N9R3_PHOLL/3-93DL..........YFGVLSFPV-------E................SHIIYYR.........EVPTG--------IE-.VL
Q92ZZ9_RHIME/4-97YELG.....LPDL.RSVSLKR-------Y................PYLIFYR..DQ....PD...H--------VD-.VW
Q88AZ2_PSESM/6-103..LS.....ELGVLHYRELNA-------D................GYRIFYEVRE......TDDIN--------VI-VIV
Q7MZK3_PHOLL/3-88LG.........KGVRSSA..Y-------G................RYVVFFQ..II....DD....--------.T-.EV
Q82WH4_NITEU/8-100LVAV.....GIREYRQAI..F-------K................PYRVIYR..VI....EQ...K--------VY-.IY
Q8D9P7_VIBVU/3-90LPH........TNYREIL..F-------G................HYRIIYS..L.....SH...E--------IR-.VL
Q87YW5_PSESM/3-90AG..........T.REWPLPD-------W................PYLIPYR..IR....NG...R--------LQ-.VL
Q93KR9_YEREN/2-90IC..........S.DMRRFQY-------K................KHGIYYI..T......LSN.D--------IL-.IS
RELE3_CAUCR/4-92.....................-------.KSQNMRE.LYVSFGAHGYVLQYR.........VYPDA--------VV-.IA
Q8TTQ0_METAC/4-84..P........YNSPIFAYRV-------G................KYRVIMS..I......HDFEL--------II-LVL
Q7P822_FUSNV/4-90KDHSL....TGNYEGFRECHI-------T...............PDWLLIYR..I......EENNL--------VL-VLL
Q9REP2_ZYMMB/4-88KDHAL....SGNWLGFRDCHV-------K...............PDLVLIYM..K......NGDD.--------YV-QLV
Q8VUA4_LACCU/4-104LNRRMSGYNEFHLRDTPKNKT-------PSE............TNDVLVVYT..I......DKDEL--------VL-IGI
Q7MBA0_PHOLL/3-91HG..........T.REIVV.R-------P................NYVIVYR..IK....DE.SGT--------VV-.VL
Q7NFL9_GLOVI/4-91LG..........T.EIRSFAA-------G................RYVLFYR.........PLPDG--------IE-.LV

PF05973

Q4KIY8_PSEF5/12-94GE------------GVHEIRI..HRGP..----------------GYRVYFS---------RHGKM...----.IY.LLL
D1N777_9BACT/14-103.G------------EVWEITA..NSRS.G----------------WGRVMYI---------AMDGD...----.VI.WLL
Q5NZR3_AROAE/12-94GE------------GVSEMRI..HYGP..----------------GYRLYFT---------QRGLE...----.VV.ILL
A4BMU1_9GAMM/12-94KL------------GVSELKI..DVGP..----------------GYRVYYT---------QQQDV...----.LV.ILL
Q1NTH7_9DELT/12-94GQ------------GISELRI..HHGP..----------------GYRIYLQ---------KQGNQ...----.VI.ILL
Q1II49_KORVE/20-110..------------GVFELKD..ADEK.T----------------WYRLLYL---------ARIDD...----.VI.YVL
A8LS22_DINSH/13-109HA------------NMKELRC..NAAD.G----------------VWRIAFA---------FDPDR...----.QA.ILL
Q3B592_PELLD/22-109.K------------DLWEVRI..HLHG.R----------------IARVLFT---------VEGGV...----..I.VLL
A2RKX2_LACLM/21-112.K------------DIFEIRS..KTSS.N----------------IQRALYF---------QKVGS...----.SY.IIT
B9LZK5_GEOSF/14-103.D------------GLFELRL..KSAE.G----------------IARVFYC---------TMIGR...----.KI.VML
Q5DQT5_ACIBA/12-106FT------------NMKELRV..QHRG.K----------------PLRAFFA---------FDPLR...----.QA.IVL
A4KI96_MYCTU/72-158.G------------DILELRW..HEAN.N----------------HFRVLFF---------RWGQH...----P...VAL
Q87UD1_PSESM/18-100GD------------GVFEMKL..DFGP..----------------GFRVYYA---------IEGQK...----.VL.FLL
Q1CAI8_YERPA/18-100RE------------GVWELRI..DQGP..----------------GYRVYYS---------LVDGE...----.VV.LLL
Q3B4N0_PELLD/19-108.N------------GLFEIRP..KGKA.G----------------IGRAFFC---------FMQGK...----.RI.VIL
A4N165_HAEIF/15-111YT------------NLKELRV..QSKL.S----------------VFRLFYI---------FDPVR...----.QA.IVL
Q7N4L8_PHOLL/12-94GE------------GFSEMRI..HEGK..----------------GYRVYLK---------NHGKV...----.IV.VLL
A2T3W3_PARAH/16-109.A------------GVLEVVE..NDVG.G----------------TYRAVYT---------VKFEE...----.AV.FVL
Q1NRL4_9DELT/14-103.S------------GLFELRL..KGAE.G----------------IARVFYC---------TLMGR...----.RV.VML
A0AYP2_BURCH/25-107GS------------PVVEMRI..DHGP..----------------GYRVYYV---------RRGTI...----.WV.ILL
Q7MYA5_PHOLL/9-98..------------GVKEIRL..RDNT.G----------------IYRIMYV---------AKFDE...----.AI.YVL
Q1NJV9_9DELT/13-106.A------------GVLEVVT..DDTG.G----------------TYRAVYT---------VKFDE...----.AV.FVL
Q218P2_RHOPB/12-101..------------AVREIRV..RDAS.G----------------AFRVIYI---------ATLAD...----.AV.YVL
A5UE73_HAEIE/18-110.G------------EIWELRP.......I----------------RDRILFA---------RLMDG...----.RF.VLL
Q9L3R6_NOSS1/13-107HS------------HMRELRV..QHKG.E----------------PYRILYA---------FDPRR...----.VA.ILL
Q1I6T8_PSEE4/11-93GH------------GMSELRV..HYGP..----------------GYRVYFH---------QCGDT...----.LI.ILL
Q1ZQ16_PHOAS/17-112KG------------VIFKLRV..DSGS.E----------------SARILFT---------KYNND...----..L.VIL
Q214V0_RHOPB/12-94GA------------GVSELRI..HYGP..----------------GYRVYYA---------EHRSE...----.II.ILL
A6TF46_KLEP7/12-108FQ------------NMKELRV..QHHG.L----------------PIRAFFA---------FDPLR...----.KA.IVL
Q879T9_XYLFT/13-95GE------------GVFEMRE..HFGP..----------------GWRMYYV---------QRGSF...----.LI.VML
A3T340_9RHOB/13-108HT------------NMKELRF..KLDG..----------------VWRFAFA---------FDPER...----.SA.VVL
Q5QWX8_IDILO/29-111GH------------GLSELRM..HFGS..----------------GYRVYFY---------EDQGV...----.LI.LLL
Q73LP9_TREDE/35-120GD------------EIYAFKP.......Q----------------PDRYLCF---------FKKGQ...----.KI.IVT
A1VUI1_POLNA/18-100GG------------EVTELRI..DSGP..----------------GYRVYCW---------KDGAT...----.VV.VAL
Q4CA57_CROWT/15-107..------------GVFEIAL..PFKG.D----------------AYRTIYA---------VQLGE...----.AI.WVI
A1TA54_MYCVP/8-96.E------------KLWELRF..RCGQ.V----------------NQRITYT---------ADPDR...----.QL.VTL
Q88BV0_PSESM/16-105..------------GVQEIRI..RDAH.G----------------AFRVIYI---------AKFST...----.AV.YVL
Y1419_HAEIN/13-95ND------------GIFELRI..DEGQ..----------------GYRVYLK---------NQNGV...----.LV.ILL
Q11SD2_CYTH3/31-121TD------------GLYEIRV..QHGS.D----------------IYRIFCF---------FDKGQ...----.LV.VIT
A1ATP5_PELPD/24-106GG------------GVLEMRI..DYGP..----------------GYRVYFG---------KDGNR...----.LL.LLL
Q0AG07_NITEC/12-100..------------GTYEIRI..H.VM.G----------------EWRVIYV---------AKMQD...----.AV.YIL
A6VT19_MARMS/12-107FA------------NMKELRT..QSKG.N----------------PIRSFYA---------FNPSR...----.TG.ILL
A3EUI7_9BACT/2-83GE------------GDSEIRI..DTGP..----------------GYRLYFV---------RRDNM...----.VI.VLL
Q0KBP4_CUPNH/12-94GG------------GVSEMRV..DHGP..----------------GYRIYFQ---------QRGQV...----.IV.ILL
A4L2W0_LACRE/20-111.K------------NLYEIRS..RVSN.N----------------QQRGLYF---------HVDGV...----.HY.VIT
Q3R5P6_XYLFA/15-104..------------GVREIRI..RDVD.G----------------AFRVIYV---------AKLSE...----.AV.YVL
A0ZK22_NODSP/13-109YS------------NMKELRF..LAHG.G----------------VWRVAFA---------FDPKR...----.KA.ILL
A0PBA6_PASPI/12-107YS------------NMKELRV..QSKG.D----------------PIRAFFA---------FDPKR...----.KG.ILL
Q1NW10_9DELT/13-107HS------------HMRELRT..QHEG.R----------------PYRTLYA---------FDPRR...----.NA.ILL
A1A1Y8_BIFAA/62-159IP------------SMKELRP..GSSGRS----------------EIRILFV---------FDPKR...----.KA.IML
A7MHM7_CROS8/12-107QA------------GMKELRV..QHAG.R----------------SIRAFYA---------FDPHR...----.YA.IVL
A7MNF3_CROS8/12-100.G------------GLYELRV..GGKD..----------------IARTFFA---------YAAGQ...----.RI.FIL
B2TE07_BURPP/34-116ED------------GVSEMRI..DCGP..----------------GYRVYFA---------REGRM...----.VY.LLL
Q6MCH9_PARUW/20-102QK------------GVHELRI..HYGP..----------------GIRIYYG---------KIGNK...----.VI.LLL
Q8FLW2_COREF/12-94GG------------GISELRI..DYGP..----------------GCRVYFL---------RERDR...----.LV.LLL
Q2IJ28_ANADE/15-99NR------------GMSEIRT.......G----------------NFRTFYC---------FKYR....----.VI.WIL
Q63YL2_BURPS/21-103GD------------GVNEMKI..DVGP..----------------GYRAYFV---------RRGKI...----.IV.VVL
Q8Z379_SALTI/21-110..------------GVNEIRI..RNNN.G----------------IYRVMYV---------ANFAE...----.AL.YVL
Q2Y597_NITMU/19-112.A------------GVLEIVT..NEMG.D----------------TFRAVYT---------VKFAT...----.AI.YVL
A3YBX5_9GAMM/13-95GV------------PIQEMRI..FVGK..----------------GYRIYFT---------VRNDR...----.II.LLL
A6V7R5_PSEA7/16-108..------------GVYELVE..DHRG.D----------------TFRAVYT---------VKIGD...----.AV.HVL
A5G8E6_GEOUR/19-99FR------------AIGEYRL..DWGP..----------------GYRVYIG---------RDGER...----.LI.ILL
A0B522_BURCH/11-93GA------------GVSEMRV..HVGP..----------------GYRVYFV---------QRGST...----.LV.ILL
B3ECU3_CHLL2/15-97GD------------GVSEMRI..HCRS..----------------GYRIYFM---------QNGLT...----.VY.ILL
Q08L06_BORPT/12-94GK------------GVSELRI..HYGP..----------------GYRVYFQ---------RRGET...----.II.VLL
A7JT82_PASHA/5-87AE------------GISEMRL..NVSK..----------------GYRLYYA---------QKGSI...----.IY.ILL
A0YXM7_LYNSP/22-104SE------------GVFELRL..NYGP..----------------GYRIYFG---------QVGFT...----.II.LLL
Q2YCU5_NITMU/19-108..------------GVREIRI..WDES.G----------------AFRVIYV---------AKFAN...----.TV.YVL
A3ETT9_9BACT/12-95GE------------GVSEIRI..DTGP..----------------GYRLYFV---------RRENT...----.VI.FLL
B3E763_GEOLS/12-94GE------------GISEMRI..NYGP..----------------GYRVYFV---------QRGSE...----.LI.ILL
Q6LL51_PHOPR/28-117.D------------GLFEIRA..KAQE.G----------------IGRGLFC---------YLKGQ...----.HV.YVL
Q6G4P3_BARHE/12-93FR------------GIGELKI..HHGP..----------------GYRIYFV---------KQGKQ...----.II.LLL
A8GK40_SERP5/17-106..------------GVCEIRL..YALA.G----------------AFRVIYV---------AKFKE...----.VI.YVL
Q66F52_YERPS/24-113.G------------DMYELKT..HSRS.H----------------WLRGFYF---------HYVDG...----.LY.IVT
A3IVA5_9CHRO/17-97IN------------GIGEYKI..NWGP..----------------GYRIYLA---------IEGKQ...----.LI.ILF
Q8YUE8_NOSS1/22-104GD------------GVFELRI..DYGS..----------------GYRIYFG---------QEGLT...----.II.ILL
A4SDX0_PROVI/12-94GE------------GISEMRI..HMGP..----------------GYRLYYT---------RTEKT...----.VY.FLL
Q1NKC1_9DELT/18-100RD------------GVWELKV..DIGP..----------------GYRVYYA---------QAGQT...----.VI.LLL
A2WEG9_9BURK/26-113.A------------DLWEIRV..RLPT.R----------------SARVLFT---------VVGDT...----..M.VLL
Q89YJ9_BACTN/14-102.E------------GLYELRI..EYQS.N----------------IYRIFFC---------FDEGR...----.IV.ILF
B7KPZ3_METC4/17-98GD------------GVQEYRI..AWGP..----------------GYRLYFG---------RDGDL...----.LI.ILL
Q0WEK0_YERPE/7-96.Q------------GLKELRV..SAKE.G----------------IGRGFFF---------CHLHR...----.QV.YII
A9BSX0_DELAS/12-94GE------------GLWEMRE..FFGP..----------------GWRMYYI---------QRDHV...----.LI.VML
A7HGK8_ANADF/12-105KH------------PLRELRP..KRGG.S----------------PLRIIYA---------FDPRR...----.EA.LLL
B0URD9_METS4/24-112.A------------GLWEVRS..DLSDGR----------------ISRVLFC---------IAHGH...----..M.VLL
Q64S39_BACFR/34-125.T------------DIWEFRT..FYKK.V----------------KYRLLAF---------WDKDNGAD----TLV.IAT
Q3KEQ5_PSEPF/13-95GD------------GVSEMRV..DVGA..----------------GYRVYFT---------MRNGV...----.VI.VLL
Q1N6Z8_9SPHN/13-108FA------------NMKELRF..DADN.G----------------VWRVAFA---------FDPER...----.KA.ILL
A8ZRU3_DESOH/22-104SP------------GLFELRF..FFGA..----------------GLRIYYT---------IQESR...----.VV.FLL
Q8D9T6_VIBVU/14-104.T------------SVVEVKV..KGRP..----------------AGRMFYT---------TLVDG...----.HI.EVL
B1Z7X4_METPB/27-120.R------------GVLEIIE..NHDG.D----------------TFRAVYT---------VRFAE...----.AI.YVL
Q7N374_PHOLL/14-103.N------------GLFELRL..KGAE.G----------------IARVFYC---------TMIGH...----.RI.VML
A1U4X0_MARAV/39-131NS------------DLWEVRS..DLSGGR----------------IARVIFT---------MFRGD...----..M.VLL
B4SF39_PELPB/12-94GG------------SVSELRI..DYGP..----------------GYRLYYT---------WRGRE...----.LV.LLL
A6TTH9_ALKMQ/20-111ID------------ALWELRI..KHSS.N----------------IFRIFYF---------HFVEG...----.KF.VLL
Q5DY06_ECOLX/13-109FS------------NMKELRV..QHQG.N----------------PVRAFFA---------FDPAR...----.RG.IVL
Q31SJ4_SHIBS/12-100.G------------GLFELRV..GDKN..----------------IARTLYA---------YATGN...----.EI.YLL
A7JPP0_PASHA/17-111FP------------NMKELRI..QNKG.K----------------PIRAFYA---------FDPLR...----.QA.IVL
Q7TZ51_MYCBO/86-182HK------------NMKELRP..GSQGRS----------------EVRILFA---------FDPAR...----.QA.IML
A7DVA5_VIBVU/13-95GA------------GISELRI..HVGK..----------------GYRVYFK---------RSGKQ...----.II.VLL
Q3AS48_CHLCH/14-104.N------------DIWEFRT..VFAG.L----------------QFRLLAF---------WDKSDNTD----TLV.FAT
Q5P365_AROAE/30-118..------------GAYEIRL..H.VL.G----------------EWRVIYV---------ARFED...----.AV.YVL
Q4UJX1_RICFE/21-102KG------------RLYELRF..FFGK..----------------GYRIYFT---------EKDNK...----.II.LLL
Q2W5K8_MAGSA/14-104.G------------KLWEMRL..MGRD.G----------------IARALYV---------TVTGR...----.RV.VVV
A3DFG3_CLOTH/17-104.G------------KLWEIKF..YRSN..----------------..RIMYV---------VADED...----.NI.YLV
Q847G3_PSEPU/12-94GQ------------GVSELRI..HHGP..----------------GYRVYFQ---------QRGDQ...----.LV.LLL
Q6ZEF9_SYNY3/12-94GG------------GVSELRI..NYGP..----------------GYRIYFT---------QQGEQ...----.LI.ILL
Q2Y569_NITMU/17-110.A------------GVLEVVE..DDAG.G----------------TYRAVYT---------VKFEE...----.AV.FVL
Q3B553_PELLD/29-119TE------------GIWEVRS..SHGG.N----------------AVRLLGF---------MHEGN...----.LV.VLT
Q4BVR3_CROWT/12-94GE------------GVSELRI..HYGP..----------------GYRVYFV---------QRGLV...----.IV.VLL
A7GVS7_CAMC5/13-102.D------------DLFEIRI..KSTE.G----------------IARSIYC---------YEVGK...----.KI.VIL
Q9S1D8_YERPE/12-106YK------------NMKELRV..QFSG.R----------------PIRAFYA---------FDPIR...----.RA.IVL
Q07IW5_RHOP5/12-94GD------------GISELRI..HDGP..----------------GYRVYFV---------QRGMI...----.LI.ILL
A1JN81_YERE8/7-96.K------------GLKELRV..SAKE.G----------------CGRGFFF---------YQADR...----.QV.YII
Q2TR61_ACIBA/20-102QD------------GVWEMRE..FFGA..----------------GWRMYYI---------QHGDV...----.VI.VML
A0YT26_LYNSP/13-107HQ------------RMRELRV..QHKG.N----------------PYRILYV---------FDPRR...----.VA.VLL
O53332_MYCTU/11-104FH------------NMKELRP....AG.T----------------SIRILFA---------FDPAR...----.QA.ILL
Q2RPR9_RHORT/12-94GD------------GVSELRV..DDGP..----------------GYRLYFV---------QRGTT...----.LI.ILL
Q8YY18_NOSS1/22-114..------------GVYEIVK..RYDT.D----------------TYRAVYA---------VKIGE...----.KI.YVL
Q1I3E1_PSEE4/13-103.A------------GAIELII..NGSP..----------------AFRCVYV---------AKYAD...----.MV.VVL
B3E292_GEOLS/31-120.T------------DIWQFRK.......G----------------HIRVVWF---------YDEGK...----.IV.ACC
A7ZGL1_ECO24/12-100.D------------GLFEIRT..MGTD..----------------IARGIWV---------YHKGN...----.TI.IML
Q7N9V6_PHOLL/12-101.N------------GLKELRV..SASE.G----------------IARGFFF---------FAVGQ...----.QF.YVV
A2PNJ7_VIBCL/13-102.D------------GLFEIRA..KAQE.G----------------IGRGLFC---------YLKGK...----.HI.YVL
A3IZL8_9CHRO/20-112.D------------GIWELRI..RQGK.I----------------QYRILYF---------FDGQN...----.IA.ILG
B1K7F4_BURCC/17-106.N------------GLYEMRL..KGAE.G----------------IARVFYC---------AIVER...----.RI.VML
B4SC33_PELPB/39-129.D------------EIWEFRT..LFQG.I----------------HYRLLAF---------WDKTNSEN----TLV.IST
A7ZDX4_CAMC1/11-94DT------------DLYELRF..FNRG..----------------GLRIFFT---------FNGDE...----.II.ILL
Q6ALJ1_DESPS/15-97EE------------NFFEIRL..FTGP..----------------GYRIYYT---------IRGGK...----.IV.LLL
A5CZG1_PELTS/31-118.G------------KLWEIKF..RRKN..----------------..RIFYA---------VVEDG...----.CV.YLL
A6VS62_MARMS/25-113.D------------GLWEVRT..NLEGGR----------------IARVLFF---------FKSNE...----..L.ILL
A0LZX5_GRAFK/14-104TD------------GIYEVIV..ITTF.K----------------SIRILGF---------QDKGN...----.LV.VLT
Q145G4_BURXL/15-104..------------GTREIRI..READ.G----------------VFRVMYV---------TKFVE...----.AL.YVL
O07029_9LACT/16-107.N------------NLYEIRS..KRAS.N----------------IQRAIYF---------KVKGS...----.QY.IIT
A1VDE6_DESVV/12-94GE------------GVSEMRI..HTGP..----------------GYRVYFT---------RRGET...----.VY.LLL
A5FU34_ACICJ/16-105..------------GVREIRI..RDEA.G----------------AFRVIYV---------TKFAD...----.TI.YVL
B3E6M8_GEOLS/17-110.A------------GVLEIVE..DHDG.D----------------TYRAVYT---------VRFAD...----.VV.YVL
A4SDW2_PROVI/21-102GA------------GLSEIKM..DFGP..----------------GHRVYFG---------TRGKN...----.LM.ILL
A1WN68_VEREI/20-105GE------------GVWELRI..DQGP..----------------GYRVYYA---------MAGAM...----.VVLLLL
A6QD20_SULNB/19-108.D------------GLFEVRA..KAKE.G----------------IGRSIYC---------YQKGQ...----.KI.IIL
A7BLF9_9GAMM/18-100SE------------GVYELRL..TYGK..----------------GIRIYYG---------KEEES...----.II.LLL
A7VXT9_9CLOT/20-112YK------------GFYELRI..RLRQ..----------------MVRIIFY---------INTEG...----.DI.VLL
Q24S02_DESHY/18-111.G------------KIWELRP.......Y----------------SDRILFA---------GLIDG...----.KF.ILL
A3IUC1_9CHRO/20-108.E------------KIYELRI..NLQG.I----------------NYRILYF---------FYQNQ...----.AI.VIS
Q7MAX4_PHOLL/12-104RN------------KIFELRT..SNGD.N----------------IARGTWC---------YGEEK...----.NTIYML
Q3KJ93_PSEPF/12-94DE------------GISEARI..DYGP..----------------GYRVYFM---------QQGRQ...----.LV.ILL
A9W8J5_METEP/32-120.G------------GLFEVRS..TLPSRR----------------EARLLFG---------FHEGR...----..L.VAL
A3RSU0_RALSL/12-94RD------------GIRELRI..DHGP..----------------GYRLYFV---------QHGVV...----.LI.VLL
A6VNM6_ACTSZ/12-94GG------------GLYEMRI..AKGP..----------------GYRVYYG---------KSGEI...----.TY.LLI
A8ZUV5_DESOH/22-104GK------------GVNELRV..DYGP..----------------GYRVYYG---------KSEMT...----.IV.ILL
A3N206_ACTP2/18-110.D------------RIWQLRP..VGDC..----------------...LLFA---------SIIRG...----.KF.VLL
B4ST98_STRM5/11-93AD------------GVSELRI..DVGP..----------------GYRVYYT---------QRGRQ...----.WV.ILL
Q13FU4_BURXL/21-103RK------------GVWELRI..DAGP..----------------GYRVYYA---------LSGRR...----.VV.LLL
B8FNX0_DESHD/18-112.E------------DIWELRP.......T----------------NDRFFYV---------YWKND...----.TF.VIL
A8L8P9_FRASN/3-102IK------------NLKELRP..RSGRDV----------------AIRVIFV---------FDPWS...----.QA.VLL
Q0YSE0_9CHLB/13-104TD------------GLKELRI..KVGS.D----------------ICRIFYF---------HHKNT...----.LY.VAT
A6GSB7_9BURK/12-94GK------------GVSELRI..NFGP..----------------GYRVYFT---------TRGQK...----.LF.ILL
A6GR64_9BURK/49-137.G------------GLWEIRS..KLEN.R----------------IARVLFA---------LEKGE...----..M.VLL
Q1NV93_9DELT/17-98GG------------GVHEYKI..DYGP..----------------GYRVYFG---------MDGKE...----.LV.ILV
B7KSA7_METC4/12-94GN------------GVSEMRI..DYGP..----------------GYRIYFT---------AQGKQ...----.IV.ILL
A3EUW1_9BACT/35-115LR------------GIGEYRI..DWGP..----------------GYRIYLA---------KDGEK...----.VI.VLL
Q64MD6_BACFR/17-108.T------------DIWEFRT..FYSK.I----------------KYRLLAF---------WDKSDKVN----TLV.IAT
Q3AR08_CHLCH/21-102GA------------GLSEIKI..NVGP..----------------GYRVYFA---------KKGST...----.IL.ILL
Q02AH7_SOLUE/9-98..------------GVEELRV..TDDS.G----------------AYRVIYV---------ARRAD...----.AV.YVL
A4W5D5_ENT38/12-94GE------------GISELRI..HYGP..----------------GYRIYFK---------SHGNT...----.LI.ILL
Q1VPX8_9FLAO/16-106DK------------GLFEARI..KLGS.N----------------IWRVFCF---------FDKGK...----.LV.ILL
Q01YW8_SOLUE/16-108..------------GVFEIAV..AMRS.D----------------AYRVVYA---------VQIAD...----.EL.WLV
Q7N9A1_PHOLL/12-100.N------------GLYEIRT..MGGD..----------------IARGLWV---------YQTGK...----.QI.YIL
Q2RNU1_RHORT/33-123.G------------KLWEMRM..KGKD.G----------------IARAIYL---------AAIGK...----.RL.VVV
Q12AL6_POLSJ/17-110.A------------GVLEVVE..DHQG.D----------------TFRAVYT---------VKFAG...----.WV.YVL
Q82UW3_NITEU/21-103GE------------GVFEMRE..FFGS..----------------GWRMYYI---------QQGGT...----.II.LML
A1URJ8_BARBK/18-100RE------------GIWELRI..DVGP..----------------GYRVYYA---------KADLA...----.VV.LLL
B3EMQ2_CHLPB/12-94GE------------GVSELRI..DYGP..----------------GYRVYYK---------KQGRE...----.VV.ILL
B0TA13_CAUSK/14-104.D------------KLWEMWF..GGRD.G----------------IARAIYV---------TAIGR...----.RV.IVV
Q9PCS5_XYLFA/14-96GA------------GISEMRI..DHGP..----------------GYRIYFM---------KHGAV...----.LI.LLL
A6TIF1_KLEP7/12-100.N------------GLFEIRT..MGAD..----------------IARGIWV---------YQSGE...----.RI.FLL
A1VID1_POLNA/19-99FD------------GMGEYVI..DWGP..----------------GYRIYLA---------KEGDT...----.LI.VLF
A3J9T6_9ALTE/13-102.A------------GLFEIRA..KAKE.G----------------IGRGIFC---------HMDNE...----.AV.TVL
Q9PD07_XYLFA/12-94GK------------GVSELRI..NYGP..----------------GYRVYFQ---------QRGDT...----.IY.LLL
B3EPE2_CHLPB/14-103.G------------GLFEMRP..KGRD.G----------------IGRAFYC---------YVKGK...----.KV.IIL
A3EQ97_9BACT/12-94GQ------------GISELRI..HIGP..----------------GYRIYFQ---------KQGNT...----.II.VLL
A0ZJ88_NODSP/54-148HR------------NMRELRV..QHKG.E----------------PYRVLYA---------FDPRR...----.VA.ILL
Q5P930_AROAE/15-104..------------CVREIRI..RDVS.G----------------AFRIIYV---------AKITD...----.AV.YVL
Q3JDX2_NITOC/12-94GE------------GLSEMRI..DYGP..----------------GYRVYYM---------QQGKV...----.LV.LIL
A1U427_MARAV/12-94GQ------------GVCELRI..HHGP..----------------GYRVYFK---------QRGNE...----.II.ILL
A3JL44_9ALTE/18-100KH------------GVSELKI..DLGP..----------------GYRVYYT---------DWDDV...----.LI.VLL
B1ZLX5_METPB/12-94TG------------GVSELRI..DHGP..----------------GYRVSYT---------QRGQE...----.IV.ILL
A7FEQ3_YERP3/12-100.D------------GLFELRT..MGTD..----------------IARGLYV---------YQKGK...----.NI.YLL
A7HQS5_PARL1/14-111HA------------NMKELRF..EADH.G----------------VWRVAFA---------FDPGR...----.KG.ILL
Q6N368_RHOPA/26-107GE------------GVLETKI..DFGP..----------------GYRIYFG---------RDGDT...----.LV.ILL
A5VYQ7_PSEP1/12-94GG------------GIGELRI..DVAA..----------------GYRVDFT---------QKGQR...----.LV.LLL
B1YYE7_BURA4/17-106.D------------GLYEMRL..KGLE.G----------------IARVFYC---------AAVDR...----.RI.VML
Q3SUP3_NITWN/18-110..------------GVYEVAL..RHRT.D----------------AYRAVYT---------LQFKD...----.AL.WVV
A7M637_BACOV/16-104.D------------GVFELRT..EYNG.N----------------IYRVFFI---------FDDGN...----.IV.VLF
B1JYX5_BURCC/20-109..------------GVREIRL..RDAS.G----------------AFRVVYV---------ATFAE...----.AV.YVL
A1ACR9_ECOK1/13-102..------------GVREIRT..RDAD.G----------------IYRVMYI---------AKFEE...----.AV.YVL
Q73S09_MYCPA/13-110HP------------NMKELRPRPTKAG.A----------------HIRVLFA---------FDTRS...----.RA.IML
A9BXV4_DELAS/19-99FR------------GIGEYKI..DWGP..----------------GYRIYLA---------KDGER...----.LI.ILF
Q1NR35_9DELT/12-94GQ------------GVTEMRI..HYGP..----------------GYRLYFT---------KKSNV...----.VV.ILL
Q2RX83_RHORT/12-94GD------------GISELRI..HYGP..----------------GYRLSFQ---------KRGQT...----.IV.VLL
A6GLV3_9BURK/12-94GD------------RVYELRI..HLGA..----------------GWRVYFT---------ERNGD...----.LI.VLL
Q1M5S2_RHIL3/20-110.G------------GVIELIE..NGSP..----------------AYRAVYC---------AKYED...----.TV.FVL
Q9PHG3_XYLFA/18-100RE------------GVWELRI..DLGS..----------------GHRIYYA---------QVERI...----.VI.LLL
C1DE87_AZOVD/12-94GE------------GVSEMRI..HYGP..----------------GYRVYFT---------QRGHE...----.LV.ILL
Q87CU6_XYLFT/12-101..------------GVEELRI..WDDS.G----------------TYRVVYT---------ARLAD...----.AV.YVL
A8GWQ1_RICB8/24-112.K------------GMYEVRS..NLTDGK----------------IGRVFFC---------IVDSE...----..M.ILL
A9AIJ2_BURM1/16-109.A------------GVLEVVE..SEDS.G----------------TYRAVYT---------VKLGG...----.AV.YVL
Q3QYK0_XYLFA/12-100..------------GVREVRI..H.AG.G----------------AFRAFYV---------TNIGN...----.AV.YVL
A6W1R7_MARMS/13-95AS------------NLLEMRV..FVGK..----------------GYRVYYS---------IRNNE...----.VI.LLI
A3ITS2_9CHRO/22-103GE------------GVYELRL..FFGS..----------------GYRIYYG---------IIGKK...----.II.LLL
Q89TC5_BRAJA/52-145.R------------SVLEVID..DEDG.D----------------TFRAVYT---------VRFAG...----.VI.YVL
Q2J903_FRASC/7-103IH------------NLKELRP..ASAGTS----------------EIRVLFV---------FDPWR...----.CA.ILL
Q6LK89_PHOPR/13-103.T------------GAIELIE..NGRP..----------------AYRTIYV---------AKFGD...----.TV.YIL
A3N344_ACTP2/16-98GA------------GLWEMRI..DTGA..----------------GYRIYYA---------QKGEC...----.IY.LLL
A7JRF2_PASHA/19-108..------------GVMEIRV..KDPS.G----------------AFRLVYL---------AKFKD...----.AI.YCL
Q7N7C8_PHOLL/17-110.A------------GVLEVLE..DDIG.G----------------TYRAVYT---------VKFDE...----.AV.FVL
A5I9N6_LEGPC/14-103.D------------GLFEIRA..KAQE.G----------------IGRSLYC---------YMKGK...----.HI.VVL
Q3R3H1_XYLFA/12-105.A------------GVLEVVE..DSDG.G----------------TYRGVYT---------VRFGN...----.AV.YVL
A2W0N6_9BURK/21-103GE------------GVIEPRV..HVGA..----------------GYRVYFG---------RHGSA...----.LV.LLL
Q48B35_PSE14/12-94GQ------------GVSELRI..HVGP..----------------GYRVYFQ---------QRGDE...----.LI.LLL
A1WNI4_VEREI/25-112.K------------DLWEVRI..HLQT.R----------------IARVLFT---------VNGNT...----..M.VLL
Q1QGV2_NITHX/19-110..------------GVLEIRD..NFDG.D----------------TYRAVYT---------TRFEG...----.VL.YVL
Q4K3L2_PSEF5/15-104..------------GVFEIRI..HEDS.G----------------AFRLFYV---------VRRAA...----.AI.YVL
B4SEJ0_PELPB/18-108TD------------GIWEIRA..KQAS.N----------------AFRLLGF---------LDQGS...----.LV.VLT
A3JL75_9ALTE/13-101.D------------ELFEIRA..KAKE.G----------------IGRGIFC---------YMQDR...----.KI..IL
Q97QQ7_STRPN/18-110.A------------EIWELRP.......L----------------RDRILFV---------AWMDG...----.SF.VLL

PF05015

HIGB1_VIBCH/1-93.GNRFEHLEG.NLKGWCSIRV----------------------NKQYRLIFQ---------WVDG....----...-VAL
Q9PFE9_XYLFA/13-105.GWKLHSLKGADLKGHWSIWV----------------------NGNYRLTFA---------FEGE.D..----...-AIL
O67947_ACEEU/3-101KDWRFHKLQG..HENRYSIDV----------------------TGNARLHFD---------IVGADNGV----...-VAD
Q46559_DICNO/28-119.GAELHRLKG.KLKTHWSLKV----------------------NGNWRVIFE---------FKDG.N..----...-AYI
Q98K96_RHILO/1-95.SNHFEKLRG.NLEGFHSIRV----------------------NQQWRLIFR---------WDGGRG..----...-EAS
Y1250_HAEIN/5-97.ANHLELLEP.KENKIYSIRV----------------------NKQYCLIFK---------YENN....----...-EVN
Q9PCR9_XYLFA/1-96.SLHYEKLKD.DPDNLYSMHL----------------------NDQWHLIMY---------LKAKEDDT----RNL-VVI
Q52305_9ZZZZ/1-92.IYKLHPLKG.DREGYWSITV----------------------RANWRITFQ---------FING.D..----...-AYI

PF06296

Q1GRC7_SPHAL/1-94GK---------GRSGGYRTLILFRR..GD----------------RAIFAFG---------FAKSAQ.A....NISKADL
A9BUS1_DELAS/16-135GQ---------GKSGGFRTVVLYRT..AE----------------RAFFVYG---------FAKSDR.D....NIDKDDE
B1ZE24_METPB/1-120GQ---------GRSGGFRTIVAYER..GK----------------LAVFLHI---------FAKNAK.A....NLTEAET
Q0BB87_BURCM/6-118..---------....RQRGIVLGKV..GH----------------TWVFVFL---------FAKRDR.D....NIDAREL
Q7MZ40_PHOLL/1-113..---------....RDRAIILAKG..GE----------------HWFYTFL---------YAKQDM.A....NIDNREL
A1IQ13_NEIMA/1-120GQ---------GRSGGYRSLILFKQ..AD----------------RAFFVYA---------FAKNDR.E....NISDKEL
A6WJD0_SHEB8/2-121NQ---------GKRSGFRTLIAFRS..ED----------------KAFYMFG---------FAKNER.D....NITKTEK
Q2RVX2_RHORT/2-121GG---------GKSGGYRTLLSARI..GS----------------RYAFLHG---------FPKSDK.A....NVTQGEK
Q8X3N0_ECO57/1-124.Q---------GKSGGARTIIFFKS..AN----------------HVFFYDG---------WSKSGLSSKGSKEIEDDEL
Q130T9_RHOPS/1-120GQ---------GRSGGYRVLIAWRK..SV----------------RAVFLFG---------FAKNAR.G....NIDQDEL
Q3B4L4_PELLD/1-122GE---------GKRSGYRVLVGFQKQGSN----------------RVVFLYA---------FSKNQQ.A....NITTKER
Q45933_COXBE/1-120GK---------GKRGGLRTIIAYRA..ED----------------KAFFVYG---------YAKNVQ.A....NITPKEK
Q32X74_PSEFL/3-115..---------....RHRSIVLAKG..GH----------------YWIYQLL---------FAKKDR.S....NISLAEL
Q7N530_PHOLL/1-120GQ---------GKSGGFRTVILYQT..AE----------------HAFFVYG---------FAKSDR.S....NIEYDEE
A0LNU9_SYNFM/1-120GR---------GRSAGYRVLAAYRC..GD----------------RAVFLYG---------FAKNER.D....NIEDDEL
Q8ZL23_SALTY/1-113..---------....RDRAIVLAKG..GE----------------HWFYTFL---------YAKQDM.A....NISYREL
Q3B1W0_PELLD/44-163GE---------GKSGGYRSVILFRS..GD----------------KAFFVFG---------FAKSAR.A....NISRVEE
A7BV94_9GAMM/1-120GR---------GKRGGARTLIAFQI..KE----------------NSFFMYG---------FAKNQR.D....NIESNEL
A1VVB2_POLNA/4-123GH---------GKSGSTRTLVAKRH..EN----------------AIFFIVG---------RSKSDPGA....DFSPTEE
A3WDJ1_9SPHN/14-133GG---------GKSGGYRTILIFRS..GG----------------RAIFVFA---------FAKSAK.A....NLSAAEL
Q12GA8_POLSJ/2-121GR---------GTSGSTRTLVAKKH..RS----------------AIFFLAG---------REKSQPGS....DFSDKEV
Q3AQ54_CHLCH/1-122GK---------GKSGGYRVIVGFKKQNND----------------RIIYLYG---------FSKSQA.A....TISKKEE
A6DKJ2_9BACT/1-122NK---------GKSSGSRLIVAFKH..GD----------------RFFVLHV---------FNKNES.E....NISSKEK
Q329F3_SHIDS/1-113..---------....RERAIILAKG..GS----------------NWFYTFL---------YAKQDM.S....NINSQEL
A6TFW5_KLEP7/12-124..---------....RDRAIILTKS..AG----------------YWFYTFL---------YAKQDM.A....NINHREL
A7BYY7_9GAMM/1-120NI---------GKRGGVRTIICFER..DK----------------KTIFIQG---------FAKNEQ.A....NITKKEL
A3RPT5_RALSL/6-118..---------....RKRSIVLNKV..GR----------------YWFFVFL---------FVKSDR.D....NIDGREL
Q92MY0_RHIME/3-122GQ---------GKSGGYRTIILFRL..EQ----------------RAFFVFG---------FAKSEQ.A....NIEDGEE
A1WRZ7_VEREI/2-121GR---------GKRGGARTLVATNK..GN----------------RWFFVFG---------FEKNDR.A....NISDEEL
B4SB86_PELPB/1-120HE---------GKSGGYRSIIFYSQ..GD----------------KAFFVYG---------FPKNAQ.A....NITKADV
C5AZC2_METEA/15-127..---------....MHRSMILAKG..GR----------------YWIYEYL---------FAKKDR.D....NIDDDEL
A5V2L0_SPHWW/1-120GG---------GKSGGYRTIILFKV..GG----------------HSFFAHG---------FAKNEK.A....NISAKEL
A7HZB0_PARL1/1-120GG---------GKSGGYRTIVMFRA..GE----------------RMVFLYG---------FPKNAQ.S....NLSPREL
B4SBL9_PELPB/1-120NE---------GKSGGFRSIVLYRA..KE----------------KAFFVYG---------FPKKDK.D....NIKTDEI
A9L1Q5_SHEB9/2-121GQ---------GKSGGFRTLLAFKS..QD----------------KSFFMFG---------FAKNER.E....NISVKEK
Q1I9J7_PSEE4/1-120GI---------GKRGGYRTLLSARV..GS----------------RYVFLHG---------FAKNDV.A....NVTSSEQ

PF12910

A1ACN0_ECOK1/10-55--------------ACVLMSL-----E------------------EYN--------------------------------
A1WU36_HALHL/1-46--------------AAVIMAE-----E------------------DYT--------------------------------
A1WV52_HALHL/1-46--------------VARLSRV-----E------------------APQ--------------------------------
A1WV58_HALHL/1-46--------------SVVMISL-----E------------------DYE--------------------------------
A2P9T6_VIBCL/1-44--------------TVVVMSI-----K------------------DFE--------------------------------
A3DB70_SHEB5/1-46--------------NVVLFSE-----S------------------EFN--------------------------------
A3UQS0_VIBSP/1-46--------------DAVVMSL-----D------------------HFN--------------------------------
A3V913_9RHOB/1-45--------------MVKVTML-----E------------------GQL--------------------------------
A3VLT0_9RHOB/1-46--------------PVVMISL-----E------------------DYE--------------------------------
A3W8L0_9RHOB/9-54--------------SVVVVSL-----E------------------TWN--------------------------------
A3ZAD9_9SYNE/1-45--------------MVQVTPL-----D------------------AKA--------------------------------
A4BLZ6_9GAMM/1-45--------------VAVLSPY-----V------------------ALG--------------------------------
A4BRI9_9GAMM/1-45--------------NAVLISE-----E------------------DWA--------------------------------
A4BVI7_9GAMM/1-46--------------YARLVPL-----E------------------KPK--------------------------------
A4J2N2_DESRM/1-47--------------FFLAMSI-----K------------------HIK--------------------------------
A5CZB0_PELTS/1-48--------------PVSLIST-----G------------------LLD--------------------------------
A5CZB2_PELTS/1-51--------------TVSIIRT-----K------------------LLD--------------------------------
A5D516_PELTS/1-47--------------EVLVLRA-----D------------------LQK--------------------------------
A5GD14_GEOUR/1-46--------------NVVLLSL-----E------------------DYE--------------------------------
A5GDY5_GEOUR/1-45--------------SAVLISE-----E------------------DWR--------------------------------
A5TRR0_FUSNP/1-46--------------NVVLMSE-----E------------------EYN--------------------------------
A6DZ93_9RHOB/1-46--------------AVVMISL-----D------------------EYN--------------------------------
A6FHK8_9GAMM/1-46--------------DVVLLSA-----S------------------EFN--------------------------------
A6TF68_KLEP7/1-45--------------SAVIISA-----E------------------EFE--------------------------------
A6UIL0_SINMW/1-46--------------MVKVIPL-----D------------------QPS--------------------------------
A6X3S6_OCHA4/1-44--------------VARLVPV-----A------------------VVA--------------------------------
A8FZZ5_SHESH/1-46--------------DAVVMSL-----D------------------YYN--------------------------------
A8GU11_RICRS/1-45--------------AVVIISI-----K------------------DYK--------------------------------
A8IME7_AZOC5/1-52--------------AVVMVSL-----S------------------DWS--------------------------------
A8ZWS8_DESOH/1-45--------------NAVLISE-----D------------------DWR--------------------------------
B0K692_THEPX/1-47--------------YIFVSNL-----E------------------MAK--------------------------------
B0NMA5_BACSE/1-46--------------SVVVISL-----D------------------EYN--------------------------------
B0T841_CAUSK/1-45--------------MVKVVAL-----D------------------TSA--------------------------------
B0VBV1_ACIBY/1-45--------------SAVVISK-----A------------------SYE--------------------------------
B1G8Y4_9BURK/1-46--------------NVVMVSL-----E------------------DFN--------------------------------
B1TGL1_9BURK/1-45--------------AARLVPM-----E------------------PVK--------------------------------
B1YFG3_EXIS2/1-46--------------NAVLLSE-----E------------------EYN--------------------------------
B2AJI9_CUPTR/1-45--------------VVRIVPF-----A------------------KPK--------------------------------
B2I1D0_ACIBC/1-45--------------AVVLISE-----K------------------AYL--------------------------------
B2J2I7_NOSP7/1-46--------------AVAIISL-----D------------------DLK--------------------------------
B2J5Y7_NOSP7/1-45--------------IAKLVPF-----R------------------TSS--------------------------------
B2PVB1_PROST/1-46--------------DAVVMSL-----E------------------YYN--------------------------------
B2TF86_BURPP/1-45--------------AARLVSI-----T------------------KPA--------------------------------
B3RCW4_CUPTR/1-45--------------LVKVVAL-----H------------------VPE--------------------------------
C7QT44_CYAP0/1-46--------------QAVLMSL-----D------------------EFN--------------------------------
B5EPP6_ACIF5/1-45--------------SAVLLST-----E------------------DWE--------------------------------
B5JSV7_9GAMM/1-46--------------DAVVMSL-----D------------------QFN--------------------------------
B5JWA5_9GAMM/1-50--------------AFVVMSA-----E------------------DWE--------------------------------
B6VMW8_PHOAA/1-45--------------KAVLISE-----A------------------EYR--------------------------------
B8FQ08_DESHD/1-49--------------QIAMLRV-----D------------------LLK--------------------------------
B8GV80_THISH/1-45--------------IARVVSI-----D------------------APE--------------------------------
B8KV21_9GAMM/1-45--------------NAVLLSE-----E------------------DWN--------------------------------
B9L8I3_NAUPA/1-46--------------SVVMISL-----D------------------EFN--------------------------------
C0GDA4_9FIRM/1-46--------------NVVMLSE-----S------------------EYN--------------------------------
D6SQ06_9DELT/1-47--------------DVALISA-----D------------------ELA--------------------------------
D6STR0_9DELT/1-45--------------LVRMVPF-----D------------------QSR--------------------------------
D0KW14_HALNC/1-45--------------SAVLISE-----E------------------DWN--------------------------------
D0KX96_HALNC/1-46--------------PVVMISL-----E------------------DYQ--------------------------------
D2SEQ1_GEOOG/1-47--------------EFRLVPV-----A------------------PSA--------------------------------
C1DNZ6_AZOVD/1-46--------------MARLVAA-----G------------------KPV--------------------------------
C7LS61_DESBD/1-45--------------MVTVTAF-----S------------------PPP--------------------------------
C7LS62_DESBD/1-46--------------SVAMIDA-----A------------------ELQ--------------------------------
D3PM77_MEIRD/1-47--------------RVAMIDA-----D------------------EYE--------------------------------
C3K1T8_PSEFS/19-64--------------PVVMISL-----S------------------EFN--------------------------------
C3PMR0_RICAE/1-45--------------NVVIISE-----E------------------DYR--------------------------------
D2B388_STRRD/1-47--------------RAVVIDA-----E------------------RLR--------------------------------
C4KD62_THASP/1-47--------------AVAMIAA-----D------------------ELQ--------------------------------
C4LCD3_TOLAT/1-45--------------SAILISA-----D------------------DWE--------------------------------
C4UEE8_YERAL/1-44--------------DMVVITA-----E------------------QFA--------------------------------
C4YXE4_9RICK/1-46--------------PVVIMSL-----E------------------DYN--------------------------------
C4ZB44_EUBR3/1-45--------------NIVMMSE-----S------------------EYN--------------------------------
C4ZJ95_THASP/1-44--------------VAVVLSM-----K------------------EYE--------------------------------
YEFM_SYNY3/1-46--------------QAVLISL-----D------------------EFN--------------------------------
Q0AX75_SYNWW/1-49--------------KVSIIST-----D------------------IFE--------------------------------
Q0AZ30_SYNWW/1-44--------------VLLFFSE-----Q------------------IIK--------------------------------
Q0KJA8_9SPHN/1-45--------------IAKMVPI-----D------------------TAA--------------------------------
Q1IT03_KORVE/1-45--------------MVKVVAI-----N------------------EAA--------------------------------
Q1NP70_9DELT/1-46--------------SVAMIAA-----D------------------ELA--------------------------------
Q1NRQ5_9DELT/1-46--------------AAVVISL-----E------------------EYN--------------------------------
Q1NU91_9DELT/25-69--------------IARLQAE-----R------------------PAP--------------------------------
Q1NX73_9DELT/1-46--------------YARLVPL-----A------------------PDP--------------------------------
Q1QB64_PSYCK/1-50--------------DAVVMSL-----D------------------YYN--------------------------------
Q28SG2_JANSC/6-49--------------VAVLREP-----G------------------EAR--------------------------------
Q2W6L4_MAGSA/1-45--------------LVMLVPL-----A------------------PTP--------------------------------
Q31NY1_SYNE7/1-46--------------EVVVMSL-----D------------------SFN--------------------------------
Q3MBC7_ANAVT/1-47--------------SVSVIPT-----A------------------ELN--------------------------------
Q3SES5_THIDA/1-45--------------MVKVIPL-----A------------------PGE--------------------------------
Q46ND9_CUPPJ/1-46--------------NAVIMSQ-----E------------------QYD--------------------------------
Q48B26_PSE14/1-46--------------PVVILSL-----D------------------DYN--------------------------------
Q5NZB8_AROAE/1-45--------------SAVLLSA-----E------------------DWS--------------------------------
Q5P6K8_AROAE/1-45--------------VARLAAY-----R------------------PPR--------------------------------
Q5P6U3_AROAE/1-46--------------DAVVMSL-----D------------------TFN--------------------------------
Q72B94_DESVH/1-47--------------PVVLMSF-----D------------------DYN--------------------------------
Q7N280_PHOLL/1-46--------------SCILMSL-----T------------------DVE--------------------------------
Q87UE9_PSESM/1-45--------------VAKLVPI-----S------------------APK--------------------------------
Q8YV80_NOSS1/1-47--------------VVAVIGL-----D------------------DLK--------------------------------
Q9Z5W8_FRANO/1-47--------------AVVMMSL-----E------------------DFK--------------------------------

PF02604

Q3AS06_CHLCH/5-78--------------KAVLQDP.....K------------------SYEETRN----------------------..-.VL
Q0A5I5_ALHEH/1-74--------------SAYLVDV.....Q------------------DYEFMQR----------------------R.-.LE
B1JW05_BURCC/1-78--------------VARIVPY.....A------------------APKRIGA----------------------A.-.RQ
Q8KPS5_SYNE7/17-90--------------EVVVMSL.....D------------------SFNSLIE----------------------..-.TF
Q1MDP7_RHIL3/1-70--------------VFDLVPH.....Q------------------KRGGLNL----------------------E.-.AG
Q7P2C4_FUSNV/1-71--------------NVVLLSL.....D------------------KYNEFLK----------------------..-...
A7HZ68_PARL1/7-79--------------VAYLVAP.....D------------------TYERMLE----------------------A.-.LA
A5U6L9_MYCTA/1-74--------------AAVLVGA.....D------------------EWESLQE----------------------..-.TL
A1VNA4_POLNA/1-72--------------AVVIVSA.....K------------------DYRRMSG----------------------G.-.AP
Q1RJA1_RICBR/1-68--------------VAVIISN.....N------------------EFKELEA----------------------..-.FK
Q4FS93_PSYA2/7-79--------------VAYLVST.....D------------------VFERMME----------------------A.-.MD
Q88JZ5_PSEPK/7-79--------------MAYLVPA.....E------------------LYEQILE----------------------R.-.LD
Q7CY23_AGRT5/1-74--------------AVVVLAE.....G------------------EYESMQE----------------------..-.TL
Q3MBC7_ANAVT/2-75--------------SVSVIPT.....A------------------ELNSIIE----------------------..-.TA
Q3A951_CARHZ/2-77--------------KGVILSY.....K------------------QYEQFKK----------------------I.-.QE
A8GN91_RICAH/1-70--------------TVVLVDY.....E------------------YFTTLED----------------------D.-.YW
Q8GEI6_ERWPY/8-80--------------AFYCVPP.....A------------------MYAYLME----------------------L.-.AE
Q83AB4_COXBU/1-74--------------TMVILSL.....R------------------DFEALKE----------------------..-.TA
P73973_SYNY3/1-74--------------RAVIISE.....Q------------------DYRSLME----------------------..-.TV
A3LCG6_PSEAI/1-74--------------ACVLMSL.....E------------------EFNALEE----------------------..-.TA
A5G9X2_GEOUR/8-81--------------VAVLLDV.....N------------------EYESMQE----------------------..-.KI
Q1QFA3_NITHX/2-74--------------RTVLMAY.....E------------------DFVRLSK----------------------R.-.DR
Q1NJK0_9DELT/1-74--------------AAVLVSP.....D------------------EFEGWRE----------------------T.-.IA
A2VFU8_MYCTU/1-74--------------VAVLTPV.....R------------------PRRRRWL----------------------S.-.KT
Q1BZZ9_YERPA/1-69--------------AYVIESY.....D------------------AQQERQN----------------------..-.AI
Q9F5E8_AGRRH/5-75--------------RLVLLNI.....D------------------DYERLMR----------------------..-.QS
Q3BKG0_9PROT/1-71--------------TAVVMSQ.....D------------------EYERLKG----------------------R.-.KP
A3ET18_9BACT/1-72--------------VATLQSVGLSKKA------------------SVRDTID----------------------..-.QL
A4KGH0_MYCTU/1-74--------------AAVLISA.....D------------------DLASIEE----------------------..-.TL
C1AHM0_MYCBT/8-83--------------VARLIPV.....Q------------------AAERSRE----------------------A.-.LI
A2VPH2_MYCTU/12-86--------------VALLSPLPQG..G------------------PYEQLLA----------------------S.-.GE
Q92JV5_RHIME/2-75--------------VARIVPA.....A------------------KSDNAVS----------------------G.-.AR
A3KKH7_STRAM/2-71--------------LVALVSA.....A------------------DLERLEG----------------------..-.LR
Q8Y121_RALSO/1-74--------------VAVVISR.....A------------------LFDRLSG----------------------S.-.GE
A5UG66_HAEIG/9-80--------------AFYCLTP.....E------------------MFAYMQE----------------------L.-.IE
B1ZAQ8_METPB/1-74--------------DLAIIPL.....A------------------ELESLRE----------------------..-.TM
A6FHK8_9GAMM/1-74--------------DVVLLSA.....S------------------EFNAWKE----------------------..-.TM
Q92K09_RHIME/1-70--------------VARVVAL.....P------------------QNKFTIG----------------------L.-.TA
Q5H0A8_XANOR/10-84--------------EAVVVDA.....E------------------EYRRLVN----------------------Q.-.AS
A1KP50_MYCBP/1-72--------------.AVLMSA.....D------------------DYDAWQE----------------------..-.TV
A4X3L4_SALTO/1-74--------------AAVIISL.....R------------------EYESLKE----------------------..-.TA
Q8F586_LEPIN/1-76--------------IAEIKKI.....L------------------KTDNRTD----------------------LY-IKE
Q72GP3_THET2/5-76--------------QAVILSV.....K------------------AYARLTA----------------------G.-.KE
A7C5N8_9GAMM/1-74--------------SVILLDA.....N------------------DYNSLME----------------------..-.TL
A6NUB6_9FIRM/2-75--------------DMVVLSM.....G------------------EYERQRA----------------------..-.LI
A7HJE8_FERNB/5-77--------------AAVIINY.....E------------------KYNKILD----------------------F.-.ID
Q87UE9_PSESM/1-73--------------VAKLVPI.....S------------------APKRRGM----------------------L.-.SH
Q0FUX1_9RHOB/1-74--------------GVVMVAQ.....E------------------EWDAIQT----------------------..-.TL
A1U627_MARAV/7-79--------------RAYMVPV.....E------------------TFEQMQE----------------------Q.-.LE
A2SME8_METPP/3-75--------------VARLLPIARSAAD------------------AQAAAER----------------------L.-.LQ
Q5N582_SYNP6/25-97--------------IARLVPAEGPDQS------------------AVQAAIA----------------------R.-.LR
Q3A3M7_PELCD/5-78--------------KAVIMGI.....R------------------EYERLKD----------------------..-.TI
Q1RJ58_RICBR/1-73--------------.VVLISE.....E------------------DYRNMEE----------------------..-.TL
A3JC22_9ALTE/1-74--------------AFVIMSA.....E------------------DWEREQE----------------------..-.TL
A8GU35_RICRS/7-79--------------TAYLMPA.....E------------------LYEQIIE----------------------A.-.LD
Q2J9K2_FRASC/1-74--------------VAILVSP.....D------------------DLAALEE----------------------..-.TV
Q8KCZ1_CHLTE/23-91--------------AVVLLDV.....R------------------HYQSMLS----------------------..-.AF
A8GU11_RICRS/1-72--------------AVVIISI.....K------------------DYKQLTK----------------------Q.-.KP
Q1M8R1_RHIL3/1-75--------------TAVVLSA.....R------------------DYDALRA----------------------G.-.RP
Q9Z5W8_FRANO/1-75--------------AVVMMSL.....E------------------DFKAYEE----------------------..-.TA
Q1N5J5_9GAMM/1-73--------------.AVLISE.....E------------------DWSAIQE----------------------..-.TL
A7BS83_9GAMM/2-72--------------VVVVLSL.....K------------------AYEKLNQ----------------------T.-.TD
Q5DXZ3_ECOLX/7-76--------------AGYLLSA.....S------------------AFEALMD----------------------M.-.LA
Q4C411_CROWT/2-74--------------SAILISQ.....K------------------SYESLQE----------------------..-.TI
VAPB4_MYCTU/2-74--------------VARIVPL.....K------------------RRRQWLP----------------------A.-.AE
A6H2C6_FLAPJ/1-74--------------GIVVISL.....E------------------EYNSLIA----------------------..-.TN
A5LVR7_STRPN/31-105--------------DIVVLSK.....S------------------EWDSIQE----------------------..-.TL
Q2Y598_NITMU/1-65--------------VAVVMSA.....R------------------EYQQMK.----------------------..-.LE
Q8YV80_NOSS1/2-75--------------VVAVIGL.....D------------------DLKRLET----------------------L.-.ED
A5E9E6_BRASB/13-85--------------AAVVVSA.....E------------------EWSRKTA----------------------R.-.KG
A3WTD0_9BRAD/1-75--------------AVRLVPV.....K------------------PAPDRKS----------------------R.-.RA
Q2J2M4_RHOP2/1-69--------------AAVVVSV.....D------------------VARRLYP----------------------A.-.RR
A9BWR5_DELAS/1-73--------------TAVLVPM.....Q------------------EWRRLHP----------------------AA-EPA
Q4C7V9_CROWT/2-73--------------VIIAMSP.....S------------------QLDSLLE----------------------..-.TI
Q1LA07_RALME/7-80--------------PVVLMSL.....Q------------------AYESIQE----------------------..-.TL
B4SDY6_PELPB/5-78--------------KIVVMDI.....R------------------TYEEQIE----------------------..-.TM
A3XEP7_9RHOB/7-79--------------MAYMVPA.....E------------------QYEAMME----------------------R.-.LD
Q3SUJ2_NITWN/10-83--------------VVVVLAV.....E------------------EYERLKA----------------------.I-ESE
B0KAJ7_THEP3/22-97--------------QAVIIPI.....E------------------EYDELIE----------------------A.-.QE
Q48B26_PSE14/1-74--------------PVVILSL.....D------------------DYNSMAE----------------------..-.TM
Q6G6L3_STAAS/1-75--------------NAVIIGL.....E------------------DWKSIQE----------------------..-.TI
A9L6D3_SHEB9/1-68--------------VAVVISA.....D------------------AYQSIET----------------------L.-.KL
Q8YUZ9_NOSS1/1-76--------------LFKIVPV.....E------------------KTDKLKN----------------------L.-.IF
Q1RH38_RICBR/1-73--------------VAVIIPIDKYYKK------------------KYANIFQ----------------------E.-.FA
A5GA73_GEOUR/8-81--------------AGVLLSP.....D------------------DYDDLVY----------------------..-.KK
A3Y9U0_9GAMM/1-68--------------AVVVMSI.....K------------------DYEELEA----------------------..-...
Q57IR8_SALCH/1-72--------------SAVIISA.....E------------------EFERYQT----------------------A.-.RM
Q0AZM5_SYNWW/1-74--------------EMVFLPI.....E------------------MYEKREA----------------------..-.EI
A7VC40_9CLOT/2-70--------------AMVVLSM.....E------------------EYANLTE----------------------..-.NV
Q02AM0_SOLUE/9-77--------------KAVLLSI.....R------------------DYVRLAA----------------------P.-.EP
Q2RG18_MOOTA/60-129--------------KAVLLSY.....E------------------EYKQLQK----------------------..-...
Q217W8_RHOPB/1-75--------------VARLIRE.....G------------------SPERHEL----------------------P.-.PA
Q7A3T0_STAAN/1-74--------------NVVIMSE.....S------------------DYNSMME----------------------..-.TL
Q8R721_THETN/2-77--------------KGVLISY.....S------------------MYNQLKE----------------------F.-.EK
Q4UNJ2_RICFE/1-69--------------TVVLISH.....E------------------EYEKFNQ----------------------..-.LE
A9BIX2_PETMO/6-72--------------KVVLLDY.....D------------------KFVKLME----------------------F.-.VD
Q7NI03_GLOVI/2-73--------------VAVILSV.....A------------------QYRKLTV----------------------P.-.RQ
Q82VL3_NITEU/3-75--------------VHVLLSY.....D------------------EYQRIIG----------------------Q.-.QE
Q4ULJ1_RICFE/2-73--------------AAKIVPI.....D------------------SHNNIEI----------------------A.-.NI
A6VV50_MARMS/5-78--------------KAVIQDI.....K------------------SYEQTQE----------------------..-.TM
A4GRN0_LEIXC/1-74--------------AAVLISP.....E------------------DLDSLQE----------------------..-.ML
A0YN28_LYNSP/3-76--------------KVALIAA.....D------------------ELSSLME----------------------..-.TA
A3ILX9_9CHRO/2-73--------------IMTAISY.....E------------------QFESLIE----------------------..-.TL
Q5NZI4_AROAE/7-79--------------AFYMVTP.....K------------------LFEALLD----------------------E.-.LA
A5TRR0_FUSNP/1-74--------------NVVLMSE.....E------------------EYNNLME----------------------..-.NL
A6DJA3_9BACT/1-74--------------SVVMISL.....E------------------DYSAMEE----------------------..-.TS
Q47D13_DECAR/1-72--------------AAVLVPV.....Q------------------EWKRLQA----------------------.A-ARP
Q1NJ13_9DELT/7-79--------------EAYLLPA.....A------------------YYERLMA----------------------H.-.LE
A7BYH2_9GAMM/1-74--------------KALLMSL.....D------------------EFNAWQE----------------------..-.TL
A5V171_ROSS1/3-74--------------QVILLSL.....S------------------DFERLLA----------------------A.-.DD
B3EPA2_CHLPB/1-72--------------EAVLLSM.....K------------------DYRNLMK----------------------K.-.QE
Q4C3A5_CROWT/6-76--------------ELVVQDA.....E------------------SYQALLN----------------------AA-ELV
Q8RAX6_THETN/1-73--------------VAKLTAV.....S------------------KNEKEIA----------------------Y.-.DR
Q4C9G6_CROWT/1-73--------------VAVIMSI.....E------------------DYKRLTE----------------------A.-.NI
Q58CI7_PSEAI/1-69--------------TLVVESY.....A------------------ERRRRDQ----------------------..-.AI
Q8VUA3_LACCU/2-76--------------AVAIVSQ.....E------------------KMDWLER----------------------A.-.LK
Q1MP08_LAWIP/5-77--------------SAVLMGI.....K------------------DYEQLKN----------------------..-.NI
A3YC32_9GAMM/10-82--------------VFYCIPA.....E------------------YYEMLVD----------------------K.-.LD
A1SK49_NOCSJ/1-74--------------VAVLLSA.....E------------------DYDALLE----------------------..-.TV
A0M6Q7_GRAFK/1-73--------------DLVLISL.....D------------------EYNSLKE----------------------..-.TT
Q3AS52_CHLCH/4-71--------------SAVLLDA.....T------------------LYQTLLE----------------------..-.QI
Q2RKQ8_MOOTA/2-70--------------KAVLLDY.....E------------------KYRLLQK----------------------T.-.AE
Q0ANU3_MARMM/14-87--------------PVVMVAL.....S------------------EWEALQE----------------------..-.TN
A7NJ95_ROSCS/1-71--------------VGVLLPI.....E------------------DDDDLER----------------------L.-.AL
Q7N4P2_PHOLL/1-74--------------PAIALRL.....E------------------DFQAYEE----------------------..-.TA
Q6LIQ3_PHOPR/1-74--------------NMVLMSE.....S------------------QYNGWVE----------------------..-.TM
Q01ZP0_SOLUE/33-106--------------DVALLPA.....T------------------ELAGLLE----------------------..-.TA
Q746J1_THET2/26-100--------------AVVVLDW.....E------------------TYARLTG----------------------E.-.EA
A5UPR7_ROSS1/1-75--------------AALLVPL.....D------------------ALPSQPD----------------------P.-.RE
Q79A04_ECOLX/1-69--------------PAVIVSK.....A------------------TFEAYKK----------------------A.-.AL
A8GY91_RICB8/1-70--------------LAAVIPI.....E------------------DLKLIEM----------------------..-.IE
A7C393_9GAMM/36-109--------------VAVLLPL.....E------------------DLALLQK----------------------..-.LE
Q92JE6_RICCN/1-64--------------NIILLTE.....E------------------EYESTKE----------------------..-.TL
Q0YRF7_9CHLB/5-72--------------KVIVQDV.....H------------------LYEETQE----------------------..-.SL
A1AYB3_PARDP/1-71--------------EAVLLSF.....E------------------EFQRISR----------------------..-.VP
A7BEP1_9ACTO/5-79--------------AAIVIGV.....D------------------DLLALEE----------------------L.-.ED
A5MYY9_CLOK5/1-73--------------.VVMLSL.....K------------------DWEAIQE----------------------..-.TL
Q3APS3_CHLCH/1-74--------------KTVMLSY.....S------------------DFSSMQE----------------------..-.TL
Q1QFA2_NITHX/11-83--------------CAVLVSA.....E------------------EWARRTA----------------------R.-.KG
Q027P6_SOLUE/1-75--------------IARIVPEVDRRQK------------------EVDRALA----------------------SI-LEL
A3N1K9_ACTP2/1-71--------------AFVLMNY.....T------------------EYERQTA----------------------P.-.VF
A5GAD7_GEOUR/18-91--------------DSVILDA.....K------------------VFEKYQK----------------------..-.AA
Q3Y3W5_ENTFC/1-75--------------TVVVLSK.....R------------------DYDSMQE----------------------..-.TL
A1VIA9_POLNA/12-89--------------VAELVPVQPAAPE------------------KLPSWKR----------------------P.-.IH
Q6N8R9_RHOPA/1-72--------------VARLVQASSELSA------------------EAIARRR----------------------..-.QA
A1TVL6_ACIAC/6-78--------------YVALIDADRL..D------------------YYHRLER----------------------E.-.HI
A5GD14_GEOUR/1-74--------------NVVLLSL.....E------------------DYESIME----------------------..-.SE
Q8GNE6_9PROT/6-79--------------KVVIQDI.....K------------------SFENTQN----------------------..-.TL
A5G3C0_GEOUR/1-74--------------LVAIVPV.....E------------------DLELLEE----------------------..-.ME
A6F080_9ALTE/7-80--------------IAVVQGL.....E------------------DYERTAE----------------------..-.EL
A3IUU6_9CHRO/1-73--------------.AVLLSK.....D------------------DWESLQE----------------------..-.TL
Q3ARA3_CHLCH/1-69--------------TYAIVPT.....G------------------KTSETDR----------------------L.-.FL
Q21DC9_RHOPB/1-74--------------TVVMMAE.....D------------------DYDGLME----------------------..-.TV
A5GBX7_GEOUR/12-83--------------AAVLVSF.....E------------------EFKKLTQ----------------------P.-.RS
A3EPH7_9BACT/1-74--------------IAELIPYPVRNTE------------------KIRKAIL----------------------G.-.LK
A3VLT0_9RHOB/1-74--------------PVVMISL.....E------------------DYEAMDE----------------------..-.TT

PF06769

Q8DX49_STRA5/4-83YFLSFRD---------------------HY
YOEB_STRCO/5-84VIVQARY---------------------HY
Q87NP8_VIBPA/11-90TIISCRY---------------------HY
YOEB_SHIFL/5-84LIAACRY---------------------HY
Q93KY2_STRVR/5-84VILAARY---------------------HY
Q8Z0C7_NOSS1/2-81NFLQARY---------------------HY
YOEB_MYCBO/6-85TMLKARY---------------------HY
Q8NV15_STAAW/8-88KIASCKY---------------------HY
Q88AQ0_PSESM/3-82TVIACRH---------------------HY
A9CID9_AGRT5/5-88EVIQCRF---------------------HY
Q8DNR3_STRR6/5-84AFLSFKD---------------------HY
Q88IR0_PSEPK/3-82TVLQCRY---------------------HY
Q8KPS4_SYNE7/6-85TIISCRY---------------------HY

PF05016

A3RE14_VIBVU/4-93RILHKSM---------------------DV
Q93DV0_9BACT/5-90AVFHSKR---------------------DP
Q52338_9BACT/4-93AILHERM---------------------DL
Q8E846_SHEON/5-93GILHKSM---------------------VP
Q8U5C1_AGRT5/4-111RVLHDSM---------------------EI
Q8K898_STRP3/6-98AVVYGSR---------------------HM
Q82UW5_NITEU/5-97AVRHQLE---------------------DD
RELE1_CAUCR/5-93RIWHGLE---------------------QR
Q8YNK4_NOSS1/5-84KISHRRD---------------------VY
Q8XGL8_SALTI/5-85AVGKREH---------------------SA
RELE1_METJA/5-87KISRREG---------------------AY
Q82UA5_NITEU/5-91AVMHGSR---------------------NP
Q7MFK6_VIBVY/2-89RVLHQKQ---------------------KF
A9CIM9_AGRT5/6-92TIIHTSR---------------------RW
Q8TUL7_METAC/5-82KVGHRRD---------------------IY
Q9PBR6_XYLFA/4-95AVRHHKE---------------------VG
Q8RG22_FUSNN/6-88KVAHRSI---------------------VY
O27942_ARCFU/4-86KVERRGK---------------------VY
Q8ZLI2_SALTY/6-91RTGTHAD---------------------LF
Q7MKD5_VIBVY/6-94AILGQSQ---------------------LP
Q93S35_9ACTO/5-86TIEHRSQ---------------------AY
Q8GQM5_SERMA/4-92RILHQSM---------------------DI
Q937D2_PSESD/5-94GVFYGGQ---------------------DY
Q8W6N1_9CAUD/4-84AVKPRGG---------------------AY
O25552_HELPY/4-90RLGSHSE---------------------LF
Q8E851_SHEON/2-90RILHQQM---------------------EP
Q8E1X3_STRA5/8-106YLLPTRS---------------------DY
Q849T7_HAEIF/5-85SIGKRER---------------------LE
Q9I5J9_PSEAE/6-101LVLRQKQ---------------------SV
Q841X2_CAMFE/6-90DIGSHAK---------------------VF
Q8P678_XANCP/4-94AIRSQRE---------------------AG
Q7UT85_RHOBA/58-145TVSHAT.---------------------AP
Q92TH9_RHIME/5-95RVIHTVR---------------------EW
Q7WXG2_CUPNH/4-95HVLHSAR---------------------NY
Q8RGS3_FUSNN/5-87DIGHRSK---------------------IY
Q8PTV6_METMA/5-89EIIPRER---------------------GY
Q8GNE5_9PROT/6-97LIADSSR---------------------NF
Q8TQ58_METAC/5-86KFSPHDK---------------------AY
Q7MYA1_PHOLL/2-89SILHQQM---------------------NH
Q93R08_STRMU/13-108RIISTKT---------------------NY
O73969_PYRHO/5-94DIKSREK---------------------AY
Q92X99_RHIME/7-94RILHGRV---------------------DA
Q7N5L6_PHOLL/4-85EIRRRQT---------------------KT
Q87CU9_XYLFT/4-93AIFHERM---------------------DL
Q7NMF6_GLOVI/3-90SVIHSAR---------------------EM
Q88JZ3_PSEPK/4-96AFRHQKE---------------------AG
Q7X2F1_AERS4/5-85AVGKRER---------------------EQ
Q7X105_XANCI/4-90NVVHTSR---------------------QW
Q7NJC2_GLOVI/4-91RVVSGRR---------------------DL
PARE2_MYCTU/5-92AVRHGME---------------------NP
Q7MYS9_PHOLL/5-97VIADGRR---------------------DM
RELE_SHIFL/5-85SVGKRER---------------------SE
Q87CA4_XYLFT/5-87RVGHRGE---------------------IY
Q7N4Z1_PHOLL/4-95AIRHQRE---------------------IN
Q9Z4G4_9ZZZZ/4-92RVLHTAQ---------------------KW
Q8XUG4_RALSO/3-90RILHGAR---------------------DL
Q7X3U4_9ENTR/5-85GIGKREG---------------------NQ
Q8ZPF9_SALTY/5-85GVGKREN---------------------DA
Q8G2B7_BRUSU/3-91AIRHGRE---------------------RP
Q930F0_RHIME/3-90RVLHGAQ---------------------KW
Q92ME5_RHIME/5-93RVFSGGQ---------------------DY
Q8PJV2_XANAC/4-95AVRHQKE---------------------AG
RELE4_CAUCR/20-106SVRHGAR---------------------RP
Q7WY46_PSEAI/4-109RVLHDAM---------------------DV
Q8YKY3_NOSS1/6-100RVFHGAR---------------------DL
A9CK22_AGRT5/5-88EIGHRRE---------------------IY
Q7X2E3_AERS4/11-92IIGHRSE---------------------VY
Q82X24_NITEU/5-83RINHRRD---------------------IY
Q8CYQ7_STRR6/7-87EVGHRRD---------------------IY
Q7TXN8_MYCBO/5-85RVDHRAD---------------------IY
Q7N9Q9_PHOLL/5-86AVGKRED---------------------AK
Q8CMA1_VIBVU/4-92FVMRAER---------------------DL
Q8R8H0_THETN/10-91TIGYRGD---------------------VY
Q9I708_PSEAE/3-93RIDRVEI---------------------TP
Q981R5_RHILO/3-91HVLHGAI---------------------DY
O68848_VIBCL/6-94AVLGQSQ---------------------LP
Q7WTS8_9RHOB/4-90RVLHAAQ---------------------MW
PARE1_CAUCR/4-91RVLHQSM---------------------NA
Q82VJ2_NITEU/2-87RVKHAAQ---------------------QS
Q7NJK8_GLOVI/3-91RLWHARE---------------------DR
Q7N4Q8_PHOLL/5-85AVGKRER---------------------SE
RELE3_METJA/3-84RVLHRKS---------------------IY
A9CGP9_AGRT5/3-91FVQHAAR---------------------EW
Q9KML4_VIBCH/13-98RIGSHSD---------------------LF
Q8XE95_ECO57/2-89RILHQLM---------------------EP
Q88BL8_PSESM/4-90RILHARQ---------------------QY
Q87UB8_PSESM/5-85AVDKRER---------------------DE
Q7NP90_GLOVI/3-91HILHGAQ---------------------DY
Q9ZKW0_HELPJ/4-89RLGSHSE---------------------LF
PARE4_CAUCR/6-94RVRHAGE---------------------DW
Q8KUB3_ENTFL/4-90RIGSHSE---------------------LF
RELE_MYCTU/9-89HIARRSA---------------------SY
Q97SQ0_STRPN/4-92RTGSHSD---------------------LF
Q9ZH42_MORMO/5-85AVGRRES---------------------SE
Q8EGZ3_SHEON/4-96CIRHQKE---------------------AG
Q8X2Z4_ECO57/4-91SVTHSRR---------------------QF
Q8PBQ3_XANCP/5-100AVRHQRE---------------------DD
RELX_ECOLX/5-85AVGKRER---------------------SD
Q7N0D1_PHOLL/3-91DLWHTRE---------------------NR
Q82WV5_NITEU/4-90RVLHAAR---------------------QW
Q8PBT4_XANCP/4-97RVLHMQR---------------------DI
Q98KV7_RHILO/3-92RVRHGHE---------------------DW
Q8YV81_NOSS1/7-86RVGKRND---------------------DE
Q7NIV5_GLOVI/2-60SVRRGGT---------------------PY
RELE_HAEIN/9-100RLNIHSQ---------------------TA
Q93TU1_9GAMM/5-88RIGNRRE---------------------VY
Q82XK4_NITEU/4-93RILHGRM---------------------DI
RELE4_METJA/4-86DFDHHDN---------------------IY
Q82UB7_NITEU/3-92RVWRSER---------------------PL
Q7X3B4_9BACT/4-92RLGSHSE---------------------LG
RELE2_METJA/6-87RVLHRKQ---------------------IY
Q7N737_PHOLL/4-92RLGSHSE---------------------LG
Q8REK0_FUSNN/5-87DFNHRRK---------------------IY
Q7N4Q3_PHOLL/3-89TLIHTAR---------------------QW
Q8PR82_XANAC/4-92HVMRSER---------------------AL
Q9F7Y3_PSEFL/5-88KIGNRRE---------------------VY
Q8KKD2_HELPX/4-88RLGSHSE---------------------LF
PARE3_CAUCR/4-92RILDGRM---------------------NL
Q7N4M0_PHOLL/4-95AVRHQKE---------------------AG
Q8P397_XANCP/6-93HVRLETQ---------------------DW
Q7NNQ3_GLOVI/4-98RVLHAAR---------------------DW
Q7N553_PHOLL/5-85AIGKRGK---------------------RV
Y4KP_RHISN/6-92TVMHAHQ---------------------QW
RELE2_CAUCR/4-88RIRHAA.---------------------RL
Q7UFD3_RHOBA/4-90AVIHGSR---------------------DW
Q7NDJ5_GLOVI/6-93AVRDGRM---------------------DP
Q82UB0_NITEU/5-85AIGKRDR---------------------NE
Q7NFJ7_GLOVI/3-90SLLHGAQ---------------------AW
O70048_9ZZZZ/3-92RIWCSER---------------------QL
Q7TZ73_MYCBO/5-94RVLHQRM---------------------DV
O82928_ECO57/3-91RLWHTRE---------------------NR
Q8R718_THETN/7-85DFDSRGD---------------------VY
Q9PBR0_XYLFA/4-92RLGSHAE---------------------LG
Q9KMA0_VIBCH/6-86AVGKRDK---------------------DA
Q08799_VIBCL/5-85AVGKRER---------------------SE
O29172_ARCFU/5-84TFKHHNH---------------------AY
Q82UC9_NITEU/5-85AVGKREN---------------------NK
Q8DUM3_STRMU/4-90DTGSHAQ---------------------ML
Q82T19_NITEU/4-92GIPHQNM---------------------DI
Q82YR6_ENTFA/5-87SIGHRST---------------------IY
Q8X366_ECO57/4-91NVIHARR---------------------QF
Q92Q75_RHIME/9-89AVGKRER---------------------VT
O25554_HELPY/4-88RLGSHSE---------------------LF
Q7N9R3_PHOLL/3-93AVLHQTQ---------------------DP
Q92ZZ9_RHIME/4-97RVLHAKR---------------------DN
Q88AZ2_PSESM/6-103LVLGGKQ---------------------SV
Q7MZK3_PHOLL/3-88RIYPMDF---------------------KM
Q82WH4_NITEU/8-100LIADGRR---------------------DM
Q8D9P7_VIBVU/3-90TVRNCRQ---------------------ML
Q87YW5_PSESM/3-90RIFHTRR---------------------QP
Q93KR9_YEREN/2-90RVLHQSI---------------------DI
RELE3_CAUCR/4-92RIRHSLE---------------------RR
Q8TTQ0_METAC/4-84EVGDRKN---------------------IY
Q7P822_FUSNV/4-90RTGTHSD---------------------LF
Q9REP2_ZYMMB/4-88RLGSHSE---------------------LF
Q8VUA4_LACCU/4-104RVGSHDR---------------------LF
Q7MBA0_PHOLL/3-91RVLHAAQ---------------------QW
Q7NFL9_GLOVI/4-91RVLHGAR---------------------DL

PF05973

Q4KIY8_PSEF5/12-94IGGDKAT..........QKRDIQRARQLAC
D1N777_9BACT/14-103YAFLKKT....N...TTPEHIAREVRKRAK
Q5NZR3_AROAE/12-94AGGDKSS..........QAKDIKTALKLAR
A4BMU1_9GAMM/12-94CGGDKSS..........QTKNIKLAYELAK
Q1NTH7_9DELT/12-94CGGDKST..........QAKDIRAAKKMAA
Q1II49_KORVE/20-110DCFEKDT....A...KTERKELNRARQRLS
A8LS22_DINSH/13-109VGGDKSGG.SEK...RFYKSLIARADDRFD
Q3B592_PELLD/22-109HGFIKKT....Q...ATPKSELQLAKNRMG
A2RKX2_LACLM/21-112HGFTKKT....Q...KTPSGEIAKAHRILD
B9LZK5_GEOSF/14-103HQFVKKT....D...KTPPRELETAQRRMK
Q5DQT5_ACIBA/12-106CIGDKSN...KK...RFYTEMLAIADEQYA
A4KI96_MYCTU/72-158TAFYKNQ....Q...KTPKTKIETALDRQK
Q87UD1_PSESM/18-100GGGSKDK..........QQNDIDQAKALWK
Q1CAI8_YERPA/18-100LGGDKRS..........QNADIDQAIVCLK
Q3B4N0_PELLD/19-108HAFIKKT....Q...STPKKELLIARKRMK
A4N165_HAEIF/15-111CGGDKKGK.KEK...LFYKEMIALAEQTYD
Q7N4L8_PHOLL/12-94CGGDKST..........QQKDIARAKAIYK
A2T3W3_PARAH/16-109HCFQKKS....KSGIATPKEDMDVIRARLK
Q1NRL4_9DELT/14-103HSFVKKS....E...KTPLRELRLAENRLK
A0AYP2_BURCH/25-107CGGDKST..........QQADIRAAHAMPA
Q7MYA5_PHOLL/9-98HSFQKKT....Q...QTSKHDKDIAKVRYN
Q1NJV9_9DELT/13-106HCFKKKS....KRGIATPKEDMAIVRARLK
Q218P2_RHOPB/12-101HAFQKKT....E...ATSKRDIDLATARFK
A5UE73_HAEIE/18-110HQFMKKT....Q...KTPKREIQTAQQRLS
Q9L3R6_NOSS1/13-107LGGNKGG...DD...RWYEENVPKADTLYD
Q1I6T8_PSEE4/11-93CGGDKGS..........QQRDIKAARQILQ
Q1ZQ16_PHOAS/17-112HAFLKST....R...KTPKKDAHQAIIVFQ
Q214V0_RHOPB/12-94AGGTKKT..........QNTDIKQAKRLFK
A6TF46_KLEP7/12-108CAGNKDGM.NEK...RFYKEMNTLADREFS
Q879T9_XYLFT/13-95GGGDKST..........QQSDIRRAIELAK
A3T340_9RHOB/13-108VGSNKEGK.NQK...RFYKQLIAIADDRFA
Q5QWX8_IDILO/29-111AGGDKKS..........QSRDIKRAHLLYE
Q73LP9_TREDE/35-120NGFCKRR....N...KLPLAEKTIALENKK
A1VUI1_POLNA/18-100GGGDKSG..........QDKDIAKAQGMVK
Q4CA57_CROWT/15-107HAFQKKS....KIGIKTPRQEVELIKRRLK
A1TA54_MYCVP/8-96TTFRKQR........QNERNEITRARKALR
Q88BV0_PSESM/16-105HCFQKKT....Q...KTSKHDLDLAAKRMK
Y1419_HAEIN/13-95CGGDKST..........QDKDIKQAKLLAQ
Q11SD2_CYTH3/31-121NGFQKKT....Q...KTPKQEIEKALKIKE
A1ATP5_PELPD/24-106IGGDKST..........QSRDIQTAMEYWQ
Q0AG07_NITEC/12-100HAFHKKT....Q...KTSKHDIALAEQRYK
A6VT19_MARMS/12-107CAGEKTGK..DK...RFYEQMISVADKEFE
A3EUI7_9BACT/2-83CGGDKST..........QDRDITRAKDQAK
Q0KBP4_CUPNH/12-94CGGNKST..........QHADIERARSLAA
A4L2W0_LACRE/20-111HGFTKKT....Q...KTPPREINHAKKLRD
Q3R5P6_XYLFA/15-104HCFQKKT....E...KTTKGDLDVAAKRYR
A0ZK22_NODSP/13-109VAGDKSGV.SQK...RFYKQLIKKADARYK
A0PBA6_PASPI/12-107CAGNKTGD..EK...RFYEVMIPIADREFA
Q1NW10_9DELT/13-107IGGDKTG...DD...RWYDVNVPIADRLYD
A1A1Y8_BIFAA/62-159VGGDKQRK..WD...KWYRKAIPEAERRYL
A7MHM7_CROS8/12-107CAAQKKGD..EK...RFYRVILRVADKLFS
A7MNF3_CROS8/12-100RTFIKKT....Q...KTPLREFEIALKRLE
B2TE07_BURPP/34-116CGGVKAT..........QPADIKHAKAMWA
Q6MCH9_PARUW/20-102CGGDKGS..........QDKDIAKAMEYLK
Q8FLW2_COREF/12-94TGGDKST..........QETDIKAAHAIAD
Q2IJ28_ANADE/15-99HVCKKQD..........QHAGIEVARKRMQ
Q63YL2_BURPS/21-103CGGDKST..........QKKDIKLAKQIAG
Q8Z379_SALTI/21-110HSFQKQT....Q...QTSQHDKNIARTRYN
Q2Y597_NITMU/19-112HAFQKKS....KSGIKTPAEDMKLIEQRFK
A3YBX5_9GAMM/13-95YGGHKGT..........QSKDIEKAHQLLA
A6V7R5_PSEA7/16-108HAFQKKS....KSGIATPQPDVELIEKRLK
A5G8E6_GEOUR/19-99GGGTKKG..........QQRDIDRAEAMWE
A0B522_BURCH/11-93CGGDKST..........QQRDIERAIALSA
B3ECU3_CHLL2/15-97VGGTKAT..........QQQDITRAKEIAR
Q08L06_BORPT/12-94CGGDKGS..........QARDIKTALRLAD
A7JT82_PASHA/5-87NGGHKGT..........QQADIDKAKMLWA
A0YXM7_LYNSP/22-104CGGDKKT..........QVKDIQTAQKYWR
Q2YCU5_NITMU/19-108HCFQKKT....A...KTSKEDIKLAEKRYR
A3ETT9_9BACT/12-95CGGDKST..........QDRDISRARELAK
B3E763_GEOLS/12-94AGGDKSN..........QSRDIKAAIRLAQ
Q6LL51_PHOPR/28-117RAFVKKS....N...KTPKKEIELARERMK
Q6G4P3_BARHE/12-93NAGDKST..........QQKDIEKALQLVK
A8GK40_SERP5/17-106HSFQKKT....A...KTSRHDIQIIKTRYD
Q66F52_YERPS/24-113HIFAKKT....N...KAPDSSKALGLRRYK
A3IVA5_9CHRO/17-97GGGTKKS..........QPSDIKKAKKLYQ
Q8YUE8_NOSS1/22-104CGGDKST..........QDKDIAKAKEYWE
A4SDX0_PROVI/12-94AGGNKRT..........QGKDIVRAKELAR
Q1NKC1_9DELT/18-100LGGDKRT..........QTADITKACKFWQ
A2WEG9_9BURK/26-113HGFFKQS....P...ATPSDDLAVTAARLK
Q89YJ9_BACTN/14-102NGFQKKT....E...KTPKKEIDKAKILRK
B7KPZ3_METC4/17-98CGGTKRR..........QQDDIAEARAHWA
Q0WEK0_YERPE/7-96HLLQKKT....Q...KTPRRTLILAYRRMK
A9BSX0_DELAS/12-94GGGDKSS..........QAQDIAAARAMAR
A7HGK8_ANADF/12-105LGGDKGN...DK...RFYERTISRAEQLWE
B0URD9_METS4/24-112HAFIKKT....Q...KTPDAELTKARKRQK
Q64S39_BACFR/34-125HGFIKKT....Q...KTPPKETAKAEEIRK
Q3KEQ5_PSEPF/13-95AGGDKSS..........QSADIRRAKNMAK
Q1N6Z8_9SPHN/13-108VAGDKSGG.SEK...RFYKTLITKRTNA.T
A8ZRU3_DESOH/22-104AGGNKSS..........QEKDIEKVTALLK
Q8D9T6_VIBVU/14-104AFATKSR....N...GQDPKIKATVEQRFK
B1Z7X4_METPB/27-120HCFQKKS....KRGIATPQHEIELIRTRLR
Q7N374_PHOLL/14-103HSFVKKT....Q...KTPLKERRKAEVRMK
A1U4X0_MARAV/39-131NGFIKKT....Q...RTPDQELKKARDRKK
B4SF39_PELPB/12-94AGGDKST..........QTRDIQKARLLLA
A6TTH9_ALKMQ/20-111HAIRKTT....T...KTPKKELSIAVKRRN
Q5DY06_ECOLX/13-109CAGDKTGL.NEK...KFYRDMIKLADSEYR
Q31SJ4_SHIBS/12-100HAFVKKT....Q...KTPTKAIEIARMRLK
A7JPP0_PASHA/17-111CAGEKGK...DK...RFYEKMIALADAEFT
Q7TZ51_MYCBO/86-182AAGNKAGR..WT...QWYDEKIKAADEMFA
A7DVA5_VIBVU/13-95CGGNKKT..........QNQDIEQAKLLAQ
Q3AS48_CHLCH/14-104HGFIKKV....D...KVPKNEIDRAVRIKE
Q5P365_AROAE/30-118HAFQKKT....Q...KTPKQDIELAARRYK
Q4UJX1_RICFE/21-102NAGSKDT..........QDKDIKKALEIIE
Q2W5K8_MAGSA/14-104RAFVKKT....Q...KTPRQEIELALARAK
A3DFG3_CLOTH/17-104HACKKQK....G...KAEKFELDTAIKRVK
Q847G3_PSEPU/12-94CGGDKSS..........QARDIETAKTLAS
Q6ZEF9_SYNY3/12-94AGGDKQT..........QSNDITIARDLAK
Q2Y569_NITMU/17-110HCFQKKS....KSGITTPKEDIDIIRARLK
Q3B553_PELLD/29-119NGFSKKS....Q...KTPAQEIALAEQRKK
Q4BVR3_CROWT/12-94CGGDKSS..........QNSDITKAKKLAR
A7GVS7_CAMC5/13-102LTFIKKS....E...KIPKYIVEQAKQRLK
Q9S1D8_YERPE/12-106CAGDKSN...DK...RFYEKLVRIAEDEFT
Q07IW5_RHOP5/12-94CGGDKST..........QTTDIAAAKRLAQ
A1JN81_YERE8/7-96HILQKKT....Q...KASRRTLMLAYQRMK
Q2TR61_ACIBA/20-102GGGDKST..........QQQDIDRAVKLSK
A0YT26_LYNSP/13-107LGGSKVG...ND...RWYEENVPKADRLYD
O53332_MYCTU/11-104LGGDKAGN..WK...RWYDNNIPIADQRSE
Q2RPR9_RHORT/12-94CGGIKGA..........QRRDIARAKAMAA
Q8YY18_NOSS1/22-114HAFQKKS....KQGIKTPLADVDLIKQRYK
Q1I3E1_PSEE4/13-103HSFVKTT....N...RSDRHAMQVAEDRLK
B3E292_GEOLS/31-120HAFVKKT....Q...KTPLAVIRHATEALR
A7ZGL1_ECO24/12-100RVFIKKS....Q...KTPAKEINLARKRLA
Q7N9V6_PHOLL/12-101HILQKKT....Q...KTPKKSLDLANQRMQ
A2PNJ7_VIBCL/13-102HAFVKKS....Q...KTPKNELNLARDRQK
A3IZL8_9CHRO/20-112HALVKKG....E...AVSNADINKAIQRKE
B1K7F4_BURCC/17-106HCFVKKT....P...RTPLKELEIARRRLK
B4SC33_PELPB/39-129HGFVKKR....S...KVPDNEIQKATQLRV
A7ZDX4_CAMC1/11-94NAGDKDS..........QSDDIKKAKEILK
Q6ALJ1_DESPS/15-97LAGDKSS..........QKKDIKKAKELIK
A5CZG1_PELTS/31-118HACKKQK....G...KAEIHEIETALQRMK
A6VS62_MARMS/25-113NGFMKKA....Q...KTPKSELDLAKKRKR
A0LZX5_GRAFK/14-104NSFIKKT....Q...KTPRKEIKLAEKLKK
Q145G4_BURXL/15-104HCFQKKT....Q...RLGPHDRKIAETRYR
O07029_9LACT/16-107NAFTKKT....Q...KTPENQKEIARNRRS
A1VDE6_DESVV/12-94AGGDKSS..........QKRDIVLAKKLAR
A5FU34_ACICJ/16-105HCFQKKT....Q...ATSKPDLELATKRYR
B3E6M8_GEOLS/17-110HVFQKKS....KTGIATPQAEIEKIKTRLK
A4SDW2_PROVI/21-102GGSGKNG..........QSKAIASAKQLWK
A1WN68_VEREI/20-105CGGDKGT..........QDADIERAIGYWK
A6QD20_SULNB/19-108HSFVKKD....Q...KTPKRDLEIALKRKK
A7BLF9_9GAMM/18-100LGGDKST..........QNRDVKTAIEYWH
A7VXT9_9CLOT/20-112HGFVKRH....E...RATEQALETARARKL
Q24S02_DESHY/18-111HHFVKKT....N...KTPRREIEKALTNLE
A3IUC1_9CHRO/20-108HGLIKDK........KVPPLEIEQAIKNKT
Q7MAX4_PHOLL/12-104SFFIKKS....Q...KTDVRDKQTAINRKK
Q3KJ93_PSEPF/12-94CGGDKSS..........QSRDIKQARLIAE
A9W8J5_METEP/32-120HAFIKKA....Q...RTPAAELELARRRLK
A3RSU0_RALSL/12-94CGGDKST..........QETDIRRAIDLSR
A6VNM6_ACTSZ/12-94SGGDKST..........QKADIVKAKALWE
A8ZUV5_DESOH/22-104CGGSKKS..........QSKDIQLAQAYWA
A3N206_ACTP2/18-110HYFAKQN....Y...RIPKREIERAKVRLA
B4ST98_STRM5/11-93AGGDKGS..........QQRDIEKAREIAR
Q13FU4_BURXL/21-103CGGDKKT..........QDADIARAVDYWQ
B8FNX0_DESHD/18-112HHYIKKT....Q...KAPRQEIELAKRNLK
A8L8P9_FRASN/3-102VAGNKAGD..WS...RWYRTAIPTAEVAYG
Q0YSE0_9CHLB/13-104SGYIKKE....M...KTDHGEIERAQTLRE
A6GSB7_9BURK/12-94AGGDKST..........QALDIKIALNLAQ
A6GR64_9BURK/49-137HGFIKKT....Q...KTPQRELEVAKDRLS
Q1NV93_9DELT/17-98GGGTKKR..........QSADIRNAGSHWA
B7KSA7_METC4/12-94CGGDKSS..........QERDIRAAKALAK
A3EUW1_9BACT/35-115GGGTKKG..........QQEDIERSIQLWE
Q64MD6_BACFR/17-108HGFIKKT....Q...KTPPKEITKAEEIRK
Q3AR08_CHLCH/21-102GGSNKKD..........QSQAIEKAKQLWE
Q02AH7_SOLUE/9-98HAFQKKT....Q...ATPKKDIDTAKRRFA
A4W5D5_ENT38/12-94SGGNKNS..........QDKDIILAKTLAR
Q1VPX8_9FLAO/16-106NGFTKKT....Q...KTPKKEIDKAVRLMK
Q01YW8_SOLUE/16-108HAFQKKS....TQGIKTPKREIEVIKDRLK
Q7N9A1_PHOLL/12-100QVYIKKT....Q...KINPSEIALAFRRLE
Q2RNU1_RHORT/33-123HVFVKKT....Q...KTPRAALETAMRRAE
Q12AL6_POLSJ/17-110HCFQKKS....KSGIATPKPDMDVINIRLK
Q82UW3_NITEU/21-103GGGDKST..........QSKDIQKAIQLAN
A1URJ8_BARBK/18-100CAGDKRK..........QEADIDRACNYWR
B3EMQ2_CHLPB/12-94AGGDKRT..........QTKDIKTALRLAQ
B0TA13_CAUSK/14-104HAFVKKT....Q...KTPRAALELAERRAK
Q9PCS5_XYLFA/14-96CGGDKSS..........QMRDIEQAKALAA
A6TIF1_KLEP7/12-100RIFIKKS....P...KTPPAEIDQALRRLE
A1VID1_POLNA/19-99GGGTKRG..........QQRDIDKAKELLT
A3J9T6_9ALTE/13-102HAFVKKD....Q...KIPKKELKLALDRLR
Q9PD07_XYLFA/12-94CGGDKGL..........QARDIKTALHLSE
B3EPE2_CHLPB/14-103HSFIKKT....Q...KTPLKELRLARKRMQ
A3EQ97_9BACT/12-94CGGDKNS..........QAKDIKKAKRLAH
A0ZJ88_NODSP/54-148LLGNKVG...ND...RWYEQNVPKADKLYD
Q5P930_AROAE/15-104HCFQKKT....E...KTSKADVDLAAKRYR
Q3JDX2_NITOC/12-94CGGDKRT..........QQEDIAKAKRIAE
A1U427_MARAV/12-94CGGDKDT..........QQSDINTALRLAS
A3JL44_9ALTE/18-100CGGDKSS..........QADDIELAYELVK
B1ZLX5_METPB/12-94CGGDKRR..........QARDIALALEMAK
A7FEQ3_YERP3/12-100RVFIKKT....Q...KLPSGEITLAFERLE
A7HQS5_PARL1/14-111VAGDKSGAGNGK...RFYKQLIAKADRRFD
Q6N368_RHOPA/26-107CGGTKKR..........QRSDIARAIVYWR
A5VYQ7_PSEP1/12-94VGGDKST..........QAADILKARKLLK
B1YYE7_BURA4/17-106HCFVKKT....Q...KTPRKELETARRRLK
Q3SUP3_NITWN/18-110HAFQKKS....KSGIKTPKQETDLILERIK
A7M637_BACOV/16-104NGFQKKS....Q...KTPGSEIDKALKIKE
B1JYX5_BURCC/20-109HCFRKQS....T...RTNKTDIDLAARRYR
A1ACR9_ECOK1/13-102HCFQKKT....Q...TTSQSDIDLDKRRYK
Q73S09_MYCPA/13-110IAGDKAGN..WS...KWYAKHIPIADELFD
A9BXV4_DELAS/19-99GGSTKKG..........QQKAIDEAVALHS
Q1NR35_9DELT/12-94AGGDKSS..........QQRDIAEAIELAG
Q2RX83_RHORT/12-94CGGDKST..........QAKDIQTAKRLAE
A6GLV3_9BURK/12-94CGGNKRT..........QTKDIKRAKDLSS
Q1M5S2_RHIL3/20-110HAFTKTT....N...GVDRAAMKTVEERYK
Q9PHG3_XYLFA/18-100CGGIKRS..........QEADILKACELLK
C1DE87_AZOVD/12-94AGGDKSS..........QAKDIKAAIDMAR
Q87CU6_XYLFT/12-101HAFQKKT....Q...ATSKRDVELAKRRYT
A8GWQ1_RICB8/24-112HGFIKKS....Q...KTPNKELDLAFKRKK
A9AIJ2_BURM1/16-109HCFQKKS....CRGIATPKPDIELVRARLR
Q3QYK0_XYLFA/12-100HAFVKKT....Q...TTSPKDIALGQQRFK
A6W1R7_MARMS/13-95NGGHKGT..........QSKDIEKAKILLS
A3ITS2_9CHRO/22-103TGGGKKT..........QNKDIKKAKKFWN
Q89TC5_BRAJA/52-145HAFQKKS....KKGIETPKHDILVIQARLK
Q2J903_FRASC/7-103VGGDKSGD..WS...GWYRTAIPRAETLYA
Q6LK89_PHOPR/13-103HSFTKTT....N...GVDRKAMDTAKRRYK
A3N344_ACTP2/16-98NGGDKSS..........QAKDIKKARTIWT
A7JRF2_PASHA/19-108HAFQKKT....Q...KTAPKDIAVIKARYA
Q7N7C8_PHOLL/17-110HAFQKKS....KHGIATPKEDMDIIRNRLK
A5I9N6_LEGPC/14-103HAFVKKS....A...KTPKPDLQLALKRKR
Q3R3H1_XYLFA/12-105HCFQKKS....THGIATSKPDIDLIRDRLK
A2W0N6_9BURK/21-103SGCDKAS..........QPDDIRRAREHWS
Q48B35_PSE14/12-94CGGDKSS..........QSRDIETAKRLAD
A1WNI4_VEREI/25-112HGFIKKS....S...STPADDLALAKNRLK
Q1QGV2_NITHX/19-110HAFQKKS....TSGIATPQRHIDLVRQRLS
Q4K3L2_PSEF5/15-104HAVRKTT....R...KTEARDIELARARYQ
B4SEJ0_PELPB/18-108NGFSKKT....Q...KTPASEIVLAEKRKT
A3JL75_9ALTE/13-101HVFVKKD....Q...KIPKKDLDLAKERLR
Q97QQ7_STRPN/18-110HHFMKRT....Q...KTPKREIEQAKRELA

PF05015

HIGB1_VIBCH/1-93NTYLDPH-----------------------
Q9PFE9_XYLFA/13-105VDYQDYH-----------------------
O67947_ACEEU/3-101ITFFDPH-----------------------
Q46559_DICNO/28-119VDYVDYH-----------------------
Q98K96_RHILO/1-95DIYLDDH-----------------------
Y1250_HAEIN/5-97NLYLDPH-----------------------
Q9PCR9_XYLFA/1-96VSIVDYH-----------------------
Q52305_9ZZZZ/1-92LNYEDYH-----------------------

PF06296

Q1GRC7_SPHAL/1-94ALLRDAAAEALEWSGAQLDRLVASETLVEI
A9BUS1_DELAS/16-135AQFRKAAGHVLGLSEEQLTVLIGNGHFSEV
B1ZE24_METPB/1-120EALRALAGYLTRLSDEQLAQLASERGWRQI
Q0BB87_BURCM/6-118RAFRKLAADVGRHTDVDIATLVALNEWVEI
Q7MZ40_PHOLL/1-113AGFRELAKHYAALADEKITALIKNKELVEI
A1IQ13_NEIMA/1-120DVYRKAAAYYLKYTRAELAALKEDGIITEI
A6WJD0_SHEB8/2-121AVLLELAKLLMSYNNTQLAKAIKDKELYEV
Q2RVX2_RHORT/2-121KALQFAGKVLLNLSAEALSKALQSGVLLEV
Q8X3N0_ECO57/1-124AAYKKMANAFLAFSNKQIEDLIETGFLIEV
Q130T9_RHOPS/1-120STAREIAQIWLDADRKALARALADGIILEI
Q3B4L4_PELLD/1-122KALQLVAQAFLEATSEQLGQLLLKKEYMEI
Q45933_COXBE/1-120EAYKKLSKTYFDMKELELQSLLKIGELIEV
Q32X74_PSEFL/3-115TQLRGLAKVYGTLTEMQVQHLLDIEEFVEI
Q7N530_PHOLL/1-120MQFKKMASHVLGLSDEQLARLIEKGHFSEV
A0LNU9_SYNFM/1-120ATLSEIATGWLTANDQGLMRALDGGFLQEV
Q8ZL23_SALTY/1-113AGFRELAKHYACLTEDQITALINNKELVEV
Q3B1W0_PELLD/44-163RDFKDLSKEVFSLSETTLQTLIKRGAFVPV
A7BV94_9GAMM/1-120KALKRLAKELLSYSNEKLEQAMKAGEIIEV
A1VVB2_POLNA/4-123TVAKAYAGLLQKASLSKLNQMKVNGALVEI
A3WDJ1_9SPHN/14-133KVYRKAARIMLELGDGEIETEVEAGRLVEV
Q12GA8_POLSJ/2-121DATKIIASRLQAADAQKLDELLAAEILKEI
Q3AQ54_CHLCH/1-122AALKMVSSEFVAYSDEQISRLIQQQYIMEV
A6DKJ2_9BACT/1-122AILIQRAKQYFQLDEEQLSKAMKAKVLFEI
Q329F3_SHIDS/1-113AGFRELAKHYAFLTKAQLTAMINTKELTEI
A6TFW5_KLEP7/12-124MGFRELAKHYANLSEEKTTVLVKSKELVEI
A7BYY7_9GAMM/1-120KAFKLLAKIFLAMSEKEFETAIKNGDFVEL
A3RPT5_RALSL/6-118AAFRKLASDFGNCASADIDRLVELKELVEV
Q92MY0_RHIME/3-122ALFKKMAKELLALSDAQMAVLIGKGRFSEV
A1WRZ7_VEREI/2-121EGLQTIATDLLARTGKQLDEAVADGTLQEI
B4SB86_PELPB/1-120KEYKELAKITFSLCDEKLEKLIRTGAFKAV
C5AZC2_METEA/15-127RDFKLLAKGYASLAKEQIDKLVSDKDLLEI
A5V2L0_SPHWW/1-120KALKLLAALYLGYSAEEITAAVNGGALIEV
A7HZB0_PARL1/1-120EAYLALAKIFDGFSEKDMARLGAEKELTEV
B4SBL9_PELPB/1-120RWFKKMAKSTFALSEEQLEQLITTGNFIPV
A9L1Q5_SHEB9/2-121AALKAMAKEFFAYDDKALIKAIKAKALYEI
Q1I9J7_PSEE4/1-120KALQFTGRVFLELSPQALAKALDCGVLMEV

PF12910

A1ACN0_ECOK1/10-55------------------------------
A1WU36_HALHL/1-46------------------------------
A1WV52_HALHL/1-46------------------------------
A1WV58_HALHL/1-46------------------------------
A2P9T6_VIBCL/1-44------------------------------
A3DB70_SHEB5/1-46------------------------------
A3UQS0_VIBSP/1-46------------------------------
A3V913_9RHOB/1-45------------------------------
A3VLT0_9RHOB/1-46------------------------------
A3W8L0_9RHOB/9-54------------------------------
A3ZAD9_9SYNE/1-45------------------------------
A4BLZ6_9GAMM/1-45------------------------------
A4BRI9_9GAMM/1-45------------------------------
A4BVI7_9GAMM/1-46------------------------------
A4J2N2_DESRM/1-47------------------------------
A5CZB0_PELTS/1-48------------------------------
A5CZB2_PELTS/1-51------------------------------
A5D516_PELTS/1-47------------------------------
A5GD14_GEOUR/1-46------------------------------
A5GDY5_GEOUR/1-45------------------------------
A5TRR0_FUSNP/1-46------------------------------
A6DZ93_9RHOB/1-46------------------------------
A6FHK8_9GAMM/1-46------------------------------
A6TF68_KLEP7/1-45------------------------------
A6UIL0_SINMW/1-46------------------------------
A6X3S6_OCHA4/1-44------------------------------
A8FZZ5_SHESH/1-46------------------------------
A8GU11_RICRS/1-45------------------------------
A8IME7_AZOC5/1-52------------------------------
A8ZWS8_DESOH/1-45------------------------------
B0K692_THEPX/1-47------------------------------
B0NMA5_BACSE/1-46------------------------------
B0T841_CAUSK/1-45------------------------------
B0VBV1_ACIBY/1-45------------------------------
B1G8Y4_9BURK/1-46------------------------------
B1TGL1_9BURK/1-45------------------------------
B1YFG3_EXIS2/1-46------------------------------
B2AJI9_CUPTR/1-45------------------------------
B2I1D0_ACIBC/1-45------------------------------
B2J2I7_NOSP7/1-46------------------------------
B2J5Y7_NOSP7/1-45------------------------------
B2PVB1_PROST/1-46------------------------------
B2TF86_BURPP/1-45------------------------------
B3RCW4_CUPTR/1-45------------------------------
C7QT44_CYAP0/1-46------------------------------
B5EPP6_ACIF5/1-45------------------------------
B5JSV7_9GAMM/1-46------------------------------
B5JWA5_9GAMM/1-50------------------------------
B6VMW8_PHOAA/1-45------------------------------
B8FQ08_DESHD/1-49------------------------------
B8GV80_THISH/1-45------------------------------
B8KV21_9GAMM/1-45------------------------------
B9L8I3_NAUPA/1-46------------------------------
C0GDA4_9FIRM/1-46------------------------------
D6SQ06_9DELT/1-47------------------------------
D6STR0_9DELT/1-45------------------------------
D0KW14_HALNC/1-45------------------------------
D0KX96_HALNC/1-46------------------------------
D2SEQ1_GEOOG/1-47------------------------------
C1DNZ6_AZOVD/1-46------------------------------
C7LS61_DESBD/1-45------------------------------
C7LS62_DESBD/1-46------------------------------
D3PM77_MEIRD/1-47------------------------------
C3K1T8_PSEFS/19-64------------------------------
C3PMR0_RICAE/1-45------------------------------
D2B388_STRRD/1-47------------------------------
C4KD62_THASP/1-47------------------------------
C4LCD3_TOLAT/1-45------------------------------
C4UEE8_YERAL/1-44------------------------------
C4YXE4_9RICK/1-46------------------------------
C4ZB44_EUBR3/1-45------------------------------
C4ZJ95_THASP/1-44------------------------------
YEFM_SYNY3/1-46------------------------------
Q0AX75_SYNWW/1-49------------------------------
Q0AZ30_SYNWW/1-44------------------------------
Q0KJA8_9SPHN/1-45------------------------------
Q1IT03_KORVE/1-45------------------------------
Q1NP70_9DELT/1-46------------------------------
Q1NRQ5_9DELT/1-46------------------------------
Q1NU91_9DELT/25-69------------------------------
Q1NX73_9DELT/1-46------------------------------
Q1QB64_PSYCK/1-50------------------------------
Q28SG2_JANSC/6-49------------------------------
Q2W6L4_MAGSA/1-45------------------------------
Q31NY1_SYNE7/1-46------------------------------
Q3MBC7_ANAVT/1-47------------------------------
Q3SES5_THIDA/1-45------------------------------
Q46ND9_CUPPJ/1-46------------------------------
Q48B26_PSE14/1-46------------------------------
Q5NZB8_AROAE/1-45------------------------------
Q5P6K8_AROAE/1-45------------------------------
Q5P6U3_AROAE/1-46------------------------------
Q72B94_DESVH/1-47------------------------------
Q7N280_PHOLL/1-46------------------------------
Q87UE9_PSESM/1-45------------------------------
Q8YV80_NOSS1/1-47------------------------------
Q9Z5W8_FRANO/1-47------------------------------

PF02604

Q3AS06_CHLCH/5-78GLLKLLAQGEEDIR......KGKLRQ..QE
Q0A5I5_ALHEH/1-74LLEGLSRGERAVLE.......GRTYS..HS
B1JW05_BURCC/1-78LLAGLNIPASVEAF......NAGDESIAAD
Q8KPS5_SYNE7/17-90HLLKSPANAAHLQR......SIAQYQ..QG
Q1MDP7_RHIL3/1-70EAYLRSKGITRTEM..........YI..AD
Q7P2C4_FUSNV/1-71.AMRNLEYMTKIRE......GIAELE..AG
A7HZ68_PARL1/7-79DHEDMKRVLHREGQ......EVTPLI..PE
A5U6L9_MYCTA/1-74YWLAQPGIRESIAE......ADADIA..SG
A1VNA4_POLNA/1-72SLLATLLNAPRGES..........LDLARS
Q1RJA1_RICBR/1-68EQFLKIAIAEGIND..........IS..QG
Q4FS93_PSYA2/7-79DMALSQTVSARLND......GQIPIK..VT
Q88JZ5_PSEPK/7-79DFELAALAKALAAE......KSIRVS..LE
Q7CY23_AGRT5/1-74HLLSNPANASRLRA......SMGELE..RG
Q3MBC7_ANAVT/2-75YLFQSPENAARLLD......ALQRVK..AK
Q3A951_CARHZ/2-77KLKMLELKNLIEEV....REKAATYE..IS
A8GN91_RICAH/1-70GKAVTNITKQPEWL........SAKE..SA
Q8GEI6_ERWPY/8-80DAELGCIVDDRMSE......LPVAKE..IS
Q83AB4_COXBU/1-74YLLSNEANAARLRQ......SIRSLK..QG
P73973_SYNY3/1-74YLLSNPVNAEKLLT......TASRSI..DQ
A3LCG6_PSEAI/1-74YLLRSPANARRLMD......SIDSLK..QG
A5G9X2_GEOUR/8-81ELLQDIQTSVSQLE......SGAGME..NN
Q1QFA3_NITHX/2-74RVQRTIDLSEAEIA......AVEAAE..MT
Q1NJK0_9DELT/1-74VKSDADLMAEIKGG.......LATLK..RK
A2VFU8_MYCTU/1-74EFLSRLRGAQADPG......LRNDLA..VL
Q1BZZ9_YERPA/1-69ALLKLLTLSEQDKA......DGNIFS..KE
Q9F5E8_AGRRH/5-75DARTVGTLETMPRE.........LFDEFEA
Q3BKG0_9PROT/1-71SLVEFLRSSPLSGV...........DLDIE
A3ET18_9BACT/1-72KAFRSGHLLDGISV..............RE
A4KGH0_MYCTU/1-74EVLRTPGASEAIRE......GLADVA..AG
C1AHM0_MYCBT/8-83ESGVLIPARRPQNL......LDVTAEPARG
A2VPH2_MYCTU/12-86IERATLDVVDLPEP..........LDLDAG
Q92JV5_RHIME/2-75TALLSRLERQPAVI......AGRWTR..DE
A3KKH7_STRAM/2-71EPAGDQVVGALSRV..........HD..TA
Q8Y121_RALSO/1-74SLVSFMRQSPLADQ......DDVVFE..RE
A5UG66_HAEIG/9-80DAELVRIAEERKAE.......GGFIE..VD
B1ZAQ8_METPB/1-74HLLGTPANATRLME......SVKQLD..AG
A6FHK8_9GAMM/1-74YLMANPNNSKRLLE......SIAQAE..RG
Q92K09_RHIME/1-70ALERWQNKGLDFRG.........SVK..AG
Q5H0A8_XANOR/10-84AAAAAPSRAQSLQA......LQAKFD..AQ
A1KP50_MYCBP/1-72YLLRSPENARRLME......AVARDK..AG
A4X3L4_SALTO/1-74YLMASPANARRLNE......AVEELR..NG
Q8F586_LEPIN/1-76ATENNSLIPAKKFK......EIKFPK..VK
Q72GP3_THET2/5-76DPLEALLSLNRAIH........ARLG..RP
A7C5N8_9GAMM/1-74YLLQNPANAERLRK......GIEQHR..QG
A6NUB6_9FIRM/2-75DLYGKLAVAEQEIT......SGAEGE..DF
A7HJE8_FERNB/5-77KVWDLYLLDLGDPS......VFKDIK..LE
Q87UE9_PSESM/1-73VMFDAEASDAMDAE.........ITELFEG
Q0FUX1_9RHOB/1-74YLLSSPRNAARLRA......SIAEFD..AG
A1U627_MARAV/7-79DYRLLQEARKRMDD......ESIPVS..IN
A2SME8_METPP/3-75IGGDLALGRDWRAL..............HG
Q5N582_SYNP6/25-97QLSQGQTLNGITVQ..............EL
Q3A3M7_PELCD/5-78ALMQLLAQSERSLR......EGRGKT..LD
Q1RJ58_RICBR/1-73YLLSIPNMHKSIVE......GRKEPI..EK
A3JC22_9ALTE/1-74HVLQNQDLMQQIAA......SFDTHS..RG
A8GU35_RICRS/7-79DKYLLELATIRLKD......KEKAIA..VN
Q2J9K2_FRASC/1-74EVLSNRETMRQLAE......SRAAVE..AG
Q8KCZ1_CHLTE/23-91EQMHGLQSGAE...........ASVL..TG
A8GU11_RICRS/1-72DFKEYLLSIPKTDN..........LDIQRA
Q1M8R1_RHIL3/1-75TLVDDLLGGPAWDD......EFADAVEARN
Q9Z5W8_FRANO/1-75YLMRSMNNYKRLQN......SIDEVE..SG
Q1N5J5_9GAMM/1-73YLLSVPGMRESIRE......GMDTPV..DE
A7BS83_9GAMM/2-72KLSSVLLAPEIGGE...........DLDFS
Q5DXZ3_ECOLX/7-76EQEEKKPIKARFRP......SAARLE..EI
Q4C411_CROWT/2-74ELLSIPKLRESLQR......SLEQIN..NN
VAPB4_MYCTU/2-74VIGELVRLGPDTTN.......LGEEL..RE
A6H2C6_FLAPJ/1-74YELSNRTNESRLDS......AIDKFK..SG
A5LVR7_STRPN/31-105RIAQNKELSDKVLR......GMAQVR..AG
Q2Y598_NITMU/1-65RLQAKLAVGEGQLN..............RG
Q8YV80_NOSS1/2-75AIDSAQLREAIAQN......AG.FTT..LE
A5E9E6_BRASB/13-85TLAEFLLASPLRGT......DLDLPR..ST
A3WTD0_9BRAD/1-75LLEAVRASAAAKVT....AGPSAARS..QD
Q2J2M4_RHOP2/1-69GFGEFLMGFPGLPE.............EIE
A9BWR5_DELAS/1-73SLKELLLSEVGRAD...........LLIPP
Q4C7V9_CROWT/2-73EILSDQEFCQQLKI......GIEELN..RG
Q1LA07_RALME/7-80HLLGTEKNATRLRE......SITEFR..AS
B4SDY6_PELPB/5-78AFLKLINLGKKDIS......EGNFQS..VE
A3XEP7_9RHOB/7-79DLALIDLVNARSAE......TPVKVT..LD
Q3SUJ2_NITWN/10-83QSAKAPRSGEKKRG......GAEWLN..RR
B0KAJ7_THEP3/22-97DLELLQLAIERTKN......LKEGET..IP
Q48B26_PSE14/1-74YLLGTENNATRLRR......SIAKHK..AG
Q6G6L3_STAAS/1-75YLESTGTMDKVREREKDN......SG..TT
A9L6D3_SHEB9/1-68HLLQSKAVKAMTDI.............KMG
Q8YUZ9_NOSS1/1-76KPDVIQGNPDDLVN....ISWEQEIN..ID
Q1RH38_RICBR/1-73ELKKRAPLGSVDEI..............LE
A5GA73_GEOUR/8-81SFLDSVGRGISDAE......SGRTYN..TD
A3Y9U0_9GAMM/1-68..MKADYIKYCFAS......AQKDLE..ED
Q57IR8_SALCH/1-72DDEFAAIMAVHGNE........LREL..AD
Q0AZM5_SYNWW/1-74KLLQQLIAAERNRL......AGSPTF..TT
A7VC40_9CLOT/2-70EMKLDEADRQAKAT..........DK..RL
Q02AM0_SOLUE/9-77DVLKLIGEESQRKG..............TH
Q2RG18_MOOTA/60-129..LSASNAAQTVSK......ALKNIQ..EA
Q217W8_RHOPB/1-75AIERRREVIDRIRR......RAATIN..LG
Q7A3T0_STAAN/1-74YLQQNPNNAEHLAQ......SIADLE..RG
Q8R721_THETN/2-77KAKQLEIMQILNEF....RDKAEKAG..LS
Q4UNJ2_RICFE/1-69DMYWAMQAKNASKS...........GFLSE
A9BIX2_PETMO/6-72EVRDISLFEIENVE..............EY
Q7NI03_GLOVI/2-73SLVDFLRSSPLVGA..........QIDLRR
Q82VL3_NITEU/3-75NIVDQLGLPSGIED......VEVEFP..RS
Q4ULJ1_RICFE/2-73AALRLRKLAKEINL..........QPSDLE
A6VV50_MARMS/5-78ALLKMLALGQRQVE......EGKVQP..AG
A4GRN0_LEIXC/1-74AWLSDPAHAAEMAE......AEEDVA..AG
A0YN28_LYNSP/3-76HLLRSPKNAERLLT......ALQNAK..SR
A3ILX9_9CHRO/2-73SILSDEAFSQKLQE......SMTQVK..EG
Q5NZI4_AROAE/7-79DRDLVELARQRVAR......KETAVE..VD
A5TRR0_FUSNP/1-74YIRSNLKYYQRLVE......SIKEVE..KG
A6DJA3_9BACT/1-74YLLRSPKNAKRLLE......SIYEIQ..NG
Q47D13_DECAR/1-72SLKALLLSVQPRGE...........IGIPP
Q1NJ13_9DELT/7-79DLEDAKLVSERANG......PFVEVS..LD
A7BYH2_9GAMM/1-74YLLSNPANAEHLQK......SIAQAK..MG
A5V171_ROSS1/3-74HERSAVGRLLREIA.........PVY..RL
B3EPA2_CHLPB/1-72SLTEFFRRSPLYGA..........TLDLER
Q4C3A5_CROWT/6-76ETLKGIKRGLDQMK..............EG
Q8RAX6_THETN/1-73LLEMIKKSKPVTEE......IDLKAA..RE
Q4C9G6_CROWT/1-73QEFQLFRKNVAKKA......QDRDFK..KE
Q58CI7_PSEAI/1-69ALVKLLAMGSREYA......EGKHCS..AD
Q8VUA3_LACCU/2-76AKEGSLEYAIARDQ......LIKRHV..LP
Q1MP08_LAWIP/5-77VLLKVLLLRFKSAD......EGNLKP..VK
A3YC32_9GAMM/10-82DLELAQLVKKRKES......AEIDIS..IN
A1SK49_NOCSJ/1-74DVLSRADEVEALRA......GLADLE..AG
A0M6Q7_GRAFK/1-73YLLSG.KNREVLLN......SINELE..RR
Q3AS52_CHLCH/4-71AFMKSVADGLEDVR..............HN
Q2RKQ8_MOOTA/2-70ENKRLALKASLAKI...........R..AR
Q0ANU3_MARMM/14-87YLLESPANARRLRD......SIAAAE..AG
A7NJ95_ROSCS/1-71AYSKQFRSLLDNAR........KEIA..AG
Q7N4P2_PHOLL/1-74YLMASPKNAAHLNQ......AIAEVE..AG
Q6LIQ3_PHOPR/1-74RIYSNPAQRKHIEE......SIEQFK..SG
Q01ZP0_SOLUE/33-106HLLRSPRNARRLLG......ALRQAE..RG
Q746J1_THET2/26-100SVLEALRPPKTLPN.......EEVEALFQR
A5UPR7_ROSS1/1-75VWARLEQIREELGK......GRQSEK..SA
Q79A04_ECOLX/1-69DAEFASLFDTLDST...........N..KE
A8GY91_RICB8/1-70NKLDIEEAKEAVKE......A....K..LK
A7C393_9GAMM/36-109DMLDYQEAIGALDE......PGENIS..LE
Q92JE6_RICCN/1-64YLLSN................LGLMR..IE
Q0YRF7_9CHLB/5-72ALLKILAQSSQSIE..............QG
A1AYB3_PARDP/1-71DFADLLLAFPGEPD..........DIPERA
A7BEP1_9ACTO/5-79ARDLAAFREAVRND......DGQRVS..LA
A5MYY9_CLOK5/1-73NLVSIPGMKESILE......GKKELV..EE
Q3APS3_CHLCH/1-74YLLSSPTMAERLRE......SLESYS..NG
Q1QFA2_NITHX/11-83TLADFLLASPLRQD......PMDIER..VR
Q027P6_SOLUE/1-75RKRTGKVTLEEIRS..............AR
A3N1K9_ACTP2/1-71RSALEALTPSDPNV........ADIE..LE
A5GAD7_GEOUR/18-91NMAKMLAPAEEQVA......GGKTRP..MK
Q3Y3W5_ENTFC/1-75RTLSNNYVMEKIRR......GDEQFS..KG
A1VIA9_POLNA/12-89PLEYQRADGKSLAQ.......LIMDE..RE
Q6N8R9_RHOPA/1-72IRNLRSLARDLKLN..............PT
A1TVL6_ACIAC/6-78HLLLIDDARRGLAD..........IE..AG
A5GD14_GEOUR/1-74YLLSSPANAARLMQ......SLEEAR..SG
Q8GNE6_9PROT/6-79TLLKLIVQSENEIN......ENKVIE..QE
A5G3C0_GEOUR/1-74DRMDVEAAKAALAE......SDERVS..YE
A6F080_9ALTE/7-80RFVKAVAQGLMDVR......EGNTVS..LE
A3IUU6_9CHRO/1-73YLQSIPGLVESIKE......AEKADD..WG
Q3ARA3_CHLCH/1-69HQNIKDRLRHSLEQ..........VK..EG
Q21DC9_RHOPB/1-74HLLKSPANAVRLLR......SIEEAD..AG
A5GBX7_GEOUR/12-83TLSQFFRQSPLHDT..........ELDLSR
A3EPH7_9BACT/1-74EFQKSHSLGEAKIQ.............ELI
A3VLT0_9RHOB/1-74YLLSSPENARRLRA......SIDRLN..RG

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window