Sequence alignment for CL0139

PF02800

G3P1_ANAVT/160-317LAPIAKVIN.DNFGL-TEGLMTTVHAMTATQPT--------------------------------------------VDG
E4PD_SHIFL/160-316IIPVIKLLD.DAYGI-ESGTVTTIHSAMHDQQV--------------------------------------------IDA
G3P1_TRIKO/155-312LAPLAKTLN.DKFTI-VEGLMTAIHAYTASQKT--------------------------------------------VDG
G3PG_LEIME/172-334LAPIVHVLTKENFGI-ETGLMTTIHSYTATQKT--------------------------------------------VDG
G3P1_BACSU/157-313LAPFAKVLN.DKFGI-KRGMMTTVHSYTNDQQI--------------------------------------------LDL
G3P_BACCO/157-314LAAFARVLH.QIFGE-VSRMMTTAHSYTNIQRI--------------------------------------------LDA
G3P_THEMA/157-313IAPIVKVLH.EKFGI-VSGMLTTVHSYTNDQRV--------------------------------------------LDL
G3P2_SYNY3/159-315LAPFGKVIN.DNFGI-IKGTMTTTHSYTGDQRI--------------------------------------------LD.
G3P_STREQ/157-314LAPMAKALH.DAFGI-QKGLMTTIHAYTGDQMI--------------------------------------------VD.
G3P3_ANAVT/158-315LAPVVKVIH.EGLGI-KHGIITTIHDNTNTQTL--------------------------------------------VDA
G3P2_ANAVT/159-315LAPIAKVLN.DKFGI-IKGSMTTTHSYTGDQRL--------------------------------------------LD.
G3P_MONPU/157-314LAPLAKVIN.DKFGI-VEGLMTTVHSYTATQKV--------------------------------------------VDG
G3P_PSEAE/159-312LAPVAQVLH.RELGI-EHGLMTTIHAYTNDQNL--------------------------------------------SD.
G3P3_ECOLI/155-313LAPMAKALH.DSFGI-EVGTMTTIHAYTGTQSL--------------------------------------------VDG
G3P_CHLTR/155-312LAPLAKVLL.DNFGI-EEGLMTTVHAATATQSV--------------------------------------------VDG
E4PD_VIBCH/164-320IVPIIKVLD.DAFGI-DSGTITTIHSSMNDQQV--------------------------------------------IDA
O68075_RHOCA/158-314LAPIVKVIH.EALGI-KHGSITTLHDVTNTQTI--------------------------------------------VDR
G3P1_AGABI/155-316LAVLAKVIN.DKFGI-VEGLMTTVHATTATQKT--------------------------------------------VDA
G3P1_CAEEL/163-320LAPLAKVIN.DNFGI-IEGLMTTVHAVTATQKT--------------------------------------------VDG
G3P_HOMAM/153-310LAPVAKVLH.ENFEI-VEGLMTTVHAVTATQKT--------------------------------------------VDG
G3P_ECHMU/156-314LAPLAKVIN.DNFGI-VEGLMTTVHSYTATQKV--------------------------------------------VDG
G3P_ONCMY/157-314LAPLAKVIH.DNFGI-EEALMTTVHAYTATQKT--------------------------------------------VDG
G3P1_SCHPO/157-314LAPLAKVIN.DTFGI-EEGLMTTVHATTATQKT--------------------------------------------VDG
G3PC_CHOCR/157-314LAPLVKVIH.EKYGI-EEGLMTTVHATTATQKT--------------------------------------------VDG
G3P2_AGABI/155-312LATLAKVIH.DNFGI-VEGLMTTVHATTATQKT--------------------------------------------VDG
G3P_LYOSH/155-312LAPLTKVIH.DKYGI-IEGLMSTIHATTATQKT--------------------------------------------VDG
G3P_PHARH/156-314LAPLGKVIH.DNYTI-VEGLMTTVHATTATQKT--------------------------------------------VDG
G3P_PHACH/156-313LAPLAKVIH.DKFGI-VQGLMTSVHATTATQKT--------------------------------------------VDG
O65843_MARQU/184-341LAPLAKVVD.QEFGI-VEGLMTTVHATTATQKT--------------------------------------------VDG
O04839_GUITH/158-316LAPLAKVVE.RNFGI-VEGLMSTVHATTATQKT--------------------------------------------VDG
G3PC_CHLRE/159-316LAPLAKVVN.SKFGI-KEGLMTTVHATTATQKT--------------------------------------------VDG
G3P_BUCAP/155-312LAPLSKVID.DHFGI-IEGLMTTVHASTATQKI--------------------------------------------VDS
O96367_LINPO/161-320LAPLTKVVH.EKFGL-LEGLMTTVHAMTATQLT--------------------------------------------VDG
O96369_PLAFA/158-317LAPLAKVIN.DRFGI-VEGLMTTVHASTANQLV--------------------------------------------VDG
G3P1_GIAIN/157-314LAPLAMVVN.KKFGI-KEGLMTTVHAVTATQLP--------------------------------------------VDG
G3PA_GUITH/203-360LAPLVKCIN.DKWGI-EEGLMTTIHAMTATQAV--------------------------------------------VDS
Q26753_TRYBO/173-335LAPIVHVLNKEGFGI-KVGLITTLHAYTATQKT--------------------------------------------VDG
G3P_TREPA/167-329LAPVVHVFLKEGVGI-ETGLMTTIHSYTATQKT--------------------------------------------VDG
G3P_STRCO/158-315VAPMAKVLD.ENFGI-VKGLMTTVHAYTNDQRI--------------------------------------------LD.
G3P_CORGL/158-313LAPMAKVLN.DKFGI-ENGLMTTVHAYTGDQRL--------------------------------------------HD.
G3P_MYCLE/163-318LAPLAKVLH.DQFGI-VKGLMTTVHAYTQDQNL--------------------------------------------QD.
G3P_STRAE/158-312LGVLAKVLH.DAVGI-DSGMMTTVHAYTQDQNL--------------------------------------------QD.
G3P_AQUAE/157-320LAPCVKVLN.EAFGV-EKGYMVTVHAYTNDQRL--------------------------------------------LD.
G3P_THEAQ/154-309LAPVMKVLE.EAFGV-EKALMTTVHSYTNDQRL--------------------------------------------LD.
G3P_STRAU/157-312LAPLAKVLD.DLAGI-EHGFMTTVHAYTQEQNL--------------------------------------------QD.
G3P_BORBU/158-316LAPLAKVLH.ESFGI-EQGLMTTVHAYTNDQRI--------------------------------------------LD.
G3PA_ARATH/218-374LAPFVKVLD.QKFGI-IKGTMTTTHSYTGDQRL--------------------------------------------LDA
G3PA_CHOCR/236-392MAPFMKVLD.DEFGV-VRGMMTTTHSYTGDQRL--------------------------------------------LDA
Q37322_EUGGR/283-439MAGVCKVLD.ENFTV-QYGTMTTTHSYTGDQMI--------------------------------------------LDG
G3P2_BACSU/157-313LAPVVKVLD.EEFGI-ESGLMTTVHAYTNDQKN--------------------------------------------IDN
G3P2_RHOSH/156-312LSPVAKVLH.DAIGI-AKGFMTTIHSYTGDQPT--------------------------------------------LD.
G3P_XANFL/158-314LAPVAKVLN.DAVGI-EKGFMTTIHAYTGDQPT--------------------------------------------LD.
G3PC_CUPNH/160-315LAPLVKPLH.EKLGL-VNGLMTTVHSYTNDQVL--------------------------------------------TD.
G3P_ZYMMO/159-316LAPVLHVLQ.QKIGI-VRGLMTTVHSFTNDQRI--------------------------------------------LD.
O00813_TRIFO/176-338LAPVIKVLN.DTFGI-RNGYMTTVHAYTNDQVV--------------------------------------------SD.
G3P_LACDE/161-318LAPMANALN.KEFGI-QVGTMTTIHAYTATQKV--------------------------------------------LDG
G3P_CLOPA/155-312LAPMAKVLN.DKFGI-EKGFMTTIHAYTNDQNT--------------------------------------------LDG
G3P1_STAAW/156-314LAPVAKVLN.DDFGL-VEGLMTTIHAYTGDQNT--------------------------------------------QDA
G3P_LACLA/157-315LAPMADALN.KNFGV-KGGTMTTVHSYTGDQMT--------------------------------------------LDG
G3P_MYCGE/162-317LAPLVHVLE.KNFGI-VYGTMLTVHAYTADQRL--------------------------------------------QDA
G3P_HALVA/161-316ITPVAKVLD.EEFGI-NAGQLTTVHAYTGSQNL--------------------------------------------MDG
Q27661_GIAIN/193-353LAPLAKVIH.ENFGI-KQALMSTIHAVTATQPV--------------------------------------------TDS
G3P_HELPY/156-312IAPICAILD.KAFKI-KEGMLTTIHSYTSDQKL--------------------------------------------IDL
O25902_HELPY/154-310SAPLLKILD.EAFKV-ENALLTTIHSYTNDQNL--------------------------------------------LDT
O68923_9ACTO/274-431IVPPLKAMA.DEFGV-ESGHVETVHSFTNDQNL--------------------------------------------LDN
G3P_ARCFU/147-300LTRLIYMLK.TNFSI-GRIRATMLRRVVDP...--------------------------------------------...
G3P_PYRWO/146-296LVRTLNAIK.DYVDY-..VYAVMIRRAADP...--------------------------------------------...
G3P_METBR/146-300LCRTLNPIN.DLCGI-KKVRAVMVRRGADP...--------------------------------------------...
G3P_METTH/145-299LCRTLKPID.DLCGI-KKVRAVMVRRGADP...--------------------------------------------...
G3P_METFE/145-298LCRTLKPLH.DSFGI-KKVRAVIVRRGADP...--------------------------------------------...
G3P_METJA/149-305LCRILYAIN.SIADI-KKARIVLVRRAADP...--------------------------------------------...

PF02774

ARGC_BACSU/158-316LAPLAQK---KLLDE.SFVIVDAKTGVSGAGRK..........................................ASMGT
DHAS_CAMJE/143-324LKPLNDA---..FNL.KRVDVSTYQAASGAGKEGMQELVEAM.......................QSFFAFKLDEFEPQT
DHAS_ARCFU/157-324LKPLMD.---.LG.L.RTVRVASMQALSGAGY.............................................PGV
DHAS_HELPY/140-329LNPLHLH---..FKI.KSVIVSTYQAVSGAGNKGIESLKNELKTAL...............ECLEKDPTIDLNQVLQAGA
USG_AZOVI/140-318LAPLRP.---.LVRW.RHLGVTACLPVSSLGREGVAELARQ.........................TTELLNGRPPKPRF
ARGC_ECOLI/163-311LKPLIDA---DLLDLNQWPVINATSGVSGAGR............................................KAAI
DHAS_BACSU/139-327LEPIRKA---..YGL.NKVIVSTYQAVSGAGNEAVKELYSQTQAI..................LNKEEIEPEIMPVKGDK
ARGC2_LACPL/155-312LAPLAQQ---QLVEP.TSIVVDAKSGLSGAGKR..........................................ATAAS
DHAS_SHESP/141-320LKPIYDA---..FGI.SRINVATYQSVSGSGKEAIAELAGQ.........................CSKLLQGLPIEPKV
DHAS_HAEIN/145-356IGGLFE.---.KDLV.EWISVATYQAASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAKMRADNFPTDN
ARGC_SYNY3/163-322LSPLLKQ---GFIVP.ETAIIDAKSGTSGGGRE..........................................AKVNM
DHAS_METTH/156-330LKPIYDA---.YT.I.KRVYVSTMQAVSGAGY.............................................NGV
ARGC_METTH/153-305CLPLVYE---KIADT...FIIDSKTGVSGAGVK..........................................PTALT
ARGC_MYCTU/167-323LFPALAA---DLIEP.A.VTVVAVSGTSGAGRA..........................................ATTDL
Q99103_USTMD/166-346LKALEAK---.FGPL.EKILVNTMQAISGAGY.............................................PGV
DHAS_MYCSM/140-329LKPLHEE---..AGL.QRLIVSSYQAVSGSGIAGVEELAGQARPVID..............GVEQLVHDGSALQYPAPNK
DHAS_SCHPO/160-338LKALQDA---.FGPI.AQTNVVSMQAISGAGY.............................................PGV
DHAS_YEAST/165-346LKPLIEK---.FGPI.DALTTTTLQAISGAGFS............................................PGV
DHAS_AZOVI/143-352LGRLRGR---.PGRL.DERHDLSGRFR..AGAQNMRELIRQMGTINAAVAAEPADPASAILEIDRKGPETQRSAEFPVDH
DHAS_LEPIN/157-329LKPLLDR---.FG.I.ESVMLFSMQAISGAGY.............................................PGV
DHAS_LEGPN/141-322LKPIYDA---..VGI.SRINVATYQSVSGTGKKAISELVAQ.........................VGDLLNGRPANVQV
DHAS_CORFL/140-329LKPLHDA---..AGL.VKLHVSSYQAVSGSGLAGVETLAKQVAAVGD..............HNVEFVHDGQAADAGDVGP
DHAS2_VIBCH/141-319LKPIYDA---..VGI.ERINVTTYQSVSGAGKAGIDELAGQ.........................TAKLLNGYPAETNT
DHAS_METJA/166-336LKPIMDK---.FG.L.EAVFIATMQAVSGAGY.............................................NGV
ARGC_METJA/158-312VAPLVKE---NIIEE.R.IIFDSKTGVSGAGIK..........................................PTETT
ARGC_CORGL/160-318LLPAVQA---GLIEP.D.VSVVSITGVSGAGKK..........................................ASVAL
USG_ECOLI/141-318LKPLIDQ---..GGL.SRISVTSLISASAQGKKAVDALAGQS........................AKLLNGIPIDEEDF
DHAS_PSEAE/144-354LGGLFDA---..GLV.EWMSAMTYQAASGAGAQNMRELLKQMGAAHASVADDLANPASAILDIDRKVAETLRSEAFPTEH
DHAS_STRAK/132-319LRPLHDE---..AGL.EALVVATYQAVSGSGLAGVAELHGQTQKVVA..............DAEKLTHDGEAVDFPEPGV
DHAS_STRMU/137-328LEPIRQK---..WGL.SRVIVSTYQAVSGAGQSAINETVREIKEVVN..............DGVDPKAVHADILPSGGDK
DHAS_SHIFL/144-353LGGLFA.---.NDLV.DWVSVATYQAASGGGARHMRELLTQMGHLYGHVADELATPSSAILDIERKVTTLTRSGELPVDN
DHAS_BORPE/145-359LAGLFN.---.NDLV.EWMSSMTYQAASGGGAQHMRELLTQFGLLNQAVKPLLDDPAAAILDIDRGVLARQQDPSLPQEH

PF02800

G3P1_ANAVT/160-317PSK..KDWRGGRGAA..QNIIPSSTGAAKAVALVLPELK.GK--------LTGMAFRVPTPDVSVVDLTFKTAK--A.TS
E4PD_SHIFL/160-316Y...HPDLRRTRAAS..QSIIPVDTKLAAGITRFFPQFN.DR--------FEAIAVRVPTINVTAIDLSVTVKK--P.VK
G3P1_TRIKO/155-312PSS..KDWRGGRAAA..QNLIPSSTGAAKAVGKVIPELA.GK--------VTGMSVRVPTVNVSLVDFTVRFAK--D.VT
G3PG_LEIME/172-334VSL..KDWRGGRAAA..VNIIPSTTGAAKAVGMVIPSTK.GK--------LTGMSFRVPTPDVSVVDLTFRATR--D.TS
G3P1_BACSU/157-313P...HKDYRRARAAA..ENIIPTSTGAAKAVSLVLPELK.GK--------LNGGAMRVPTPNVSLVDLVAELNQ--E.VT
G3P_BACCO/157-314AT..HADLRGARAAA..ESIIDTTNGAAMAVALVLPELK.GK--------LNGMAMRVATANVSVVDLVYELAK--E.VT
G3P_THEMA/157-313P...HKDLRRARAAA..VNIIPTTTGAAKAVALVVPEVK.GK--------LDGMAIRVPTPDGSITDLTVLVEK--E.TT
G3P2_SYNY3/159-315AS..HRDLRRARAAA..VNIVPTSTGAAKAVALVIPELQ.GK--------LNGIALRVPTPNVSVVDLVVQVEK--N.TI
G3P_STREQ/157-314GHRGGGDLRRARAGA..ANIVPNSTGARKAIGLVIPELN.GK--------LDGAAQRVPVPTGSVTELVVTLDK--N.VS
G3P3_ANAVT/158-315P...HKDLRRARATS..LSLIPTTTGSATAIALIYPELK.GK--------LNGIAVRVPLLNASLTDCVFEVNR--P.TT
G3P2_ANAVT/159-315AS..HRDLRRARAAA..INIVPTSTGAAKAVALVIPELK.GK--------LNGVALRVPTPNVSMVDFVVQVEK--R.TI
G3P_MONPU/157-314PSN..KDWRGGRTAA..QNIIPSSTGAAKAVGKVIPSLN.GK--------LTGMSMRVPTSNVSVVDLTARLEK--A.AT
G3P_PSEAE/159-312VY..HPDLYRARSAT..QSMIPTKTGAAEAVGLVLPELA.GK--------LTGLAVRVPVINVSLVDLTVQVAR--D.TS
G3P3_ECOLI/155-313PRG..KDLRASRAAA..ENIIPHTTGAAKAIGLVIPELS.GK--------LKGHAQRVPVKTGSVTELVSILGK--K.VT
G3P_CHLTR/155-312PSR..KDWRGGRGAF..QNIIPASTGAAKAVGLCLPELK.GK--------LTGMAFRVPVADVSVVDLTVKLSS--A.TT
E4PD_VIBCH/164-320YHN...DLRRTRAAS..QSIIPVDTKLHKGIERIFPKFS.NK--------FEAISVRVPTVNVTAMDLSVTIKS--N.VK
O68075_RHOCA/158-314PA...KDLRRARSAL..MNLIPTTTGSATAITLIYPELK.GR--------LNGHAVRVPLLNASLTDCVFELDR--P.TT
G3P1_AGABI/155-316PAK..KDWRSGRSVT..NNIIPASTGAAKAVTKAIPDLE.GK--------LTGLAFRVPTLDVSVVDLVVRLEK--E.TS
G3P1_CAEEL/163-320PSG..KLWRDGRGAG..QNIIPASTGAAKAVGKVIPELN.GK--------LTGMAFRVPTPDVSVVDLTVRLEK--P.AS
G3P_HOMAM/153-310PSA..KDWRGGRGAA..QNIIPSSTGAAKAVGKVIPELD.GK--------LTGMAFRVPTPDVSVVDLTVRLGK--E.CS
G3P_ECHMU/156-314PSK..KAWRDGRTAA..QNIVPASTGAAKRVGKVIPELN.GK--------LTGMAFRVPTPNVSVVDLTCKLSK--P.AT
G3P_ONCMY/157-314PSA..KAWRDGRGAH..QNIIPASTGAAKAVGKVIPELN.GK--------LTGMAFRVPVADVSVVELTCRLSR--P.GS
G3P1_SCHPO/157-314PSK..KDWRGGRGAS..ANIIPSSTGAAKAVGKVIPALN.GK--------LTGMAFRVPTPDVSVVDLTVKLAK--P.TN
G3PC_CHOCR/157-314PSN..KDWRGGRGRG..RNIIPSSTGAAKAVGKVMPELN.GK--------LTGMAFRVPTPDVSVVDLTVRLAS--E.TT
G3P2_AGABI/155-312PSH..KDWRGGRGVG..NNIIPSSTGAAKAVGKVIPSLN.GK--------LTGLSMRVPTQDVSVVDLVVRLEK--P.AS
G3P_LYOSH/155-312PSN..KDWRGGRAVV..NNIIPSSTGAAKAVGKVIPSLN.GK--------LTGLSFRVPTIDVSVIDLVVRLEK--P.AS
G3P_PHARH/156-314PSN..KDWRGGRGAG..ANIIPSSTGAAKAVGKVIPSLN.GK--------LTGMAFRVPTPDVSVVDLVVRIEK--G.AS
G3P_PHACH/156-313PSN..KDWLGGRSVG..NNIIPSSTGAAKAVGKVIPSLN.GK--------LNGLAFRVPTVDVSVVDLVVRLEK--P.AS
O65843_MARQU/184-341PSG..KDWRGGRGAA..QNIIPSSTGAAKAVGKVLPQLN.GK--------LTGMAFRVPTPNVSVVDLTCRLEK--G.AS
O04839_GUITH/158-316PSG..KDWRGGRGAA..QNIIPSATGAAKAVGKVLPELN.GK--------LTGMAFRVPTPDVSVVDLTVKLAK--P.AS
G3PC_CHLRE/159-316PSK..KDWRGGRAVN..GNIIPSSTGAAKAVGKVLPELK.GK--------LTGMAFRVPTNDVSVVDLTVTLEK--A.TT
G3P_BUCAP/155-312ASK..KDWRGGRGAL..QNIIPSSTGAAVAVGKVLPNLN.GK--------LTGIAFRVPTANVSVVDLTVRYKK--T.AT
O96367_LINPO/161-320PSV..AARTGVVAAAHPQNIIPSSTGAAKAVGKVIPAVN.GK--------LTGMAFRVPTPDVSVVDLTCRIEK--A.AK
O96369_PLAFA/158-317PSKGGKDWRAGRCAL..SNIIPASTGAAKAVGKVLPELN.GK--------LTGVAFRVPIGTVSVVDLVCRLQK--P.AK
G3P1_GIAIN/157-314PSK..KDWRGGRSCG..ANVIPSSTGAAKAVGKVLPALN.GK--------LTGMAFRVPVPDVSVVDLTCTLEK--D.AT
G3PA_GUITH/203-360SSR..KDWRGGRAAS..GNIIPSSTGAAKAVAKVIPAVK.GK--------LTGMAFRVPTIDVSVVDLTCRLAK--D.AT
Q26753_TRYBO/173-335VSQ..KDWRGGRAAS..VNIIPSSTGAAKAVGEVLPETK.GK--------LTGMAFRVPTPDVSVVDLTFTTTK--D.TS
G3P_TREPA/167-329VSL..KDWRGGRAAA..VNIIPSTTGAAKAVGEVLPSTR.GK--------LTGMAFRVPTPTGSVVDLTFRTEK--E.TS
G3P_STRCO/158-315FP..HKDLRRARAAA..ENIIPTTTGAAKATALVLPQLK.GK--------LDGIAMRVPVPTGSATDLVVELQR--E.VT
G3P_CORGL/158-313AP..HRDLRRARAAA..VNIVPTSTGAAKAVALVLPELK.GK--------LDGYALRVPVITGSATDLTFNTKS--E.VT
G3P_MYCLE/163-318GP..HSDLRRARAAA..LNVVPTSTGAAKAIGLVMPELK.GK--------LDGYALRVPIPTGSVTDLTADLSK--C.VS
G3P_STRAE/158-312AP..HKDLRRARAAA..LNIVPTSSGAAKAIGLVLPELA.GR--------LDAFALRVPVPTGSVTDLTVTTRR--G.TS
G3P_AQUAE/157-320LP..HKDFRRARAAA..INIVPTTTGAAKAIGEVIPELK.GK--------LDGTARRVPVPDGSLIDLTVVVNK--APSS
G3P_THEAQ/154-309LP..HKDLRRARAAA..INIIPTTTGAAKATALVLPSLK.GR--------FDGMALRVPTATGSISDITALLKR--E.VT
G3P_STRAU/157-312GP..HRDPRRARAAA..VNIVPTTTGAAKAIGLVLPNLD.GK--------LSGDSIRVPVPVGSIVELNTTVAR--D.VT
G3P_BORBU/158-316LP..HSDLRRARAAA..LSIIPTSTGAAKAVGLVLPELK.GK--------LNGTSMRVPVPTGSIVDLTVQLKK--KDVT
G3PA_ARATH/218-374S...HRDLRRARAAA..LNIVPTSTGAAKAVALVLPNLK.GK--------LNGIALRVPTPNVSVVDLVVQVSK--K.TF
G3PA_CHOCR/236-392G...HRDLRRARSAA..LNIVPTTTGAAKAVALVVPSLK.GK--------LNGIALRVPTPNVSVCDVVMQVNK--K.TF
Q37322_EUGGR/283-439R...HSDLRRARAGA..VNIVPTSTGAAKAVALVLPNLK.GK--------LNGIALRVPTPNVSIVDLVVKVDK--K.TT
G3P2_BACSU/157-313P...HKDLRRARACG..ESIIPTTTGAAKALSLVLPHLK.GK--------LHGLALRVPVPNVSLVDLVVDLKT--D.VT
G3P2_RHOSH/156-312TM..HKDLYRARAAA..LSMIPTSTGAAKAVGLVLPELK.GR--------LDGVSIRVPTPNVSVVDLVFEAAR--D.TT
G3P_XANFL/158-314TM..HKDLYRARAAA..MSMIPTSTGAAKAVGLVLPELA.GK--------LDGTSIRVPTPNVSVIDLKFVAKR--A.TS
G3PC_CUPNH/160-315VY..HEDLRRARSAT..MSMIPTKTGAAAAVGLVMPELD.GR--------LDGFAVRVPTINVSLVDLSFVAAR--P.TT
G3P_ZYMMO/159-316QI..HSDLRRARTAS..ASMIPTSTGAARAVALVIPELK.GK--------LDGISIRVPTPDVSLVDFTFVPQR--D.TT
O00813_TRIFO/176-338IM..HKDLRRARAAA..MNIIPTSTGAAIALTRVVKNLTRGC--------MDGLALRVPAITGSLVDITVNTRE--K.VT
G3P_LACDE/161-318PDR.GNNFRNARAAA..ENIIPHSTGAAKAIGLVLPELN.GK--------LDGHAQRVPVKDGSETELVTILDK--K.VT
G3P_CLOPA/155-312PHR.KGDFRRARAAA..VSIIPNSTGAAKAIAQVIPELK.GK--------LDGNAQRVPVPTGSVTELISVLKK--N.VT
G3P1_STAAW/156-314PHR.KGDKRRARAAA..ENIIPNSTGAAKAIGKVIPEID.GK--------LDGGAQRVPVATGSLTELTVVLEK--QDVT
G3P_LACLA/157-315PHR.GGDFRRARAAA..ENIVPASSGAAKAIGLVLPELS.GL--------MKGHAQRVSTPTGSITELVTVLEK--H.VT
G3P_MYCGE/162-317P...HNDLRRARAAA..VNIVPTTTGAAKAIGLVVPEAN.GK--------LNGMSLRVPVLTGSIVELSVVLEK--S.PS
G3P_HALVA/161-316P...NGKPRRRRAAA..ENIIPTSTGAAQAATEVLPELE.GK--------LDGMAIRVPVPNGSITEFVVDLDD--D.VT
Q27661_GIAIN/193-353VMKK.RDWRSGRACL..SNIIPASTGAASALTLVIPELA.GR--------ITGTSWRVPVQDVSVVDLVVETEK--D.TS
G3P_HELPY/156-312AHP..LDKRRSRAAA..SNIIPTTTKAALALHKVLPNLK.NK--------MHGHSVRVPSLDVSMIDLSLFLEK--K.AP
O25902_HELPY/154-310KH...KDIRRARAAG..LNLIPTSTGVSKAISLVLPHLG.PK--------VTGLAIRVPTPNVSLVDLSLNFKK--S.VS
O68923_9ACTO/274-431YH...KSDRRGRSAP..LNMVLTETGAASAVAKALPDLG.AK--------ISGSSIRVPVPDVSIAILNLRLSR--G.TS
G3P_ARCFU/147-300.....KEDKKGLVNGIMPDPVAIPSHHGPDVKTVLPD...VD--------IVTTAFKLPTTLMHVHSLCVEMRE--A.VK
G3P_PYRWO/146-296.....NDIKRGPINAIKPS.VTIPSHHGPDVQTVIP....IN--------IETSAFVVPTTIMHVHSIMVELKK--P.LT
G3P_METBR/146-300.....GQVKKGPINAIVPNPPTVPSHHGPDVQTVMY..D.LN--------ITTMALLVPTTLMHQHNLMVELES--S.VS
G3P_METTH/145-299.....VQVKKGPINAIVPNPPTVPSHHGPDLKTVMK..G.VN--------IHTVALLVPTTLMHQHNIMVELED--P.VE
G3P_METFE/145-298.....AQVSKGPINAIIPNPPKLPSHHGPDVKTVL...D.IN--------IDTMAVIVPTTLMHQHNVMVEVEE--T.PT
G3P_METJA/149-305.....NDDKTGPVNAITPNPVTVPSHHGPDVVSVVPEFE.GK--------ILTSAVIVPTTLMHMHTLMVEVDG--D.VS

PF02774

ARGC_BACSU/158-316HFSELNDNFKIYKVN.EHQHTPEIEQALNEWQPGLGPITFSA.............HLVPMTRGIMATMYTRLTC..D-LT
DHAS_CAMJE/143-324FPYTLALNLIPQIDVFMDND..YTKEELKMVNETQKILH.KN...LEVS...ATCVRVPVLRSHSEAITMHF.....-EK
DHAS_ARCFU/157-324PSLAITDNVIPFIKGEEDKVEEEPLKLLGKFNGRKIEFADIK.....VS...ASCHRVPVIDGHTEAVWVEFD...R-..
DHAS_HELPY/140-329FAYPIAFNAIAHIDTFKENG..YTKEELKMLHETHKIMG.VD...FPIS...ATCVRVPVLRSHSESLSIAF.....-EK
USG_AZOVI/140-318FDRQIAFNLLGRVGDSDTAG..HTGLERRLVEESRQVLDAPE...LKIS...VTCLMAPVFFGDSLSLAVQAS....-.Q
ARGC_ECOLI/163-311SNSFCEVSLQPYGVF.THRHQPEIATHLGADVIFTPHLGNFP...................RGILETITCRLKS..G-VT
DHAS_BACSU/139-327KHYQIAFNAIPQIDKFQDNG..YTFEEMKMINETKKIMHMPD...LQVA...ATCVRLPIQTGHSESVYIEID....-RD
ARGC2_LACPL/155-312HYVAVNDNLSLYKLN.QHQHIPEMMQQLQQWWSAISAIEFTT.............TLIPVTRGIMTTIYAKAKS..A-LT
DHAS_SHESP/141-320YSKQIAFNVLPQIDTFMENG..YTKEEMKMVWETQKIFGDDN...IVVN...PTAVRVPVFFGHSEAIHLET.....-IQ
DHAS_HAEIN/145-356FGAALGGSLIPWIDKLLPETG.QTKEEWKGYAETNKILGLSD....NPIPVDGLCVRIGALRCHSQAFTIKLK....-.K
ARGC_SYNY3/163-322LLAEAEGSLGAYGVA.KHRHTPEIEQIASDLAGTELRVQFTP............H.LIPMVRGILATVYATLRD.PG-LV
DHAS_METTH/156-330PSMAILDNLVPFIGGEEEKIETETLHLLGELDEGVVKPASFG.....VS...ASCHRVPVVDGHTEAVFIELDD..E-FD
ARGC_METTH/153-305HYPHCSDNVIPYNVT.GHRHTPEIRQELSRLNP..VRLSFTP............H.LVPVTRGILTTAHTFLLE..D-LE
ARGC_MYCTU/167-323LGAEVIGSARAYNIAGVHRHTPEIAQGLRAVTDRDVSVSFTP............V.LIPASRGILATCTARTRS..P-LS
Q99103_USTMD/166-346SSLDILDNVVPFISGEEEKIEWETAKILGGIKTDKTAFDYHE...EHPLKVSAHCNRVPVIDGHMECVSVSFKNRPA-PS
DHAS_MYCSM/140-329YVAPIAFNIVPLAGNYVDDGSGETDEDQKLRNESRKILGIPE...LLVS...GTCVRVPVFSGHSLSINAEF.....-SQ
DHAS_SCHPO/160-338SSLDILDNIVPFIGGEEEKIEWETRKILGSVNSTISGYELT.....DNVV.SAQCNRVPVIDGHLMCISVKFAK.TS-PT
DHAS_YEAST/165-346PGIDILDNIIPYIGGEEDKMEWETKKILAPLAEDKTHVKLLT...PEEIKVSAQCNRVAVSDGHTECISLRFKNRPA-PS
DHAS_AZOVI/143-352FGVPLAGSLIPYIDKELPNG..QSREEWKGQAETNKILGRIK....NPIPVDGICVRVGAMRCHSQALTIKLN....-.K
DHAS_LEPIN/157-329PTMDILGNVIPHIGGEEEKAEIEPLKCLGKVENGKILHADFS.....IS...AHCNRVPVFDGHTVCVSVKFKK..K-PS
DHAS_LEGPN/141-322YPQQIAFNALPHIDQFEDNG..YTREEMKMVWETRKIMEDDS...IMVN...PTAVRVPVIYGHSEAVHLEL.....-KK
DHAS_CORFL/140-329YVSPIAYNVLPFAGNLVDDGTFETDEEQKLRNESRKILGLPD...LKVS...GTCVRVPVFTGHTLTIHAEF.....-DK
DHAS2_VIBCH/141-319FSQQIAFNCIPQIDQFMDNG..YTKEEMKMVWETQKIFNDPS...IMVN...PTCVRVPVFYGHAEAVHVET.....-RA
DHAS_METJA/166-336PSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDGKVELANFK.....IS...ASCNRVAVIDGHTESIFVKTKE..G-AE
ARGC_METJA/158-312HFPNVNENINPYKIT.THRHTPEIEKELKKLGK..AKVSFTP............H.LAPITRGILTTAHTFLAK..D-VD
ARGC_CORGL/160-318LGSETMGSLKAYNTSGKHRHTPEIAQNLGEVSDKPVKVSFTP.............VLAPLPRGILTTATAPLKE..G-VT
USG_ECOLI/141-318FGRQLAFNMLPLLPD..SEG..SVREERRIVDEVRKILQDEG...LMIS...ASVVQAPVFYGHAQMVNFEA.....-LR
DHAS_PSEAE/144-354FGAPLGGSLIPWIDKELPNG..QSREEWKAQAETNKILARFK....NPIPVDGICVRVGAMRCHSQALTIKL.....-NK
DHAS_STRAK/132-319YKRPIAFNVLPLAGSIVDDGLNETDEEQKLRNESRKILEIPG...LKVS...GTCVRVPVFSGHSLQINARF.....-AR
DHAS_STRMU/137-328KHYPIAFNALAQIDVFTDND..YTYEEMKMTNETKKIMEEPE...LPVS...ATCVRVPILFSHSEAVYIETK....-.D
DHAS_SHIFL/144-353FGVPLAGSLIPWIDKQL.DNG.QSREEWKGQAETNKILNTS.....SVIPVDGLCVRVGALRCHSQAFTIKLK....-.K
DHAS_BORPE/145-359FGVPLGGNLIPWIDKDLGDG..MSREEWKAEAETNKILGRGAAFGTPATPIDGLCVRIGAMRCHSQALTIKLK....-.R

PF02800

G3P1_ANAVT/160-317YKEICAAMKQASE.......GSLAGILGYTDEEVVSTDFQGDTH..SSIFDAGAGIELN.....SNFFK---VVAWY---
E4PD_SHIFL/160-316ANEVNLLLQKAAQ.......GAFHGIVDYTELPLVSVDFNHDPH..SAIVDGTQTRVSG.....AHLIK---TLVWC---
G3P1_TRIKO/155-312YDEVKAAIKEASE.......GPLKGILAYTEDDIVSTDILTDPH..SSTFDAKAGIALN.....KNFVK---VMSWY---
G3PG_LEIME/172-334IQEIDKAIKKAAQ.......TYMKGILGFTDEELVSADFINDNR..SSVYDSKATLQNNL.PGEKRFFK---VVSWY---
G3P1_BACSU/157-313AEEVNAALKEAAE.......GDLKGILGYSEEPLVSGDYNGNKN..SSTIDALSTMVME.....GSMVK---VISWY---
G3P_BACCO/157-314VEEVNAALKAIAE.......GELKGILAYSIEPLVIRNYNGSTV..SSTIDILSTMVID.....GAMVK---VVSWY---
G3P_THEMA/157-313VEEVNAVMKEATE.......GRLKGIIGYNDEPIVSSDIIGTTF..SGIFDATITNVIG.....GKLVK---VASWY---
G3P2_SYNY3/159-315AEQVNGVLKEAAN.......TSLKGVLEYTDLELVSSDFRGTDC..SSTVDGSLTMVMG.....GDMVK---VIAWY---
G3P_STREQ/157-314VDEINAAMKAAS...........NDSFGYTEDPIVSSDIVGVSY..GSLFDATQTKVMEV..DGSQLVK---VVSWY---
G3P3_ANAVT/158-315VEEINALLKAASE......QAPLQGILGYEERPLVSIDYKDDPR..SSIIDALSTMVVD.....ETQVK---ILAWY---
G3P2_ANAVT/159-315TEEVNQALKDASE.......GPLKGILDYSELQLVSSDYQGTDA..SSIVDASLTLVMG.....NDLVK---VMAWY---
G3P_MONPU/157-314YDEIKQAVKEASE.......GPLKGVLGYTEDDVVSSDLNGDPH..SSIFDAKAGIALN.....SNFVK---LVSWY---
G3P_PSEAE/159-312VDEVNRLLREAS.........EGSPVLGYNTQPLVSVDFNHDPR..SSIFDANHTKVS......GRLVK---AMAWY---
G3P3_ECOLI/155-313AEEVNNALKQAT.........TNNESFGYTDEEIVSSDIIGSHF..GSVFDATQTEITAV..GDLQLVK---TVAWY---
G3P_CHLTR/155-312YEAICEAVKHAAN.......TSMKNIMYYTEEAVVSSDFIGCEY..SSVFDAQAGVALN.....DRFFK---LVAWY---
E4PD_VIBCH/164-320VNDVNQTIVNASQ.......CTLRGIVDYTEAPLVSIDFNHDPH..SAIVDGTQTRVSN.....GQLVK---MLVWC---
O68075_RHOCA/158-314VAEVNSLLQTAAE.......GGLNGILGFETRPLVSSDFTNDPR..SAVIDGPSTMVVN.....GTQLK---LYAWY---
G3P1_AGABI/155-316YDDVKKAMRDAADGK...HPGIEKGIVDYTEEDVVSTDFVGSNY..SMIFDAKAGIALN.....SRFMK---LVAWY---
G3P1_CAEEL/163-320MDDIKKVVKAAAD.......GPMKGILAYTEDQVVSTDFVSDPH..SSIFDAGACISLN.....PNFVK---LVSWY---
G3P_HOMAM/153-310YDDIKAAMKTASE.......GPLQGFLGYTEDDVVSSDFIGDNR..SSIFDAKAGIQLS.....KTFVK---VVSWY---
G3P_ECHMU/156-314YDQIKAAVKRASE......SSALKRILEYTEDQVVSTDFLSTTC..SSTFDARAGIALN.....DTFVK---LIAWY---
G3P_ONCMY/157-314YAEIKGAVKKAAE.......GPMKGYVGYTEYSVVSSDFIGDTH..SSMFDAGAGISFN.....DNFVK---LISWY---
G3P1_SCHPO/157-314YEDIKAAIKAASE.......GPMKGVLGYTEDAVVSTDFCGDNH..SSIFDASAGIQLS.....PQFVK---LVSWY---
G3PC_CHOCR/157-314YEDIKATMKAAAD.......DSMKGIMKYTEDAVVSTDFIHDDA..SCIFDASAGIMLN.....SKFCK---LVAWY---
G3P2_AGABI/155-312YEQIKEVMRKAAE.......GEYKGIIAYTDEDVVSTDFISDNN..SCVFDAKAGIQLS.....PNFVK---LIAWY---
G3P_LYOSH/155-312YEDIKKTVKEASE.......GAYKGIIEYTEEQVVSADFIGHHA..SSIFDAQAGIQLN.....PNFVK---LIVWY---
G3P_PHARH/156-314YEEIKETIKKASQ......TPELKGILNYTDDQVVSTDFTGDSA..SSTFDAQGGISLN.....GNFVK---LVSWY---
G3P_PHACH/156-313YDEIKQAIKEASE.......TTHKGILGYTEEKVVSTDFTGNDN..SSIFDRDAGIALN.....KTFVK---LISWY---
O65843_MARQU/184-341YDDVKAAVKAASE.......GSMKGILGYTEDDVVSTDFVGDSR..SSIFDAKAGIALN.....KNFIK---MVTWY---
O04839_GUITH/158-316YQQICDAIKAATT......DPEYCGVIAYTDDEVVSTDFLGNSY..SSIFDAKAGIALN.....DTFVK---LVSWY---
G3PC_CHLRE/159-316YEDIMKALKEASE.......GEMKGVLAYTDEDVVSSDFVTDPA..SCTVDAKAGIMLS.....PTFVK---LVAWY---
G3P_BUCAP/155-312YNEICEVVKNASE.......QKMKGILGYTEDEVVSTDFNGKEL..TSIFDAKAGLSLN.....KNFAK---LISWY---
O96367_LINPO/161-320YDDIVAAIKEAAA.......GPMSGVLDWTDEEVVSTDFVSCKS..SSIFDVGAGISLN.....DNFVK---LVSWY---
O96369_PLAFA/158-317YEEVALEIKKAAE.......GLLKGVLGYTEDEVVSQDFVHDNR..SSIFDMKAGLALN.....DNFFK---LVSWY---
G3P1_GIAIN/157-314YDEICAEIKRGSE.......NELKGIMTYTNEDVVSSDFLSTTS..TCNFDSKAGIMLN.....SRFVK---LVAWY---
G3PA_GUITH/203-360YEEICAEVKRRAN.......GDMKGFLGYTDEPLVSTDFETEPI..SSTFDAEAGISLN.....PRFVK---LVAWY---
Q26753_TRYBO/173-335IKEIDAALKRAAA.......SYLRGILDISKEELVSTDFIHNPN..SSIYDSLATLQNNL.PTEKRFFK---VVSWY---
G3P_TREPA/167-329VADLNAMLKKASE.......SYLRGVLQYCDEDIVSADVIHNQY..SSIYDSRATLQNNL.PNEKRFFK---VVSWY---
G3P_STRCO/158-315KDEVNAAFKKAAD......DGDLKGILFYTEDAIVSSDITGDPA..SCTFDSSLTMVQE...G..KSVK---ILGWY---
G3P_CORGL/158-313VESINAAIKEAAV.......GEFGETLAYSEEPLVSTDIVHDSH..GSIFDAGLTKVS....G..NTVK---VVSWY---
G3P_MYCLE/163-318VNEINAVFQDAAE.......GRLKGILKYVDAPIVSSDIVTDPH..SSIFDSGLTKVI....A..SQAK---VVSWY---
G3P_STRAE/158-312VEEVKEAYAAAAS.......GPYKGLLSYVDAPLVSTDIVGDP...ASLFDAGLTRVC....G..PQVK---VVGWY---
G3P_AQUAE/157-320VEEVNEKFREAAQKYRESGKVYLKEILQYCEDPIVSTDIVGNPH..SAIFDAPLTQVID......NLVH---IAAWY---
G3P_THEAQ/154-309AEEVNAALKAAAE.......GPLKGILAYTEDEIVLQDIVMDPH..SSIVDAKLTKALG......NMVK---VFAWY---
G3P_STRAU/157-312RDEVLDAYRAAAQ.......GPLAGVLEYSEDPLVSSDITGNPA..SSIFDSELTRVD....G..RHIK---VVAWY---
G3P_BORBU/158-316KEEINSVLRKASE......TPELKGILGYTEDPIVSSDIKGNSH..SSIVDGLETMVLENGFA.....K---ILSWY---
G3PA_ARATH/218-374AEEVNAAFRDSAE.......KELKGILDVCDEPLVSVDFRCSDF..STTIDSSLTMVMG.....DDMVK---VIAWY---
G3PA_CHOCR/236-392KEEVNGALLKASE.......GAMKGIIKYSDEPLVSCDHRGTDE..STIIDSSLTMVMG.....DDMIK---VVAWY---
Q37322_EUGGR/283-439KEEVNAALKKAAD.......GPLNGVLGYTELPLVSSDFKGTNV..SATVDGQLSMVMG.....EDMVK---VVMWY---
G3P2_BACSU/157-313AEEVNEAFKRAAK.......TSMYGVLDYSDEPLVSTDYNTNPH..SAVIDGLTTMVME.....DRKVK---VLAWY---
G3P2_RHOSH/156-312VEEVNAAIEAAAC......GPLK.GVLGFTTEPNVSSDFNHDPH..SSVFHMDQTKVME.....GRMVR---ILSWY---
G3P_XANFL/158-314KEEINEAIIAAAS......QQLK.GILGFTDQPNVSIDFNHNPN..SSTFHLDQTKVME.....GTLVR---VLSWY---
G3PC_CUPNH/160-315VEEVNGILKAAAE......GELK.GILDYNTAPLVSVDFNHNPA..SSTFDATLTKVN......GTLVK---VSAWY---
G3P_ZYMMO/159-316AEEINSVLKAAAD......TGDMTGVLGYTDEPLVSRDFYSDPH..SSTVDSRETAVLE.....GKLAR---VVAWY---
O00813_TRIFO/176-338KDQVNQALKAASE......SEALRGILGYTDEPIVSSDIIGDRH..SSIVDSLSTMVLDNEKG.GSLVK---VLSWY---
G3P_LACDE/161-318AEEVNAAMKKYE...........SPSFAYNADQIVSTDVLGMTA..GSIFDPTQTQVITA..GDKQLVK---TVAWY---
G3P_CLOPA/155-312VEEINAAMKEAA...........NESFGYTEDEIVSADVVGISY..GSLFDATLTKIVDV..DGSQLVK---TVSWY---
G3P1_STAAW/156-314VEQVNEAMKNAS...........NESFGYTEDEIVSSDVVGMTY..GSLFDATQTRVMSV..GDRQLVK---VAAWY---
G3P_LACLA/157-315VDEINEAMKAAA...........DESFGYNVDEIVSSDIIGMAY..GSLFDATLTEVTDL.KDGGQLVK---TAAWY---
G3P_MYCGE/162-317VEQVNQAMKRFA...........SASFKYCEDPIVSSDVVSSEY..GSIFDSKLTNIVEV..DGMKLYK---VYAWY---
G3P_HALVA/161-316ESDVNAAFEDAAA.......GELEGVLGVTSDDVVSSDILGDPY..STQVDLQSTNVVSG......MTK---ILTWY---
Q27661_GIAIN/193-353YAEICAAVKRACET.....PDELCGIMAYRDDFCVSSDFLTTTT..ISNFDSKSGIELH.....SRFFK---LVSWY---
G3P_HELPY/156-312KDPINDLLIEASK.......GVLKGVLEIDLKERVSSDFISNPH..SVIIAPDLTFTL......ENMVK---IMGWY---
O25902_HELPY/154-310KASVQHALKDACK.......HAFKGVVSIDEERLVSSDFISSPF..SAIVIDDQIMTIG.....EKNAK---VLAWY---
O68923_9ACTO/274-431REEVLTHLREVSLT.....SPLRRQIDFTTSADAVSSDFVGSRH..ASIVDAGATKVDG......DNAI---LYLWY---
G3P_ARCFU/147-300AEDVVSALSEEPRIM...LISAEDGFTSTAKVIEFARELRLRYD.LYENIVWRESIGVD.....GNDLF---VTQAV---
G3P_PYRWO/146-296REDVIDIFENTTRVL...LFEKEKGFESTAQLIEFARDLHREWNNLYEIAVWKESINVK.....GNRLF---YIQAV---
G3P_METBR/146-300VDDIKEKLNETPRVL...LLKAGEGLTSTAGFMEYAKDLGRSRNDLFEIGVWEESLNIV.....DGELY---YMQAI---
G3P_METTH/145-299ADEIKARLDETTRVM...LVRASEGLASTAEIMEYAKELGRSRNDLFEIPVWEESINVV.....DGELF---YMQAV---
G3P_METFE/145-298VDDIIDVFEDTPRVI...LISAEDGLTSTAEIMEYAKELGRSRNDLFEIPVWRESITVV.....DNEIY---YMQAV---
G3P_METJA/149-305RDDILEAIKKTPRII...TVRAEDGFSSTAKIIEYGRDLGRLRYDINELVVWEESINVL.....ENEIF---LMQAV---

PF02774

ARGC_BACSU/158-316ADDLHDLYSEFYQD..........SYFVRVRP...KGQYPQTKE--VYG...SNFCDIA.VTLDERTNR...VTIVSVID
DHAS_CAMJE/143-324EIDVKKAKEILKKA.........PSVIVIDDPK..NKKYPMPLM--TSD...TNETYVGRIRADVYDKK..ILHLWCVAD
DHAS_ARCFU/157-324EVSVEEAKAAFESLKPLD.LPTSPEKVIIVRE...EPDRPQPRL--DRDAGNGMSITVGRIRKDGERG....LKYIVLGH
DHAS_HELPY/140-329EFDLKEVYEVLKNA.........PSVAVCDDPS..HNLYPTPLK--ASHT...DSVFIGRLRKDLFDKK..TLHGFCVAD
USG_AZOVI/140-318AIDPSAVRAALERA.........PGLELIEPD.....DCPTVIG--DAVG..QDVAYVGRVRTGVDDAC..ELDLWIASD
ARGC_ECOLI/163-311QAQVAQVLQQAYAH..........KPLVRLYD....KGVPALKN--VVG...LPFCDIG.FAVQG..EH...LIIVATED
DHAS_BACSU/139-327DATVEDIKNLLKEA.........PGVTLQDDPS..QQLYPMPAD--AVGK...NDVFVGRIRKDLDRAN..GFHLWVVSD
ARGC2_LACPL/155-312TTQVRAAFTATYHE..........QPFVQVLP....TGMPTLKD--VVG...SNNCALG.VDYNPVTNT...IVVVSVID
DHAS_SHESP/141-320PAEAEDVKAVLRDA.........PGIELFESN....EEYPTAVT--ESAG..TDPVYVGRVRKDISHSH..GINLWVVSD
DHAS_HAEIN/145-356DLPLEEIEQIIASH........NEWVKVIPNDKEITLRELTPAK--VTG...TLSVPVGRLRKLAMGPE..YLAAFTVGD
ARGC_SYNY3/163-322RDDLITIYSAFYRA..........SPFVKILP...HGVYPQTKW--AW...GTNLCYIG.IEVDPRTGR...VIVLSAID
DHAS_METTH/156-330IDDVREAMDKFRGLPQKLGLHSAPEKPVVVRD...EENRPQPRM--DRDMDGGMAVTVGRLREDAAFKN..SLRYVLVGH
ARGC_METTH/153-305QGEIADIFMGFYDG..........EPFVRVV.....EGIPGLSA--VR...GSNFCQIGCFEVDD.NQR...AVIVSAID
ARGC_MYCTU/167-323..QLRAAYEKAYHA..........EPFIYLMP...EGQLPRTGA--VI...GSNAAHIA.VAVDEDAQT...FVAIAAID
Q99103_USTMD/166-346VDEVKKCLQGFTTEAQTIGVHSAPKQAITVHE...EQDRPQPRL--DRDWQNGAGVNVGRVRECPVFD....IKFVVLSN
DHAS_MYCSM/140-329PISVERTKELLSAA.........AGVKLVDV........PTPLA--AAGI...DDCLVGRIRQDPGVPDGRGLALFVSGD
DHAS_SCHPO/160-338PDQVREVLANYVSEPQKLGCYSAPKQAIYVFDD.STPDRPQPRL--DRNNENGYAVSVGRIRSDSIFD....IKFVSLVH
DHAS_YEAST/165-346VEQVKTCLKEYVCDAYKLGCHSAPKQTIHVLE...QPDRPQPRL--DRNRDSGYGVSVGRIREDPLLD....FKMVVLSH
DHAS_AZOVI/143-352DVPIADIEGLISQH........NPWVKLVPNHREASMQELSPAA--ITG...TLTVPVGRLRKLNMGSQ..YLGAFTVGD
DHAS_LEPIN/157-329REEIISSWKDFSGEPQTLGLPLAPNPVILFRE...EEDRPQPRL--DLDTGKGMTTVIGRLRPDPILD....WKYVVLSH
DHAS_LEGPN/141-322PLTADDARALLAKA.........PGVTVVDNLS..KASYPTAIK--NAVG..HDDVFVGRIRQDISHPC..GLNLWIVAD
DHAS_CORFL/140-329AITVEQAQEILGAA.........SGVELVDV........PTPLA--AAGI...DESLVGRIRQDSTVDDNRGLVLVVSGD
DHAS2_VIBCH/141-319PIDAEQVMDMLEQT.........DGIELFRG.....ADFPTQVR--DAGG..KDHVLVGRVRNDISHHS..GINLWVVAD
DHAS_METJA/166-336PEEIKEVMDKFDPLKDL..NLPTYAKPIVIRE...EIDRPQPRL--DRNEGNGMSIVVGRIRKDPIFD....VKYTALEH
ARGC_METJA/158-312REEIIKIYEKFYGS..........EVFVRIFS....EEIPKLTW--VR...GTNFCDIGGFEIDE.HGR...LVVISAID
ARGC_CORGL/160-318AEQARAVYEEFYAQ..........ETFVHVLP...EGAQPQTQA--VLG...SNMCHVQ.VEIDEEAGK...VLVTSAID
USG_ECOLI/141-318PLAAEEARDAFVQG.........EDIVLSEEN.....EFPTQVG--DASG..TPHLSVGCVRNDYGMPE..QVQFWSVAD
DHAS_PSEAE/144-354DVPLTDIEGLISQH........NPWVKLVPNHREVSVRELTPAA--VTG...TLSVPVGRLRKLNMGSQ..YLGAFTVGD
DHAS_STRAK/132-319PISADGATELLKDA.........PGVELSDI........PTPLQ--AAGK...DPSYVGRIRSDETVDN..GLALFVSND
DHAS_STRMU/137-328VAPIEEVKAAIAAF.........PGAVLEDDIK..HQIYPQAAN--AVG...SRETFVGRIRKDLDIEN..GIHMWVVSD
DHAS_SHIFL/144-353DVSIPTVEELLAAH........NPWAKVVPNDREITMRELTPAA--VTG...TLTTPVGRLRKLNMGPE..FLSAFTVGD
DHAS_BORPE/145-359DVPLDEIEDLIAAG........TQWAKVVPNTKEDTVKALTPVA--VTG...TLDIPVGRLRKLSMGLQ..YLGAFTVGD

PF02800

G3P1_ANAVT/160-317----
E4PD_SHIFL/160-316----
G3P1_TRIKO/155-312----
G3PG_LEIME/172-334----
G3P1_BACSU/157-313----
G3P_BACCO/157-314----
G3P_THEMA/157-313----
G3P2_SYNY3/159-315----
G3P_STREQ/157-314----
G3P3_ANAVT/158-315----
G3P2_ANAVT/159-315----
G3P_MONPU/157-314----
G3P_PSEAE/159-312----
G3P3_ECOLI/155-313----
G3P_CHLTR/155-312----
E4PD_VIBCH/164-320----
O68075_RHOCA/158-314----
G3P1_AGABI/155-316----
G3P1_CAEEL/163-320----
G3P_HOMAM/153-310----
G3P_ECHMU/156-314----
G3P_ONCMY/157-314----
G3P1_SCHPO/157-314----
G3PC_CHOCR/157-314----
G3P2_AGABI/155-312----
G3P_LYOSH/155-312----
G3P_PHARH/156-314----
G3P_PHACH/156-313----
O65843_MARQU/184-341----
O04839_GUITH/158-316----
G3PC_CHLRE/159-316----
G3P_BUCAP/155-312----
O96367_LINPO/161-320----
O96369_PLAFA/158-317----
G3P1_GIAIN/157-314----
G3PA_GUITH/203-360----
Q26753_TRYBO/173-335----
G3P_TREPA/167-329----
G3P_STRCO/158-315----
G3P_CORGL/158-313----
G3P_MYCLE/163-318----
G3P_STRAE/158-312----
G3P_AQUAE/157-320----
G3P_THEAQ/154-309----
G3P_STRAU/157-312----
G3P_BORBU/158-316----
G3PA_ARATH/218-374----
G3PA_CHOCR/236-392----
Q37322_EUGGR/283-439----
G3P2_BACSU/157-313----
G3P2_RHOSH/156-312----
G3P_XANFL/158-314----
G3PC_CUPNH/160-315----
G3P_ZYMMO/159-316----
O00813_TRIFO/176-338----
G3P_LACDE/161-318----
G3P_CLOPA/155-312----
G3P1_STAAW/156-314----
G3P_LACLA/157-315----
G3P_MYCGE/162-317----
G3P_HALVA/161-316----
Q27661_GIAIN/193-353----
G3P_HELPY/156-312----
O25902_HELPY/154-310----
O68923_9ACTO/274-431----
G3P_ARCFU/147-300----
G3P_PYRWO/146-296----
G3P_METBR/146-300----
G3P_METTH/145-299----
G3P_METFE/145-298----
G3P_METJA/149-305----

PF02774

ARGC_BACSU/158-316NLMK
DHAS_CAMJE/143-324QIRV
DHAS_ARCFU/157-324NTVR
DHAS_HELPY/140-329QLRV
USG_AZOVI/140-318NVRK
ARGC_ECOLI/163-311NLLK
DHAS_BACSU/139-327NLLK
ARGC2_LACPL/155-312NLMK
DHAS_SHESP/141-320NIRK
DHAS_HAEIN/145-356QLLW
ARGC_SYNY3/163-322NLVK
DHAS_METTH/156-330NTVR
ARGC_METTH/153-305NLVK
ARGC_MYCTU/167-323NLVK
Q99103_USTMD/166-346NVMI
DHAS_MYCSM/140-329NLRK
DHAS_SCHPO/160-338NTVL
DHAS_YEAST/165-346NTII
DHAS_AZOVI/143-352QLLW
DHAS_LEPIN/157-329NTIR
DHAS_LEGPN/141-322NIRK
DHAS_CORFL/140-329NLRK
DHAS2_VIBCH/141-319NVRK
DHAS_METJA/166-336NTIR
ARGC_METJA/158-312NLVK
ARGC_CORGL/160-318NLTK
USG_ECOLI/141-318NVRF
DHAS_PSEAE/144-354QLLW
DHAS_STRAK/132-319NLRK
DHAS_STRMU/137-328NLLK
DHAS_SHIFL/144-353QLLW
DHAS_BORPE/145-359QLLW

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window