Sequence alignment for CL0139

PF02774

E8VGZ3_BACST/158-316LAPLAQK---KLLDE.SFVIVDAKTGVSGAGRK..........................................ASMGT
A3YN03_CAMJU/143-324LKPLNDA---..FNL.KRVDVSTYQAASGAGKEGMQELVEAM.......................QSFFAFKLDEFEPQT
DHAS_ARCFU/157-324LKPLMD.---.LG.L.RTVRVASMQALSGAGY.............................................PGV
K4NFU4_HELPY/140-329LNPLHLH---..FKI.KSVIVSTYQAVSGAGNKGIESLKNELKTAL...............ECLEKDPTIDLNQVLQAGA
USG_AZOVI/140-318LAPLRP.---.LVRW.RHLGVTACLPVSSLGREGVAELARQ.........................TTELLNGRPPKPRF
A0A017J6B0_ECOLX/163-311LKPLIDA---DLLDLNQWPVINATSGVSGAGR............................................KAAI
L0D445_BACIU/139-327LEPIRKA---..YGL.NKVIVSTYQAVSGAGNEAVKELYSQTQAI..................LNKEEIEPEIMPVKGDK
M7CDQ8_LACPN/155-312LAPLAQQ---QLVEP.TSIVVDAKSGLSGAGKR..........................................ATAAS
DHAS_SHESP/141-320LKPIYDA---..FGI.SRINVATYQSVSGSGKEAIAELAGQ.........................CSKLLQGLPIEPKV
C9MJR3_HAEIF/145-356IGGLFE.---.KDLV.EWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDN
F7UTQ8_SYNYG/163-322LSPLLKQ---GFIVP.ETAIIDAKSGTSGGGRE..........................................AKVNM
DHAS_METTH/156-330LKPIYDA---.YT.I.KRVYVSTMQAVSGAGY.............................................NGV
ARGC_METTH/153-305CLPLVYE---KIADT...FIIDSKTGVSGAGVK..........................................PTALT
A0A038FER3_MYCTX/167-323LFPALAA---DLIEP.A.VTVVAVSGTSGAGRA..........................................ATTDL
Q99103_USTMD/166-346LKALEAK---.FGPL.EKILVNTMQAISGAGY.............................................PGV
DHAS_MYCSM/140-329LKPLHEE---..AGL.QRLIVSSYQAVSGSGIAGVEELAGQARPVID..............GVEQLVHDGSALQYPAPNK
DHAS_SCHPO/160-338LKALQDA---.FGPI.AQTNVVSMQAISGAGY.............................................PGV
A0A023ZB84_YEASX/165-346LKPLIEK---.FGPI.DALTTTTLQAISGAGFS............................................PGV
DHAS_AZOVI/143-352LGRLRGR---.PGRL.DERHDLSGRFR..AGAQNMRELIRQMGTINAAVAAEPADPASAILEIDRKGPETQRSAEFPVDH
A0A022SYW0_LEPIR/157-329LKPLLDR---.FG.I.ESVMLFSMQAISGAGY.............................................PGV
DHAS_LEGPN/141-322LKPIYDA---..VGI.SRINVATYQSVSGTGKKAISELVAQ.........................VGDLLNGRPANVQV
G6WZT3_CORGT/140-329LKPLHDA---..AGL.VKLHVSSYQAVSGSGLAGVETLAKQVAAVGD..............HNVEFVHDGQAADAGDVGP
A0A016XEH1_VIBCL/141-319LKPIYDA---..VGI.ERINVTTYQSVSGAGKAGIDELAGQ.........................TAKLLNGYPAETNT
DHAS_METJA/166-336LKPIMDK---.FG.L.EAVFIATMQAVSGAGY.............................................NGV
ARGC_METJA/158-312VAPLVKE---NIIEE.R.IIFDSKTGVSGAGIK..........................................PTETT
G2EQW4_CORGT/160-318LLPAVQA---GLIEP.D.VSVVSITGVSGAGKK..........................................ASVAL
A0A017ID96_ECOLX/141-318LKPLIDQ---..GGL.SRISVTSLISASAQGKKAVDALAGQS........................AKLLNGIPIDEEDF
A0A024SXL8_PSEAI/144-354LGGLFDA---..GLV.EWMSAMTYQAASGAGAQNMRELLKQMGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEH
DHAS_STRAK/132-319LRPLHDE---..AGL.EALVVATYQAVSGSGLAGVAELHGQTQKVVA..............DAEKLTHDGEAVDFPEPGV
I6TY00_STRMG/137-328LEPIRQK---..WGL.SRVIVSTYQAVSGAGQSAINETVREIKEVVN..............DGVDPKAVHADILPSGGDK
A0A017I2M7_ECOLX/144-353LGGLFA.---.NDLV.DWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDN
A0A058UU82_BORPT/145-359LAGLFN.---.NDLV.EWMSSMTYQAASGGGAQHMRELLTQFGLLNQAVKPLLDDPAAAILDIDRGVLARQQDPSLPQEH

PF02800

G3P1_BACSU/157-313LAPFAKVLN.DKFGI-KRGMMTTVHSYTNDQQI---------------------------------LDLP...HKDYRRA
G3P_THEMA/157-313IAPIVKVLH.EKFGI-VSGMLTTVHSYTNDQRV---------------------------------LDLP...HKDLRRA
G3P2_SYNY3/159-315LAPFGKVIN.DNFGI-IKGTMTTTHSYTGDQRI---------------------------------LD.AS..HRDLRRA
G3P_PSEAE/159-312LAPVAQVLH.RELGI-EHGLMTTIHAYTNDQNL---------------------------------SD.VY..HPDLYRA
G3P3_ECOLI/155-313LAPMAKALH.DSFGI-EVGTMTTIHAYTGTQSL---------------------------------VDGPR..GKDLRAS
G3P_CHLTR/155-312LAPLAKVLL.DNFGI-EEGLMTTVHAATATQSV---------------------------------VDGPS..RKDWRGG
E4PD_VIBCH/164-320IVPIIKVLD.DAFGI-DSGTITTIHSSMNDQQV---------------------------------IDAYH..N.DLRRT
G3P1_CAEEL/163-320LAPLAKVIN.DNFGI-IEGLMTTVHAVTATQKT---------------------------------VDGPS..GKLWRDG
G3P1_SCHPO/157-314LAPLAKVIN.DTFGI-EEGLMTTVHATTATQKT---------------------------------VDGPS..KKDWRGG
G3P_TREPA/167-329LAPVVHVFLKEGVGI-ETGLMTTIHSYTATQKT---------------------------------VDGVS..LKDWRGG
G3P_STRCO/158-315VAPMAKVLD.ENFGI-VKGLMTTVHAYTNDQRI---------------------------------LD.FP..HKDLRRA
G3P_CORGL/158-313LAPMAKVLN.DKFGI-ENGLMTTVHAYTGDQRL---------------------------------HD.AP..HRDLRRA
G3P_MYCLE/163-318LAPLAKVLH.DQFGI-VKGLMTTVHAYTQDQNL---------------------------------QD.GP..HSDLRRA
G3P_AQUAE/157-320LAPCVKVLN.EAFGV-EKGYMVTVHAYTNDQRL---------------------------------LD.LP..HKDFRRA
G3P_BORBU/158-316LAPLAKVLH.ESFGI-EQGLMTTVHAYTNDQRI---------------------------------LD.LP..HSDLRRA
G3PA1_ARATH/218-374LAPFVKVLD.QKFGI-IKGTMTTTHSYTGDQRL---------------------------------LDAS...HRDLRRA
G3P2_BACSU/157-313LAPVVKVLD.EEFGI-ESGLMTTVHAYTNDQKN---------------------------------IDNP...HKDLRRA
G3PC_CUPNH/160-315LAPLVKPLH.EKLGL-VNGLMTTVHSYTNDQVL---------------------------------TD.VY..HEDLRRA
G3P_ZYMMO/159-316LAPVLHVLQ.QKIGI-VRGLMTTVHSFTNDQRI---------------------------------LD.QI..HSDLRRA
G3P_LACLA/157-315LAPMADALN.KNFGV-KGGTMTTVHSYTGDQMT---------------------------------LDGPHR.GGDFRRA
G3P_HELPY/156-312IAPICAILD.KAFKI-KEGMLTTIHSYTSDQKL---------------------------------IDLAH..PLDKRRS
O25902_HELPY/154-310SAPLLKILD.EAFKV-ENALLTTIHSYTNDQNL---------------------------------LDTKH...KDIRRA
G3P_ARCFU/147-300LTRLIYMLK.TNFSI-GRIRATMLRRVVDP...---------------------------------........KEDKKG
G3P_METTH/145-299LCRTLKPID.DLCGI-KKVRAVMVRRGADP...---------------------------------........VQVKKG
G3P_METJA/149-305LCRILYAIN.SIADI-KKARIVLVRRAADP...---------------------------------........NDDKTG
A4I5X6_LEIIN/172-334LAPIVHVLTKENFGI-ETGLMTTIHSYTATQKT---------------------------------VDGVS..LKDWRGG
A8BSP4_GIAIC/157-314LAPLAMVVN.KKFGI-KEGLMTTVHAVTATQLP---------------------------------VDGPS..KKDWRGG
A8JHS0_CHLRE/136-293LAPLAKVVN.SKFGI-KEGLMTTVHATTATQKT---------------------------------VDGPS..KKDWRGG
D5AV33_RHOCB/158-314LAPIVKVIH.EALGI-KHGSITTLHDVTNTQTI---------------------------------VDRPA...KDLRRA
E2RU88_GIAIC/193-353LAPLAKVIH.ENFGI-KQALMSTIHAVTATQPV---------------------------------TDSVMK.KRDWRSG
E3GXP7_METFV/145-298LCRTLKPLH.DSFGI-KKVRAVIVRRGADP...---------------------------------........AQVSKG
F3Z6S4_9ACTO/294-451IVPPLKAMA.DEFGV-ESGHVETVHSFTNDQNL---------------------------------LDNYH...KSDRRG
G7XDD5_ASPKW/156-313LAPLAKVIN.DKFGI-VEGLMTTVHSYTATQKV---------------------------------VDAPS..SKDWRGG
G9NDK9_HYPVG/155-312LAPLAKTLN.DKFTI-VEGLMTAIHAYTASQKT---------------------------------VDGPS..SKDWRGG
K5WMK0_AGABU/133-294LAVLAKVIN.DKFGI-VEGLMTTVHATTATQKT---------------------------------VDAPA..KKDWRSG
K5XPB7_AGABU/155-312LATLAKVIH.DNFGI-VEGLMTTVHATTATQKT---------------------------------VDGPS..HKDWRGG
E4PD_ECOLI/160-316IIPVIKLLD.DAYGI-ESGTVTTIHSAMHDQQV---------------------------------IDAYH...PDLRRT
G3P_STRP1/157-314LAPMAKALH.DAFGI-QKGLMTTIHAYTGDQMI---------------------------------LDGPHR.GGDLRRA
G3P2_NOSS1/159-315LAPIAKVLN.DKFGI-IKGSMTTTHSYTGDQRL---------------------------------LDASH...RDLRRA
G3P3_NOSS1/158-315LAPVVKVIH.EGLGI-KHGIITTIHDNTNTQTL---------------------------------VDAPH...KDLRRA
G3P_PYRFU/146-296LVRTLNAIK.DYVDY-..VYAVMIRRAADP...---------------------------------........NDIKRG
G3P1_NOSS1/160-317LAPIAKVIN.DNFGL-TEGLMTTVHAMTATQPT---------------------------------VDGPS..KKDWRGG
Q1GB27_LACDA/161-318LAPMANALN.KEFGI-QVGTMTTIHAYTATQKV---------------------------------LDGPDR.GNNFRNA
Q2G032_STAA8/156-314LAPVAKVLN.DDFGL-VEGLMTTIHAYTGDQNT---------------------------------QDAPHR.KGDKRRA
Q3IX57_RHOS4/156-312LSPVAKVLH.DAIGI-AKGFMTTIHSYTGDQPT---------------------------------LDTMH...KDLYRA
Q5SMF8_THET8/154-309LAPVMKVLE.EAFGV-EKALMTTVHSYTNDQRL---------------------------------LDLPH...KDLRRA
Q5UZX2_HALMA/160-315ITPVAKVLD.EEFGI-NAGQLTTVHAYTGSQNL---------------------------------MDGPN...GKPRRR
Q8IKK7_PLAF7/158-317LAPLAKVIN.DRFGI-VEGLMTTVHASTANQLV---------------------------------VDGPSKGGKDWRAG
R4K768_CLOPA/155-312LAPMAKVLN.DSFGI-EKGFMTTIHAYTNDQNT---------------------------------LDGPHR.KGDFRRA
U6HHB1_ECHMU/156-314LAPLAKVIN.DNFGI-VEGLMTTVHSYTATQKV---------------------------------VDGPS..KKAWRDG
V4IQQ6_9ACTO/158-313LAPLAAVLD.ELAGI-EHGFMTTVHAYTQEQNL---------------------------------QDGPH...RDPRRA

PF02774

E8VGZ3_BACST/158-316HFSELNDNFKIYKVN.EHQHTPEIEQALNEWQPGLGPITFSA.............HLVPMTRGIMATMYTRLTC..D-LT
A3YN03_CAMJU/143-324FPYTLALNLIPQIDVFMDND..YTKEELKMVNETQKILH.KN...LEVS...ATCVRVPVLRSHSEAITMHF.....-EK
DHAS_ARCFU/157-324PSLAITDNVIPFIKGEEDKVEEEPLKLLGKFNGRKIEFADIK.....VS...ASCHRVPVIDGHTEAVWVEFD...R-..
K4NFU4_HELPY/140-329FAYPIAFNAIAHIDTFKENG..YTKEELKMLHETHKIMG.VD...FPIS...ATCVRVPVLRSHSESLSIAF.....-EK
USG_AZOVI/140-318FDRQIAFNLLGRVGDSDTAG..HTGLERRLVEESRQVLDAPE...LKIS...VTCLMAPVFFGDSLSLAVQAS....-.Q
A0A017J6B0_ECOLX/163-311SNSFCEVSLQPYGVF.THRHQPEIATHLGADVIFTPHLGNFP...................RGILETITCRLKS..G-VT
L0D445_BACIU/139-327KHYQIAFNAIPQIDKFQDNG..YTFEEMKMINETKKIMHMPD...LQVA...ATCVRLPIQTGHSESVYIEID....-RD
M7CDQ8_LACPN/155-312HYVAVNDNLSLYKLN.QHQHIPEMMQQLQQWWSAISAIEFTT.............TLIPVTRGIMTTIYAKAKS..A-LT
DHAS_SHESP/141-320YSKQIAFNVLPQIDTFMENG..YTKEEMKMVWETQKIFGDDN...IVVN...PTAVRVPVFFGHSEAIHLET.....-IQ
C9MJR3_HAEIF/145-356FGAALGGSLIPWIDKLLPETG.QTKEEWKGYAETNKILGLSD....NPIPVDGLCVRIGALRCHSQAFTIKLK....-.K
F7UTQ8_SYNYG/163-322LLAEAEGSLGAYGVA.KHRHTPEIEQIASDLAGTELRVQFTP............H.LIPMVRGILATVYATLRD.PG-LV
DHAS_METTH/156-330PSMAILDNLVPFIGGEEEKIETETLHLLGELDEGVVKPASFG.....VS...ASCHRVPVVDGHTEAVFIELDD..E-FD
ARGC_METTH/153-305HYPHCSDNVIPYNVT.GHRHTPEIRQELSRLNP..VRLSFTP............H.LVPVTRGILTTAHTFLLE..D-LE
A0A038FER3_MYCTX/167-323LGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTP............V.LIPASRGILATCTARTRS..P-LS
Q99103_USTMD/166-346SSLDILDNVVPFISGEEEKIEWETAKILGGIKTDKTAFDYHE...EHPLKVSAHCNRVPVIDGHMECVSVSFKNRPA-PS
DHAS_MYCSM/140-329YVAPIAFNIVPLAGNYVDDGSGETDEDQKLRNESRKILGIPE...LLVS...GTCVRVPVFSGHSLSINAEF.....-SQ
DHAS_SCHPO/160-338SSLDILDNIVPFIGGEEEKIEWETRKILGSVNSTISGYELT.....DNVV.SAQCNRVPVIDGHLMCISVKFAK.TS-PT
A0A023ZB84_YEASX/165-346PGIDILDNIIPYIGGEEDKMEWETKKILAPLAEDKTHVKLLT...PEEIKVSAQCNRVAVSDGHTECISLRFKNRPA-PS
DHAS_AZOVI/143-352FGVPLAGSLIPYIDKELPNG..QSREEWKGQAETNKILGRIK....NPIPVDGICVRVGAMRCHSQALTIKLN....-.K
A0A022SYW0_LEPIR/157-329PTMDILGNVIPHIGGEEEKAEIEPLKCLGKVENGKILHADFS.....IS...AHCNRVPVFDGHTVCVSVKFKK..K-PS
DHAS_LEGPN/141-322YPQQIAFNALPHIDQFEDNG..YTREEMKMVWETRKIMEDDS...IMVN...PTAVRVPVIYGHSEAVHLEL.....-KK
G6WZT3_CORGT/140-329YVSPIAYNVLPFAGNLVDDGTFETDEEQKLRNESRKILGLPD...LKVS...GTCVRVPVFTGHTLTIHAEF.....-DK
A0A016XEH1_VIBCL/141-319FSQQIAFNCIPQIDQFMDNG..YTKEEMKMVWETQKIFNDPS...IMVN...PTCVRVPVFYGHAEAVHVET.....-RA
DHAS_METJA/166-336PSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDGKVELANFK.....IS...ASCNRVAVIDGHTESIFVKTKE..G-AE
ARGC_METJA/158-312HFPNVNENINPYKIT.THRHTPEIEKELKKLGK..AKVSFTP............H.LAPITRGILTTAHTFLAK..D-VD
G2EQW4_CORGT/160-318LGSETMGSLKAYNTSGKHRHTPEIAQNLGEVSDKPVKVSFTP.............VLAPLPRGILTTATAPLKE..G-VT
A0A017ID96_ECOLX/141-318FGRQLAFNMLPLLPD..SEG..SVREERRIVDEVRKILQDEG...LMIS...ASVVQAPVFYGHAQMVNFEA.....-LR
A0A024SXL8_PSEAI/144-354FGAPLGGSLIPWIDKELPNG..QSREEWKAQAETNKILARFK....NPIPVDGICVRVGAMRCHSQALTIKL.....-NK
DHAS_STRAK/132-319YKRPIAFNVLPLAGSIVDDGLNETDEEQKLRNESRKILEIPG...LKVS...GTCVRVPVFSGHSLQINARF.....-AR
I6TY00_STRMG/137-328KHYPIAFNALAQIDVFTDND..YTYEEMKMTNETKKIMEEPE...LPVS...ATCVRVPILFSHSEAVYIETK....-.D
A0A017I2M7_ECOLX/144-353FGVPLAGSLIPWIDKQL.DNG.QSREEWKGQAETNKILNTS.....SVIPVDGLCVRVGALRCHSQAFTIKLK....-.K
A0A058UU82_BORPT/145-359FGVPLGGNLIPWIDKDLGDG..MSREEWKAEAETNKILGRGAAFGTPATPIDGLCVRIGAMRCHSQALTIKLK....-.R

PF02800

G3P1_BACSU/157-313RAAA..ENIIPTSTGAAKAVSLVLPELKGKLN--------------------GGAMRVPTPNVSLVDLVAELNQ--E.VT
G3P_THEMA/157-313RAAA..VNIIPTTTGAAKAVALVVPEVKGKLD--------------------GMAIRVPTPDGSITDLTVLVEK--E.TT
G3P2_SYNY3/159-315RAAA..VNIVPTSTGAAKAVALVIPELQGKLN--------------------GIALRVPTPNVSVVDLVVQVEK--N.TI
G3P_PSEAE/159-312RSAT..QSMIPTKTGAAEAVGLVLPELAGKLT--------------------GLAVRVPVINVSLVDLTVQVAR--D.TS
G3P3_ECOLI/155-313RAAA..ENIIPHTTGAAKAIGLVIPELSGKLK--------------------GHAQRVPVKTGSVTELVSILGK--K.VT
G3P_CHLTR/155-312RGAF..QNIIPASTGAAKAVGLCLPELKGKLT--------------------GMAFRVPVADVSVVDLTVKLSS--A.TT
E4PD_VIBCH/164-320RAAS..QSIIPVDTKLHKGIERIFPKFSNKFE--------------------AISVRVPTVNVTAMDLSVTIKS--N.VK
G3P1_CAEEL/163-320RGAG..QNIIPASTGAAKAVGKVIPELNGKLT--------------------GMAFRVPTPDVSVVDLTVRLEK--P.AS
G3P1_SCHPO/157-314RGAS..ANIIPSSTGAAKAVGKVIPALNGKLT--------------------GMAFRVPTPDVSVVDLTVKLAK--P.TN
G3P_TREPA/167-329RAAA..VNIIPSTTGAAKAVGEVLPSTRGKLT--------------------GMAFRVPTPTGSVVDLTFRTEK--E.TS
G3P_STRCO/158-315RAAA..ENIIPTTTGAAKATALVLPQLKGKLD--------------------GIAMRVPVPTGSATDLVVELQR--E.VT
G3P_CORGL/158-313RAAA..VNIVPTSTGAAKAVALVLPELKGKLD--------------------GYALRVPVITGSATDLTFNTKS--E.VT
G3P_MYCLE/163-318RAAA..LNVVPTSTGAAKAIGLVMPELKGKLD--------------------GYALRVPIPTGSVTDLTADLSK--C.VS
G3P_AQUAE/157-320RAAA..INIVPTTTGAAKAIGEVIPELKGKLD--------------------GTARRVPVPDGSLIDLTVVVNK--APSS
G3P_BORBU/158-316RAAA..LSIIPTSTGAAKAVGLVLPELKGKLN--------------------GTSMRVPVPTGSIVDLTVQLKK--KDVT
G3PA1_ARATH/218-374RAAA..LNIVPTSTGAAKAVALVLPNLKGKLN--------------------GIALRVPTPNVSVVDLVVQVSK--K.TF
G3P2_BACSU/157-313RACG..ESIIPTTTGAAKALSLVLPHLKGKLH--------------------GLALRVPVPNVSLVDLVVDLKT--D.VT
G3PC_CUPNH/160-315RSAT..MSMIPTKTGAAAAVGLVMPELDGRLD--------------------GFAVRVPTINVSLVDLSFVAAR--P.TT
G3P_ZYMMO/159-316RTAS..ASMIPTSTGAARAVALVIPELKGKLD--------------------GISIRVPTPDVSLVDFTFVPQR--D.TT
G3P_LACLA/157-315RAAA..ENIVPASSGAAKAIGLVLPELSGLMK--------------------GHAQRVSTPTGSITELVTVLEK--H.VT
G3P_HELPY/156-312RAAA..SNIIPTTTKAALALHKVLPNLKNKMH--------------------GHSVRVPSLDVSMIDLSLFLEK--K.AP
O25902_HELPY/154-310RAAG..LNLIPTSTGVSKAISLVLPHLGPKVT--------------------GLAIRVPTPNVSLVDLSLNFKK--S.VS
G3P_ARCFU/147-300LVNGIMPDPVAIPSHHGPDVKTVLPD..VDIV--------------------TTAFKLPTTLMHVHSLCVEMRE--A.VK
G3P_METTH/145-299PINAIVPNPPTVPSHHGPDLKTVMK..GVNIH--------------------TVALLVPTTLMHQHNIMVELED--P.VE
G3P_METJA/149-305PVNAITPNPVTVPSHHGPDVVSVVPEFEGKIL--------------------TSAVIVPTTLMHMHTLMVEVDG--D.VS
A4I5X6_LEIIN/172-334RAAA..MNIIPSTTGAAKAVGMVIPSTKGKLT--------------------GMSFRVPTPDVSVVDLTFRATR--D.TS
A8BSP4_GIAIC/157-314RSCG..ANVIPSSTGAAKAVGKVLPALNGKLT--------------------GMAFRVPVPDVSVVDLTCTLEK--D.AT
A8JHS0_CHLRE/136-293RAVN..GNIIPSSTGAAKAVGKVLPELKGKLT--------------------GMAFRVPTNDVSVVDLTVTLEK--A.TT
D5AV33_RHOCB/158-314RSAL..MNLIPTTTGSATAITLIYPELKGRLN--------------------GHAVRVPLLNASLTDCVFELDR--P.TT
E2RU88_GIAIC/193-353RACL..SNIIPASTGAASALTLVIPELAGRIT--------------------GTSWRVPVQDVSVVDLVVETEK--D.TS
E3GXP7_METFV/145-298PINAIIPNPPKLPSHHGPDVKTVLD...INID--------------------TMAVIVPTTLMHQHNVMVEVEE--T.PT
F3Z6S4_9ACTO/294-451RSAP..LNMVLTETGAASAVAKALPDLEAKIS--------------------GSSIRVPVPDVSIAILNLRLSR--G.TS
G7XDD5_ASPKW/156-313RTAA..QNIIPSSTGAAKAVGKVIPTLNGKLT--------------------GMAMRVPTSNVSVVDLTCRLEK--A.TS
G9NDK9_HYPVG/155-312RAAA..QNLIPSSTGAAKAVGKVIPELAGKVT--------------------GMSVRVPTVNVSLVDFTVRFAK--D.VT
K5WMK0_AGABU/133-294RSVT..NNIIPASTGAAKAVTKAIPELEGKLT--------------------GLAFRVPTLDVSVVDLVVRLEK--E.TS
K5XPB7_AGABU/155-312RGVG..NNIIPSSTGAAKAVGKVIPSLNGKLT--------------------GLSMRVPTQDVSVVDLVVRLEK--P.AS
E4PD_ECOLI/160-316RAAS..QSIIPVDTKLAAGITRFFPQFNDRFE--------------------AIAVRVPTINVTAIDLSVTVKK--P.VK
G3P_STRP1/157-314RAGA..ANIVPNSTGAAKAIGLVIPELNGKLD--------------------GAAQRVPVPTGSVTELVVTLDK--N.VS
G3P2_NOSS1/159-315RAAA..INIVPTSTGAAKAVALVIPELKGKLN--------------------GVALRVPTPNVSMVDFVVQVEK--R.TI
G3P3_NOSS1/158-315RATS..LSLIPTTTGSATAIALIYPELKGKLN--------------------GIAVRVPLLNASLTDCVFEVTR--P.TT
G3P_PYRFU/146-296PINA.IKPSVTIPSHHGPDVQTVIP...INIE--------------------TSAFVVPTTIMHVHSIMVELKK--P.LT
G3P1_NOSS1/160-317RGAA..QNIIPSSTGAAKAVALVLPELKGKLT--------------------GMAFRVPTPDVSVVDLTFKTAK--A.TS
Q1GB27_LACDA/161-318RAAA..ENIIPHSTGAAKAIGLVLPELNGKLD--------------------GHAQRVPVKDGSETELVTILDK--K.VT
Q2G032_STAA8/156-314RAAA..ENIIPNSTGAAKAIGKVIPEIDGKLD--------------------GGAQRVPVATGSLTELTVVLEK--QDVT
Q3IX57_RHOS4/156-312RAAA..LSMIPTSTGAAKAVGLVLPELKGRLD--------------------GVSIRVPTPNVSVVDLVFEAAR--D.TT
Q5SMF8_THET8/154-309RAAA..LNIIPTTTGAAKATALVLPSLKGRFD--------------------GMALRVPTPTGSISDITALLKR--E.VT
Q5UZX2_HALMA/160-315RAAA..ENIIPTSTGAAQAATEVLPELEGKLD--------------------GMAIRVPVPNGSITEFVVDLDD--D.VT
Q8IKK7_PLAF7/158-317RCAL..SNIIPASTGAAKAVGKVLPELNGKLT--------------------GVAFRVPIGTVSVVDLVCRLQK--P.AK
R4K768_CLOPA/155-312RAAA..VSIIPNSTGAAKAIAQVIPELKGKLD--------------------GNAQRVPVPTGSVTELVSVLKK--N.TT
U6HHB1_ECHMU/156-314RTAA..QNIIPASTGAAKAVGKVIPELNGKLT--------------------GMAFRVPTPNVSVVDLTCKLSK--P.AT
V4IQQ6_9ACTO/158-313RAAG..VNIVPTTTGAAKAIGLVLPNLDGKLS--------------------GDSIRVPVPVGSIVELNTTVTR--D.VT

PF02774

E8VGZ3_BACST/158-316ADDLHDLYSEFYQD..........SYFVRVRP...KGQYPQTKEVYG...SNFCDIA.VTLDERTNR...VTIVSVIDNL
A3YN03_CAMJU/143-324EIDVKKAKEILKKA.........PSVIVIDDPK..NKKYPMPLMTSD...TNETYVGRIRADVYDKK..ILHLWCVADQI
DHAS_ARCFU/157-324EVSVEEAKAAFESLKPLD.LPTSPEKVIIVRE...EPDRPQPRLDRDAGNGMSITVGRIRKDGERG....LKYIVLGHNT
K4NFU4_HELPY/140-329EFDLKEVYEVLKNA.........PSVAVCDDPS..HNLYPTPLKASHT...DSVFIGRLRKDLFDKK..TLHGFCVADQL
USG_AZOVI/140-318AIDPSAVRAALERA.........PGLELIEPD.....DCPTVIGDAVG..QDVAYVGRVRTGVDDAC..ELDLWIASDNV
A0A017J6B0_ECOLX/163-311QAQVAQVLQQAYAH..........KPLVRLYD....KGVPALKNVVG...LPFCDIG.FAVQG..EH...LIIVATEDNL
L0D445_BACIU/139-327DATVEDIKNLLKEA.........PGVTLQDDPS..QQLYPMPADAVGK...NDVFVGRIRKDLDRAN..GFHLWVVSDNL
M7CDQ8_LACPN/155-312TTQVRAAFTATYHE..........QPFVQVLP....TGMPTLKDVVG...SNNCALG.VDYNPVTNT...IVVVSVIDNL
DHAS_SHESP/141-320PAEAEDVKAVLRDA.........PGIELFESN....EEYPTAVTESAG..TDPVYVGRVRKDISHSH..GINLWVVSDNI
C9MJR3_HAEIF/145-356DLPLEEIEQIIASH........NEWVKVIPNDKEITLRELTPAKVTG...TLSVPVGRLRKLAMGPE..YLAAFTVGDQL
F7UTQ8_SYNYG/163-322RDDLITIYSAFYRA..........SPFVKILP...HGVYPQTKWAW...GTNLCYIG.IEVDPRTGR...VIVLSAIDNL
DHAS_METTH/156-330IDDVREAMDKFRGLPQKLGLHSAPEKPVVVRD...EENRPQPRMDRDMDGGMAVTVGRLREDAAFKN..SLRYVLVGHNT
ARGC_METTH/153-305QGEIADIFMGFYDG..........EPFVRVV.....EGIPGLSAVR...GSNFCQIGCFEVDD.NQR...AVIVSAIDNL
A0A038FER3_MYCTX/167-323..QLRAAYEKAYHA..........EPFIYLMP...EGQLPRTGAVI...GSNAAHIA.VAVDEDAQT...FVAIAAIDNL
Q99103_USTMD/166-346VDEVKKCLQGFTTEAQTIGVHSAPKQAITVHE...EQDRPQPRLDRDWQNGAGVNVGRVRECPVFD....IKFVVLSNNV
DHAS_MYCSM/140-329PISVERTKELLSAA.........AGVKLVDV........PTPLAAAGI...DDCLVGRIRQDPGVPDGRGLALFVSGDNL
DHAS_SCHPO/160-338PDQVREVLANYVSEPQKLGCYSAPKQAIYVFDD.STPDRPQPRLDRNNENGYAVSVGRIRSDSIFD....IKFVSLVHNT
A0A023ZB84_YEASX/165-346VEQVKTCLKEYVCDAYKLGCHSAPKQTIHVLE...QPDRPQPRLDRNRDSGYGVSVGRIREDPLLD....FKMVVLSHNT
DHAS_AZOVI/143-352DVPIADIEGLISQH........NPWVKLVPNHREASMQELSPAAITG...TLTVPVGRLRKLNMGSQ..YLGAFTVGDQL
A0A022SYW0_LEPIR/157-329REEIISSWKDFSGEPQTLGLPLAPNPVILFRE...EEDRPQPRLDLDTGKGMTTVIGRLRPDPILD....WKYVVLSHNT
DHAS_LEGPN/141-322PLTADDARALLAKA.........PGVTVVDNLS..KASYPTAIKNAVG..HDDVFVGRIRQDISHPC..GLNLWIVADNI
G6WZT3_CORGT/140-329AITVEQAQEILGAA.........SGVELVDV........PTPLAAAGI...DESLVGRIRQDSTVDDNRGLVLVVSGDNL
A0A016XEH1_VIBCL/141-319PIDAEQVMDMLEQT.........DGIELFRG.....ADFPTQVRDAGG..KDHVLVGRVRNDISHHS..GINLWVVADNV
DHAS_METJA/166-336PEEIKEVMDKFDPLKDL..NLPTYAKPIVIRE...EIDRPQPRLDRNEGNGMSIVVGRIRKDPIFD....VKYTALEHNT
ARGC_METJA/158-312REEIIKIYEKFYGS..........EVFVRIFS....EEIPKLTWVR...GTNFCDIGGFEIDE.HGR...LVVISAIDNL
G2EQW4_CORGT/160-318AEQARAVYEEFYAQ..........ETFVHVLP...EGAQPQTQAVLG...SNMCHVQ.VEIDEEAGK...VLVTSAIDNL
A0A017ID96_ECOLX/141-318PLAAEEARDAFVQG.........EDIVLSEEN.....EFPTQVGDASG..TPHLSVGCVRNDYGMPE..QVQFWSVADNV
A0A024SXL8_PSEAI/144-354DVPLTDIEGLISQH........NPWVKLVPNHREVSVRELTPAAVTG...TLSVPVGRLRKLNMGSQ..YLGAFTVGDQL
DHAS_STRAK/132-319PISADGATELLKDA.........PGVELSDI........PTPLQAAGK...DPSYVGRIRSDETVDN..GLALFVSNDNL
I6TY00_STRMG/137-328VAPIEEVKAAIAAF.........PGAVLEDDIK..HQIYPQAANAVG...SRETFVGRIRKDLDIEN..GIHMWVVSDNL
A0A017I2M7_ECOLX/144-353DVSIPTVEELLAAH........NPWAKVVPNDREITMRELTPAAVTG...TLTTPVGRLRKLNMGPE..FLSAFTVGDQL
A0A058UU82_BORPT/145-359DVPLDEIEDLIAAG........TQWAKVVPNTKEDTVKALTPVAVTG...TLDIPVGRLRKLSMGLQ..YLGAFTVGDQL

PF02800

G3P1_BACSU/157-313AEEVNAALKEAAE.......GDLKGILGYSEEPLVSGDYNGNKN..SS--TIDALSTMVME....GSMVKVISWY-----
G3P_THEMA/157-313VEEVNAVMKEATE.......GRLKGIIGYNDEPIVSSDIIGTTF..SG--IFDATITNVIG....GKLVKVASWY-----
G3P2_SYNY3/159-315AEQVNGVLKEAAN.......TSLKGVLEYTDLELVSSDFRGTDC..SS--TVDGSLTMVMG....GDMVKVIAWY-----
G3P_PSEAE/159-312VDEVNRLLREAS.........EGSPVLGYNTQPLVSVDFNHDPR..SS--IFDANHTKVS.....GRLVKAMAWY-----
G3P3_ECOLI/155-313AEEVNNALKQAT.........TNNESFGYTDEEIVSSDIIGSHF..GS--VFDATQTEITAV.GDLQLVKTVAWY-----
G3P_CHLTR/155-312YEAICEAVKHAAN.......TSMKNIMYYTEEAVVSSDFIGCEY..SS--VFDAQAGVALN....DRFFKLVAWY-----
E4PD_VIBCH/164-320VNDVNQTIVNASQ.......CTLRGIVDYTEAPLVSIDFNHDPH..SA--IVDGTQTRVSN....GQLVKMLVWC-----
G3P1_CAEEL/163-320MDDIKKVVKAAAD.......GPMKGILAYTEDQVVSTDFVSDPH..SS--IFDAGACISLN....PNFVKLVSWY-----
G3P1_SCHPO/157-314YEDIKAAIKAASE.......GPMKGVLGYTEDAVVSTDFCGDNH..SS--IFDASAGIQLS....PQFVKLVSWY-----
G3P_TREPA/167-329VADLNAMLKKASE.......SYLRGVLQYCDEDIVSADVIHNQY..SS--IYDSRATLQNNLPNEKRFFKVVSWY-----
G3P_STRCO/158-315KDEVNAAFKKAAD......DGDLKGILFYTEDAIVSSDITGDPA..SC--TFDSSLTMVQE...G.KSVKILGWY-----
G3P_CORGL/158-313VESINAAIKEAAV.......GEFGETLAYSEEPLVSTDIVHDSH..GS--IFDAGLTKVS....G.NTVKVVSWY-----
G3P_MYCLE/163-318VNEINAVFQDAAE.......GRLKGILKYVDAPIVSSDIVTDPH..SS--IFDSGLTKVI....A.SQAKVVSWY-----
G3P_AQUAE/157-320VEEVNEKFREAAQKYRESGKVYLKEILQYCEDPIVSTDIVGNPH..SA--IFDAPLTQVID.....NLVHIAAWY-----
G3P_BORBU/158-316KEEINSVLRKASE......TPELKGILGYTEDPIVSSDIKGNSH..SS--IVDGLETMVLENGFA....KILSWY-----
G3PA1_ARATH/218-374AEEVNAAFRDSAE.......KELKGILDVCDEPLVSVDFRCSDF..ST--TIDSSLTMVMG....DDMVKVIAWY-----
G3P2_BACSU/157-313AEEVNEAFKRAAK.......TSMYGVLDYSDEPLVSTDYNTNPH..SA--VIDGLTTMVME....DRKVKVLAWY-----
G3PC_CUPNH/160-315VEEVNGILKAAAE......GELK.GILDYNTAPLVSVDFNHNPA..SS--TFDATLTKVN.....GTLVKVSAWY-----
G3P_ZYMMO/159-316AEEINSVLKAAAD......TGDMTGVLGYTDEPLVSRDFYSDPH..SS--TVDSRETAVLE....GKLARVVAWY-----
G3P_LACLA/157-315VDEINEAMKAAA...........DESFGYNVDEIVSSDIIGMAY..GS--LFDATLTEVTDLKDGGQLVKTAAWY-----
G3P_HELPY/156-312KDPINDLLIEASK.......GVLKGVLEIDLKERVSSDFISNPH..SV--IIAPDLTFTL.....ENMVKIMGWY-----
O25902_HELPY/154-310KASVQHALKDACK.......HAFKGVVSIDEERLVSSDFISSPF..SA--IVIDDQIMTIG....EKNAKVLAWY-----
G3P_ARCFU/147-300AEDVVSALSEEPRIM...LISAEDGFTSTAKVIEFARELRLRYD.LYE--NIVWRESIGVD....GNDLFVTQAV-----
G3P_METTH/145-299ADEIKARLDETTRVM...LVRASEGLASTAEIMEYAKELGRSRNDLFE--IPVWEESINVV....DGELFYMQAV-----
G3P_METJA/149-305RDDILEAIKKTPRII...TVRAEDGFSSTAKIIEYGRDLGRLRYDINE--LVVWEESINVL....ENEIFLMQAV-----
A4I5X6_LEIIN/172-334IQEIDKAIKKAAQ.......TYMKGILGFTDDELVSSDFINDNR..SS--VYDSKATLQNNLPGERRFFKIVSWY-----
A8BSP4_GIAIC/157-314YDEICAEIKRASE.......NELKGIMTYTNEDVVSSDFLSTTS..TC--NFDSKAGIMLN....SRFVKLVAWY-----
A8JHS0_CHLRE/136-293YEDIMKALKEASE.......GEMKGVLAYTDEDVVSSDFVTDPA..SC--TVDAKAGIMLS....PTFVKLVAWY-----
D5AV33_RHOCB/158-314VAEVNSLLQTAAE.......GGLNGILGFETRPLVSSDFTNDPR..SA--VIDGPSTMVVN....GTQLKLYAWY-----
E2RU88_GIAIC/193-353YAEICAAVKRACET.....PDELCGIMAYRDDFCVSSDFLTTTT..IS--NFDSKSGIELH....SRFFKLVSWY-----
E3GXP7_METFV/145-298VDDIIDVFEDTPRVI...LISAEDGLTSTAEIMEYAKELGRSRNDLFE--IPVWRESITVV....DNEIYYMQAV-----
F3Z6S4_9ACTO/294-451REEVLTHLREVSLT.....SPLRRQIDFTTSADAVSSDFVGSRH..AS--IVDAGATKVDG....D.NAILYLWY-----
G7XDD5_ASPKW/156-313YDEIKKAIKDASE.......NELKGILGYTEDDIVSSDLNGDDH..SS--IFDAKAGIALN....SNFVKLVSWY-----
G9NDK9_HYPVG/155-312YDEVKAAIKEASE.......GPLKGILAYTEDDIVSTDILTDPH..SS--TFDAKAGIALN....KNFVKVMSWY-----
K5WMK0_AGABU/133-294YDDVKKAMKDAADGK...HPGIEKGIVDYTEEDVVSTDFVGSNY..SM--IFDAKAGIALN....SRFMKLVAWY-----
K5XPB7_AGABU/155-312YEQIKEVMRKAAE.......GEYKGIIAYTDEDVVSTDFISDNN..SC--VFDAKAGIQLS....PNFVKLIAWY-----
E4PD_ECOLI/160-316ANEVNLLLQKAAQ.......GAFHGIVDYTELPLVSVDFNHDPH..SA--IVDGTQTRVSG....AHLIKTLVWC-----
G3P_STRP1/157-314VDEINAAMKAAS...........NDSFGYTEDPIVSSDIVGVSY..GS--LFDATQTKVMEV.DGSQLVKVVSWY-----
G3P2_NOSS1/159-315TEEVNQALKDASE.......GPLKGILDYSELQLVSSDYQGTDA..SS--IVDANLTLVMG....NDLVKVMAWY-----
G3P3_NOSS1/158-315VEEINALLKAASE......QAPLQGILGYEERPLVSIDYKDDPR..SS--IIDALSTMVVD....ETQVKILAWY-----
G3P_PYRFU/146-296REDVIDIFENTTRVL...LFEKEKGFESTAQLIEFARDLHREWNNLYE--IAVWKESINVK....GNRLFYIQAV-----
G3P1_NOSS1/160-317YKEICAAMKQASE.......GSLAGILGYTDEEVVSTDFQGDTH..SS--IFDAGAGIELN....SNFFKVVAWY-----
Q1GB27_LACDA/161-318AEEVNAAMKKYE...........SPSFAYNADQIVSTDVLGMTA..GS--IFDPTQTQVITA.GDKQLVKTVAWY-----
Q2G032_STAA8/156-314VEQVNEAMKNAS...........NESFGYTEDEIVSSDVVGMTY..GS--LFDATQTRVMSV.GDRQLVKVAAWY-----
Q3IX57_RHOS4/156-312VEEVNAAIEAAAC.......GPLKGVLGFTTEPNVSSDFNHDPH..SS--VFHMDQTKVME....GRMVRILSWY-----
Q5SMF8_THET8/154-309AEEVNAALKAAAE.......GPLKGILAYTEDEIVLRDIVMDPH..SS--IVDGKLTKAIG.....NLVKVFAWY-----
Q5UZX2_HALMA/160-315ESDVNAAFEEAAA.......GDLEGVLGVTSDDVVSSDILGDPY..ST--QVDLQSTNVVS.....GMTKILTWY-----
Q8IKK7_PLAF7/158-317YEEVALEIKKAAE.......GPLKGILGYTEDEVVSQDFVHDNR..SS--IFDMKAGLALN....DNFFKLVSWY-----
R4K768_CLOPA/155-312VEEINAAMKAAA...........DESFGYTEDEIVSADVVGISY..GS--LFDATLTKIVDV.NGSQLVKTVSWY-----
U6HHB1_ECHMU/156-314YDQIKAAVKAASE......SSALKGILEYTEDQVVSTDFLSTTC..SS--TFDARAGIALN....DTFVKLIAWY-----
V4IQQ6_9ACTO/158-313RDDVLAAYRKAAD.......GPLAGVLEYSEDPLVSSDITGNPA..SS--IFDSALTRVDG.....RHVKVVAWY-----

PF02774

E8VGZ3_BACST/158-316MK
A3YN03_CAMJU/143-324RV
DHAS_ARCFU/157-324VR
K4NFU4_HELPY/140-329RV
USG_AZOVI/140-318RK
A0A017J6B0_ECOLX/163-311LK
L0D445_BACIU/139-327LK
M7CDQ8_LACPN/155-312MK
DHAS_SHESP/141-320RK
C9MJR3_HAEIF/145-356LW
F7UTQ8_SYNYG/163-322VK
DHAS_METTH/156-330VR
ARGC_METTH/153-305VK
A0A038FER3_MYCTX/167-323VK
Q99103_USTMD/166-346MI
DHAS_MYCSM/140-329RK
DHAS_SCHPO/160-338VL
A0A023ZB84_YEASX/165-346II
DHAS_AZOVI/143-352LW
A0A022SYW0_LEPIR/157-329IR
DHAS_LEGPN/141-322RK
G6WZT3_CORGT/140-329RK
A0A016XEH1_VIBCL/141-319RK
DHAS_METJA/166-336IR
ARGC_METJA/158-312VK
G2EQW4_CORGT/160-318TK
A0A017ID96_ECOLX/141-318RF
A0A024SXL8_PSEAI/144-354LW
DHAS_STRAK/132-319RK
I6TY00_STRMG/137-328LK
A0A017I2M7_ECOLX/144-353LW
A0A058UU82_BORPT/145-359LW

PF02800

G3P1_BACSU/157-313--
G3P_THEMA/157-313--
G3P2_SYNY3/159-315--
G3P_PSEAE/159-312--
G3P3_ECOLI/155-313--
G3P_CHLTR/155-312--
E4PD_VIBCH/164-320--
G3P1_CAEEL/163-320--
G3P1_SCHPO/157-314--
G3P_TREPA/167-329--
G3P_STRCO/158-315--
G3P_CORGL/158-313--
G3P_MYCLE/163-318--
G3P_AQUAE/157-320--
G3P_BORBU/158-316--
G3PA1_ARATH/218-374--
G3P2_BACSU/157-313--
G3PC_CUPNH/160-315--
G3P_ZYMMO/159-316--
G3P_LACLA/157-315--
G3P_HELPY/156-312--
O25902_HELPY/154-310--
G3P_ARCFU/147-300--
G3P_METTH/145-299--
G3P_METJA/149-305--
A4I5X6_LEIIN/172-334--
A8BSP4_GIAIC/157-314--
A8JHS0_CHLRE/136-293--
D5AV33_RHOCB/158-314--
E2RU88_GIAIC/193-353--
E3GXP7_METFV/145-298--
F3Z6S4_9ACTO/294-451--
G7XDD5_ASPKW/156-313--
G9NDK9_HYPVG/155-312--
K5WMK0_AGABU/133-294--
K5XPB7_AGABU/155-312--
E4PD_ECOLI/160-316--
G3P_STRP1/157-314--
G3P2_NOSS1/159-315--
G3P3_NOSS1/158-315--
G3P_PYRFU/146-296--
G3P1_NOSS1/160-317--
Q1GB27_LACDA/161-318--
Q2G032_STAA8/156-314--
Q3IX57_RHOS4/156-312--
Q5SMF8_THET8/154-309--
Q5UZX2_HALMA/160-315--
Q8IKK7_PLAF7/158-317--
R4K768_CLOPA/155-312--
U6HHB1_ECHMU/156-314--
V4IQQ6_9ACTO/158-313--

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window