Sequence alignment for CL0142

PF00950

ZNUB_HAEIN/1-258-----------------------------------------------------------------------------MF-
P29K_STRGN/11-267-----------------------------------------------------------------------------DF-
ADCB_BACSU/5-263-----------------------------------------------------------------------------DL-
O33704_STRPN/6-264-----------------------------------------------------------------------------SY-
MNTC_BACSU/10-277-----------------------------------------------------------------------------QH-
O28298_ARCFU/4-264-----------------------------------------------------------------------------MD-
Y360_HAEIN/10-266-----------------------------------------------------------------------------SY-
ZNUB_ECOLI/1-258-----------------------------------------------------------------------------MI-
YCXC_CYAPA/29-287-----------------------------------------------------------------------------QL-
YFEC_YERPE/10-266-----------------------------------------------------------------------------NY-
O26706_METTH/9-265-----------------------------------------------------------------------------QY-
YFED_YERPE/13-269-----------------------------------------------------------------------------AY-
MNTB_SYNY3/19-275-----------------------------------------------------------------------------QY-
Y359_HAEIN/10-266-----------------------------------------------------------------------------QF-
Y2045_SYNY3/23-279-----------------------------------------------------------------------------QY-
TROC_TREPA/9-276-----------------------------------------------------------------------------SD-

PF01032

B2UAJ5_RALPJ/22-333AC..VV....VLAAS...L....MLGSV.K..LSLAEVWRALIGGG................DSLAAG........IVI-
A9BXV2_DELAS/19-335LL..LA....SLLIA...A....CAGHQ.W..ASPADLLAALGGE.................DSLRSR........LLL-
A9CFY7_AGRT5/353-653IM..AV....LVFAA...L....VIGKG.P..DGWTML........................KASDLQ........TLL-
A9BER0_PETMO/21-332FL..LI....LLFTS...F......GSV.K..VPVKDIFTSLIAKN...............NNDIYNN........LIL-
B8FP67_DESHD/19-334LT..VA....LFFGS...F....LVGRY.P..IPPQTVMDIILSQFLPI.........PQYWDSTLET........VVM-
A8MDX7_CALMQ/17-330LL..LT....GFILN...L....VLGEV.N..VPGDCLIHC....S................QVKYRV........IIM-
C3AB59_BACMY/28-334LT..VL....GLFYG...L....FAGSL.S..FSLRDIIEGIQDE.................GSTVHR........IVW-
A3TJ31_9MICO/19-329AV..GV....AAAVS...L....LVGTQ...SVAPSDIVAALLGNP................VTEQVS........GIV-
Q121Y4_POLSJ/15-320LL..LA....AWLSL...L....AFSEH...PLMLSGLWQG.....................DDMSAL........IVR-
A6B3C3_VIBPA/13-319LL..LI....ASSLT...L....FVGAA...NLSAQQVFALLFS..................FSDSDF........VIH-
A7FSM0_CLOB1/26-347FV..IT....TVC.....I....TFGSV...KIDVGVTFKSLINNILNKEI......FAKDWPNNIDN........IVF-
Q8XL25_CLOPE/21-346LF..IS....SIILG...I....SFGAV...DIPPYDVYRVFLYKVFGIKIG....NLDEILNSTLFD........IIW-
Q4JT73_CORJK/31-344LA..AL....CYCLI...L....GQGAV...KLSPMEVIEVLTGGG................TQQAIN........VVW-
Q8YHY6_BRUME/22-332LV..IV....LFAVS...L....LTGPA...ALGIGESFKALLGDD................RDMTVL........VMR-
A4XWA5_PSEMY/361-670AL..AV....LICLA...L....LVAGT...AQGESGIWSFWQ...................RVWSG.EP...MAMTLL-
Q7P5E3_FUSNV/14-333LL..IG....IIIFS...L....FYGAV...KVPVSDVIKIILNKT................ELFNFEISKQSYIPIVF-
Q4JT72_CORJK/24-339GL..AL....LLVAS...L....YLGSK...DLSVGEVTSILMHGP................QPSAQSGINAEQAGIIW-
A3ZCW4_CAMJU/19-323AY..II....ASFTA...L....CLGDE...NLNPKELFSYIFSQ.................DEILRQ........III-
A7VD13_9CLOT/10-320YL..IAGSVGLILLTAASL....FIGKY...RITLTGLIAG.....................DSMQWR........VFL-
Q9CLX0_PASMU/8-308LA..ILGTVLLIWFS...T....GVGFG...GWQPPNALDP...................................IVF-
Q65LP4_BACLD/15-326LL..LA....SFALS...V....SIGSS...MIALSDIWAAVFAYD................GSKLHA........IIQ-
Q6AAX5_PROAC/19-337LL..VL....TPVLS...I....AFGAA...PVPIGQVLGVLADHCGLPV........HLSWDSITDA........IVW-
Q02HL3_PSEAB/28-334AI..GA....IVVGT...L....ALGDF...GIPFGRVLQVLVQDD................GSDAAF........VIH-
A1B6F1_PARDP/12-324AL..AL....CLLLA...L....SAGES...WIPPSGIWAALARFD...............ETRQADV........IVI-
A3MG79_BURM7/44-331AL..AA....ASIAA...L....CIGAY...RLSPAQLLGALTATD................AQLAGDAALRQARAVLV-
Q6LGA6_PHOPR/15-328AV..SF....LVLLS...L....SVGAG...IYGFSDAFGYLTGSPLL............ASDAQLAM........VMD-
Q9PRC3_UREPA/34-339LL..II....TIILT...L....IAVAG...ASRFINVFSYLSD...................................-
A4E6M6_9ACTN/22-336VL..IV....LVGAN...L....CIGSV...LVPADHIPGILSGGA...............ANSMESQ........VIW-
A7VAE4_BACUN/14-334VI..LL....LFAGN...L....LVGSV...SIPPADVFRILLGGEG..............EKASWSF........ILW-
A3YF14_9GAMM/27-354VL..LL....GLFFN...I....SEGVS...NITFTDIVNIFKIKLYHLLQIPIDPELASAVSPIHTS........IIW-
Q2IWL1_RHOP2/32-347AA..AL....ALQLD...I....GTGPS...ALTTMDLLRGLFDPSS..............LSRSSAV........IVW-
Q24RI2_DESHY/37-351LL..LL....SLLIS...M....NSGYA...KLSPLDTLRTLFGGG................TAKENL........ILF-
Q15VS6_PSEA6/37-365FV..LALATVLLLVG...L....QSGSF...EQSSHVLFDVLVNKF................NHQALSQEQYLQWYVFS-
Q73KI5_TREDE/13-334AC..IL....VLILG...I....GIGSV...FVPPQDIIKIIFSKI................AQKEISCIEPTFVAIVW-
Q6D3D7_ERWCT/30-340VL..LA....TVFLS...L....SLGQI...VLSPTQVMSALLGKA................DSGVHF........IVN-
A7HJN9_FERNB/19-327IF..VV....VFLLN...L....SFGTV...NVSVFKIFKLLTE..................DSPEKY........MIW-
A5KUT8_9GAMM/358-660LLGAMI....FGLLALSTL....SQPSA...DMGYFIVPDA...................................FEW-
Q1QPP0_NITHX/33-350LL..IG....AILFA...L....TIGRY...PLEIRDIAAFFQAMAGLKP.......MAPDRYQLLHN........IIV-
A5LD35_STRPN/18-329GL..LI....TIFLS...L....KLGTK...EINIRDFLAAFGMGNT..............NDDFIKS........IIY-
A3N3V3_ACTP2/14-322VL..FF....GLFLSVLMLQLPDGSGLA..SLFLPSENLELL..................................LIQ-
A1B6F0_PARDP/27-334AA..LA....LTLAS...L....GLGAV...SLSWGETRLDLLAPL................DADQAF........ALY-
A5I1H3_CLOBH/13-328IT..IV....ASLVS...I....TIGAA...SITPFKVIEVILNKFIG...........NINDSILQK........IIW-
Q8XM96_CLOPE/18-333IT..LL....IFGIS...L....SLGEV...MISPIDVLKSIFGID................TGFSSI........LVM-
A3D7X9_SHEB5/21-359IT..LI....TPIAA...T....SFGAA...NISFMDVIQVFINKMASL..........TQANGMTER........IVM-
A4F7E2_SACEN/13-332AL..VL....AGLVA...V....SLGSV...HLPPGQVWRILAAPLLPV.........EQDWTQVRAS........IVW-
A4EFI4_9RHOB/31-342IL..LS....ICAAS...L....MSGSY...PLTLREVLATLAGDP...............PVDTAET........IVW-
A6X2T0_OCHA4/30-336IL..VA....LFLLT...L....MLGQS...FTPPKDVVRVLLGED................VQGASF........TVG-
A1UTS1_BARBK/10-312AI..IL....LSILS...I....FVGYS...DVTLSNLLLK.....................DSTAWL........LFW-
O29818_ARCFU/18-331LL..IF....SVTAS...L....LAGSY...SLSPAKIF........................SLNSP........VIT-
A6X5K1_OCHA4/5-313PT..LI....LSLLS...VLTLLAVAAF..MTVGAKGSWS....................................FIL-
Q9PR75_UREPA/33-354LI..LI....AICFV...F....LTLAI...YFDTTNGFEASI...................NQFN.F...........-
Q1J550_STRPF/39-345SL..LF....LAVIA...L....SLGGL...AVSYEAIVKGLFVA.................YDPQVA........LIY-
Q81L64_BACAN/20-329LL..LL....LFFIH...I....GQGQA...NISYSMIIDALISPN................QSLEHQ........TLI-
A1U5U9_MARAV/26-335LL..LL....VVLAS...L....LYGAG...PVSASDAMAALMANG................TEEAWF........VVT-
Q8XBV5_ECO57/19-328LL..II....ATALS...L....LIGAK...SLPASVVLEAFSGTC................QSADCT........IVL-
Q83NW0_TROW8/17-317IV..GL....CYLAL...F....LDGS......SVGQLIDAVFGGG................DDFKDV........VLR-
Q8FRR5_COREF/20-326LL..VV....SFVIS...L....MMGPV...TVPLSDLASSP..................................VVT-
A7BAW8_9ACTO/35-350LI..VV....CAAAA...M....LIGRF...SVSLEDVVAAVRARFWGG..........PAVPPRVNS........VVF-
A4SEC4_PROVI/34-339AV..PL....LLIVS...L....MLGPS...GIGFPDL........................DSPVGS........AIA-
Q11VA6_CYTH3/11-326LL..VV....VFLLA...A....GTTLD...VKTIHALPKAMFQFD...............SSSMNNV........IWI-
A3XVW2_9VIBR/10-312FL..VV....LCVAS...L....MIGVA...EISFSDFFNG.....................NQHANS........IYV-
Q6KZE8_PICTO/14-329LL..FL....IFFIS...L....FIGPV...YIPASRILDILLEEIFRI.........NMHVKYSSYE........IVV-
A3KJ26_STRAM/33-348LV..AA....LAVVD...I....AQGTA...AVGPSEVFKALTGRA................DPDDAS........VVI-
A3YGJ5_9GAMM/37-349FL..LF....LLLWG...A....AIGSY...QLSILKSWQIIIAPEL..............APEKLVR........VVW-
A3XB47_9RHOB/28-331LV..KV....GSVLA...L....RLGSY...PFTETSWLSVLLGAG................SEIERM........ILM-
Q1CIH2_YERPN/33-335ML..LF....ALLIS...L....CAGDV...WIWPEHWF.......................SESGKL........FVW-
A2RI59_LACLM/16-313SL..LF....LSVLY...L....MLGNK...NVPLTELSTNK..................................MVL-
A2BJ83_HYPBU/11-316LLLFPL....LILAS...L....AVGPA..GLVNPLDPGSQ...................................LIA-
A8H8F5_SHEPA/17-341IA..IV....VGLVG...I....CAGRF...SINPSDLFSAIQKLPSVLSSLI.LTGQVPDNLTQEER........VIL-
A4W6Q0_ENT38/19-325VA..LLLTWSNLSIA...LP.RGQWGQA....ISVPDI........................DNIQQM........IFH-
O58520_PYRHO/11-323LS..VA....SIFLA...L....SLGSV...KIPIKEVISSLSPTS................ISLYRKGNLSGSKFIIL-
Q17WF3_HELAH/19-322LL..FG....GEFLS...L....EEWK....EVAMNVKNHFLH...D.............EELSSLSI........IIL-
A5WEG3_PSYWF/387-689SV..GV....LLLIALVSV....WVKDL..SGIAFSTDWA....................................LTQ-
A6F9M2_9GAMM/35-348VL..SL....SFVFS...L....KLGSV...SVSWADVYGVISFDV...............ALNDATS........TIY-
Q5KVV1_GEOKA/17-326GI..IL....LIIVS...L....VSGPF...FVPIPKVLDVLLHDD................GSKART........VVW-
Q03SH9_LACBA/15-312LL..LV....TIVLA...M....MVGTT...WLGIAQIFRAVTRP.................ASSDFT........TVF-
Q87G79_VIBPA/12-323LI..AL....LSLLS...L....QIDTS....LSLSEQWQLFTQPES..............ASEFRDV........FFM-
Q631N2_BACCZ/34-330VV..II....LGIIS...L....FTGVYDIRG..............................QEDGTE........MFF-
A5L0T4_9GAMM/1-312ML..SG....YAASM...L....GWSNF...SLTLNDLVGYWFTFD...............TSNMTHQ........ILA-
Q9PPX4_UREPA/42-345IIFCSL....FFLID...L....FFTGN..HLNVIKRMFENSS.................................LSN-
A1S042_THEPD/21-338LV..AA....ALPLS...I....LSGTV....YKPWDVLRLLQE..................GSSDAG........IVL-
Q9RCF5_VIBCL/33-344AL..MG....LTISS...V....FVGSR...DIPYAVTFDALFHFD...............EQNTQHL........LVH-
Q9PPX3_UREPA/27-335KT..MI....TVIIS...I....VVFII...TLAWTYDFNFKQ...................DNIALA...........-
A6AQM9_VIBHA/8-312TI..VT....VMLLS...I.............LSLTFVFVN.....................SGLDFD........YII-
A6F9M3_9GAMM/34-346IL..LL....VALTH...I....SIGAR...SIAWADIFQAIFAFD...............SQQFVHH........IVI-
A3ZGV6_CAMJU/15-317LL..LF....FGMIS...L....FIGVI...SINVKDILNL.....................NSTQLE........IIT-
A1AFV0_ECOK1/14-324LL..LV....GCVVY...P....GIGAR...FIAPQTVLQAFLHFD...............PQNFDHN........VIV-
A3JJ56_9ALTE/20-327AL..GA....LFLMG...L....LAGRQ...WTTPEALWGVLQGQG................SIIERV........SVL-
Q6LGA7_PHOPR/59-365ML..LV....GIVIA...V....SVGSA...KLTPLSALQAFLGDA................SRMVNI........MVF-
Q30UD5_SULDN/9-317TL..TV....FLFLS...P....FIGAV...TLHVADIFNF.....................SSLHSQ........IFF-
A6TAD2_KLEP7/17-327AT..LG....IAVAS...L....CFGQY...PLSLSAVGHTLVHLPP..............GEGVIGQ........IVW-
A3KIF2_STRAM/39-360AL..PV....SLACG...A....GFGSS...GLAWSEALSYLWA..GLTG.......GSIAPDEVSSY.......TIVW-
Q9PQ90_UREPA/27-331LI..ILSICVLICYC...L....FDGKE...LMNFKNVGEEINE..................GSAPYI...........-
Q129V6_POLSJ/5-323VL..LV....LCVVS...V....KAGAV...PVSLERLVQSLSLLVSGA.........PQALYGMEDR........IVV-
A6TUM4_ALKMQ/16-325IL..II....GLFLA...I....SLGVT...HIGISEIWNSIFNYS................ETLELM........LIR-
A3VEF7_9RHOB/16-333CL..AV....LAVVA...T....GLGSS...ALPLDRVTAALFGRG................EAMDAV........IVW-
Q4JT63_CORJK/46-360LI..VF....LGAFS...I....GLGDF...PISVSRVLEVVFRGD...............GNRVERL........VVL-
Q97ZU1_SULSO/12-320GF..II....SFLLG...L....LYGDV...TIPISEIFHP.....................SGVYAY........ILL-
Q3IX97_RHOS4/12-310CL..VV....AGLYLFWGL....RAANW...A............................................FAL-
Q2JZ26_RHIEC/14-331LI..AV....VVGVS...V....GIGDL...PIPLATTFSAVTNRLGWT.........AVELNRIHET........VIW-
A4QFH8_CORGB/19-335IL..GF....VVLFS...G....FSGVI...DLSPTAVIRHLSGQDT..............LTPRDQA........IFF-
Q49VF6_STAS1/13-310FI..II....SLLLS...LF..WGLGDI...S..............................DTLSQT........ILY-
A5WD74_PSYWF/27-334LL..VA....LILLS...L....SLGVA...DFSWQGLWQALTQQS................VSNDLQ........LLL-
A1RVX0_PYRIL/6-302LLAAPV....LFSAE...L....LLGPA...GLDWG........................................IVG-
A4VU24_STRSY/44-354SF..IA....GVYLS...L....RFGAI...SYSHQQLIETLKHPL...............TNSSAQD........VII-
A6U9A9_SINMW/17-325TA..AL....IGFAA...L....LVGAK...PMSLEAAIRAVLAPN................QGVDGI........IVW-
Q76BS8_VIBMI/28-336LI........AVLLQ........TTAPY...SQGISLIWDTLWHFD...............QSNYQHV........ITY-
A2RG79_STRPG/17-331LL..VS....LMGLV...L....SLGES...HLSFLDLVHVFLGKS................SHAISF........IVI-
Q5WBH7_BACSK/359-661LL..VV.....AIGA...L....AFGGG..SFYSFSEMVS......................GALFDT........VTV-
A6VX05_MARMS/48-354LL..AI....ACVAT...L....GIGSM...PISPKEVIAVLFGHG................NVMSQF........IVH-
A0B6B4_METTP/21-333PL..IV.....MVLS...L....FIGKF...TISPDDIIQLVIFNLMGA.........ETPHPSVYKT........VVF-
Q2K6T4_RHIEC/8-328LA..LL....SLAAA...I....FLGVA...DIPMGDVAAVLTGAG................SAEARL........IIL-
Q7CHR7_YERPE/34-340IL..LL....CLTAA...L....MLSPS...GFEGGKMLAVLAGEG................SQYEEF........ILL-
Q65F32_BACLD/24-345FL..SA....SVLMG...I....SIGSL...EIPIPSIMKVFLEEWFGIQ........GLNPDPTEAN........IIM-
Q83NW1_TROW8/30-337LC..VG....LLFLS...V....SVGYT...QTSFADMWSALTGNG................DIELRQ........TIL-
A6U3Q5_STAA2/30-338FL..FI....CIYLN...M....AIGSS...KINFSDIIHYVTGHT................DTKATF........LLH-
A7VNB1_9CLOT/26-334LL..LC....VLLLS...L....RFGSS...GMDWQSFFGGLLRQE...............GFEAQSV........ILY-
A6VN37_ACTSZ/353-655LL..II....STVTA...L....MLGQS...LQG..............................WHWLDIADQWDRQIF-
Q8XM97_CLOPE/21-331LT..GI....LCYLS...I....TKGFI...KTNYETVIDAYKNFN................GSQEHI........IIK-
Q3JCU5_NITOC/12-323LL..AI....GVLSS...A...PFLGLH...PIPVKTILESTA...................GNIEAE........IFW-
Q11M36_MESSB/26-335LL..AF....AVLGS...L....MLGYT...IYMPGELWNALASSG................TSEADT........VIR-
Q5M4D4_STRT2/13-320IL..WVIVVLLIMLS...L....AIGSN..RQFSLFGLFQG.....................QHKSWE........LFW-
A6EUM8_9ALTE/34-356SL..VV....VVVAG...V....QLGAV...DLTWSQVWSGLTGDS................SQHVQR........VVF-
A6T636_KLEP7/15-325LM..AA....SLLISLLGL....AQGPV...PLTIDQVFSALFGDA................PRNVAM........VVN-
A7MZ09_VIBHB/22-322LL..LA....VVYAS...L....SSGIY...HFDAQQIMAFLISDS................SSQASL........VFW-
Q9PRC2_UREPA/30-332LT..SF....IFIFN...I...........IYTNKTFIWESFYF..................QNASFE........EVF-
A6TUM3_ALKMQ/16-333LF..LV....SIIIY...L....SWGTY...KIAPLDTIKTLLGRG................TKFQNA........SVL-
Q9PQD3_UREPA/50-363IV..TI.....LFLS...L....LVMFI...KINNQGQLLNNR...................TPLDLF...........-
A1ANB5_PELPD/15-334LV..VA....GGLLS...L....SSGSW...SIPASHVVMIVLSKLGLY.........AGAISDVEAS........IVW-
A3WNU5_9GAMM/8-317CF..IILFAIVILLSALQL....TVGGS...SINWWMP........................NALEKD........IIW-
Q2S814_HAHCH/54-360VI..LL....AVCAS...L....MLGST...RLSLTQVWQAMLGEG................SPAHQL........LTM-
Q9CPB8_PASMU/14-325LF........GLLWGSLFL....YYPTP....ISAWETLQAFIGLD................DELVQI........TIL-
Q9PQ91_UREPA/44-347IA..LL....VVI.....I....LIFSV...TLSNKLGFS....................................ELA-
Q7A870_STAAN/15-326CL..AI....VAILS...L....MIGNT...LVSPGTVIQALFNFD...............SENDLHD........VVT-
Q12X02_METBU/48-366LV..IF....LSAFI...V....TIGPL...EISVAEVYKILLSSLFPG.........YFTNEGLTSQ........IVW-
Q8Y5U7_LISMO/26-336LL..LI....LALFG...I....AVGAA...DINLSTVWDALFHYN...............SSDTQHQ........IIR-
A3KJ26_STRAM/379-687VL..VG....LVIAA...V....LVGDS...KLLLGDVVNWAQGR.................AGRTVS........FVL-
Q4JUP3_CORJK/57-360LL..AF....AIVLG...L....SVGAV...MKPPAETIHDLFTGG...............K..............LIW-
A6A112_VIBCL/7-312LL..LLIAISLLFAA...L....FIGVG....LNADNYQ.....................................YFL-
A6F9Z0_9GAMM/16-319LA..VL....FVLGL...L....SVGTF..SLVPTMNLF.......................DSYQQT........YVF-
Q8FDJ1_ECOL6/35-344FA..VG....ILIFG...L....MQGSF...FVPASEVGRALFAPEN..............VSTDARY........IVQ-
Q28Q47_JANSC/15-330GL..VL....AVLAG...I....FFGTA...EATWSDRWAALVGGAD..............APRSLSL........IIW-
Q72EC9_DESVH/10-344LALGAA....LWLLS...VPAACLFGPF...DIGPAEVMRLLGAAAGVPV........SGHVDPIRLL........VVG-
A3YGJ6_9GAMM/27-335AL..VI....AAFLH...L....SLGAK...EIDWMTVWHALFDYN...............TADMDQV........IIR-
Q5HJQ6_STAAC/19-328FL..AI....VSVVS...M....MIGSS...FIPLQRVLMYFINPN................DSMDQF........TLE-

PF02653

Q9YG34_AERPE/1-252MISAVLTTLIPLSLA--------ALGEA------------------------------------------------VLE.
O06762_MYCFE/85-368IKFDFPTFFVIFGFT--------GLAVS------------------------------------------------IGF.
LIVM_METJA/5-317LISMILLWFGLYYIV--------SLSLN------------------------------------------------MEFG
Y121_MYCGE/6-281QLESWFFIAPALLLA--------VLSGY------------------------------------------------LAE.
Q9I6Z5_PSEAE/59-338GLGELLVKAMPILLC--------ALGLA------------------------------------------------LAY.
Q98MD6_RHILO/14-287IMPVTLAQSLILAFV--------VLGIM------------------------------------------------IPFR
Q9CLF9_PASMU/36-307VLLYSTSDFIYIGML--------ALPLT------------------------------------------------MII.
O52371_RHITR/57-322YWFVILKQSAPLGIA--------VLAQS------------------------------------------------LVM.
LIVH_ECOLI/11-292QMFNGVTLGSTYALI--------AIGYT------------------------------------------------MVYG
Q9KWA8_AGRRH/45-310NLFNLVAQAMPLIIT--------AVGQL------------------------------------------------FVI.
Q98EK5_RHILO/53-315GFSLMLNLAIPIALA--------TIAQM------------------------------------------------FVI.
Q9I2F6_PSEAE/53-318TFLAIANQIPDLVVL--------AVGMT------------------------------------------------FIL.
P73350_SYNY3/7-371GIFNGLSTSSVLLIA--------ALGLA------------------------------------------------IVFG
Q9KZH2_STRCO/67-346SMATVLYQSSTIGIM--------ALPVA------------------------------------------------LLM.
Q98JY4_RHILO/41-309NLVAIVRSVSVLGIL--------ALGMA------------------------------------------------VVI.
O59405_PYRHO/50-320NLNYLLNKSTPLIMT--------GLAFS------------------------------------------------IPA.
Q98JL3_RHILO/52-340WIANTIKFAIPLAIL--------AGCQT------------------------------------------------MTM.
O83343_TREPA/7-293MVALTLVFSTPILIT--------ALGGL------------------------------------------------FSE.
P74318_SYNY3/6-274LIFNGIAVGSIIALG--------AVGLT------------------------------------------------LTYG
Q987K1_RHILO/554-814GLDLLLMPALSLVLV--------TAAQM------------------------------------------------FIV.
Y259_MYCPN/73-364NIENFARQIAIYTLA--------ALAFS------------------------------------------------FCM.
O30014_ARCFU/51-321AYLYILGLAYIFAIM--------VISWD------------------------------------------------LMVG
P73351_SYNY3/61-355LRLRLMGRFLSLAII--------ALGID------------------------------------------------LIWG
Q98MN6_RHILO/59-339QLHELAIKAAPLILI--------AVGLS------------------------------------------------VCY.
O30015_ARCFU/8-272IAVFGAVVGGIWGLV--------ASGFS------------------------------------------------LIFG
Q99Q30_ENTCL/81-358RIAFGLNRSTPYILT--------GVGVA------------------------------------------------LCF.
Q98JL4_RHILO/36-311DFGSLARAVLPYAFA--------VAAQT------------------------------------------------VVV.
LIVM_ECOLI/110-398GTVDIATLTMIYIIL--------GLGLN------------------------------------------------VVVG
ALSC_ECOLI/52-318NITQIFVQSSVTVLI--------GMGEF------------------------------------------------FAI.
Q9HR22_HALSA/99-387RVASLLRSTTLLVFT--------GLAVA------------------------------------------------VSF.
LIVH_METJA/14-293ILEGAIIYSNLLVLL--------ALGLT------------------------------------------------LTYI
O29434_ARCFU/24-292YALRISTLFIIYTIA--------AMGLN------------------------------------------------IIIG
Q9PRD1_UREPA/65-355SPDIYLTKVAILGIA--------ALSFI------------------------------------------------FAF.
Q98LJ0_RHILO/59-359GIMNFMAPAAQLGIL--------AIGAA------------------------------------------------LLM.
Q98PV1_MYCPU/73-354NT..FLLMVVVFIIA--------SLGIA------------------------------------------------LTF.
O28879_ARCFU/13-293IIEGSLIYSNLLVLL--------SIGLT------------------------------------------------ITYI
P74455_SYNY3/5-354YLIFLITSAATYGIF--------ALGLN------------------------------------------------LQWG
Y120_MYCGE/76-367NTENFLRQIAIYILA--------GLAFS------------------------------------------------FCM.
Q98J21_RHILO/47-326NLFNITRQISITGLI--------ALGMT------------------------------------------------FVI.
Q98JY6_RHILO/57-328ALQESTRQLGEFSMV--------VTGMT------------------------------------------------VVM.
Q987G4_RHILO/75-353SVQNSLSRGAPLLLA--------ALCVA------------------------------------------------LPA.
YTFT_ECOLI/55-321SPIDILNRAAPVALL--------AIGMT------------------------------------------------LVI.
O29433_ARCFU/11-282LLLGGLVVGFIYALT--------ALGIT------------------------------------------------IIYG
Y260_MYCPN/10-286NLDNWLFVAPALLLA--------VLSGY------------------------------------------------LSE.
Q988C0_RHILO/13-289LLFGAVTAAIPLLLA--------GLGEQ------------------------------------------------MSE.
Q9RKT4_STRCO/53-332SLSTVLYAASTIGIM--------AVPVA------------------------------------------------LLM.
Q98JJ2_RHILO/56-323NFLNIGRQTTLVSII--------AVGMT------------------------------------------------FVI.
O28878_ARCFU/110-423IILNLALWFGLYTIV--------SLSLN------------------------------------------------IEYG
O29302_ARCFU/25-274FAVSVAALAMIYSTL--------SLSWY------------------------------------------------FMER
Q985L1_RHILO/86-358GAASWLNVASELGII--------ALPIG------------------------------------------------LLM.
Q98IE3_RHILO/52-351GIVNFLEVSAQLGIL--------AAPVA------------------------------------------------LLM.

PF08566

PAM17_CRYNJ/36-212FST....PTEPTSFH--------TQPSH------------------------------------------------STPT
PAM17_SCHPO/33-205LTL......WKTCYN--------VKTYS------------------------------------------------TESI
PAM17_ASPFU/74-246IFR.......KTAFR--------LNSTA------------------------------------------------ANAS
PAM17_DEBHA/12-177INT......IGRSVR--------FNSSG------------------------------------------------KSS.
A5DHA4_PICGU/2-166FKV......GIRAVR--------FNSTS------------------------------------------------VG..
PAM17_YEAST/25-197LRS......TATTLP--------LRSYS------------------------------------------------QPAS
A7TFJ6_VANPO/18-188ISS......MSYSTV--------TSSSS------------------------------------------------SSSS
A2Q923_ASPNC/72-247TQL....PSSLVLRR--------ANSSA------------------------------------------------AAAA
A6RWX6_BOTFB/58-240VTF......KPSTSS--------TRSAS------------------------------------------------TTTS
PAM17_CANGA/18-186LIR........PLVK--------CNARY------------------------------------------------YSDK
PAM17_CANAL/11-185FTR....RALFSGFR--------FNSTT------------------------------------------------TTTT
PAM17_GIBZE/62-235VSD......KPQPET--------VQATP------------------------------------------------QPAP
A3LZW7_PICST/19-186SGL.....RQVYNVR--------LNSSS------------------------------------------------TSTT
Q2URA5_ASPOR/67-241MPT.....YRVASMR--------ANSTV------------------------------------------------SEAT
A7S783_NEMVE/36-226TTRKSLIFVSLRNFT--------STSDS------------------------------------------------ESTS
PAM17_YARLI/17-185LVR........PSVG--------QMTKR------------------------------------------------FAGT
PAM17_KLULA/26-196VTR......NAVAIR--------MNSTN------------------------------------------------AGKT
PAM17_NEUCR/88-267STR....PRSDAELD--------ANAAE------------------------------------------------AAAA
A6R0Y4_AJECN/108-295TTT....ATSPRKFS--------TQAPS------------------------------------------------SSTS
Q0UWY5_PHANO/108-281VVR........NATS--------ASSQA------------------------------------------------TGRA
A5DXH9_LODEL/6-189LSRRCVTKGLFSKVR--------FNSTS------------------------------------------------TITN
PAM17_USTMA/50-232TFS....PTSPILFS--------ASSSS------------------------------------------------SSSS
PAM17_ASHGO/16-186LGR.........AFS--------CSAQW------------------------------------------------QQAA
Q2HF36_CHAGB/90-267AAT......PDAAAD--------ANAAQ------------------------------------------------TAAK

PF05145

ABRB_ECOLI/29-344LL--LGPMIAGIIFS--------MRG.I------------------------------------------------TLQ-
O69766_PSEPU/200-509WM--VGSLLAIILVR--------CVTPW------------------------------------------------QLT-
Q9I5H8_PSEAE/33-345WM--IGSLLAVMLVR--------CLADL------------------------------------------------PLA-
YHJN_BACSU/33-370WM--IGTLIVACCLA--------MIRPA------------------------------------------------WLM-
Q98HN9_RHILO/33-349LL--IGPMLAAIVAG--------TNG.A------------------------------------------------TVR-
Q9KLW2_VIBCH/33-345EM--FIASGLVIVLH--------KKRWL------------------------------------------------TIH-
Q9RC51_BACHO/27-340WL--LGSLLSGMVCT--------LWIKK------------------------------------------------IML-
Q99TJ6_STAAM/31-352FM--FGPIIASIICV--------KVFKL------------------------------------------------DIK-

PF01098

RODA_HELPY/1-357MALDKRIWMHFDLLP---FVFIIPLLVV------------------------------------------------SFLL
FTSW_BACSU/11-377YSLIFAIVLLCG.FG---LVMVYSSSMI------------------------------------------------TAVS
FTSWL_MYCLE/79-442PLLLPIVALLNG.LG---LVMIHRLDLV------------------------------------------------DNDV
SP5E_BACSU/10-366LLLVIITLLLLT.IG---LIMVYSASAV------------------------------------------------WADY
FTSW_ENTHR/8-376DWLILGPYLALSIVG---LLEIYSASSY------------------------------------------------RLLV
FTSW_ECOLI/46-403RTLLWLTFGLAA.IG---FIMVTSASMP------------------------------------------------IGQR
FTSW_CYAPA/41-395ATLLRWLTHFWLFFG---LMVLISASGF------------------------------------------------TSYE
RODA_BACSU/7-385QQSPFYQGDLIFIFG---VFFIISVVSI------------------------------------------------YAAG
RODA_SHIFL/18-365PTMLLILLALLV.YS---ALVIWSASG.------------------------------------------------QDIG
RODA_HAEIN/19-366FWLFIGLLAITA.YG---MLVLYSASG.------------------------------------------------ASET
FTSW_SYNY3/26-379ARLMRTLFFAWMAMG---VVVLFSASYA------------------------------------------------ESLD
FTSW_HAEIN/26-383RALFWLFVILLL.IG---LVAVTSASIP------------------------------------------------YSSR
FTSW_BORBU/9-363RTCYLLVLLLLVAYG---LVVFYTSSFF------------------------------------------------LSLE
FTSW_MYCTU/57-414FHLIIAVAALLTTLG---LIMVLSASAV------------------------------------------------RSYD
FTSW_HELPY/4-388DRNLFFCASLLIFLG---VLMSYSLSTY------------------------------------------------TTVV

PF00950

ZNUB_HAEIN/1-258EILFPA-------LLTGIVLSLITAPLGVFVVWRKMAY-------------------------------------FGDTL
P29K_STRGN/11-267HFLQNA-------LITAIVIGVVAGAVGCFIILRGMSL-------------------------------------MGDAI
ADCB_BACSU/5-263EFMRRA-------FLAGGMIAVMAPILGVYLVLRRQAL-------------------------------------MADTL
O33704_STRPN/6-264DFIQRA-------FLAVIAMSLFSPVLGTFLILRRQSL-------------------------------------MSDTL
MNTC_BACSU/10-277PNTQWV-------LAGTLLLGTASGVLGSFVLLRKQSL-------------------------------------IGDAM
O28298_ARCFU/4-264ELILRA-------LIASVLISLNASIAGTLTVFRRASF-------------------------------------LVAGS
Y360_HAEIN/10-266DYMLKA-------MILSTAVGGICAFLSSYLMLKGWSL-------------------------------------IGDAL
ZNUB_ECOLI/1-258ELLFPG-------WLAGIMLACAAGPLGSFVVWRRMSY-------------------------------------FGDTL
YCXC_CYAPA/29-287HFMQRA-------FVIGLIAALLAGIVGSFLMLQRLTL-------------------------------------LSDAI
YFEC_YERPE/10-266NYMVKA-------IWVSAIVGAVCAFLSAYLMLKGWSL-------------------------------------MGDAL
O26706_METTH/9-265QFMRNA-------AVAAILVSIACGAVGSYVVTKRIVS-------------------------------------ISGGI
YFED_YERPE/13-269PFMQRA-------IVAAIVTGVVCAILSCYLVLKGWSL-------------------------------------MGDAI
MNTB_SYNY3/19-275EFLIRA-------IWVSAFVGLVCAVLSCYITLKGWSL-------------------------------------MGDAI
Y359_HAEIN/10-266EFMQNA-------LLTALIVSIICALLSCYLVLKGWSL-------------------------------------MGDAI
Y2045_SYNY3/23-279EFMQNA-------IVASLLVSLACGLIGSFIVINRMVF-------------------------------------ISGGV
TROC_TREPA/9-276YTLQNV-------VLGTLFLGLGSGLVGSFAVLRRQSL-------------------------------------FGDAV

PF01032

B2UAJ5_RALPJ/22-333ELRLPR-------AGAAFAAGGLLAFAGALMQMLLRNP-------------------------------------LADPY
A9BXV2_DELAS/19-335QWRVPR-------VLAAALVGALLGLSGAIFQGVFRNP-------------------------------------LAEPY
A9CFY7_AGRT5/353-653PFRWPR-------LVAAIAAGGLLAMAGALLQRLTGNP-------------------------------------MASPE
A9BER0_PETMO/21-332NIRLPR-------VVGSFLVGSILAVSGNVLQLVVQNP-------------------------------------LADPY
B8FP67_DESHD/19-334QVRLPR-------IALGILVGGALSVSGASYQTLFKNP-------------------------------------MVSPD
A8MDX7_CALMQ/17-330DIRLPS-------ALTSLLVGYVLGVSGAVMQGILRNP-------------------------------------LAEPF
C3AB59_BACMY/28-334DLRIPR-------VLVGFIVGTCLAASGALLQGVMRNP-------------------------------------LADPG
A3TJ31_9MICO/19-329DSRIDR-------TLIGLVVGAAVGICGVVLQGLTRNP-------------------------------------LAEPG
Q121Y4_POLSJ/15-320DVRLPR-------MLVCALVGVGLGMAGSLLQAVTRNA-------------------------------------LASPH
A6B3C3_VIBPA/13-319QYRLPR-------MLLAIGVGAGLGLSGVLVQGVIRNP-------------------------------------LASPD
A7FSM0_CLOB1/26-347KLRLPR-------LLLAIVSGGALALVGILMQTLTRNS-------------------------------------LADPY
Q8XL25_CLOPE/21-346GVRMPR-------VLLGAFAGMALAMVGVIMQATIQNP-------------------------------------LGDPY
Q4JT73_CORJK/31-344DLRLPV-------AIATVLVGAALGLAGAWTQTMARNP-------------------------------------LASPD
Q8YHY6_BRUME/22-332EIRLPR-------ALLALLIGASLGLSGAALQGYLRNP-------------------------------------LAEPG
A4XWA5_PSEMY/361-670DLRLPR-------LLVDMAAGALLATAGMLLQAVTRNP-------------------------------------LAGPE
Q7P5E3_FUSNV/14-333FVRFPR-------IMVAVIVGGALALCGCTMQSLLKNP-------------------------------------IVDSG
Q4JT72_CORJK/24-339DLRVPR-------TLLAVITGAALAMAGAIAQSWTRNP-------------------------------------LADPG
A3ZCW4_CAMJU/19-323DGRLPR-------IIMAILIGMLLASSGAITQNVFSNP-------------------------------------IADPY
A7VD13_9CLOT/10-320TLRASR-------AVIGAIGGFVLGMAGFVYQTVFRNP-------------------------------------LASPD
Q9CLX0_PASMU/8-308DIRIPR-------ILNALLVGAALAAAGAGLQALFENP-------------------------------------LADPS
Q65LP4_BACLD/15-326SIRIPR-------ALTAALIGANLGAAGALMQAVTRNA-------------------------------------LASPS
Q6AAX5_PROAC/19-337QNRMPR-------IVTGLGVGAILGAAGVTLQAVVRNP-------------------------------------LAEPY
Q02HL3_PSEAB/28-334EIRLPR-------LLTATLVGAALGLAGAIVQAITRNP-------------------------------------LGEPG
A1B6F1_PARDP/12-324YQRLPR-------ALIAMLAGAALSMSGAVLQGVLRNP-------------------------------------LASPS
A3MG79_BURM7/44-331DIRAPR-------VVLALFVGAGFGAAGAAMQALFRNP-------------------------------------LADPG
Q6LGA6_PHOPR/15-328TLRIPR-------TLCAVIVGVSLALAASLLQSATRNP-------------------------------------LAEPG
Q9PRC3_UREPA/34-339...WKI-------ITQLLFSGIALGISGYILQRLTKNR-------------------------------------LADSS
A4E6M6_9ACTN/22-336EIRLPR-------VLSAVLLGGALSLSGFLLQTFFNNP-------------------------------------IADPF
A7VAE4_BACUN/14-334ESRLPQ-------ALTALLCGGALAVCGLMLQTAFKNP-------------------------------------LAGPS
A3YF14_9GAMM/27-354QLRLPR-------SILAILAGGGLAVAGAVLQAVTRNP-------------------------------------LADPF
Q2IWL1_RHOP2/32-347EIRLPQ-------ALMAALVGAALAVAGAELQTILANP-------------------------------------LASPF
Q24RI2_DESHY/37-351SFRLPR-------IVISMLIGGGLALSGCIIQSIARNG-------------------------------------LADPG
Q15VS6_PSEA6/37-365ELRVPR-------MFMAMFVGALLAMSGCAMQGLVRNP-------------------------------------LADPG
Q73KI5_TREDE/13-334NVRLPR-------VLVAFLAGGSLAVSGAVMQSILKNP-------------------------------------LASSY
Q6D3D7_ERWCT/30-340DLRLPR-------ALLALLVGGALAISGLILQSIVRNP-------------------------------------LASPD
A7HJN9_FERNB/19-327NLRFPR-------VLMATLTGIALSIVGNTFQAIMKNP-------------------------------------LVDPY
A5KUT8_9GAMM/358-660SIRWPR-------MLTAIFAGGGLAVAGVILQRLVYNP-------------------------------------LASPD
Q1QPP0_NITHX/33-350EIRLPR-------ILGAALVGAALASSGAAFQAVFRNP-------------------------------------LVSPG
A5LD35_STRPN/18-329K.RIPR-------TIFAILAGSSLAISGVLMQSVTRNP-------------------------------------IADPG
A3N3V3_ACTP2/14-322SYSLPR-------IVMALLAGGILGLASLLLQQVMANP-------------------------------------LASDN
A1B6F0_PARDP/27-334QVRLPR-------LLLGFMAGWSVALAGAMLQSLARNP-------------------------------------LADPS
A5I1H3_CLOBH/13-328DIRMPR-------IILAALVGIGLSVTGTSFQGIFKNS-------------------------------------MADPY
Q8XM96_CLOPE/18-333NIRLPR-------VIIAFLIGGSLGLAGAILQGVVKNP-------------------------------------LASPE
A3D7X9_SHEB5/21-359ELRLPR-------ILLAFVAGAGLSLAGSVLQTVTRNP-------------------------------------LADPY
A4F7E2_SACEN/13-332DSRLPR-------VVTAVVVGAALALAGGIAQIVTSNP-------------------------------------MADPY
A4EFI4_9RHOB/31-342QFRFPR-------TLVAGMAGALFGLSGAILQYVTRNP-------------------------------------LADPS
A6X2T0_OCHA4/30-336KLRLPR-------AVLSVLAGLSFGLGGVAFQLMLRNS-------------------------------------LASPD
A1UTS1_BARBK/10-312QTRLPR-------TAAALLSGMALALSGMIMQMLVRNR-------------------------------------FVEPS
O29818_ARCFU/18-331NIRLPR-------IVTALIVGASLAVSGAVMQCILRNP-------------------------------------LASPF
A6X5K1_OCHA4/5-313SFRGTK-------LAAMVLVAYSIAVSTVLFQTVTNNR-------------------------------------ILTPS
Q9PR75_UREPA/33-354NIRGPK-------TLMAFFSGGAIAVAGLLLQKVTRNH-------------------------------------LADTS
Q1J550_STRPF/39-345DLRFPR-------IVIALLAGAGIAVSGVLFQAVLKNP-------------------------------------ISDPA
Q81L64_BACAN/20-329MLRLPR-------AVIAILAGGALAASGVILQTLTKNP-------------------------------------LAESS
A1U5U9_MARAV/26-335ELRLPR-------TIIALITGLALGLAGALLQSMTRNP-------------------------------------LAEPG
Q8XBV5_ECO57/19-328DARLPR-------TLAGLLAGGALGLAGALMQTLTRNP-------------------------------------LADPG
Q83NW0_TROW8/17-317DFRVPR-------ILLAILVGAALSVAGAIMQVVTRNP-------------------------------------LADPG
Q8FRR5_COREF/20-326EIRAPR-------IIIAALVGAALAVSGAIMQTVFHNP-------------------------------------LADPG
A7BAW8_9ACTO/35-350DLRAPR-------IIVAILIGGGLSVAGASFQSLFSNP-------------------------------------LATPD
A4SEC4_PROVI/34-339SLRFSR-------MLMGMMTGAALAASGVVFQALLRNP-------------------------------------LAEPY
Q11VA6_CYTH3/11-326ELRMPR-------LLLALLTGSALGLSGYLMQVLVRNP-------------------------------------LADPY
A3XVW2_9VIBR/10-312VSRIPR-------LFAIVLAGAGLSVAGLIMQQIVQNK-------------------------------------FAAPS
Q6KZE8_PICTO/14-329YLREPE-------ILGAVIVGSSLGIGGAVVQSIFKNP-------------------------------------ITEPY
A3KJ26_STRAM/33-348ASRLPR-------MTAGLLVGAALGMAGAVLQAVSRNV-------------------------------------LASPD
A3YGJ5_9GAMM/37-349EFRLPR-------LLVAALCGAALAIAGVILQSITRNA-------------------------------------LASPG
A3XB47_9RHOB/28-331DHRLPR-------ILTALGAGACFGLSGAMFQTMMRNP-------------------------------------LASPD
Q1CIH2_YERPN/33-335QLRLPR-------SMAVIMVGASLAVSGAVMQALFENP-------------------------------------LAEPG
A2RI59_LACLM/16-313QLRLPR-------LISLFLTGFLLSVSGFLVQIMTRNP-------------------------------------ITEMS
A2BJ83_HYPBU/11-316RLRLMR-------TLLAVGVGTALGLSGTLVQYSVANP-------------------------------------LASPS
A8H8F5_SHEPA/17-341LIRFPR-------LLTALIVGAGLAVSGAVYQGVFRNP-------------------------------------LVSPD
A4W6Q0_ENT38/19-325YSLLPR-------LAISLLVGAGLGLVGVLFQQVLRNP-------------------------------------LAEPT
O58520_PYRHO/11-323DVRLPR-------IILAYLVGFSLALAGTASQALFRNS-------------------------------------LADPY
Q17WF3_HELAH/19-322EIRLPR-------VILALLVGASLSGSGVVMQTIFRNP-------------------------------------LVDPF
A5WEG3_PSYWF/387-689QYRLPR-------TLSAAATGVMLATAGVLLQTLTRNP-------------------------------------MASPE
A6F9M2_9GAMM/35-348ELRLPR-------IMGAIAAGALMALSGYLLQTAARNA-------------------------------------LADPG
Q5KVV1_GEOKA/17-326NLRFPR-------ALLAVLIGASLAVAGAMMQCLTKNP-------------------------------------MAEPK
Q03SH9_LACBA/15-312TLRVPR-------ILSSLICGGSLAVAGALFQAVFRNP-------------------------------------IADPS
Q87G79_VIBPA/12-323QSQLPR-------LSITLLVGAMLGLTGSLMQQLTQNN-------------------------------------LTSPL
Q631N2_BACCZ/34-330ITRVPR-------TAALMLTGAAMAMAGLVMQLITQNR-------------------------------------FVEPT
A5L0T4_9GAMM/1-312TLRAPR-------AYAGLLIGASLAVAGLLMQGLTRNP-------------------------------------LASPS
Q9PPX4_UREPA/42-345STYIFV-------PVANIITGFSLGIGSISIQITSKNI-------------------------------------LAGPS
A1S042_THEPD/21-338ALRARR-------AFVALLVGALLGGAGALTQASFRNP-------------------------------------MASPF
Q9RCF5_VIBCL/33-344YLRVPR-------TGLAILVGAALGAAGVIMQAMTRNP-------------------------------------LADPG
Q9PPX3_UREPA/27-335....YI-------IMQIFLSGFILGFCAYLIQKLTKNR-------------------------------------FSDTS
A6AQM9_VIBHA/8-312PKRLIK-------LGAIFVGGSCVAISAVIFQALVGNR-------------------------------------ILTPS
A6F9M3_9GAMM/34-346KQRLPR-------LVVAMACGAMLGLAGFSAQKMFQNP-------------------------------------LVSSS
A3ZGV6_CAMJU/15-317LTRIPR-------LIAILLTGMSLSICGLIMQQLTQNK-------------------------------------FVSPT
A1AFV0_ECOK1/14-324RLRLPR-------LAAALLTGASLGVAGALLQAVIRNP-------------------------------------LGEPH
A3JJ56_9ALTE/20-327ELRLPR-------NLLAMLGGGALGAAGAIMQGVTRNS-------------------------------------LASPG
Q6LGA7_PHOPR/59-365KIRLPR-------VVAVVVAGAALGLSGCLIQTLVRNR-------------------------------------LATPD
Q30UD5_SULDN/9-317ELRLPR-------VMFALFAGAILSISGLLFQTLFRNA-------------------------------------LMTPY
A6TAD2_KLEP7/17-327SVRLPR-------VVMALLAGGALGLCGATLQGVFQNP-------------------------------------LVDPH
A3KIF2_STRAM/39-360ELRFPR-------ALLAAVVGAGLASVGVAVQAMVRNA-------------------------------------LADPF
Q9PQ90_UREPA/27-331RKFIAT-------PIAIFLSALTLSFSGYSMQVVSRNP-------------------------------------LASPT
Q129V6_POLSJ/5-323ELRLPR-------VILAMLVGAGLAVVGTLLQTVTRNE-------------------------------------LSDPY
A6TUM4_ALKMQ/16-325DVRIPR-------VLSVLFTGGILGITGAMIQGVTRNP-------------------------------------IAEPS
A3VEF7_9RHOB/16-333TLRLPR-------VALAVLAGMALALAGALLQRVTRNP-------------------------------------VAAPS
Q4JT63_CORJK/46-360DWRMPR-------VATAIAVGSALGLSGALTQTVTRNA-------------------------------------LASPD
Q97ZU1_SULSO/12-320NIRLPT-------LTVAILIGAILSTSGAVLQMLLRNP-------------------------------------LVDPY
Q3IX97_RHOS4/12-310ELRATR-------LAALTVVGASVGVATVLFQTVSTNR-------------------------------------ILTPS
Q2JZ26_RHIEC/14-331DYRLSR-------ALVAAFCGAGLALSGAIMQSLLRNP-------------------------------------LAEPY
A4QFH8_CORGB/19-335DIRLPR-------IIAGVIVGATLAISGAAYQAVFRNP-------------------------------------LADPY
Q49VF6_STAS1/13-310QVRIPR-------TLQALLAGVGLTLAGHMFQTLLNNP-------------------------------------LADSF
A5WD74_PSYWF/27-334VSRLPR-------TLAIILTGASLAVAGMILQVVLKNR-------------------------------------FVDPS
A1RVX0_PYRIL/6-302AVRLPR-------ALGAAVSGALLGMSGLLLQTSLRNP-------------------------------------LADPY
A4VU24_STRSY/44-354DLRLPR-------MVAAILVGAAMAQAGAMMQGITRNP-------------------------------------IADPG
A6U9A9_SINMW/17-325TLRMPR-------SIAAFLAGAALAVAGLLLQIITRNP-------------------------------------LAAPD
Q76BS8_VIBMI/28-336LTYLPR-------LCVALLCGFALAVAGCIMQFVLRNP-------------------------------------IASPT
A2RG79_STRPG/17-331NIRLPR-------ILAACLGGGSLALSGLLLQRLTRNP-------------------------------------LADSG
Q5WBH7_BACSK/359-661QFRWPR-------VLVAFLVGSLLALCGVLLQSVLRNP-------------------------------------LGDPS
A6VX05_MARMS/48-354DLRLPR-------LLAALFTGAAFSLAGCLMQTMARNR-------------------------------------LATPG
A0B6B4_METTP/21-333EVRLPR-------ILLGMLVGASLSVAGAAFQGIFRNP-------------------------------------LVSPY
Q2K6T4_RHIEC/8-328DIRLPR-------IATGILAGIHFSLAGYLLQTITRNP-------------------------------------LADPS
Q7CHR7_YERPE/34-340QLRLPR-------ALVALGAGAALAISGAIFQTTTHNA-------------------------------------LASPD
Q65F32_BACLD/24-345KIRLPR-------VVLAALVGAGLAAAGAGFQGLLKNP-------------------------------------LADPY
Q83NW1_TROW8/30-337EWRLPR-------VLSAIFVGSSVALAGALFQSLTRNP-------------------------------------LCSPD
A6U3Q5_STAA2/30-338NVRMPR-------MIAGLFIGGALAVSGLLMQAMTRNP-------------------------------------LASPK
A7VNB1_9CLOT/26-334SLRLPR-------LLQGVLAGIGLSVSGVLLQSVTGND-------------------------------------LASPN
A6VN37_ACTSZ/353-655VLRYPR-------VLTALSVGILLAVAGVILQRLTLNP-------------------------------------MASPE
Q8XM97_CLOPE/21-331TSRVPR-------TLNALLVGGALGVSGLLIQALTKNK-------------------------------------LASPS
Q3JCU5_NITOC/12-323NLRVPR-------VMAAFLAGAGLAVSGMSFQALFRNP-------------------------------------LATPF
Q11M36_MESSB/26-335EYRLPR-------AMMAPLVGAALGVAGVMVQTLSRNR-------------------------------------IASPD
Q5M4D4_STRT2/13-320ESRLPR-------TLAIILASSAISLSGLLMQTISQNP-------------------------------------YAAPS
A6EUM8_9ALTE/34-356ELRLPR-------TLTGALIGVHFALSGWLLQLLSRNP-------------------------------------LAEAG
A6T636_KLEP7/15-325EWRLPR-------VLMALLIGAALGVSGAIFQSLTRNP-------------------------------------LGSPD
A7MZ09_VIBHB/22-322ELRLPR-------TLIALFGGAALAVSGSLMQDIVRNP-------------------------------------LASPN
Q9PRC2_UREPA/30-332LLFFYS-------PIVLLVCGAGLVCSGFSLQSTTRNG-------------------------------------LAGPS
A6TUM3_ALKMQ/16-333HLRLPR-------MLVGIFVGIALSTAGALLQTITKNE-------------------------------------LADSG
Q9PQD3_UREPA/50-363KVNYET-------ILQIWITGASLGASAYMFQRITKNR-------------------------------------LVDTS
A1ANB5_PELPD/15-334DGRLPR-------FLVAFLVGFSLGGAGTIMQGIFKNP-------------------------------------MASPG
A3WNU5_9GAMM/8-317DIRVPR-------MLLTWLIASALGLAGAVMQLLLRNP-------------------------------------LAEPG
Q2S814_HAHCH/54-360QIRLPR-------IAAGLVVGACLGAAGCLLQGLARNR-------------------------------------LATPD
Q9CPB8_PASMU/14-325DLRLPR-------SLVAIAMGANLAVAGALLQTITRNP-------------------------------------LASPS
Q9PQ91_UREPA/44-347KVIWQE-------VVQLIITGVALGVSSYVLQRITRNR-------------------------------------FADVS
Q7A870_STAAN/15-326GARASR-------TIIALLTGAALAVSGLLMQALTRNP-------------------------------------IASPG
Q12X02_METBU/48-366NIRLPR-------IIAGIMAGFGLGVCGCVMQAVLKNP-------------------------------------LASPF
Q8Y5U7_LISMO/26-336SLRVPR-------VVADMAVGAAFAVAGAIMQGITRNP-------------------------------------LADSG
A3KJ26_STRAM/379-687DTRVPR-------VLAALSAGAALALAGTLVQAVTRNP-------------------------------------LAEPS
Q4JUP3_CORJK/57-360RYRMPR-------VLVGILAGAAMAVSGALLQLALRNP-------------------------------------LAAPD
A6A112_VIBCL/7-312SRRVPK-------VLAMVFAGIAIAQSSLAFQTITHNR-------------------------------------ILTPS
A6F9Z0_9GAMM/16-319QLLLPT-------LLIAVLSGALLAQSGTVVQVTLGND-------------------------------------FASPS
Q8FDJ1_ECOL6/35-344DIRLPR-------VIMALLCGAMLGMAGAAMQSIARNG-------------------------------------LADPG
Q28Q47_JANSC/15-330EWRLPR-------VLAVAAVGASLALAGVMMQTVLHNP-------------------------------------LADPY
Q72EC9_DESVH/10-344DIRLAR-------VCLSLLVGGGLAMAGVVFQGVLRNP-------------------------------------LADPF
A3YGJ6_9GAMM/27-335ESRQAR-------LIVSVVVGASLALAGVMMQAISSNP-------------------------------------LADPG
Q5HJQ6_STAAC/19-328VLRLPR-------ITLAILAGAALGMSGLMLQNVLKNP-------------------------------------IASPD

PF02653

Q9YG34_AERPE/1-252RTGRVN-------LGVDGLMAVG.AAVGALAGVETGS......................................LLAGL
O06762_MYCFE/85-368KVGLFN-------IGISGQMLLPAILVFSFIAKARNFNVDAGF................................LWLAI
LIVM_METJA/5-317YAGIPN-------FGKALSVLVG.AIAVGGILDRLLM....LYFGIGGDFITGTTYATSAINNLIASNPIVGIGILILAI
Y121_MYCGE/6-281RVGIIN-------IAINGGMVFGGLFMALLSYGFTNNLNQSAPSWS.............................LFITI
Q9I6Z5_PSEAE/59-338QARVWN-------IGAEGQLLVGALAGSAVAIQLLDWQSRWA.................................LAWVL
Q98MD6_RHILO/14-287MLNFPD-------LTSEGAFPLG.GCACGVLLAAGVS......................................PLTCI
Q9CLF9_PASMU/36-307VSGGMD-------ISFGSTVGLC.AIFLGVLFKSDVP......................................LSLAI
O52371_RHITR/57-322RVRSID-------LSVSGVFAFSIYLASSGLLNSYP.......................................PFVTV
LIVH_ECOLI/11-292IIGMIN-------FAHGEVYMIG.SYVSFMIIAALMMMGIDT.................................GWLLV
Q9KWA8_AGRRH/45-310LVGGLD-------LSVGSLISFTTAILALDAP...........................................GYITI
Q98EK5_RHILO/53-315SGNELD-------LSIGTFVGFV.GCVTATWLKD.........................................APLIG
Q9I2F6_PSEAE/53-318IVGGID-------LSVGSVLALA.ASAVSLATLGWGWG.....................................VLPAA
P73350_SYNY3/7-371LMGVIN-------LAHGELMMLG.AYSTFVVQNLFQSLGDPWFDLY.............................IFAAL
Q9KZH2_STRCO/67-346IGGEFD-------LSAGVAVVTS.ALTAGMLSYQLTMN.....................................VWMGV
Q98JY4_RHILO/41-309IGRGID-------LSAVAIMAMSVAWYLQLLDTGTS.......................................DGLAF
O59405_PYRHO/50-320IAGVFN-------IGGESQLYIGAFLGLLTAYYTGN.......................................SILAL
Q98JL3_RHILO/52-340LTGGID-------LSVGTVATMS.AFIMATQIVNQD.......................................PAVAF
O83343_TREPA/7-293RSGVIN-------IALEGLMMFG.AFSTATVTVLCEPYTIAA.................................PWIAL
P74318_SYNY3/6-274ILRLSN-------FAHGDFMTLA.AYLTWWANTSGIN......................................LWLSM
Q987K1_RHILO/554-814GGSEID-------LGVGAFAGLI.SVLSATLLYD.........................................QPWLG
Y259_MYCPN/73-364SVGVFN-------IGISGQMMAGANFGFMMILKVFPESFRPAFGG..............................QIITI
O30014_ARCFU/51-321YTGQVN-------LGHTTFVGLG.AYVAAILQTPIRAGLSLH.................................PALAI
P73351_SYNY3/61-355YTGLLS-------LGHGIFFALG.GYAFAMYLNLQLPEGQLPEFFGLYGVDKLP.............LIWQPFHSLPVTV
Q98MN6_RHILO/59-339KANIWN-------IGAEGQFIFGAIFGSAIPVLFPQFEGPLV.................................LPLML
O30015_ARCFU/8-272VSRILN-------FAHGAAFVSS.AFLAYALISEGYN......................................LYLAI
Q99Q30_ENTCL/81-358RAKVIN-------IGSEGQIAVGGLASTSVALYFPDMPLVL..................................IPAAV
Q98JL4_RHILO/36-311IAGGID-------LSVAAMMALT.SVTAASMMAGASEEY....................................ALFVV
LIVM_ECOLI/110-398LSGLLV-------LGYGGFYAIG.AYTFALLNHYYGLG.....................................FWTCL
ALSC_ECOLI/52-318LVAGID-------LSVGAILALSGMVTAKLMLAGVDP......................................FLAAM
Q9HR22_HALSA/99-387RAGMFN-------IGVQGQLLLGALAAALATVYAAPLVPGGVVGTLV...........................LVPVGI
LIVH_METJA/14-293TTNVPN-------FAQGSYAIVG.SYVALTLLKLFGIC.....................................PYLSL
O29434_ARCFU/24-292YTGQAS-------LAQGAFYGLG.AYVSALLVLNGWS......................................FWASV
Q9PRD1_UREPA/65-355KAGLFN-------IGISGQMLGSGLIMLLVVKNMQIANINMPNVLG.............................QFFLL
Q98LJ0_RHILO/59-359IGGEFD-------LSIGSMVAFA.GLVFGTALVVWHVP.....................................LSVAI
Q98PV1_MYCPU/73-354KAGVFN-------IGISGQMMMG.GSVGMYLIYSQGQINHGN.................................VFGAF
O28879_ARCFU/13-293TTAVPN-------FAQGSFAIFG.SYVALTMLRLFGIH.....................................PYASL
P74455_SYNY3/5-354FAGLIN-------FGHVAFMTLG.AYATTLLSLRGLP......................................IPLAV
Y120_MYCGE/76-367SVGIFN-------IGISGQMMAGAIFGFLMILKVFPSSFRPGFGG..............................QIITV
Q98J21_RHILO/47-326LTAGID-------LSVGSLLAFC.GMVAAVVAKGGAANTLSLSTSGTQ........................GYGWFAAL
Q98JY6_RHILO/57-328LGGGID-------LSVGSIFALS.CFSAVYVFFILEQS.....................................IWLAL
Q987G4_RHILO/75-353RLGLVV-------IGGEGAIVLGGVAAAAIGAALSGAPSPIV.................................ILAMG
YTFT_ECOLI/55-321ATGGID-------LSVGAVMAIAGATTAAMTVAGFS.......................................LPIVL
O29433_ARCFU/11-282ILQIPD-------FSHGNRYMIG.AYAGFLAASVAGSM.....................................LEISY
Y260_MYCPN/10-286RVGIVN-------IAINGGMVFGGMFLSLMSYAFVPNANDSAPSWS.............................LAISI
Q988C0_RHILO/13-289KAGVLN-------IGIEGMMLAG.AYLGFVGAFYSGS......................................LWLGF
Q9RKT4_STRCO/53-332IGGEFD-------LSAGVMVTSS.ALVSSMFSYQMTAN.....................................VWVGV
Q98JJ2_RHILO/56-323ISRQID-------LSVASTLALS.GMSASLAMAFVANN.....................................WVVGA
O28878_ARCFU/110-423FAGIPN-------FGRALAVLMG.AFTVGGLVNRLLM...LAFNIQGGELKEATGRLASTVNEIIANNPAFGIGLILLSV
O29302_ARCFU/25-274RAGWVS-------LSHSIPFGLA.AY.................................................CLAIN
Q985L1_RHILO/86-358IAGHLD-------LSVGSMVPAS.SMTIAILSGHYGLP.....................................IIVGI
Q98IE3_RHILO/52-351IAGEFD-------LSVGSMIGFA.GILIAIPAVFWGWP.....................................IWLSL

PF08566

PAM17_CRYNJ/36-212GPLP..-------............LTWPSYLSLRRQ--------------------------------------...RR
PAM17_SCHPO/33-205KQKKPQ-------...........DLNWPTFLKLRKS--------------------------------------...RR
PAM17_ASPFU/74-246RAEVPK-------............LDWNSFFKLRAS--------------------------------------...RR
PAM17_DEBHA/12-177......-------............LNWVEYLNLKKQ--------------------------------------...NN
A5DHA4_PICGU/2-166......-------............MTWQQYLALKKQ--------------------------------------...NS
PAM17_YEAST/25-197LQDSSI-------............LTWSDFFKLRKQ--------------------------------------...QR
A7TFJ6_VANPO/18-188SNDL..-------............LTWTEFFQLRKK--------------------------------------...QR
A2Q923_ASPNC/72-247KSETVR-------............LDWDSFFKLRAS--------------------------------------...RR
A6RWX6_BOTFB/58-240PPSTKT-------SKSS..AAQTEVLDWNTFFKLRRT--------------------------------------...RR
PAM17_CANGA/18-186PEDS..-------............LTWTDFFQLRKQ--------------------------------------...ER
PAM17_CANAL/11-185TASQPR-------............LTWVDYFQLKKQ--------------------------------------...NN
PAM17_GIBZE/62-235SNVLPP-------............LDWNSFFKLRVK--------------------------------------...RR
A3LZW7_PICST/19-186......-------............LSWAEYFKLKKQ--------------------------------------...NN
Q2URA5_ASPOR/67-241RKEAAK-------............LTWNSFFQLRAS--------------------------------------...RR
A7S783_NEMVE/36-226RDAGAK-------KAGE..SPKQFTLGFEEFQKLKRK--------------------------------------VRARQ
PAM17_YARLI/17-185APVP..-------............LTWERFLLLRTR--------------------------------------...RR
PAM17_KLULA/26-196ASHE..-------............MTWPEFFKLRKK--------------------------------------...ER
PAM17_NEUCR/88-267AQSAAH-------AG.......EPVLDWNTFFKLRKT--------------------------------------...RR
A6R0Y4_AJECN/108-295SSASSP-------SAHSSTPPENLPLDWNSFFRLRAS--------------------------------------...RR
Q0UWY5_PHANO/108-281PPAAQP-------...........KLTWNDFFALRRT--------------------------------------...RR
A5DXH9_LODEL/6-189TTTTSG-------SP.......SGLLSWVDYFKLKKQ--------------------------------------...NN
PAM17_USTMA/50-232SPSSSR-------E........LSHLSWDKYLQLRRS--------------------------------------...RR
PAM17_ASHGO/16-186GSTSGR-------...........ELSWPDFFALRKT--------------------------------------...ER
Q2HF36_CHAGB/90-267AAATAH-------PE.......QAVLDWNSFFQLRKA--------------------------------------...RR

PF05145

ABRB_ECOLI/29-344LPRSAF.......LAAQAILGCMIAQNLTGSILTTLAV-------------------------------------NWPIV
O69766_PSEPU/200-509KSRRA........KCGQWIVGIGIGLHFTPVVMEQVLS-------------------------------------HFGLI
Q9I5H8_PSEAE/33-345EVPGAR.......KCGQWIVGIGIGLHFTPAVIEQVLA-------------------------------------HSVII
YHJN_BACSU/33-370MAPDQKGINRRWLALGQMILGIELGQKLNLSVLSVLKD-------------------------------------HWFSV
Q98HN9_RHILO/33-349VPRLLF.......GSAQAIVGCLVAASISADIFPVFYQ-------------------------------------EWPLF
Q9KLW2_VIBCH/33-345TPPWLL.......LFVQVVLGISVGATISLSELGTTLT-------------------------------------LPVIV
Q9RC51_BACHO/27-340PDRLFK.......WT.LAAIGGNIGFMLRPEQFLQYHS-------------------------------------LLGPF
Q99TJ6_STAAM/31-352WPFLLS.......ELGIVLLGVQIGSTFTKNVVMDIKN-------------------------------------NWLSI

PF01098

RODA_HELPY/1-357IFESS.-------AVLSLKQGVYYAIGFILFWIVFFIP-------------------------------------FR..K
FTSW_BACSU/11-377RYGVSS-------NFFFMRQLFALIAGGALFILMALFP-------------------------------------YKALA
FTSWL_MYCLE/79-442TGH.H.-------HTSAAQQMLWTLVGVAAFVLVMTV.-------------------------------------LK..D
SP5E_BACSU/10-366KFDDS.-------FFFAKRQLLFAGIGVIAMFFIMNVD-------------------------------------YW..T
FTSW_ENTHR/8-376AGSDP.-------KSLFIRQFLFIILSWGVIVLTYSIR-------------------------------------LQVLL
FTSW_ECOLI/46-403LTNDP.-------FFFAKRDGVYLILAFILAIITLRLP-------------------------------------ME..F
FTSW_CYAPA/41-395EHRDV.-------LYYFKRQFVFCLIGIVISNILMHFP-------------------------------------LTLLL
RODA_BACSU/7-385QFGQYG-------NTDWIQQIVFYLLGAVAITVLLYFD-------------------------------------LE..Q
RODA_SHIFL/18-365MME...-------.....RKIGQIAMGLVIMVVMAQIP-------------------------------------PR..V
RODA_HAEIN/19-366MFN...-------.....SRIIQVLLGFIVMLLMAQFP-------------------------------------PR..F
FTSW_SYNY3/26-379TSGTG.-------LSIILKQIAYLWLGLNIFNFLVRLP-------------------------------------LQ..V
FTSW_HAEIN/26-383LFNDP.-------FYFAKRDAIYVLLSLLTCYISLQIS-------------------------------------SS..Q
FTSW_BORBU/9-363LTGNP.-------NFLFFTRLNYLFLSFMVFLVFERIS-------------------------------------LN..F
FTSW_MYCTU/57-414DDGSA.-------WVIFGKQVLWTLVGLIGGYVCLRMS-------------------------------------VR..F
FTSW_HELPY/4-388LYHYGE-------FHFFIRQLVSAIIGIVIMWGLSRVD-------------------------------------PSKWF

PF00950

ZNUB_HAEIN/1-258SHSALLGVALGIFLQVN...----------------------------..PYIAIV--VLTLIL---AIAMV-WLE----
P29K_STRGN/11-267SHAVLPGVALSFILGIN...----------------------------..FFIGAI--TFGLLA---SIIIT-YIK----
ADCB_BACSU/5-263SHISLSGVAIGFFLSTN...----------------------------..ITAASI--VVVTIG---AIGIE-YMR----
O33704_STRPN/6-264SHVSLSGVAFGLVLGIS...----------------------------..PTVSTI--AIVLIA---AVFLE-YLR----
MNTC_BACSU/10-277AHSALPGVCLAFLFTGQKSL----------------------------PFFLLGAA--LAGLLG---TFCIQ-LIP----
O28298_ARCFU/4-264AHSALAGVALALFLNSIG..----------------------------..FSAHYF--LFAVIA---AVFFA-VLS----
Y360_HAEIN/10-266SHSVVPGVAIAYAFALP...----------------------------..YALGAF--FAGILA---ALSIL-WIK----
ZNUB_ECOLI/1-258AHASLLGVAFGLLLDVN...----------------------------..PFYAVI--AVTLLL---AGGLV-WLE----
YCXC_CYAPA/29-287SHSVLPGLAIAFSFGIP...----------------------------..LIFGAL--LASIIS---VIIIN-WIR----
YFEC_YERPE/10-266SHSVVPGVAGAYALGFP...----------------------------..YAAGAF--FTGMLA---ALAMT-LVR----
O26706_METTH/9-265SHAAFGGVGLGYFLGVN...----------------------------..PITSAI--PFTVAA---ALTMG-AVT----
YFED_YERPE/13-269SHAVLPGIVLAFWLGIP...----------------------------..LVIGAF--VSGIFC---AVATG-YLK----
MNTB_SYNY3/19-275SHAVVPGVVLAYALNIP...----------------------------..FAIGAF--TFGFGA---TVAIG-YVK----
Y359_HAEIN/10-266SHAVLPGIVLAYLAGIP...----------------------------..LAIGAF--FSGIFC---SLGVG-YLK----
Y2045_SYNY3/23-279AHAAYGGIGLGYYFAFN...----------------------------..PLWGAF--VFSLVM---ALAMG-WVA----
TROC_TREPA/9-276SHATLPGIVIAFLLTGTKST----------------------------EILLLGAA--LSGLVG---TVVML-MVM----

PF01032

B2UAJ5_RALPJ/22-333VLGVSGGGAVAALTAMLF..............SLPW............WLVQTSAG..AGALLS...MALVA.ALARQ.H
A9BXV2_DELAS/19-335LLGASGGAALGATVALLVPMH.......LLFGLPQA............WTLPVLAF..AGAWGS...TVLVL.AVS....
A9CFY7_AGRT5/353-653VIGVSGGAGLGFAAAITIF............PAAGL............FELFCGAG..IGSAAV...MILVL.FFA....
A9BER0_PETMO/21-332ILGISSGASFGAVLYTALSS.........IYGLSLF............LGLETFSF..LFGILA...TFIVL.ILA....
B8FP67_DESHD/19-334LLGVSAGAGFGAALAMI..............NDGSW............WQIQTTAF..TFGMIA...VIAAY.IIA....
A8MDX7_CALMQ/17-330TTGIASAAVLGGLLGYLLVLVG......KLTGLYTT............LAIPLLAL..IVGLFS...SLIVV.MLG....
C3AB59_BACMY/28-334IIGVSSGAGLVAIIIMIL.............FPQHM............AFLPLGAF..LGAFIT...AMVIY.ALS....
A3TJ31_9MICO/19-329ILGINSGAALAVVIGIKLF............ALSSV............GGYVWFAL..IGAVVT...AVVVQ.VLA....
Q121Y4_POLSJ/15-320VLGINQGAGLFVALSL...............GVLQR............WQLPTLAMACAGATLS...GALVM.LLS....
A6B3C3_VIBPA/13-319LMGISAGAGLAATACLVLY............PNAPV............AMLPMVAM..AGGLLA...AGFIA.VLA....
A7FSM0_CLOB1/26-347ILGISSGASAGATLSIVLGV..........LSSFGH............FGIALGAF..LGAMIA...SIMVF.KIS....
Q8XL25_CLOPE/21-346ILGLSSGASLGATFSILIGF..........SGVLSS............FGAPLGAF..LGALIA...SIFVY.FLA....
Q4JT73_CORJK/31-344ILGVSGGAAVLVVAGTVVTRPA......WSEELPTF............WWRAALAL..VGALVI...VGLLV.LLG....
Q8YHY6_BRUME/22-332LLGVSASASLGAVIAIYSG...........LSLLFP............LALPLLAL..AGAFVS...VFLVK.LLA....
A4XWA5_PSEMY/361-670ILGVSQMAALVVLLALIFM............PELAV............AWRFPLAW..LGAGLA...LVIVI.GLN....
Q7P5E3_FUSNV/14-333IIGISSGASLGAVIAVSLG...........LTATNI............FAMPLFSG..AFALII...SAIIY.KIS....
Q4JT72_CORJK/24-339IIGVNAGASFAVAAALTLG............WATTV............GERTLVGL..VGAAVA...ALVVL.LIS....
A3ZCW4_CAMJU/19-323IIGIASAATFGAVLAYLLKL.........ND.................YYYGILGF..VCSAFF...ALGVF........
A7VD13_9CLOT/10-320IIGVSSGASAGAAFGIL..............FLSGS............MAITVSAF..AGAVCS...VILAL.VLS....
Q9CLX0_PASMU/8-308LIGTSGGAALGVICVLAFGS.........LG.................IGVPLAAF..VGALVV...CLVIL.FAH....
Q65LP4_BACLD/15-326IFGINAGASLAVVCLTVMF...........PALAAP............QTAMGAAF..AGGAAA...ALIVY.AVA....
Q6AAX5_PROAC/19-337VLGVSAGASSGAATAIILV............GISST............FGVAGMAF..LGALAS...TAIVL.FMG....
Q02HL3_PSEAB/28-334LLGVTAGAAFAMALCMTY.............LSLPT............SAELAAST..VGGIAA...ATLTL.AIG....
A1B6F1_PARDP/12-324LVGINAGAALAVVAGAFL.............LGLEP............RAQGSAAL..AGGGLGFLASLGVA.RLA....
A3MG79_BURM7/44-331LIGVSSGAAL............................................................VY.RLA....
Q6LGA6_PHOPR/15-328LLGVNAGAVLGLVIGLTYF............DVEST............QGYLVWSG..LGALVG...NTVVL.IIG....
Q9PRC3_UREPA/34-339LLGMGNINLVILTILFLIFDFG.....QLQIQKRME............YVLPFIYL..IGSTMI...CFFIH.FLC....
A4E6M6_9ACTN/22-336ILGVSSGAKFVVALTMIVLLG........ANQAMSS............PAMVAAAF..LGSLIT...ISFVL.LIA....
A7VAE4_BACUN/14-334ILGINAGASLGVAFVMLLFGGSI...TAGVFSLSGF............FSVLLGAF..IGAMLI...MALIL.FFS....
A3YF14_9GAMM/27-354LLGASSGASLGAVAVIAHI...........GLFAGL............YSLTIASF..LGSLLS...LIFLF.ALL....
Q2IWL1_RHOP2/32-347TLGMSSAATFGAAVAIVLGIG........IPGVPRI............GIISTNAF..VFAFGS...ALLIQ.LLG....
Q24RI2_DESHY/37-351LLGINAGAGLMVILYVMFFG.........AQSFLSI............FTLPFLSL..IGAGVT...AVLVY.ILA....
Q15VS6_PSEA6/37-365LIGISGGAAAAAATALALINHY......PQLEIGGQ............YLIALSAF..IGALIA...VWIVL.IVA....
Q73KI5_TREDE/13-334TMGVSSGAALGAALVILTGF.........TLPLIPA............FTLPLAGT..LAGLLT...VYASVKVAS....
Q6D3D7_ERWCT/30-340ILGITSGASAAAVFFLSFL...........ATTISQ............RWLPLAAM..SGAWIT...AVAIY.LLA....
A7HJN9_FERNB/19-327LVGTSAGASFGALLAVYFV...........VNSIAH............VSIPTMSF..IFAVIA...SLMTI.TLA....
A5KUT8_9GAMM/358-660ILGVSAGAVLALIFSSLFM............GYSIH............SLSPWVAF..LGSAIA...LCLLL.FLG....
Q1QPP0_NITHX/33-350ILGVLGGASFGAALGILLFG.........NW.................ALIQLSAF..AMGLVA...VGVGL.LIA....
A5LD35_STRPN/18-329ILGINTGASLSVVIGLSFL............GISSS............ISHISFAI..IGGLVS...AIFVY.AIA....
A3N3V3_ACTP2/14-322TLGISSGAQFALFLTAIFL............PDWLE............YGSSAVAL..IGAALS...LILVL.SLA....
A1B6F0_PARDP/27-334LLGLSQGAMVAIMVLTVLA............PGLPP............AWLPVAAL..LGGLAV...AALLL.ALV....
A5I1H3_CLOBH/13-328VLGISSGAALGATISIVYK...........LETKGA............LVTTLCAF..IGAILT...IFIVY.NIA....
Q8XM96_CLOPE/18-333ILGISNGGAVGALVFLTIFTNP.....NNNSLTTSI............LYMPIFTF..IFSFLA...VVIIF.FIC....
A3D7X9_SHEB5/21-359LFGISSGASFGAVVMLTLFTGSGFFENAGMAANSGIFSGSGALSGLLWFSLPFGAF..IGASLS...VLIVL.ALS....
A4F7E2_SACEN/13-332LLGVSQGAGLAVSLVTVLGF.........GAGAVGM............ATLPVAAF..AGGLLA...LLFVL.AVA....
A4EFI4_9RHOB/31-342LVGVSQGASLAVVTLIVIY............PEVNI............ALRPLIAF..GGALLV...AALIQ.WIA....
A6X2T0_OCHA4/30-336IIGISSGASAAAVFAIVV.............LSLSG............PIVSIFAV..VAGLAV...ALAVY.GLS....
A1UTS1_BARBK/10-312TTGTVESASLGLLLIMMFA............PGMPV............LGKMAIAT..IFAMAG...SLLFI.FLL....
O29818_ARCFU/18-331TLGVSHGAAFGAAFAIIYLGAGMLHRTGESITILNP............YLVPFFAF..LGSLIS...VFVIL.TLS....
A6X5K1_OCHA4/5-313IMGFDALYILIQTLVVFF.............FGAVQ............IDWIGPNI.RFLAETA...IMVVF..AGTLYY
Q9PR75_UREPA/33-354VLGIGSLNIILMTVYLILIKDK.....TSSYLNPEM............RILPLVMF..LSSIFG...TSIVY.TLS....
Q1J550_STRPF/39-345IIGICSGASFMVLVSSLL.............LPQLL............LYGPIVSF..LGGGVS...FLLIY.GLA....
Q81L64_BACAN/20-329TMGIHSGAYFFLVAATIFL............PKGLQ............INSLLFTF..IGGAIT...ALFVY.RIS....
A1U5U9_MARAV/26-335LLGVSAGSGFAVALAILL.............GATTA............TLTTLAAQ..LGALAG...CTLVI.AAT....
Q8XBV5_ECO57/19-328LLGVNAGASFAIVLGAALF............GYSSA............QEQLAMAF..AGALVA...SLIVAFTGS....
Q83NW0_TROW8/17-317LLGITHGAYLAIVLGFLVG............YVTPF............WNLLIVPL..LGASIA...AGLVY.FIG....
Q8FRR5_COREF/20-326IVGVSSGAAVAAVLAIVTG...........ASFFGE............WTIPFAAF..IGAIIT...VAVVY.LIASS..
A7BAW8_9ACTO/35-350TLGVAAGTCVGAVIALL..............LDWNL............IGVQAAAL..VAGLAT...MAFTT.AIS....
A4SEC4_PROVI/34-339VLGVSGGAGLGATVSILAG...........ASLALP............LSLPVVAF..VSAVLT...LLLVY.GIAS...
Q11VA6_CYTH3/11-326VLGSSAGASLFAAVFYIWLA..........PGFASL............SVLLVLTF..AGAFGT...NIVSL.FLS....
A3XVW2_9VIBR/10-312TMGTIDCAMLGYIVGILVL............GNAAQ............WSYLGFIF..AFAVLG...TMLLV.RFL....
Q6KZE8_PICTO/14-329IIGISSGSALGAVISLFL.............GLFSF............VFLQGFSF..IFSVMT...VIFIY.IIS....
A3KJ26_STRAM/33-348TLAVNAGSYLALGLAGATG............LSLPM............IASSGVAF..LGGLAA...AAVVL.GLS....
A3YGJ5_9GAMM/37-349LIGVEAGASATMLVFVVIV...........PGIIPI............FLLPVFAM..IGGFIV...ASCVW.LLS....
A3XB47_9RHOB/28-331VIGFNAGASCGALIAIIL................TG............GNVLLGAL..IGALLT...AILVV.SLA....
Q1CIH2_YERPN/33-335LLGVANGAGVALVTAVLLG...........HGLLPI............WVLSTCAI..IGALLM...TSILL.SFT....
A2RI59_LACLM/16-313TLGISGGSSLALSLLLTLG............WSTND............GISVMVSS..LGAFIA...LAVVM.LLT....
A2BJ83_HYPBU/11-316ILGVSAGALAAASAAYIVY...........RGSPPP............AAPLAAAV..MGGLAA...YALTL.AIA....
A8H8F5_SHEPA/17-341ILGVASGCMFGAAMGLIL.............PGSSW............LMVQLLAF..ICGLTA...ACAAM.FMA....
A4W6Q0_ENT38/19-325TLGVATGAQLGITITTLW.............ALPGA............LTSQFAAL..AGACIV...GALVF.GVA....
O58520_PYRHO/11-323ILGISGGASIGAALALAYN...........P.................RYIELFAF..IGAIAA...VYLVY.SIS....
Q17WF3_HELAH/19-322LLGISSGAMLGVAVAIAIF...........E.................SNIAILAF..LGAILA...SLVVL.AMN....
A5WEG3_PSYWF/387-689VLGISSGAALGVIGGFLLLP..........AFGIKA............GALSLVGSGLAGAFLV...LLLII.WLA....
A6F9M2_9GAMM/35-348VLGLSDGAALSVIVLYVVF............SQVSL............TASILASF..FGVFVT...ALLVLWFVH....
Q5KVV1_GEOKA/17-326IMGVSAGAAAMVVLIEYFF............AGLPL............LFFSPLVF..LGAAVG...GATVY.SLS....
Q03SH9_LACBA/15-312ILGVSAAANFFKLGGALL.............LPAMW............GRNWFFAL..GGGLVA...LAILT........
Q87G79_VIBPA/12-323TLGTSSGAWLALVIVNIWF............VDWVA............DYSAFAAM..AGALVA...FGLII.SIA....
Q631N2_BACCZ/34-330TTGTIEWSGLGLLFVYLLF............PAPTL............VQRMTGAI..IFSFIG...TMIFF.LFL....
A5L0T4_9GAMM/1-312ILGINSGAACFMALAAIGV............PIVSE............LNPILNAV..IGALLS...GGAVM.ILG....
Q9PPX4_UREPA/42-345TLGFTPMAILASTISFII.............TSSGI............FSTILIYC..LGLIFSFIIIGVNF.ILV....
A1S042_THEPD/21-338TLGISQASALGVAVALVTGIGGTGGAWVLTFSRPTL..............IALFAF..AFAVVQ...VFVVL.ALS....
Q9RCF5_VIBCL/33-344ILGVNAGAILMVVIGIAGF............GLTDM............LHYLWFGL..FGAAAT...SVGVY.LLA....
Q9PPX3_UREPA/27-335IMGISSVNILGVIIIAFQVDFNN...FSADKLSTLE............HTEPIIFF..IAPIIL...CMLYY.FTC....
A6AQM9_VIBHA/8-312IMGYESVYLVWQSLLLLIA.............................GTAGSAALGVIGNFAISTLLILMY.SFAIQ.F
A6F9M3_9GAMM/34-346TLGVSSGAVFFSLCAIYF.............FNVSE............NDIFIPAF..LGAAVA...GLFTL.SMTE...
A3ZGV6_CAMJU/15-317TAGTMDCAKFGILISLIFF............TGASF............FTQAIIAS..IFALLG...SFIFI.QIL....
A1AFV0_ECOK1/14-324ILGLNAGAALAVVAASAL.............GLAFP............VGRPLLAS..TGGALL...FLLIL.LLS....
A3JJ56_9ALTE/20-327LTGVIAAAAFGMVGTQTF.............FTPDA............LWLPVISL..CGGLLG...GMLTF.VIA....
Q6LGA7_PHOPR/59-365MIGVNEGATLAITFFTLYIT.........VG.................AWPWWAAP..IGAMLA...AVILF.LLC....
Q30UD5_SULDN/9-317TLGISSGAVLGAGIAIKLGL.........GTLIFGI............SAINIFGF..LGAILT...LFLLL.YLN....
A6TAD2_KLEP7/17-327IIGVTAGSAFGGTLAIL..............LGVGS............LLMMASTF..FFGLVA...LGLIY.ALA....
A3KIF2_STRAM/39-360VLGISSGAGVGANAVLVFGA..........FGALGV............WALSTAAF..LSALAA...MTLVY.AIA....
Q9PQ90_UREPA/27-331TLGYLPAAILGLAI.................SKLAI............NQILYLPF.IIGIVFASCLIVINF.FLV....
Q129V6_POLSJ/5-323LFGLSSGSAAGAVAAITFT...........GEAFGL............WSLPLAAL..AGGLAS...VAAVL.LLL....
A6TUM4_ALKMQ/16-325LLGVSQGATLVVAIFYAVG............ITINT............TNVMMASL..IGAALS...GIIVIGFLS....
A3VEF7_9RHOB/16-333ILGITDGAAVGVVAFLWIFSDD......ANALAVSI............HWQRLAAA..LGALVF...AALVA.VLA....
Q4JT63_CORJK/46-360ILGITTGASAMAVTVIVLGGGS......GFLSWLSG............IGIPLAAL..LGAILS...ATAIW.ALA....
Q97ZU1_SULSO/12-320ISGTASGGAFGAVLTYLLLML.......NLPFSWII............YFQPLVAF..FTATLA...TLITI.MIG....
Q3IX97_RHOS4/12-310IMGFDALYVLMQTALVAVLGI........SGFAALP............GGTKFLLE..TGGLVA...AALLL.FGTL...
Q2JZ26_RHIEC/14-331VLGISAGASTGAVAIVILG............VGAGA............VSLSAGAF..AGAFAA...FFFVA.LLS....
A4QFH8_CORGB/19-335LLGVSAGSGLGVTAVIVGGTV........LGFSAPS............IGVIGAAF..VGGVAA...VLATL.MVS....
Q49VF6_STAS1/13-310TLGLASGATFGSGLAVV..............IGVSF............IWLPIFSV..LFSIMT...LILVIVLTS....
A5WD74_PSYWF/27-334MVGATQSAGLGLLLVSLYL............PTSSL............FSKMLIAT..LCAIAG...MVLFM.RLI....
A1RVX0_PYRIL/6-302VLGVSGTAMLAALGSYLLWR..........L.................WGLPYVGY.FLGAVVG...AAVVIVGLT....
A4VU24_STRSY/44-354LLGINAGAGLALIVAYALF............GGLHY............SQILLICL..LGSCLA...AGLVF.GLA....
A6U9A9_SINMW/17-325LTGVSAGAVLLIVFTFVAF............PAVSS............VFYPFIGM..SGGLLA...VALTI.WAA....
Q76BS8_VIBMI/28-336TLGVATGAELGMVLSLLLL............PTGLA............IPNFIPAF..LGGCFA...TGLVF.LLS....
A2RG79_STRPG/17-331VLGITIGAGISLAIVVSFSF.........FEQAHIS............HYLPLFAM..LGAVVT...TFSVY.WLS....
Q5WBH7_BACSK/359-661ILGITSGGGVGALSVIVLF............PSLSF............AWVPVGAA..TGAGLA...IAIIL..LA....
A6VX05_MARMS/48-354IIGIDNAAMAFAVSSVV..............GMGVS............LAPSAMAL..AGAATA...TALAF.GLA....
A0B6B4_METTP/21-333ILGLSSGAAFGAALSL...............AVAPQ............FPVQLSAL..FFSLLA...VGFAY.YIA....
Q2K6T4_RHIEC/8-328LMGVSQGATLSVTIFLLFTVYIFE.PGSNTLAELPV............AWLPAAGL..AGGLLA...GGVIY.LLA....
Q7CHR7_YERPE/34-340IIGITTGASAGVVATLL..............LWPGV............MPVPLGAF..IGACTA...VALVY.AGS....
Q65F32_BACLD/24-345TLGISSGAAVGAVVTLFFGI.........QLPVIGS............FTLPFLSV..AAAVIV...IFLVL.FFA....
Q83NW1_TROW8/30-337IIGFNAGAFAGVIIAAEL.............FGGER............TPSTLSAL..AGGFIV...AILVY.FLS....
A6U3Q5_STAA2/30-338IFGVSSGASFFIVFVTIII............PSLE.............YYALYLGV..IGAFIG...GLTVY.TLS....
A7VNB1_9CLOT/26-334IIGVNAGAGFAVILILSY.............FPAAV............MGLPLAAF..LGAFLT...TLAIM.AIA....
A6VN37_ACTSZ/353-655LLGVSSGTTMGILAVIFL............FSAQQT............QWFWLAGI..LGALIA...LFILV.AIN....
Q8XM97_CLOPE/21-331ILGINSGAVFILVIAITYI............PQISN............MGLACLSF..IGALGA...TILVY.ILS....
Q3JCU5_NITOC/12-323TLGVASGAALGAALYLRLGL.........SFALFNI............SGLSLSAF..AGALGA...ILLVY.GLT....
Q11M36_MESSB/26-335TLGLNAGASLAVVAASVGL............GISSL............AVLSLVAA..AGAFLT...SILVF.ALA....
Q5M4D4_STRT2/13-320TTGTTEAAQLGILSSLFFF............GKATL............FQKMSFAF..ISSLLF...TSLFI.QVI....
A6EUM8_9ALTE/34-356ILGISAGASLVAVVAFIIGDWVVSSADPYNNTSFAL............QYLPLFAM..AGGLVT...ALAVY.FLG....
A6T636_KLEP7/15-325VMGFNTGAWSGVLVAMVL.............FGQNL............TAIALAAM..AGGVLT...SLVVW.LLA....
A7MZ09_VIBHB/22-322LTGVMSGAALSVLTATMFLL..........P.................LPTLFWGI..VGGLLG...GAITL.SIS....
Q9PRC2_UREPA/30-332TLGIFPLAALGNILSQLI...............TKS............FSNIFIGY.VFGIIFSLFALGINF.LFI....
A6TUM3_ALKMQ/16-333IIGINAGAAVAAVIFISLRTTNY....HSVLGPLSV............YVLPSMAI..VGAGIS...AFIIY.FLS....
Q9PQD3_UREPA/50-363TLGIGNVCLIGLFFLAISINFE.....NYGSQKLFE............NLLPFIFI..ISGVCA...GLILY.WFS....
A1ANB5_PELPD/15-334VMGIDAGAALGAVLAIYLG...........LASYSL............VALPCAAI..VFSLLT...LVMVF.AIA....
A3WNU5_9GAMM/8-317ITGVSGCAALVTIACLYFG...........WLPAFS............FGLPALAL..VGGLLG...VSLLM.VLA....
Q2S814_HAHCH/54-360ILGVHQGATLAVVIAMLA.............GAGSV............LDTWWAAI..IGASAT...LLGVL.AFS....
Q9CPB8_PASMU/14-325LLSVNAGASLAMVTATAVM...........PSFFSG............YSIAFISS..IGGGLS...WLLVM.LIS....
Q9PQ91_UREPA/44-347IMGIGTINLILLCALSIPVDFT.....SANELSILQ............KKEPWIFM..FMSCCL...MVLYF.FVS....
Q7A870_STAAN/15-326LFGVNAGAVFFVIFSITFI............QIQSF............KMIVVIAF..LGAIVV...TILVV.ALG....
Q12X02_METBU/48-366TLGISSGANFGVAVAAVMGV..........GVIGGP............YLLVGNAF..LFSMLC...ALFII.ALA....
Q8Y5U7_LISMO/26-336LLGLNAGSTFMVAVCFAFM............PWLSY............NSLILFSF..VGAAIG...AFLVF.GVS....
A3KJ26_STRAM/379-687VLGVTGGGALGAVILVTTA............PVAGT............WGVAGAAF..AGSGLT...AVLVF.GLA....
Q4JUP3_CORJK/57-360TVGVTAGGGLAAVAALLSV............GSLPA............QALTPVAF..IGALVG...AGLVL.VLA....
A6A112_VIBCL/7-312IMGFDALYMFTQVLVVVL.............FGGMS............SIAMNVYW.NFSLSVA...AMLSF..STLLFA
A6F9Z0_9GAMM/16-319TIGISSGALLGAMLVNLFI............PDPSI............WMLWIAAF..ITAVMV...AGLIL.ILS....
Q8FDJ1_ECOL6/35-344LIGVKEGCSVAVLWLIFQF............PMLGM............FWRPVAGL..AGGLLV...ALIVI.FCA....
Q28Q47_JANSC/15-330LMGLSSGASAAAVGTILWAP..........AWVAST............FGVPVIAF..CGAVAA...FAMTL.GLS....
Q72EC9_DESVH/10-344TLGVSSGAALGASVAISFGVTLPAAVAPALVAGLGV..............VTPAAL..FGAFAA...LSLVL.LLG....
A3YGJ6_9GAMM/27-335LLGINSGAAFFVVASLLFF............PMFGQ............GYVPVFAF..LGAAFA...ALLVM.MLS....
Q5HJQ6_STAAC/19-328IIGITGGASLSAVVFIAFF............SHLTI............HLLPLFAV..LGGAVA...MMILL.VFQ....

PF02653

Q9YG34_AERPE/1-252AAGALAGGVGSLSYIILT------------------------------DRLGVNMI--.........VAGLL........
O06762_MYCFE/85-368ILFIIVGFATGAIAGLLK------------------------------AYCKIHEV--.........ISTIF........
LIVM_METJA/5-317ILASILGFVVGAIFILPS------------------------------AKLKEDYL--.........GITLL........
Y121_MYCGE/6-281PLSVLFSSVIGCLFALAA------------------------------VKLRADHV--.........IVGTG........
Q9I6Z5_PSEAE/59-338LAGTAAGALWAGFAAWLR------------------------------TRFNANEI--.........LTTIM........
Q98MD6_RHILO/14-287VVAFGAGFAAGCCTAFIH------------------------------LRFRIHTL--.........LAGIL........
Q9CLF9_PASMU/36-307PLTFLVGILCGVVNASLI------------------------------LYTKVNPL--.........VITLG........
O52371_RHITR/57-322LMTIVIGLAVGLINGALV------------------------------AYVRASAV--.........IATLS........
LIVH_ECOLI/11-292AAGFVGAIVIASAYGWSI------------------------------ERVAYRPV--RNSKRLIALISAIG........
Q9KWA8_AGRRH/45-310PAVFLLAALLGLTNGYVI------------------------------TRLNVHPI--.........IATLA........
Q98EK5_RHILO/53-315VAILLGSIGVYALLGALI------------------------------HLRNLPSI--.........VVTLG........
Q9I2F6_PSEAE/53-318MLGMACATLAGCVTGSIT------------------------------VAWRIPSF--.........IVSLG........
P73350_SYNY3/7-371PVAFLVAAIAGLVLERQV------------------------------IRYLYGRP--.........LETLLATWGVSLI
Q9KZH2_STRCO/67-346VVALVASLAVGAFNGWVL------------------------------VKTGLPSF--.........LVTLA........
Q98JY4_RHILO/41-309AYVLSGVLVIGLLNGFLV------------------------------AYADVPAI--.........FVTLA........
O59405_PYRHO/50-320IVGALSGGLLGLFVGALR------------------------------VYRGINEV--.........ITAIM........
Q98JL3_RHILO/52-340LLAMMPAVLIGLVNGIGV------------------------------GVFRVHPL--.........IMTLG........
O83343_TREPA/7-293GVGMAVAASVALFYAYLS------------------------------VRLCSDQI--.........IAGTA........
P74318_SYNY3/6-274ALGCVGTIIAMFIGEWLL------------------------------WKPMRARR--.........ATATT........
Q987K1_RHILO/554-814ALALFVAVAAYAGLGGLI------------------------------QARKIPAI--.........VVTLG........
Y259_MYCPN/73-364LLMILGSVTVAMVVAALK------------------------------VFFKVNEV--.........VSAIM........
O30014_ARCFU/51-321ITGGVVAAGVGLSIGIIT------------------------------LRLRGYYF--.........SLVTA........
P73351_SYNY3/61-355LAMVLVPGAIAALLGYLI------------------------------FRNRIKGV--.........YFSIL........
Q98MN6_RHILO/59-339LLGMVGGAAYAAIPAFLK------------------------------TRFNTNEI--.........LTSLM........
O30015_ARCFU/8-272LAGLLLSALIGLAVYALT------------------------------KPVRDREV--.........MVIIL........
Q99Q30_ENTCL/81-358VAGAVGGAAWAGIAAVIS------------------------------VKRGVHVV--.........LTTLL........
Q98JL4_RHILO/36-311PFVLAMGLVLGALNGLLI------------------------------VVTRVPDI--.........VVTLA........
LIVM_ECOLI/110-398PIAGLMAAAAGFLLGFPV------------------------------LRLRGDYL--.........AIVTL........
ALSC_ECOLI/52-318IGGVLVGGALGAINGCLV------------------------------NWTGLHPF--.........IITLG........
Q9HR22_HALSA/99-387VAGALAGGVWGAIPGALK------------------------------AYADANEV--.........ITTIM........
LIVH_METJA/14-293PVLFVVGAIVGLITY.LA------------------------------LKPLIKRN--.........ASVEI........
O29434_ARCFU/24-292IVAIAFVAFVAFLIGLMT------------------------------LRLKGAYF--.........AIATL........
Q9PRD1_UREPA/65-355IIAMLAGAMFAVFIGILK------------------------------VFLKINEV--.........VSSIL........
Q98LJ0_RHILO/59-359LVAVAFAVFIGVTNAQIT------------------------------MRTGLPSF--.........IVTLA........
Q98PV1_MYCPU/73-354IISILLGGLWALIAGIAK------------------------------SFFKVHEV--.........VSTIL........
O28879_ARCFU/13-293PVAFALGGLLGIATYILI------------------------------LRPLIRRG--.........ASVVI........
P74455_SYNY3/5-354LVGMGLAMALGLLIGTST------------------------------LRLREDYL--.........AIVTI........
Y120_MYCGE/76-367LLMVIGSVSVAVVVATLK------------------------------IFFKVNEV--.........VSAIM........
Q98J21_RHILO/47-326LAAVIVGAAAGGVQGLAI------------------------------TRLKVPPF--.........VVTLG........
Q98JY6_RHILO/57-328AASLATGLIFGAINGYLV------------------------------GYLRLRAF--.........LTTLV........
Q987G4_RHILO/75-353VGGLAAGGTWIGAVGALR------------------------------HYRAVNET--.........ISSLL........
YTFT_ECOLI/55-321LSALGTGILAGLWNGILV------------------------------AILKIQPF--.........VATLI........
O29433_ARCFU/11-282VAAILGAVAVSSVIAVLS------------------------------YLFVYKRL--.........LSAPH........
Y260_MYCPN/10-286PLSVIFASAVGFLFGIAA------------------------------IKLKADHV--.........IVGTG........
Q988C0_RHILO/13-289LTGAAGGVAVALIMALLC------------------------------VCIGLNQI--.........VIGIA........
Q9RKT4_STRCO/53-332VVSLLVTLAIGAFNGFML------------------------------TRTKLPSF--.........IITLG........
Q98JJ2_RHILO/56-323AAGLGTGALIGLLNGVLT------------------------------TRLEIPSF--.........LVTLG........
O28878_ARCFU/110-423VLAMIIGAVTGALFILPS------------------------------AKLSEDYL--.........AITLL........
O29302_ARCFU/25-274PFLILLSVVASLLIFLGL------------------------------SRLGRENF--.........PFATF........
Q985L1_RHILO/86-358LAALGLGLAVGFVNGVLV------------------------------IRTKVPSF--.........VVTLA........
Q98IE3_RHILO/52-351LFTFAVCGGIGALNGLAV------------------------------VRTGLPSF--.........IVTLG........

PF08566

PAM17_CRYNJ/36-212LWSTLTSVPTTFLGLFLGG-----------------------------GYFASLEA------------------------
PAM17_SCHPO/33-205IFETLTSIPTALTGLGLGS-----------------------------AYFLTRTV------------------------
PAM17_ASPFU/74-246RYTLASSIIASMASTIIGV-----------------------------QILSEQDL------------------------
PAM17_DEBHA/12-177RLNVASSAFTSLAGAFITL-----------------------------TYLGNIEI------------------------
A5DHA4_PICGU/2-166RINTVMSAFTAAGGALATL-----------------------------SYMGNLEI------------------------
PAM17_YEAST/25-197RINVGSSLFTALLGCNVSW-----------------------------AYLSTMEI------------------------
A7TFJ6_VANPO/18-188KINVGSSAFTALVGANVSW-----------------------------AYLSTMQI------------------------
A2Q923_ASPNC/72-247RYSLASSIVSSLFTTVIGV-----------------------------QVLSTQDL------------------------
A6RWX6_BOTFB/58-240WFQLGSSIGTGFGGFAIGA-----------------------------QILTHTDM------------------------
PAM17_CANGA/18-186RINVGSSVFTALVGANVSW-----------------------------AYLSTMEI------------------------
PAM17_CANAL/11-185RINTIAGVFTGLGGAFITL-----------------------------SYLGNIEI------------------------
PAM17_GIBZE/62-235RYQMLFSITNGIFAGSGGA-----------------------------IFLSTGSA------------------------
A3LZW7_PICST/19-186IINTGASVFTGLAGGFVTL-----------------------------TYLGNIQV------------------------
Q2URA5_ASPOR/67-241RYSLASSVVSSMASTFIGV-----------------------------QVLSSQDL------------------------
A7S783_NEMVE/36-226RVAGLPVAAVALMTSSAVS-----------------------------AYLNPNMF------------------------
PAM17_YARLI/17-185QINFVASIFTGVATSVLAW-----------------------------GFISEAEL------------------------
PAM17_KLULA/26-196VFNTASSVATAIVFVNGSW-----------------------------FYFSTLEI------------------------
PAM17_NEUCR/88-267RVQLAFSVIMTLITSGAGG-----------------------------AVLSTGVA------------------------
A6R0Y4_AJECN/108-295KYSLVSSIIASVFSTAGGV-----------------------------QVFVANNM------------------------
Q0UWY5_PHANO/108-281RIGQGCSVVGAVGVTYYGL-----------------------------TTMMANGY------------------------
A5DXH9_LODEL/6-189RINMVSGVITGLGGSLLTL-----------------------------GYLGNIEI------------------------
PAM17_USTMA/50-232LAGMVTTIPTTLLAGAAAG-----------------------------SYFLTLEL------------------------
PAM17_ASHGO/16-186RINTGSSVLTAFLTANCAW-----------------------------AYISTVQI------------------------
Q2HF36_CHAGB/90-267RWQSGFSVVGALGSGSSGA-----------------------------LVLSSGMA------------------------

PF05145

ABRB_ECOLI/29-344LAILLVTLLSSAIVGWLLVRYS--------------------------SLPGNTGA--WGSSPGGAAAMVAM--------
O69766_PSEPU/200-509FFGALVTSLSAVVGVWLMRRTG--------------------------EDR.ATAF--FSSMPGGSGEMVNL--------
Q9I5H8_PSEAE/33-345VFGAVATTLSSVLAIAFMRRSG--------------------------EDR.ATAF--FASMPGGASEMVNL--------
YHJN_BACSU/33-370GVMLILSILLAMLSGYVLWRFS--------------------------KTDMMTSF--VGTAPGGLSAMPSI--------
Q98HN9_RHILO/33-349LGVVIATVAASSLLGWLISRWR--------------------------ILPGTTAV--WGSSPGAATAMVLM--------
Q9KLW2_VIBCH/33-345GLVCCLTLQIISSYLWLTKKEG--------------------------WTP.FESL--LGAVPGAMAAILVI--------
Q9RC51_BACHO/27-340VVTLVLTLCGGILLGKFLKRFS--------------------------NVNHNTAF--FCCMPGGASEVIAL--------
Q99TJ6_STAAM/31-352IVVSISILLIAIVMAFIFKKIA--------------------------RINTETAI--LSVIPGALTQMLVM--------

PF01098

RODA_HELPY/1-357LGRWLFVFYWACVILLALVDF....MGYSKLGAQRWLVIPFIS-----ITLQPSEPVKIAILLL---LAHLIKIN.....
FTSW_BACSU/11-377HQKFQKGILLVSVLALISLFV....FGHVAGNAQSWFKIG..G-----MSIQPGEFVKLVVILY---LAAVYAKK.....
FTSWL_MYCLE/79-442HRQLARYGYISGLTGLVFLAIPA..PLPEQNGAKIWIRFP..G-----FSIQPAEFSKILLLIF---FAAVLVAKRSLFT
SP5E_BACSU/10-366WRTWSKLLMVICFFLLVLVLIPG..VGMVRNGSRSWIGVG..A-----FSIQPSEFMKLAMIAF---LAKFLSEK.....
FTSW_ENTHR/8-376KPRIIKAGLIVSGLLLAMMKLGI..FAVTVNGAQRWVSIA..G-----IQFQPSEIATIFLILY---LSRFFRN......
FTSW_ECOLI/46-403WQRYSATMLLGSIILLMIVLV....VGSSVKGASRWIDLG..L-----LRIQPAELTKLSLFCY---IANYLVRK.....
FTSW_CYAPA/41-395KYSNIPFFFIFGLTILTLMPN....IGISINGARRWIAVY..G-----FLVQPSELIKPFWVLQ---ISKIFGQ......
RODA_BACSU/7-385LEKLSLYIFIIGILSLIILKISPESIAPVIKGAKSWFRIG..R-----ITIQPSEFMKVGLIMM---LASVIGKA.....
RODA_SHIFL/18-365YEGWAPYLYIICIILLVAVDA....FGAISKGAQRWLDLG..I-----VRFQPSEIAKIAVPLM---VARFINR......
RODA_HAEIN/19-366YQRIAPYLYLIGFVLLILVDV....IGTTSKGAQRWLDLG..F-----IRFQPSEIVKLAVPLM---VAVYLGN......
FTSW_SYNY3/26-379CLKLVPWFLIVVLLLIFLTKSG...LGVEVNGARRWISLG..P-----ILIQPSEFMKPCLVLQ---AANLFGN......
FTSW_HAEIN/26-383WEKWHAKIFLFSVILLLLVPF....IGTSVNGAKRWISLG..I-----LNFQPAEFAKLALTCF---LASYFTRR.....
FTSW_BORBU/9-363LKKSIFPVLIITLFLIMATFL.....SPSISGAKRWIFFQ..G-----VSIQPSEIFKISFTIY---LSAYLSKF.....
FTSW_MYCTU/57-414MRRIAFSGFAITIVMLVLVLVPG..IGKEANGSRGWFVVA..G-----FSMQPSELAKMAFAIW---GAHLLAAR.....
FTSW_HELPY/4-388SRLGFFLLFVPPLLIIGMFFLPE.SLSSSAGGAKRWIRLG..F-----FSLAPLEFLKIGFTFF---LAWSLSRTFV...

PF00950

ZNUB_HAEIN/1-258-----SNTQFSIDTLLGIIAHSCLSLGVVTVG-LL-----RN....---------------V-RVDLMNYLFGDL--L-A
P29K_STRGN/11-267-----GNSIIKSDTAIGITFSSFLALGIILIS-VA-----K.....---------------S-STDLFHILFGNI--L-A
ADCB_BACSU/5-263-----RAYRTYSEVSIAILMAAGLSFAMFLIS-LS-----KG...T---------------A-NMSIDQYLFGSL--V-T
O33704_STRPN/6-264-----TVYKSFMEIGTAILMSTGLAVSLIVMS-KG-----KSS...---------------S-SMSLDQYLFGSI--V-T
MNTC_BACSU/10-277-----RLSKTKEDSAIGIVLSVFFGVGIILLT-YI-----QQQGAG---------------S-QSGLDSFLFGQA--A-S
O28298_ARCFU/4-264-----AKAARRGDVNVGIATAFSLSMALAAIF-IA-----MTRN..---------------S-ASNAWQFLFGDV--L-L
Y360_HAEIN/10-266-----SISKLKEDAVIGFIFSTFFALGLLIVS-LN-----P.....---------------T-AVNVQNIILGNI--L-G
ZNUB_ECOLI/1-258-----KRPQLAIDTLLGIMAHSALSLGLVVVS-LM-----SN....---------------I-RVDLMAYLFGDL--L-A
YCXC_CYAPA/29-287-----TESRLKEDTAIGIVFASFFGLGILLIS-VI-----QKE...---------------N-KVDLNHFLFGNI--L-G
YFEC_YERPE/10-266-----HITRLREDAIIGFIFSTFFAVGLLIVS-LN-----P.....---------------T-SVNVQSIIFGNI--L-G
O26706_METTH/9-265-----RRTRISEDTAIGVLWSAGMALGILFIN-LS-----PG....---------------Y-APDLFSYLFGNI--L-M
YFED_YERPE/13-269-----ENSRVKEDTVMGIVFSGMFAFGLVLFS-RI-----D.....---------------T-DQHLSHILFGNM--L-G
MNTB_SYNY3/19-275-----SKTRLKEDAVIGIVFTGFFALGLVLVT-KI-----P.....---------------S-NVDLFHILFGNV--L-G
Y359_HAEIN/10-266-----ENSRIKEDTAMGIVFSGMFAIGLVMFT-KI-----Q.....---------------T-EEHLTHILFGNV--L-G
Y2045_SYNY3/23-279-----RKYQQRSDTLIGVMWALGMAIGIMLID-LT-----KG....---------------Y-KADVASYLFGSI--L-T
TROC_TREPA/9-276-----RTTKIDTDGAQGIVLGVFLGFGFLLLT-HV-----QKSPQA---------------A-KAGLNKFILGQA--A-T

PF01032

B2UAJ5_RALPJ/22-333LWRGEPGEANARLLLGGVVMASGWVGLITLIL.TV-----A...PEN..............K-LRGMIFWMVGDL..G.G
A9BXV2_DELAS/19-335..RVAGATDAAGMLLAGVALAAVLGALRSFLM.LA-----LS.DETV..............S-LQVVLSWVLGGI..Q.T
A9CFY7_AGRT5/353-653...VRRHLAPEKILLAGIAVSSLCSAVLSALL.AI-----....GDQ..............R-AWQILAWLSGSG..S.T
A9BER0_PETMO/21-332..RQGKKLPVLSLILSGVIISFLFNSFTTLFT.VM-----....YWG..............N-LIHVNTWLMGST..A.D
B8FP67_DESHD/19-334..YVFGRQTITILILGGVVVSSLFQSLISIIK.TL-----A..DTEN..............Q-LPAITFWLMGGL..G.K
A8MDX7_CALMQ/17-330.....SRLGVVGLILMGILITLLSYAASMIVM.LI-----IESINPT..............V-SMQPLYLLYGNL..S.G
C3AB59_BACMY/28-334...WQKGAPPSRIVLVGVSINALIGAATSALM.LL-----....HSD..............K-VQSVLPWLAGGI..G.G
A3TJ31_9MICO/19-329.LLAPVRAQPVTMALAGAAVMATSTSIVGAIL.VS-----....DQG..............A-LDVFRFWQVGSV..A.G
Q121Y4_POLSJ/15-320.GLHRGRASGVRLVLSGVALSSLLAAMTDGAV.ML-----....NDE..............L-GVSIVAFMAGSV..D.G
A6B3C3_VIBPA/13-319...YWSKPTPARLALIGVAVSAFLASGIDFLL.IV-----....HPI..............E-INTAMVWLTGSL..W.G
A7FSM0_CLOB1/26-347..GVSKVYSKTKLILTGVAVSSIFTAVTNFII.TF-----A..RNDS..............L-VKSAVFWTIGSL..A.G
Q8XL25_CLOPE/21-346..KIGGRITPFKMILAGMVISSICSSLTSLII.FL-----S..KDNE..............G-IRTVNFWMMGSL..A.G
Q4JT73_CORJK/31-344.....GFGTSQRVVVIGLALSFLTQSLVQYLL.LR-----A...DLT..............R-ATDAQTWLAGST..G.F
Q8YHY6_BRUME/22-332....GRNAGTLAVILAGVAVTSLAGALTALAL.NL-----S..PNPF..............A-AMEIMFWMLGSL..A.D
A4XWA5_PSEMY/361-670...LRHGLEPLRVTLTGFAISGVVLAVVSLLM.AQ-----....FTS..............N-IAQALIWMVGSS..Y.G
Q7P5E3_FUSNV/14-333..TLRGRTDNLLLILSGIAIGSFVGAITSVIL.TS-----L...AET..............E-MKEYIFWAMGSL..N.G
Q4JT72_CORJK/24-339....RVSRNPLTLVLVGVGVTFALQAATNMLS.LY-----....SSD..............T-LEGLRRWTVGST..A.G
A3ZCW4_CAMJU/19-323..KISSKASIATLLIIGIAASSFLGAFTSFFT.YL-----....IGE..............D-SFKIVAWLMGNI..G.N
A7VD13_9CLOT/10-320..FLTADRNGHSIVLAGIAVHSLAQTALVCLK.LI-----A..DPEK..............Q-LASIEYWIMGSL..N.G
Q9CLX0_PASMU/8-308...HVFGGGTLGLLIMGFILSAFCSAVVGLIL.FL-----S...DDL..............V-LRSATIWLAGSL..S.E
Q65LP4_BACLD/15-326.SVFSEHDRDISFALIGVVIQAILASMTQMLL.IF-----....HEE..............S-TETLLFWLSGSL..A.G
Q6AAX5_PROAC/19-337...GGRNSSTLRLILAGLAVGFVFQALTNFII.FS-----S..DSPE..............T-ARAVMFWTLGDL..S.R
Q02HL3_PSEAB/28-334...MGARLDPLYLTLTGMSINLFFAAAIIVML.VS-----....ANV..............E-VNGIYYWLTGSL..I.N
A1B6F1_PARDP/12-324..GHAHDPRGLALILSGAIVSMFLGGLTQALL.LS-----....DPA..............L-RQDYLGWLGGNV..S.H
A3MG79_BURM7/44-331..VARGRLALPLLLLAGIAINALAGAGIGLLT.YL-----A...DDA..............Q-LRSLTFWSLGSV..G.G
Q6LGA6_PHOPR/15-328..HLVGKSHPLKLILVGVALSATFGGLSNYVL.LS-----....NQV..............V-LDQFRFWNLGSL..A.A
Q9PRC3_UREPA/34-339..NSSTGYIFKRIIVSGIIINLITIVIAQSLR.IL-----M...SKE..............S-SMYLKTILLGNI..E.S
A4E6M6_9ACTN/22-336....RRISSMAMLIVAGVMVGYICSAATNFLI.AF-----A...DDQ..............S-IVNLHNWSLGSF..S.G
A7VAE4_BACUN/14-334....TLIKSNVMLLITGIMIGYIASSAIALLN.FF-----A...TAE..............G-VQSYMIWGLGNF..G.G
A3YF14_9GAMM/27-354..SKKTNQSPDKIILAGVAISFLLMAATNFLI.YL-----G...DQS..............T-ANSILFWMLGGL..G.R
Q2IWL1_RHOP2/32-347...RLRGTDGQTHVLFGIALFFTFNALVAIMQ.FI-----A...TEQ..............A-LQQLVFWTLGSV..T.R
Q24RI2_DESHY/37-351.FKKGEGIAPMRLVLTGVAVQAGISALTTLLV.VK-----L...DDT..............Q-FDFVATWQAGSI..W.G
Q15VS6_PSEA6/37-365..RTPAGMAISSLILAGVAVNALSGTHIGAIS.YM-----A...NDD..............A-LRQITYWTMGSL..G.G
Q73KI5_TREDE/13-334..LVDRNFENSTIILTGIVFSLFINGIITIII.AL-----....NRD..............G-MARLIFWQMGSF..A.S
Q6D3D7_ERWCT/30-340...WKQGASPLRLVLVGVGLSAIMGAAVTMML.VF-----S...PIG..............T-TLTAYVWLTGSI..Y.G
A7HJN9_FERNB/19-327..RKGSVIPVVHLVLSGVLVSTMFSAGSMLLL.NI-----....AQK..............T-LVTGHVWLFGSF..S.G
A5KUT8_9GAMM/358-660...KKHQFAPSILILTGISLTAVLEALVQFSL.TR-----....VGE..............G-KYTLLAWLAGST..Y.R
Q1QPP0_NITHX/33-350..NMFGQASMIMLVLGGMISAALFTSALSIVK.YT-----A..DPYE..............Q-LPAIVYWLMGSL..G.G
A5LD35_STRPN/18-329.VSGKAGLTPIKLALSGTCVSMALSSFVSFLI.LP-----....NNN..............V-LDKFRFWQIGSL..G.A
A3N3V3_ACTP2/14-322...MRKTMSPLLLILAGLVVNLYFGSFSALMM.LF-----....YPE..............E-SRGLAQWGAGSL..V.Q
A1B6F0_PARDP/27-334....RGHAGGLAVLLMGIALESTLSAVTAVLV.LY-----T...PPE..............T-SHALAGWMAGSL..A.L
A5I1H3_CLOBH/13-328..RVGNKIPTTTLLLAGIALNFFMSSLISMSM.IL-----....HKE..............A-IDRIVYWTMGSL..G.N
Q8XM96_CLOPE/18-333....GKSTSTKKLIIIGVGVSAIFKALTNILI.IN-----G...PIV..............F-MKEATTWLTGSI..Y.G
A3D7X9_SHEB5/21-359..GLGLNSQVERMLLSGVATSFMFGALTSLLL.YF-----A...SPQ..............A-TASVLFWSLGSF..A.K
A4F7E2_SACEN/13-332....GRSGSVTTLVLGGLAVGEVAYALTSLVL.HA-----F..ATGD..............Q-AKQVLFWITGGL..G.A
A4EFI4_9RHOB/31-342..MQRTGGATMRFILTGIGVAAFISAVTTSML.TY-----G...NID..............Q-AQSALGWLAGSI..H.A
A6X2T0_OCHA4/30-336...FRNGIAGTRLILVGIGVSAMLESFIAYIL.SS-----A...PAW..............S-LQEAMRWLTGSV..N.G
A1UTS1_BARBK/10-312..YQIPLKSTLIVPLTGIMLGYVISALTNTIA.DY-----E..T.................L-LPSLQAYLFGSF....A
O29818_ARCFU/18-331...RIRSFTPEAMILTGVAMASLFQAATMLMQ.YF-----A...EDV..............M-VASVVFWTFGDM..G.R
A6X5K1_OCHA4/5-313WLFSGATRSLHLIMLVGIVCGVFFRSISNLMQ.RM-----L...DPN..............L-FAVLQDRFFASF..N.T
Q9PR75_UREPA/33-354...KLGRANNEKFIIIGIALNFLFEAISVVLI...-----....NPANNSLFSNQDKNLMIA-FENIKNYTLGIIPNSQY
Q1J550_STRPF/39-345...WKKGLNPIRLILTGIAINALFMGLSTALT.SF-----....FTS..............A-SPMVNALLAGHI..S.Q
Q81L64_BACAN/20-329...GEKKGTPLRMALAGMVVTLMLSAFTGTMQ.LF-----....YEN..............E-TAGLFLWGAGSL..I.Q
A1U5U9_MARAV/26-335.RVQGLGNDPVRLVLAGATMTGLLLALTSMLM.LM-----....DQR..............A-ADEIRFWITGSV..A.G
Q8XBV5_ECO57/19-328..QGGGQLSPVRLTLAGVALAAVLEGLTSGIA.LL-----....NPD..............V-YDQLRFWQAGSL..D.I
Q83NW0_TROW8/17-317.....NIVTPGQLILVGVALTALISGLARSVA.LI-----....NQD..............I-FDVIRHWAVGSL..D.Y
Q8FRR5_COREF/20-326RAMDGRGADPATLVLVGLAITAFLGAVISAAT.AN-----A..PQDS..............E-LRSVTFWLNGDL..V.S
A7BAW8_9ACTO/35-350.RTRTGAFNVITLVLGGVIVSALANAVLSLLK.LT-----A..DPTS..............Q-LPEITYWLMGSL..A.A
A4SEC4_PROVI/34-339.QGSAGQPSVYSLILSGVIVSAICSSIIMFLV.ST-----A...SVD..............G-MHNVIWWMLGSL..Q.P
Q11VA6_CYTH3/11-326..TVNGRIVPYRMILVGIAISSLAIALLSLML.YT-----S..GADQ..............S-WKNIIFWTFGSF..Q.T
A3XVW2_9VIBR/10-312..QHLKFKNAVLVPLIGIMYGNVISSLTTFIA.YK-----Y..D.................L-VQTMSAWTMANF....A
Q6KZE8_PICTO/14-329..VRHGYSNILYLLLTGISVSFFLSSIMAFLL.FS-----....DIK..............I-EDEAFFWLLGSL..Q.G
A3KJ26_STRAM/33-348....GLGTGTVRLVLAGTALMLGLNSMTEGLL.LL-----....FPE..............Q-TEGLYQWNQGSI..A.Q
A3YGJ5_9GAMM/37-349...SLRGYSPIRLVLIGVGITSMLSAFSEMLI.TY-----G...DID..............F-VESALMWFGGSL..H.Q
A3XB47_9RHOB/28-331...WKEGLPPQRLVLIGLGIGFALAALSDLLL.SR-----T...DAR..............T-AADMAEWLIGTL..N.A
Q1CIH2_YERPN/33-335...RRRLLTNAQLLLVGVALGIICSAMMTWAV.YF-----S...TSL..............D-LRQLMYWMMGGF..S.G
A2RI59_LACLM/16-313...ARTHFQPLKVVLVGTSVGLFATSLASSMT.F.-----....ASH..............D-KQAYFRWIVGSF..S.G
A2BJ83_HYPBU/11-316...SRAGLTRVSMVLAGIAVSSSLAGIASMLV.IY-----I...NAR..............Y-HVASALLLMGSF..A.Y
A8H8F5_SHEPA/17-341..KRFGSNSLLLMIMTGIIVGSIFGAGLTMLK.AL-----A..DPYG..............E-LPAIVFWLMGSL..S.V
A4W6Q0_ENT38/19-325...WGKRLSPVTLILAGLVVSLYCGAINQLLV.LF-----....HHD..............E-LQSMFLWSTGTL..T.Q
O58520_PYRHO/11-323..KVNGHIPVDVLLLAGIAVGFFSHAITSYIL.YM-----....NKD..............R-IHEGLVWLFGTF..A.L
Q17WF3_HELAH/19-322...RVLGNSVLSLVLSGVVLSAFLGALAGAIK.FF-----V...IPQ..............K-AQAIVVWLLGSL..S.L
A5WEG3_PSYWF/387-689.....RKVTPAYLLLVGIGIAAMMDGIMSMVK.LS-----....GDP..............R-LEAMLSWLSGTT..Y.S
A6F9M2_9GAMM/35-348.....KNLNGTFIVLVGIAVGAVVSAFSDILL.SS-----V...TIE..............D-MAFLMAFLSGSF..L.S
Q5KVV1_GEOKA/17-326..LKRGSLSPVRLTLAGVAVSAFLHAITVGIL.VL-----....LGQ..............D-AAAVYAWLAGGL..N.G
Q03SH9_LACBA/15-312..SGRALADPYRLIIVGVALDATFVGLQQLLS...-----......................-.SGATQISSSTF..N.G
Q87G79_VIBPA/12-323...GVRNMTGLPLVVSGMVINILLGSIATALI.IL-----....NAQ..............F-AQNIFMWGAGDL..S.Q
Q631N2_BACCZ/34-330..RRVKLRSSLIVPIIGLMLGAVISAVSTFMG.LL-----F..Q.................M-TQSIETWFVGSF....A
A5L0T4_9GAMM/1-312.GFFSARSHPLRLVLAGIAITALLIGLTRAAL.IL-----....ADD..............M-AYSVLHWLTGSL..S.T
Q9PPX4_UREPA/42-345..RNNFLENSFKPILVAFGIGALVTGINIVLI.AT-----....HD...............N-LKIVGWWRFITINNTLI
A1S042_THEPD/21-338...WKAGLDPRALVLSSIAISFVYQAALYLMQ.YL-----V..LNEV..............Q-LATVIFWTFGDL..G.R
Q9RCF5_VIBCL/33-344..GINQSPNPVRVVLAGAAMTVVLLSMTHLIM.LN-----S...AQE..............V-FNQFRHWSIGSL..Q.G
Q9PPX3_UREPA/27-335..KEQSSFNYKKMLISGVIVNFLSVALGASIA.KN-----L...PKL..............A-NAYVSRYTYGSI....E
A6AQM9_VIBHA/8-312WVLKKFQRDMHQVLLIGFVLTMVLTTIAQFVQ.LR-----I...SPG..............E-FSILQGLSYTSF..E.R
A6F9M3_9GAMM/34-346MMNRSSISKNLHIVLAGSLVSMLFSSLSSFLM.QL-----....DPL..............R-FANVQDWLLGDI..S.P
A3ZGV6_CAMJU/15-317..RKIKLKDVIFVPLIGLMFGGIISAITTFFA.YA-----L..N.................Y-IQNIQGWLQGSM....A
A1AFV0_ECOK1/14-324.SAGRSGLTPMKVTLCGVALSAFVSSITAAIL.IL-----....DEQ..............T-LLAMRTWLAGDL..A.G
A3JJ56_9ALTE/20-327...GRGRLQPERVVLAGIAVTALCTALTTGTL.LI-----....SGS..............E-AAELYYWLAGSL..M.G
Q6LGA7_PHOPR/59-365...KNPGEQGYLFVVIGIGVSELMRAIGEFMM.ST-----E...SIV..............H-VSSVYMWSMGNF..V.G
Q30UD5_SULDN/9-317..LFIKNAKSESFLLLGIALSLFYTSALMIIF.YL-----G...SAI..............Q-NDMLIRFTMGSL..S.I
A6TAD2_KLEP7/17-327..ALQGRDSTLGLILSGIILSGFFAALVSLMQ.YL-----A..DSEE..............T-LPNIVFWLLGSF..A.T
A3KIF2_STRAM/39-360..RTPRGLTPLRLVLTGTALYYGFSAVTTFMV.FA-----A..EHGE..............A-ARSAVMWLLGSL..G.G
Q9PQ90_UREPA/27-331..KGNALEASFKPILVGFAIGGIITGINVLLE...-----......D..............L-VKDINIKITGFVEPPIN
Q129V6_POLSJ/5-323..RGYANHSSDQLILAGLSVSFLFTALTYYLT.FL-----G...DQR..............A-AQSVLFWTMGGL..G.G
A6TUM4_ALKMQ/16-325..KNTKKSSITKILLAGTAMSTFFISLTTIIG.LL-----S..N.................Q-SHFIAFWISGGF..R.N
A3VEF7_9RHOB/16-333.LLDPQGLSPLRIILYGISLAALAKAAVTLMM.IL-----G...PVY..............R-AGQALTWLTGSV..G.A
Q4JT63_CORJK/46-360...WRRQADSYRLVLFGIIITALLSSYINFLM.IR-----S...ELR..............N-ATQAQFWLTGSL..A.T
Q97ZU1_SULSO/12-320.....KKSGYLGLVIGGVLVSFIFSSLVTVIL.SV-----MS.AKYP..............Q-IPPLTFWLLGDI..S.V
Q3IX97_RHOS4/12-310.L.ARGAQDLPRMILTGVIFGILFRSAAGFVG.RL-----L...DPN..............A-YAVVQQASFATF..S.R
Q2JZ26_RHIEC/14-331...NGTRGGADRTILAGVAASQLFNASTSYIV.TT-----S..ANAQ..............Q-ARDVMFWLLGSF..S.G
A4QFH8_CORGB/19-335.RGVGQGSSTTVVILAGVAVAAFASSIQTYIQ.QR-----....HID..............T-VARVYVWMLGNL..N.V
Q49VF6_STAS1/13-310..VMSRGYPVRTLILAGIMIGALFNAFLYVLI.IF-----....NQE..............K-MNNIVNYMFGGF..S.S
A5WD74_PSYWF/27-334..KHLPATDILMVPLVGIVFGGIIEAVTTFIA.YE-----T..E.................S-LQMLSVWRFGDF....S
A1RVX0_PYRIL/6-302..TLARRASLFVVLMVGILVSFVTGAALQLAL.LL-----L...PPE..............E-LGYIYLGLQGNY..G.A
A4VU24_STRSY/44-354.YQVQKGYNQLRLILSGAMVASLFSAIGQAIT.IY-----F..D.................L-STAVIGWQAGGL..V.Q
A6U9A9_SINMW/17-325...RSGRGPALHLALSGITVSLFLNALTAYIL.IR-----....GAP..............Q-SPSMLFWLSGGF..Q.G
Q76BS8_VIBMI/28-336...ASRGFAPLHMILAGMVVSLFFGSLNTMLL.ML-----....HEQ..............K-LTSVFVWGAGAL..N.Q
A2RG79_STRPG/17-331.LTKQGQIDPTRLILTGVAVTTMLSSLMVALV.GH-----I...NRY..............K-VDLVINWLSGQL..I.G
Q5WBH7_BACSK/359-661..TKRSNWEPISLALMGVAVSAMGSGIIQILT.VK-----....AGV..............G-VAPVLLWLAGST..Y.G
A6VX05_MARMS/48-354...GGSGTRGYRFIVAGIGIGAIAGAVTQLLL.SQ-----V...SID..............V-ANSAYPWTVGSL..S.A
A0B6B4_METTP/21-333..TSRGSTPVISLLLSGVIVSAVFDSLLSIIQ.MA-----V...NER..............A-LQSIVYWLMGSL..A.T
Q2K6T4_RHIEC/8-328...FRLGLSALRITLCGVAVGAVLHAVAIGLI.AG-----W...GSA..............R-IEIILEWLSGSL..Y.A
Q7CHR7_YERPE/34-340...MSILSHPERIIISGIAVGAVCIAFVNFAT.SQ-----V...RLE..............Q-ASQLAALLSGSL..A.E
Q65F32_BACLD/24-345.RLVHPSLTLSALILTGIIFSSFLGALISLMI.AL-----....TGD..............D-LKPIVHWLLGSV..S.M
Q83NW1_TROW8/30-337...LTRTFRGLRLVIVGISLNAIISSFNTYMK.SI-----I...NVE..............I-SQNISIWGVGSL..S.L
A6U3Q5_STAA2/30-338..GATKGMTPIKLALAGMAIHLFFSSMTEGII.IL-----....NEN..............S-NEQVMFWLVGSL..S.S
A7VNB1_9CLOT/26-334...NRVDSSKATVILAGIAVQAVLSAGISFFS.LL-----....DTD..............V-LVSYNYFSVGGL..S.N
A6VN37_ACTSZ/353-655...QRQGMLPEKVLLTGISLSALLDTLQRLAI.AG-----....GDP..............R-VNQLIAWTSGST..Q.N
Q8XM97_CLOPE/21-331.GGLSGEVRTMDLTLGGAALSALLFSLTQGIL.YK-----....NDI..............A-LEEIIYWMTGSV..E.G
Q3JCU5_NITOC/12-323..QVSRGFSAASILLAGVAISFFFSSLILFIQ.YL-----S...DFT..............Q-SFHILRWLMGSL..S.I
Q11M36_MESSB/26-335..ATAGGLSPLRIVLVGVTFAALMNAMVEVIL.TV-----....NEA..............E-LQQLLFWLSGAF..V.D
Q5M4D4_STRT2/13-320..RRLKFKEKWVLPLVGLIYSGIIGSFAETIA.FR-----F..N.................L-TQSMTSWNQGSF....S
A6EUM8_9ALTE/34-356..MRHGQLSPVKMTLTGAVIAGMLHALTTGAL.AF-----W...GHA..............H-TELVAQWLAGSL..Y.G
A6T636_KLEP7/15-325...WRNGIETFRLIIIGIGVRAMLVAFNTWLL.LR-----A...SLE..............T-ALSAGLWNAGSL..N.G
A7MZ09_VIBHB/22-322...WKQGVTPARLALAGISVSAFCQAAVTYIL.LS-----....DRV..............D-SESLFFWLTGSN..A.G
Q9PRC2_UREPA/30-332..RISPHKKTFKPIIFGFSLGAIITAVNILIA.NF-----N..S.................S-IVASPIQLLGSI..GVY
A6TUM3_ALKMQ/16-333...SRNGIKPKRLLLIGLGMNAGLNAFITFFT.FR-----G...GVG..............D-YNRVLIWTSGSL..W.G
Q9PQD3_UREPA/50-363..KKRTGFSHTKLIVSGVFINFIAIALSISLK.DN-----L...TLV..............A-SNYIDDRLLGNF..S.N
A1ANB5_PELPD/15-334..TSGGRTSVSTLLLAGIALSLVFGALTSFVI.TL-----ST.AEFD..............V-GRVIVNWLMGDL..N.N
A3WNU5_9GAMM/8-317....GRRASPTRVILAGVAIATMSSAAMGLLL.YL-----A..PNPF..............A-FQEWAFWHMGSL..A.N
Q2S814_HAHCH/54-360...GRFGSNGYRILVIGLGLTYLLRAMTEVLVTYL-----....PLH..............E-ASAMYTWSIGTL..L.G
Q9CPB8_PASMU/14-325.GGWHARAERNRVILAGIAVSLFCAALTKLVI.II-----....AED..............H-AANIMNWLAGGI..A.H
Q9PQ91_UREPA/44-347..RQKENFNYKKLILIGVILTFFLIAIAQSIR.GW-----L...NYH..............A-NDYVVGHIVGSV..Q.K
Q7A870_STAAN/15-326.MFRQTLFSPHRVILAGAAIAMLFTAFTQGIL.IM-----....NET..............D-LQGLLFWLSGSV..S.L
Q12X02_METBU/48-366...NFKGATSETLILAGIAINYLFSSLSDLFR.YF-----A...TDE..............Q-LRIMVSWGMGDL..S.A
Q8Y5U7_LISMO/26-336.SLAGSAMSPTRLVLAGAAVSSLLTALSEGLA.IY-----F..Q.................L-SQDLAFWYAGGV..A.G
A3KJ26_STRAM/379-687...ARGGFQQNRLVLVGIGVAAATTALISLLI.VL-----T...DPF..............N-ATKALTWLSGST..Y.G
Q4JUP3_CORJK/57-360...GRGATDPVRLTLTGVAVSVGLGALTQLLL.VK-----....AAP..............E-AGAAMTWLKGAL..Y.A
A6A112_VIBCL/7-312FYFRSGHRNLIVLLLLGVILGQLFSSIASFFV.ML-----M...DPN..............D-FASVQANMFASF..N.N
A6F9Z0_9GAMM/16-319...QVIGGGKLQLILIGMAMSLAVGAVSSAIM.LY-----....AEQ..............R-MDGLFLWGSGNI....S
Q8FDJ1_ECOL6/35-344.....RDISRPRFVLIGIGVSWFFAAGIGVFM.TT-----A...DVR..............D-VQTALMWLSGSL..H.A
Q28Q47_JANSC/15-330.FRRGTMMSPLVVILAGVAVSLMFQSLTAFFL.YV-----G...DPH..............A-TRTALGWLMGTA..A.G
Q72EC9_DESVH/10-344..TAAGSFRRETVVLAGVVVSTFLAALVSLVK.AL-----....DEE..............S-VSSIVFWIMGSL..Q.G
A3YGJ6_9GAMM/27-335....GWEQGSERLVLAGVVVTALFSAMTAILL.LI-----....DQQ..............G-LEKVRHWLTGAI..G.A
Q5HJQ6_STAAC/19-328...TKGQIRPTTLIIIGISMQTLFIALVQGLL.IT-----T...KQL..............S-AAKAYTWLVGSL..Y.G

PF02653

Q9YG34_AERPE/1-252..........VFFAGIGLGD......LVGSKI-AG.....RPGPVLT--------------S.LYTTAATIG...--...
O06762_MYCFE/85-368..........INWIVAFISGWLFSLNGKMFNP-ES.....YSPTTIG--------------S.ARIAIENAVKYQ--F..
LIVM_METJA/5-317..........AISEAVLLICTYNLNIIGGYYG-IS.....TPDILAF--------------V.SGEYRGWVFAWI--V..
Y121_MYCGE/6-281..........INLLASGITLFISQNAASLFSD-TT.....LRVRYLF--------------P.IQTTVSIEAIGV--F..
Q9I6Z5_PSEAE/59-338..........LNYIALNLLLYGVHGPLKDPDG-FN.....FPQSALF--------------G.EASRLPALFEDS--R..
Q98MD6_RHILO/14-287..........MMTMLYSINLRIMGKSNLSVFG-SP.....TVFDWVP--------------F.ARPGFPASKIVV--A..
Q9CLF9_PASMU/36-307..........TMYLFGGGAL.....LLSGFAG-AT.....GYEGIGG--------------F.PESLLEFANQTL--F..
O52371_RHITR/57-322..........VSAILIGIVQFMSSGRAPGSTP-SW.....LRVLTSG--------------N.IYGLSYSV....--...
LIVH_ECOLI/11-292..........MSIFLQNYVS..LTEGSRDVAL-PSLFNGQWVVGHSE--------------N.FSASITTMQAVI--W..
Q9KWA8_AGRRH/45-310..........MQYIVLGAARILRPVSGGTIPD-AV.....ISSVSGS--------------F.............--...
Q98EK5_RHILO/53-315..........MSFVWQGLAI..LVLPKPGGKA-PD.....WLLAIMS--------------F.KPPLIPFPI...--...
Q9I2F6_PSEAE/53-318..........VLEMARGLAY......QMTDSR-TA.....YIGDAYA--------------W.LSNPLAFGISPA--F..
P73350_SYNY3/7-371LQQFVRSVNWIMVLVVGIFLLLYFGGTWLIKR-QA.....GGKPWLG--------------K.AQVILFFLSAAI--SGI
Q9KZH2_STRCO/67-346..........TFLVLQGVNL.AVTKLVTGNVA-TD.....DISDMDG--------------F.DQAKALFASSFD--V..
Q98JY4_RHILO/41-309..........TGSFVFGYVRSQLITQDAVPVP-QG.....HWVELLG--------------G.LRFL........--...
O59405_PYRHO/50-320..........VNWIFYYLIAYLIAAKFYNPEV-SH.....ESIPVPP--------------E.ARIGSIGGVSLI--F..
Q98JL3_RHILO/52-340..........TSLIGTGCLQ..........VY-QR.....TVIASGA--------------K.IPDFLAWLGTGV--TRL
O83343_TREPA/7-293..........INLCATGMTVFFAQVIFGQQGT-QA.....YSRGLVK--------------T.SYGFFSRIPVLG--P..
P74318_SYNY3/6-274..........LIIISIGLALFLRNGILLIWGG-NN.....QNYRVPI--------------V.PAQDFMGIKFEY--YRL
Q987K1_RHILO/554-814..........ASFIWVGLGY..ALQPTPGGAS-PE.....WLMALFG--------------W.SLDFLPTS....--...
Y259_MYCPN/73-364..........LNWVIVLVSAYLVGTYIKPEKT-DT.....SQFYSIE--------------L.PDAFALYNFSDV--QQK
O30014_ARCFU/51-321..........ILPLVFMQTVFIWRELFGGEEG-FA.....IENTMLT--------------T.TVEKYYFS....--...
P73351_SYNY3/61-355..........TQAALLVFYNFFNGQQKLINGT-NG.....LKTDTER--------------I.FGYLASSDGVQL--VFY
Q98MN6_RHILO/59-339..........LVYVAQLFLDWLVRGPWRDPQG-HG.....FPQTIQF--------------G.DSAVLPELMPDA--G..
O30015_ARCFU/8-272.........TLAFALLVQQVLLVLYGDRGVSI-EP.....FVSGFAE--------------I.GGVKVTYMRILS--F..
Q99Q30_ENTCL/81-358..........LNFVGLLFVGHLLHGVLGDPGA-GF.....PQSPILT--------------E.MAWLPKLLPGTD--L..
Q98JL4_RHILO/36-311..........MLFVLQGAAL..LVLDAPGGAA-AE.....WLKALIS--------------G.TVPISGLPDAID--A..
LIVM_ECOLI/110-398..........GFGEIVRILLLNNTEITGGPNG-IS.....QIPKPTL--------------F.GLEFSRTAREGG--WDT
ALSC_ECOLI/52-318..........TNAIFRGITL...........V-IS.....DANSVYG--------------F.SFDFVNFFAASV--I..
Q9HR22_HALSA/99-387..........LNFVAANLAYVAVSTWFTPADS-SL.....VQTATIP--------------A.AARIPNVPFGFQ--PRD
LIVH_METJA/14-293..........LMIATLAIDLILLGVIGAYSEI-LS.....QIVGSTQ--------------A.KFVFANLDFSLF--GFK
O29434_ARCFU/24-292..........LFNVIIYEVVDKWDEVTRGPRG-LF.....GIPSPSI--------------E.LSGISISFSGTY--NFY
Q9PRD1_UREPA/65-355..........LNWIMFYITRYVVFTAQSKMYN-PT.....PDQVGSR--------------S.IPFADNYSLFHL--ASG
Q98LJ0_RHILO/59-359..........FLFILRGLTLVGLKWASGGSTQ-LR.....GMKEAAA--------------G.SPLAPFFSGDAF--S..
Q98PV1_MYCPU/73-354..........LNWIATYVIKQIYEGTSFINRQ-NP.....ESTIRFD--------------T.TSLNIENAAQFR--N..
O28879_ARCFU/13-293..........LMIATLAFDLILLGIIGSYSET-LA.....TITRKSA--------------S.KFTFIPTDFKMF--SFS
P74455_SYNY3/5-354..........GVSELIRLIANNEEWLTQGTFG-VQ.....SFPWPMD--------------F.NPTLLSRIVFVI--WLT
Y120_MYCGE/76-367..........LNWIVVLISAYLVETYIKDNSG-GT.....AQFFSLP--------------L.PDEFALYNFSPL--TKK
Q98J21_RHILO/47-326..........GLTVFRGLTL...........T-IS.....NGGPISG--------------F.DASMRWFGTGLI--G..
Q98JY6_RHILO/57-328..........TFIFGRALFDILVTTYAADVQL-ST.....ATSDVLD--------------F.IGDSTFWGLSVS--V..
Q987G4_RHILO/75-353..........MAYIAIALMNQLVEGPLRDPAS-LN.....KPSTQPL--------------A.DIYRIGNIPGME--V..
YTFT_ECOLI/55-321..........LMVAGRGVAQLITAGQIVTFN.-..............--------------..SPDLSWFGSGSL--L..
O29433_ARCFU/11-282..........ITSFIAAIGLLMLLEGFALAVF-GP.....RYQRIHT--------------P.FDYMVVIGALRI--NAQ
Y260_MYCPN/10-286..........VNLLGTGINFFVAQNARSLLND-TD.....LRVRYSF--------------VRTGNSVSIEGIAI--F..
Q988C0_RHILO/13-289..........LTLGLEGLTALLHHFQFSRSYP-RL.....PAAEATV--------------I.PLLSDIPVVGPA--L..
Q9RKT4_STRCO/53-332..........TFLMLTGLNL.GFTKLVDGTVS-TK.....SIADMEG--------------F.PSAQDVFASTIT--I..
Q98JJ2_RHILO/56-323..........TLSGARGLAL..........MV-TN.....TKPVIIT--------------N.EYYFAIFGEGSV--L..
O28878_ARCFU/110-423..........AISEVAFMVFYYHTGIIGGYYG-VS.....VPDVLAF--------------L.PGQYRSHAFAVI--A..
O29302_ARCFU/25-274..........FTAVIFWYLSHYIVVEKNGEMV-GG.....EEGFGFT--------------S.IGLLNSYLLA..--...
Q985L1_RHILO/86-358..........TLFALAGLTL.....GLSVILS-GS.....TSVALKS--------------G.PTAKLLFGDYLG--G..
Q98IE3_RHILO/52-351..........SLFMLRGLTL.GLTRGISGRTQ-VS.....GVHELAQ--------------N.DPLNSLFSGQVF--T..

PF08566

PAM17_CRYNJ/36-212-----D....PSQLIFGVEPMFVYGGAT---------------------------------L-GCMALGYLIGPS-----
PAM17_SCHPO/33-205-----D....PTMTIMGLDLFTLYVIGT---------------------------------I-ASGGLGWLLGPS-----
PAM17_ASPFU/74-246-----E...SLGAQVMGLDPFVVLGLAT---------------------------------A-TCGAVGWLAGPF-----
PAM17_DEBHA/12-177-----Q....VDKPIMGLDPFMVMGGAV---------------------------------I-LGGGVGYLFGPF-----
A5DHA4_PICGU/2-166-----D....PEKTIFGIDPLMFVVGAV---------------------------------L-AGGFGGFLAGPV-----
PAM17_YEAST/25-197-----D....PTQMLFGFDPLTVISAGI---------------------------------I-ASGALGYLLGPI-----
A7TFJ6_VANPO/18-188-----D....PTQTILGFDPLVVISAGL---------------------------------I-ASGTLGYLFGPL-----
A2Q923_ASPNC/72-247-----E...SLGAQVMGLDPFVVLGMAT---------------------------------A-ACGAAGWLVGPF-----
A6RWX6_BOTFB/58-240-----D...ALVGQI.PLDPFITLGLVT---------------------------------F-ACGGAGWLTGPI-----
PAM17_CANGA/18-186-----D....PTQMIFGFDPLVVVTAGL---------------------------------M-ASGALGYLMGPA-----
PAM17_CANAL/11-185-----D....VEKPIMGFDPLMVMGGAV---------------------------------I-LGGLVGFLVGPF-----
PAM17_GIBZE/62-235-----E...PIISQI.PLDPFMTLGLMT---------------------------------L-AFSGLGWLSGPS-----
A3LZW7_PICST/19-186-----D....VEKPIMGLDPLMVLGGAV---------------------------------F-LGAGFGYLLGPF-----
Q2URA5_ASPOR/67-241-----E...SLGAQVMGLDPFVVLGMAT---------------------------------A-ACGAVGWLIGPF-----
A7S783_NEMVE/36-226-----DAPPDQIQPILGMDPLIFCGLCG---------------------------------V-ASAGVGYIAGSA-----
PAM17_YARLI/17-185-----D..LEQQDVFFGLDAFTAAGLGV---------------------------------V-AAGFMGSLLGPT-----
PAM17_KLULA/26-196-----D....PTQTIFGFDPLMAITAGM---------------------------------I-TCAAVGWLLGPI-----
PAM17_NEUCR/88-267-----D...AMVAQV.PLEPMFAVGLMT---------------------------------A-SFGALGWLMGPA-----
A6R0Y4_AJECN/108-295-----D...SIGAQALGLDPFIVLGLAT---------------------------------A-SCAALGWLLGPV-----
Q0UWY5_PHANO/108-281-----D..ATLSAQLGGLDPFMLMGLST---------------------------------I-GMMAVGWLIGPI-----
A5DXH9_LODEL/6-189-----D....VEKPIMGFDPIMVMGGAV---------------------------------I-LGGFAGYLVGPF-----
PAM17_USTMA/50-232-----D....PTNAIAGLDPVYINAGLT---------------------------------L-ACTGLGWLIGPT-----
PAM17_ASHGO/16-186-----D....VTQMLFGFDPMVVLVGAL---------------------------------F-ASSGLGYLCGPL-----
Q2HF36_CHAGB/90-267-----D...GLVSQI.PLDPLITLGLMT---------------------------------M-SCAALGWLVGPS-----

PF05145

ABRB_ECOLI/29-344--A.QDYGADIRLVAFMQYLRVLFVAGAAVLVTRMMLGD....NAEA----------------VNQHIVWFPP..----.
O69766_PSEPU/200-509--H.TRNSSCSATSRPGKACGCWWWCSACPAAFKYLLG........D----------------GNPIAHAGS...----.
Q9I5H8_PSEAE/33-345--G.QRHGAVLSRVAAAQSLRLLLVVLLVPAAFQYLLG........G----------------GQPGPHQAAP..----.
YHJN_BACSU/33-370--A.QEVGANTAIVSLVQMMRVLLVVLSIPFLVILIYTKQDRTASAA----------------AETISSATTDFR----L
Q98HN9_RHILO/33-349--A.GAFGADQRLVAFMQYLRVIFVSMTAAIVAKMWVDT....SGIE----------------VPP.IIWFPP..----.
Q9KLW2_VIBCH/33-345--S.ESSEKPSAKVVYSHSVRLMILTLLALLISNSAPDS.......A----------------SVDGSLTVY...----.
Q9RC51_BACHO/27-340--S.KDYGADQRIVAAFHTTRITFFVFVIPLFVGLNVTG.......R----------------TGLGTMFLPLD.----.
Q99TJ6_STAAM/31-352--AEQDKRANLLVVSLTQTSRIIFVVVLVPFISYFFHDG....NMHA----------------NGKLTKVLPLSQ----V

PF01098

RODA_HELPY/1-357......PP.PFKGYDWGMFLKLSFYICLPAALILK---------QPD--------------LGTALIVLIMGFGILLIVG
FTSW_BACSU/11-377......QS.YIDHLLTGVAPPVV.MTLIICGLIAM---------QPD--------------FGTAMIIGLIATCMILCSG
FTSWL_MYCLE/79-442SAGKHLIG.MTLPRPRDLAPLLA.AWVISVSVMVF---------EKD--------------LGTSLLLYASFLVVVYLAT
SP5E_BACSU/10-366......QK.NITSFRRGFVPALG.IVFSAFLIIMC---------QPD--------------LGTGTVMVGTCIVMIFVAG
FTSW_ENTHR/8-376..........DRSVPEKLHIPVL.IVGGIAVLVLF---------QPK--------------IAGALMILAIAGAIFWAAA
FTSW_ECOLI/46-403......GD.EVRNNLRGFLKPMG.VILVLAVLLLA---------QPD--------------LGTVVVLFVTTLAMLFLAG
FTSW_CYAPA/41-395.........WEFLTTRTKIFWLI.IFLIQIVAVLI---------QPN--------------LSTASLLGITLWLMGLCAN
RODA_BACSU/7-385.....NPKGVRTLRDDIHLLLKIAGVAVIPVGLIL---------MQD--------------AGTAGICMFIVLVMVFMSG
RODA_SHIFL/18-365.......D.VCPPSLKNTGIALV.LIFMPTLLVAA---------QPD--------------LGTSILVALSGLFVLFLSG
RODA_HAEIN/19-366.......R.PLPPKLSETFIAIA.MILLPTLLVAI---------QPD--------------LGTSILVSASGLFVVFLAG
FTSW_SYNY3/26-379.........WHRFPWRSRLIWLG.IFALTLGSILL---------QPN--------------LSTTALCGMGLWLIALASG
FTSW_HAEIN/26-383......YD.EVRSRHVSIFKPFI.VMLVLGCFLLL---------QPD--------------LGSTVVLFIIMSGMLFIVG
FTSW_BORBU/9-363......DP.RKNNGISYWIKPML.IFAIFWVLIIL---------QND--------------YSTAIYFAILFFIVLFVSN
FTSW_MYCTU/57-414.......R.MERASLREMLIPLVPAAVVALALIVA---------QPD--------------LGQTVSMGIILLGLLWYAG
FTSW_HELPY/4-388...AKEKA.NVKEELITFVPYSVVFVALAIGVGVL---------QND--------------LGQIVLLGAVLAVLLVFSG

PF00950

ZNUB_HAEIN/1-258INYTD-------------------------------------------------------------------L-IYIGIG
P29K_STRGN/11-267VQDLD-------------------------------------------------------------------M-WISIGV
ADCB_BACSU/5-263VNQQQ-------------------------------------------------------------------V-YIISII
O33704_STRPN/6-264ISEEQ-------------------------------------------------------------------V-ISLFVI
MNTC_BACSU/10-277LVRQD-------------------------------------------------------------------I-ILIAGI
O28298_ARCFU/4-264LTLDD-------------------------------------------------------------------F-VIVAIT
Y360_HAEIN/10-266IADED-------------------------------------------------------------------I-YQVAII
ZNUB_ECOLI/1-258VTPED-------------------------------------------------------------------L-ISIAIG
YCXC_CYAPA/29-287ITSED-------------------------------------------------------------------L-QNTSII
YFEC_YERPE/10-266IADED-------------------------------------------------------------------V-LQVEII
O26706_METTH/9-265VDNGD-------------------------------------------------------------------L-WTMLVL
YFED_YERPE/13-269ISLTE-------------------------------------------------------------------L-KQTLWI
MNTB_SYNY3/19-275ISQQD-------------------------------------------------------------------I-IQTLIA
Y359_HAEIN/10-266VSHQE-------------------------------------------------------------------L-IQSAVI
Y2045_SYNY3/23-279VPRQE-------------------------------------------------------------------L-WLMAGL
TROC_TREPA/9-276ILQRD-------------------------------------------------------------------V-LLIIAM

PF01032

B2UAJ5_RALPJ/22-333ADRYA-------------------------------------------------------------------G.ALMALV
A9BXV2_DELAS/19-335PSWSG-------------------------------------------------------------------L.GLLAGA
A9CFY7_AGRT5/353-653ATPAS-------------------------------------------------------------------A.IFLSIL
A9BER0_PETMO/21-332LIWSD-------------------------------------------------------------------N.FKFIFT
B8FP67_DESHD/19-334GANQD-------------------------------------------------------------------V.MLMLPA
A8MDX7_CALMQ/17-330ILWWQ-------------------------------------------------------------------F.YVMLAA
C3AB59_BACMY/28-334VSWAH-------------------------------------------------------------------L.NMIIYY
A3TJ31_9MICO/19-329RDAGI-------------------------------------------------------------------I.VDVAPF
Q121Y4_POLSJ/15-320MTWQD-------------------------------------------------------------------V.AGLWPW
A6B3C3_VIBPA/13-319RNWQQ-------------------------------------------------------------------V.PFIWSA
A7FSM0_CLOB1/26-347ANYNQ-------------------------------------------------------------------V.KFSLVI
Q8XL25_CLOPE/21-346AQWSN-------------------------------------------------------------------I.VLPIAI
Q4JT73_CORJK/31-344VRTEA-------------------------------------------------------------------L.LPMALG
Q8YHY6_BRUME/22-332RSMTH-------------------------------------------------------------------V.ALVIPF
A4XWA5_PSEMY/361-670RTWSD-------------------------------------------------------------------L.QAMLPW
Q7P5E3_FUSNV/14-333RRWEH-------------------------------------------------------------------F.FFGLIP
Q4JT72_CORJK/24-339RGMDD-------------------------------------------------------------------V.AVAALG
A3ZCW4_CAMJU/19-323ASWFR-------------------------------------------------------------------V.GILILP
A7VD13_9CLOT/10-320ISIYS-------------------------------------------------------------------I.KGNIIL
Q9CLX0_PASMU/8-308AGFTP-------------------------------------------------------------------I.YYPFAI
Q65LP4_BACLD/15-326SSWDK-------------------------------------------------------------------L.HLLVPV
Q6AAX5_PROAC/19-337ASWAQ-------------------------------------------------------------------G.WTSIVV
Q02HL3_PSEAB/28-334RTWEH-------------------------------------------------------------------V.AMLWPW
A1B6F1_PARDP/12-324VHAER-------------------------------------------------------------------L.ADFWWL
A3MG79_BURM7/44-331AQWRT-------------------------------------------------------------------I.AAVAPF
Q6LGA6_PHOPR/15-328AEMGA-------------------------------------------------------------------M.LMILPF
Q9PRC3_UREPA/34-339RSDFC-------------------------------------------------------------------F.YFCFGM
A4E6M6_9ACTN/22-336SSWDD-------------------------------------------------------------------V.AVIAVV
A7VAE4_BACUN/14-334VSLQQ-------------------------------------------------------------------M.PAFALV
A3YF14_9GAMM/27-354AQWSN-------------------------------------------------------------------L.FLPAIT
Q2IWL1_RHOP2/32-347ANMES-------------------------------------------------------------------V.AILAVV
Q24RI2_DESHY/37-351SNWNY-------------------------------------------------------------------V.LALLPW
Q15VS6_PSEA6/37-365VTWSK-------------------------------------------------------------------V.LFVGIL
Q73KI5_TREDE/13-334QNIKN-------------------------------------------------------------------F.NVLLPI
Q6D3D7_ERWCT/30-340AQWQH-------------------------------------------------------------------V.SALAGW
A7HJN9_FERNB/19-327ITFSD-------------------------------------------------------------------I.PVPALS
A5KUT8_9GAMM/358-660VEPDA-------------------------------------------------------------------A.TIMSIV
Q1QPP0_NITHX/33-350LDMTQ-------------------------------------------------------------------I.RWAAIP
A5LD35_STRPN/18-329ATLSS-------------------------------------------------------------------I.STLLPF
A3N3V3_ACTP2/14-322ESWRD-------------------------------------------------------------------S.LLLMVQ
A1B6F0_PARDP/27-334ADWPR-------------------------------------------------------------------V.TMLAPW
A5I1H3_CLOBH/13-328ASYKQ-------------------------------------------------------------------I.YFLSPI
Q8XM96_CLOPE/18-333ANWTH-------------------------------------------------------------------A.AIISVI
A3D7X9_SHEB5/21-359ASWSL-------------------------------------------------------------------L.VLPTLV
A4F7E2_SACEN/13-332ARWEL-------------------------------------------------------------------L.PVPAAV
A4EFI4_9RHOB/31-342VGWGE-------------------------------------------------------------------V.WSLAAC
A6X2T0_OCHA4/30-336ARLDQ-------------------------------------------------------------------M.LPLLIA
A1UTS1_BARBK/10-312MVLEG-------------------------------------------------------------------R.YELLWL
O29818_ARCFU/18-331TNWNE-------------------------------------------------------------------I.YLMGAI
A6X5K1_OCHA4/5-313INSDI-------------------------------------------------------------------L.IMSAVI
Q9PR75_UREPA/33-354IDLSL-------------------------------------------------------------------V.ISCSVL
Q1J550_STRPF/39-345KTWAD-------------------------------------------------------------------V.GVLFPY
Q81L64_BACAN/20-329NNWDG-------------------------------------------------------------------V.QFSFPF
A1U5U9_MARAV/26-335KPLSM-------------------------------------------------------------------L.WATLPS
Q8XBV5_ECO57/19-328RNLHT-------------------------------------------------------------------L.KVVLIP
Q83NW0_TROW8/17-317KKIDT-------------------------------------------------------------------V.YISFPL
Q8FRR5_COREF/20-326RTWDH-------------------------------------------------------------------V.GVSVIP
A7BAW8_9ACTO/35-350VTYHQ-------------------------------------------------------------------I.ALGAPF
A4SEC4_PROVI/34-339ASTAQ-------------------------------------------------------------------Q.QFSALL
Q11VA6_CYTH3/11-326ASWEK-------------------------------------------------------------------V.AVMAGI
A3XVW2_9VIBR/10-312SVLQG-------------------------------------------------------------------S.YEILYL
Q6KZE8_PICTO/14-329ITYNN-------------------------------------------------------------------L.IPVSII
A3KJ26_STRAM/33-348NGFDG-------------------------------------------------------------------V.LQMLPI
A3YGJ5_9GAMM/37-349ASWSQ-------------------------------------------------------------------V.KVMMFW
A3XB47_9RHOB/28-331RDWQD-------------------------------------------------------------------V.TIVWSG
Q1CIH2_YERPN/33-335VDWRQ-------------------------------------------------------------------..QSLVLA
A2RI59_LACLM/16-313ITNTK-------------------------------------------------------------------V.LLMAVV
A2BJ83_HYPBU/11-316AVEEK-------------------------------------------------------------------V.LVAAVA
A8H8F5_SHEPA/17-341SSWST-------------------------------------------------------------------V.AQLIVP
A4W6Q0_ENT38/19-325TDWSI-------------------------------------------------------------------V.QRLWPQ
O58520_PYRHO/11-323ATWAK-------------------------------------------------------------------V.LLMLIG
Q17WF3_HELAH/19-322SSYKD-------------------------------------------------------------------C.LVAFIG
A5WEG3_PSYWF/387-689ASPET-------------------------------------------------------------------V.WYLMIA
A6F9M2_9GAMM/35-348LDLAS-------------------------------------------------------------------A.SFLSIW
Q5KVV1_GEOKA/17-326LTWRH-------------------------------------------------------------------V.SLIAPW
Q03SH9_LACBA/15-312MTWSE-------------------------------------------------------------------T.TVLLIL
Q87G79_VIBPA/12-323YSWDW-------------------------------------------------------------------F.EWLLPR
Q631N2_BACCZ/34-330NIQVG-------------------------------------------------------------------R.YEYLWL
A5L0T4_9GAMM/1-312VDDEQ-------------------------------------------------------------------W.RMLWPP
Q9PPX4_UREPA/42-345NNYRM-------------------------------------------------------------------I..VSSVL
A1S042_THEPD/21-338AGWSE-------------------------------------------------------------------L.GVLAAG
Q9RCF5_VIBCL/33-344RGYEV-------------------------------------------------------------------L.LPTSVF
Q9PPX3_UREPA/27-335PQQES-------------------------------------------------------------------F.FIALVL
A6AQM9_VIBHA/8-312AKPST-------------------------------------------------------------------L.LFACTV
A6F9M3_9GAMM/34-346ADFTD-------------------------------------------------------------------L.SRIYPL
A3ZGV6_CAMJU/15-317NVIQG-------------------------------------------------------------------N.YELLYI
A1AFV0_ECOK1/14-324QDWAT-------------------------------------------------------------------L.GTSAWF
A3JJ56_9ALTE/20-327RGWLQ-------------------------------------------------------------------L.KLVALW
Q6LGA7_PHOPR/59-365QGYTT-------------------------------------------------------------------S.LPVAML
Q30UD5_SULDN/9-317IGWQN-------------------------------------------------------------------P.LFIGLI
A6TAD2_KLEP7/17-327ASWHK-------------------------------------------------------------------V.LLMSLP
A3KIF2_STRAM/39-360ASWSS-------------------------------------------------------------------V.PIAAGA
Q9PQ90_UREPA/27-331FQWQQ-------------------------------------------------------------------L.CIGGPL
Q129V6_POLSJ/5-323ARWDN-------------------------------------------------------------------L.FLPLLG
A6TUM4_ALKMQ/16-325ATWSD-------------------------------------------------------------------F.ILVASV
A3VEF7_9RHOB/16-333AHWHD-------------------------------------------------------------------V.GTVAAG
Q4JT63_CORJK/46-360AGWNT-------------------------------------------------------------------T.IPMVIL
Q97ZU1_SULSO/12-320VGWFN-------------------------------------------------------------------A.IILSLF
Q3IX97_RHOS4/12-310VEAGL-------------------------------------------------------------------L.PWAGLL
Q2JZ26_RHIEC/14-331VRWPE-------------------------------------------------------------------F.ALVSVV
A4QFH8_CORGB/19-335TNWMS-------------------------------------------------------------------I.FIVAVV
Q49VF6_STAS1/13-310AEYNE-------------------------------------------------------------------V.IYIGIV
A5WD74_PSYWF/27-334TILAG-------------------------------------------------------------------R.YELLYV
A1RVX0_PYRIL/6-302YPPGL-------------------------------------------------------------------LGWAVAGA
A4VU24_STRSY/44-354VNWKM-------------------------------------------------------------------L.AIIAPL
A6U9A9_SINMW/17-325RSWPQ-------------------------------------------------------------------V.SYMLPW
Q76BS8_VIBMI/28-336NGWNS-------------------------------------------------------------------T.QVLLPF
A2RG79_STRPG/17-331DDWPT-------------------------------------------------------------------L.SVIAPL
Q5WBH7_BACSK/359-661MNWQD-------------------------------------------------------------------V.WFLAFV
A6VX05_MARMS/48-354RDPMM-------------------------------------------------------------------V.NILGIG
A0B6B4_METTP/21-333ASWSK-------------------------------------------------------------------I.HSTLPL
Q2K6T4_RHIEC/8-328RSWDH-------------------------------------------------------------------A.LFLLPF
Q7CHR7_YERPE/34-340KNWRD-------------------------------------------------------------------V.GIISLT
Q65F32_BACLD/24-345RGWGY-------------------------------------------------------------------V.ALFLPF
Q83NW1_TROW8/30-337ITWSD-------------------------------------------------------------------A.LLLYLT
A6U3Q5_STAA2/30-338MKWDE-------------------------------------------------------------------I.LTILPW
A7VNB1_9CLOT/26-334SSIDL-------------------------------------------------------------------L.WLPGTI
A6VN37_ACTSZ/353-655IHQDF-------------------------------------------------------------------A.LGYLCL
Q8XM97_CLOPE/21-331KKIDM-------------------------------------------------------------------I.LKFSPV
Q3JCU5_NITOC/12-323IGIEA-------------------------------------------------------------------V.FEILPF
Q11M36_MESSB/26-335RPLSL-------------------------------------------------------------------V.ARNIPL
Q5M4D4_STRT2/13-320MIQRH-------------------------------------------------------------------Q.YEWLFL
A6EUM8_9ALTE/34-356SQWQH-------------------------------------------------------------------L.RTLLPW
A6T636_KLEP7/15-325LTWGK-------------------------------------------------------------------T.WPSAPL
A7MZ09_VIBHB/22-322ANWSV-------------------------------------------------------------------F.TPLVYT
Q9PRC2_UREPA/30-332NSIER-------------------------------------------------------------------F.YIGTPI
A6TUM3_ALKMQ/16-333AGWNY-------------------------------------------------------------------A.RIIIPL
Q9PQD3_UREPA/50-363RNSTE-------------------------------------------------------------------K.YLSYAV
A1ANB5_PELPD/15-334RSWEH-------------------------------------------------------------------V.AIVIPT
A3WNU5_9GAMM/8-317KSWHS-------------------------------------------------------------------V.MLALPG
Q2S814_HAHCH/54-360RDYAI-------------------------------------------------------------------A.TPALIG
Q9CPB8_PASMU/14-325ARWGE-------------------------------------------------------------------W.WIILPF
Q9PQ91_UREPA/44-347APLNS-------------------------------------------------------------------L.IIAASF
Q7A870_STAAN/15-326RNIWD-------------------------------------------------------------------I.PWIIPL
Q12X02_METBU/48-366FSWSN-------------------------------------------------------------------F.SILLGV
Q8Y5U7_LISMO/26-336VKWSQ-------------------------------------------------------------------L.AAIWPW
A3KJ26_STRAM/379-687RTMPD-------------------------------------------------------------------I.APVALA
Q4JUP3_CORJK/57-360RTLAD-------------------------------------------------------------------A.QVVGPV
A6A112_VIBCL/7-312VNTKL-------------------------------------------------------------------V.YVVSPL
A6F9Z0_9GAMM/16-319QSDGE-------------------------------------------------------------------LAAIILTP
Q8FDJ1_ECOL6/35-344ANWML-------------------------------------------------------------------V.GISACW
Q28Q47_JANSC/15-330TAWED-------------------------------------------------------------------L.WLPLIA
Q72EC9_DESVH/10-344RGWAH-------------------------------------------------------------------T.AVLLPP
A3YGJ6_9GAMM/27-335SDLKK-------------------------------------------------------------------L.HWVYPY
Q5HJQ6_STAAC/19-328ATFKD-------------------------------------------------------------------T.IILGMV

PF02653

Q9YG34_AERPE/1-252.........................................................................-...IAA
O06762_MYCFE/85-368............................................VYFGI.......................G-MFVLTA
LIVM_METJA/5-317........................................................................L-FIAFLV
Y121_MYCGE/6-281........................................................................V-FSLLLI
Q9I6Z5_PSEAE/59-338............................................VHLGA.......................L-FGLLAL
Q98MD6_RHILO/14-287........................................................................G-LLALVV
Q9CLF9_PASMU/36-307...........................................GIPTPI.......................I-YFLLMT
O52371_RHITR/57-322........................................................................I-VWIGIS
LIVH_ECOLI/11-292........................................................................I-VTFLAM
Q9KWA8_AGRRH/45-310..........................................LGIPMPI.......................F-WGICVA
Q98EK5_RHILO/53-315........................................................................I-AALLIG
Q9I2F6_PSEAE/53-318........................................................................V-IALLVM
P73350_SYNY3/7-371SGFVVAQAN......................SPLWNRAWFGARNVNVSAPTWLRGGLAIGTFQVPYTRIFIIF-LTLLCL
Q9KZH2_STRCO/67-346........................................GGVEVKITV.......................V-WWLVFA
Q98JY4_RHILO/41-309...........................................DIPIEV.......................F-VFAGLA
O59405_PYRHO/50-320........................................................................L-LAVLFA
Q98JL3_RHILO/52-340PDAWVPSEA......................ARQWLTDAGIGFSFPNAL.......................L-LYVPLA
O83343_TREPA/7-293.......................................MVFTHTYPTV.......................Y-LGFVLV
P74318_SYNY3/6-274LVI.....................................................................A-MAIAAM
Q987K1_RHILO/554-814........................................................................I-ILIAAV
Y259_MYCPN/73-364YGWLTSL.................................................................V-IAIAAA
O30014_ARCFU/51-321........................................................................L-AVLVVS
P73351_SYNY3/61-355EVT.....................................................................V-LALLLV
Q98MN6_RHILO/59-339...........................................RANWGF.......................V-FALVAA
O30015_ARCFU/8-272........................................................................V-LAVLCL
Q99Q30_ENTCL/81-358.............................................HIGI.......................V-AAVLAV
Q98JL4_RHILO/36-311...........................................WVPKAL.......................L-VLIVCL
LIVM_ECOLI/110-398FSNFFGLKY......................DPSDRVIFLYLVA............................L-LLVVLS
ALSC_ECOLI/52-318...........................................GIPVPV.......................I-FSLIVA
Q9HR22_HALSA/99-387NFSLLGL.................................................................L-FAVALV
LIVH_METJA/14-293GILFVST.................................................................F-VVILLL
O29434_ARCFU/24-292YLM.....................................................................L-AVLIVM
Q9PRD1_UREPA/65-355YGYLFAL.................................................................L-IFISLS
Q98LJ0_RHILO/59-359....................SLFSWLAEKGIIEAFPSGAPKVPGIPVEI.......................L-WFIAIA
Q98PV1_MYCPU/73-354.....................................FFQSNTLIYSML.......................A-LAIFLA
O28879_ARCFU/13-293ASLFVSS.................................................................L-VIIIVL
P74455_SYNY3/5-354VLTIYAESILIKSLLKQWKEGKKIQGKSYQPRKPLALLIWGIITTALILTAYVPGVVSLYNYSGKAGLMLLAL-TLLALT
Y120_MYCGE/76-367FGWLASL.................................................................I-IAFISV
Q98J21_RHILO/47-326...........................................PVPVPA.......................I-IFAVAA
Q98JY6_RHILO/57-328........................................................................W-LAIILA
Q987G4_RHILO/75-353.............................................HWGL.......................A-VGVVSC
YTFT_ECOLI/55-321...........................................FLPTPV.......................I-IAVLTL
O29433_ARCFU/11-282RLIVL...................................................................F-CSIAAI
Y260_MYCPN/10-286........................................................................A-FAIIFV
Q988C0_RHILO/13-289..........................................FKHHLIV.......................Y-LAVALV
Q9RKT4_STRCO/53-332........................................GGVGFKVTI.......................L-WWLALV
Q98JJ2_RHILO/56-323...........................................GIPAPI.......................L-WTLGVT
O28878_ARCFU/110-423........................................................................L-LFALLV
O29302_ARCFU/25-274........................................................................S-LLLTLT
Q985L1_RHILO/86-358...........................................KFEVTL.......................F-WWIAAI
Q98IE3_RHILO/52-351....................GLIAWLADLGLIGKRADGMPSISGIPVSI.......................V-WWIVLT

PF08566

PAM17_CRYNJ/36-212------------------------------------------------------------------------V-------
PAM17_SCHPO/33-205------------------------------------------------------------------------I-------
PAM17_ASPFU/74-246------------------------------------------------------------------------L-------
PAM17_DEBHA/12-177------------------------------------------------------------------------I-------
A5DHA4_PICGU/2-166------------------------------------------------------------------------I-------
PAM17_YEAST/25-197------------------------------------------------------------------------V-------
A7TFJ6_VANPO/18-188------------------------------------------------------------------------L-------
A2Q923_ASPNC/72-247------------------------------------------------------------------------V-------
A6RWX6_BOTFB/58-240------------------------------------------------------------------------L-------
PAM17_CANGA/18-186------------------------------------------------------------------------V-------
PAM17_CANAL/11-185------------------------------------------------------------------------I-------
PAM17_GIBZE/62-235------------------------------------------------------------------------V-------
A3LZW7_PICST/19-186------------------------------------------------------------------------A-------
Q2URA5_ASPOR/67-241------------------------------------------------------------------------V-------
A7S783_NEMVE/36-226------------------------------------------------------------------------I-------
PAM17_YARLI/17-185------------------------------------------------------------------------I-------
PAM17_KLULA/26-196------------------------------------------------------------------------V-------
PAM17_NEUCR/88-267------------------------------------------------------------------------M-------
A6R0Y4_AJECN/108-295------------------------------------------------------------------------L-------
Q0UWY5_PHANO/108-281------------------------------------------------------------------------F-------
A5DXH9_LODEL/6-189------------------------------------------------------------------------I-------
PAM17_USTMA/50-232------------------------------------------------------------------------V-------
PAM17_ASHGO/16-186------------------------------------------------------------------------M-------
Q2HF36_CHAGB/90-267------------------------------------------------------------------------L-------

PF05145

ABRB_ECOLI/29-344VSIN.-------------------------------------------------------------------LLLTILLA
O69766_PSEPU/200-509IDWRW-------------------------------------------------------------------LALLFPAG
Q9I5H8_PSEAE/33-345VDWHW-------------------------------------------------------------------LALLFPAG
YHJN_BACSU/33-370APVLW-------------------------------------------------------------------TVILILAA
Q98HN9_RHILO/33-349IDVQA-------------------------------------------------------------------FAATSGIA
Q9KLW2_VIBCH/33-345.AWLI-------------------------------------------------------------------FLALALMS
Q9RC51_BACHO/27-340ETLLA-------------------------------------------------------------------LGALMAVV
Q99TJ6_STAAM/31-352LNIGQ-------------------------------------------------------------------IVILAIAI

PF01098

RODA_HELPY/1-357LRT.R-------------------------------------------------------------------V-WLPLFI
FTSW_BACSU/11-377FSG.K-------------------------------------------------------------------T-LVRLVI
FTSWL_MYCLE/79-442QRLSW-------------------------------------------------------------------V-IIGLVL
SP5E_BACSU/10-366ARI.A-------------------------------------------------------------------H-FVFLGL
FTSW_ENTHR/8-376IPI.K-------------------------------------------------------------------K-GLIIIG
FTSW_ECOLI/46-403AKL.W-------------------------------------------------------------------Q-FIAIIG
FTSW_CYAPA/41-395FPW.K-------------------------------------------------------------------Y-LLGTVF
RODA_BACSU/7-385INW.K-------------------------------------------------------------------L-IAIIAG
RODA_SHIFL/18-365LSW.R-------------------------------------------------------------------L-IGVAVV
RODA_HAEIN/19-366MSW.W-------------------------------------------------------------------L-ILAAVI
FTSW_SYNY3/26-379LPW.I-------------------------------------------------------------------Y-LISTAL
FTSW_HAEIN/26-383AKI.L-------------------------------------------------------------------Q-FVGLIA
FTSW_BORBU/9-363MAF.S-------------------------------------------------------------------Y-VFAIVV
FTSW_MYCTU/57-414LPL.R-------------------------------------------------------------------V-FLSSLA
FTSW_HELPY/4-388GSV.H-------------------------------------------------------------------L-FGLIIS

PF00950

ZNUB_HAEIN/1-258------VIIVLSTLI--------------------------------------Y-FWQSLLSTTVS-----PELAQVEGI
P29K_STRGN/11-267------GILVLLVIS--------------------------------------I-FFKQLLLTSFD-----PLLAQAMGM
ADCB_BACSU/5-263------TLLILLYFI--------------------------------------V-LRRPLYLLTFD-----EATAKTSGI
O33704_STRPN/6-264------AAVVLILTF--------------------------------------L-FLRPMYILTFD-----EDTAFVDGL
MNTC_BACSU/10-277------SAVLLLLCI--------------------------------------V-FFKEFTLITFD-----LAFAKGLGI
O28298_ARCFU/4-264------TAFVLIAIS--------------------------------------F-FYHKFIFISFD-----PSGAEATCI
Y360_HAEIN/10-266------IGVCLVLLL--------------------------------------L-FWKDLLLIFFD-----ETQAITVGL
ZNUB_ECOLI/1-258------VVIVVAILF--------------------------------------W-QWRNLLSMTIS-----PDLAFVDGV
YCXC_CYAPA/29-287------LAIILLFFI--------------------------------------S-CYRQLKCYTFD-----PIMAQTIGL
YFEC_YERPE/10-266------ILVSFVILC--------------------------------------L-IWKDLLAVFFD-----ESHAMSIGL
O26706_METTH/9-265------DLIIISSAL--------------------------------------L-FNREFVAICFD-----EEYAEVLGV
YFED_YERPE/13-269------AGFTLLVVL--------------------------------------L-KRKDFMLYCFD-----PNHARVIGL
MNTB_SYNY3/19-275------GSITLIVIL--------------------------------------L-RRKDLLLFCFD-----PNHAKAIGL
Y359_HAEIN/10-266------SAIIFCLIV--------------------------------------F-KRKDFLLYCFD-----PSHARVAGL
Y2045_SYNY3/23-279------DMLIIILLF--------------------------------------L-LYKEFLAISFD-----PVYATTRNL
TROC_TREPA/9-276------EVVIGLLVL--------------------------------------L-FWKELKLSTFD-----RDFSAVQGF

PF01032

B2UAJ5_RALPJ/22-333------AAVAVVLPH--------------------------------------A...RDLNVLLTG-----ETRARALGV
A9BXV2_DELAS/19-335------SLACLAGAM--------------------------------------A.LARGLDLLGLG-----ADAAQGFGL
A9CFY7_AGRT5/353-653------SVVLLVAAL--------------------------------------S.VTRWLTILPLG-----RDVPLSLGL
A9BER0_PETMO/21-332------LIFQFILVL--------------------------------------L.FSKQLNVLSMG-----DDMAVFSGI
B8FP67_DESHD/19-334------MVLSLALLF--------------------------------------L.FRNQINALAAG-----EDEAATMGV
A8MDX7_CALMQ/17-330------AVPPILVVA--------------------------------------F.LSRYVDLLMLG-----DDVAKASGV
C3AB59_BACMY/28-334------AIFAIILAF--------------------------------------F.GIKHIRVLMLG-----DEMAKLLGY
A3TJ31_9MICO/19-329------LVIGFALSL--------------------------------------A.SGSLLNAVALG-----DDLARGLGQ
Q121Y4_POLSJ/15-320------VLCATLGAL--------------------------------------L.LAHPLNLLQLG-----DEAAHALGL
A6B3C3_VIBPA/13-319------LMLLLPLAF--------------------------------------W.LAWRLDVMGLG-----EESATTLGM
A7FSM0_CLOB1/26-347------MVITAILSM--------------------------------------L.LYKDLDAMLLG-----EAVAKNIGI
Q8XL25_CLOPE/21-346------SVIPLIYFF--------------------------------------T.QYRNLNLMVLG-----DETSITLGL
Q4JT73_CORJK/31-344------LLPFVVLGL--------------------------------------C.VTRDVPLLSHD-----DATASTLGV
Q8YHY6_BRUME/22-332------ILIGWLMLL--------------------------------------S.LGRSLDSLTLG-----SDAAATMGV
A4XWA5_PSEMY/361-670------LVIGLALCA--------------------------------------A.TTRWMDLLQLG-----DGVAGSLGL
Q7P5E3_FUSNV/14-333------IAILSPILF--------------------------------------Y.YGKELNILLLG-----EEEAKSLGI
Q4JT72_CORJK/24-339------LALGALCGA--------------------------------------L.AARPLDLLAMG-----EDSARSLGS
A3ZCW4_CAMJU/19-323------LIFCLFYFY--------------------------------------A.HKNELNILLSG-----DDEARNLGV
A7VD13_9CLOT/10-320------CLFCSVILF--------------------------------------L.LYRQIILLSLD-----DNEGKMLGV
Q9CLX0_PASMU/8-308------MLIGLVWMA--------------------------------------I.LGRQLDCLMLG-----EDTAFTMGI
Q65LP4_BACLD/15-326------SIAGLLTAL--------------------------------------A.LGRAASVMSLG-----DEVSHGLGQ
Q6AAX5_PROAC/19-337------AVVLSILLW--------------------------------------I.CAPWLDALASG-----DSTATAVGI
Q02HL3_PSEAB/28-334------VVSGLVLGL--------------------------------------A.CAGRLDTMILD-----EDVLTALGM
A1B6F1_PARDP/12-324------AALGMAAML--------------------------------------L.LARRLSLLALG-----AEKAASLGI
A3MG79_BURM7/44-331------ALAGCVLLA--------------------------------------R.ERHALNALQLG-----EAEAMHLGV
Q6LGA6_PHOPR/15-328------LVVAVILTF--------------------------------------A.LTRQLTLMQLG-----EQQAKSLGI
Q9PRC3_UREPA/34-339------LTISVIWLM--------------------------------------L.NATKFKIMVTN-----QQISGQLGI
A4E6M6_9ACTN/22-336------VITVSACVF--------------------------------------A.ISKPLSAFQLG-----EAYAKSVGV
A7VAE4_BACUN/14-334------TIVGLFGSL--------------------------------------L.LIKPLNALLLG-----ERYAENLGV
A3YF14_9GAMM/27-354------VLCTCLWLI--------------------------------------W.QAPVLNTLMMG-----SQSAHTLGI
Q2IWL1_RHOP2/32-347------LLLVFPLAM--------------------------------------A.SSWQLTALRLG-----QERASSFGV
Q24RI2_DESHY/37-351------LLLLIPYVM--------------------------------------M.KSRVLDVLNLG-----EDEACGLGV
Q15VS6_PSEA6/37-365------SIPIIALYM--------------------------------------H.LRQPLNLFALG-----ENEAQCMGL
Q73KI5_TREDE/13-334------CAAATLILT--------------------------------------S.LSHEMDLLTFG-----EEQAKTMGV
Q6D3D7_ERWCT/30-340------LLLGAPFLL--------------------------------------G.LARHVNVHELD-----DALACGVGQ
A7HJN9_FERNB/19-327------LGVFVFLSL--------------------------------------L.YSKQLDAMSLG-----EKEAKSLGV
A5KUT8_9GAMM/358-660------ITVCIGVAL--------------------------------------L.LSRWVTLIATG-----RQFASARGL
Q1QPP0_NITHX/33-350------IVGGLMVLA--------------------------------------L.FGRALDALSMG-----DDEARALGV
A5LD35_STRPN/18-329------IILGHLIAI--------------------------------------F.ISSDLNALAMG-----DEMAVGLGV
A3N3V3_ACTP2/14-322------TIPALLFIA--------------------------------------L.FIRPLTILALN-----DANAQSLGV
A1B6F0_PARDP/27-334------FAASPIAIL--------------------------------------L.LGRALRLIDLG-----APMAMALGL
A5I1H3_CLOBH/13-328------VVIITFIFY--------------------------------------Y.NYRALNIMAAG-----EESAYILGI
Q8XM96_CLOPE/18-333------FFIFTLITV--------------------------------------I.FIKDLNLHQLD-----DEIITVLGN
A3D7X9_SHEB5/21-359------IGASLFIIL--------------------------------------G.MKRQIMALQAG-----DETAHTLGV
A4F7E2_SACEN/13-332------LGAGIVAAV--------------------------------------A.AGRWMNLLHAG-----DDAAAAMGL
A4EFI4_9RHOB/31-342------LIVLTPCLI--------------------------------------W.SARYLSALRMG-----PEVATGLGV
A6X2T0_OCHA4/30-336------LIVLGGLLL--------------------------------------S.RSRDLEALRLG-----DDSAAALGT
A1UTS1_BARBK/10-312------SLPVCILAY--------------------------------------C.FADRFTVASLG-----EDLTNNLGL
O29818_ARCFU/18-331------FAVSLLYFI--------------------------------------F.RRMDYNALTLN-----DETAISLGV
A6X5K1_OCHA4/5-313------VAAVSLYGL--------------------------------------R.FVYVFDVLSLG-----RDPAINLGV
Q9PR75_UREPA/33-354------IALTLIPIW--------------------------------------F.LRKKIDLYETS-----AALASTTGI
Q1J550_STRPF/39-345------TFIGLLLAL--------------------------------------L.LSKTCNLLLLD-----DQVIRHLGI
Q81L64_BACAN/20-329------IIISFLVLL--------------------------------------G.ISRKLNILLLG-----DDVAVSLGE
A1U5U9_MARAV/26-335------ITLALVLIA--------------------------------------I.VARPLAAMALG-----EKAAVGLGH
Q8XBV5_ECO57/19-328------VLIAGATAL--------------------------------------L.LSRALNSLSLG-----SDTATALGS
Q83NW0_TROW8/17-317------ILAGILIAL--------------------------------------M.MMSSLNVLSID-----KDISKSLGV
Q8FRR5_COREF/20-326------IIVGLILAV--------------------------------------G.ASRDLNLLLLG-----ESTAQTSGL
A7BAW8_9ACTO/35-350------IIAGVIVIV--------------------------------------A.LRWQLNILSLS-----EDEARSAGV
A4SEC4_PROVI/34-339------IVGGIAGCW--------------------------------------V.LSSRLNALVLG-----REMAHYQGI
Q11VA6_CYTH3/11-326------VSALILLSM--------------------------------------L.FFNAFQIMELG-----EENANRIGV
A3XVW2_9VIBR/10-312------AVPACVLAY--------------------------------------Y.FASQFSAASIG-----ESFAKNIGL
Q6KZE8_PICTO/14-329------VIFISIILY--------------------------------------F.YSNELDAIGIG-----ERYAHSIGV
A3KJ26_STRAM/33-348------ALVGLVGLM--------------------------------------L.TARRVDALALG-----DDAARGLGV
A3YGJ5_9GAMM/37-349------LLIAGSLAW--------------------------------------L.CFRELNLLILG-----NKVAFSRGV
A3XB47_9RHOB/28-331------VLLLAPALF--------------------------------------W.IHFPLARLGLS-----DDLSSSLGL
Q1CIH2_YERPN/33-335------LLPTVIWLC--------------------------------------C.QGRVLNFMSLG-----EQQARQLGV
A2RI59_LACLM/16-313------SLIFLLLLL--------------------------------------L.FSKQIYLLNFG-----DELAQSFGV
A2BJ83_HYPBU/11-316------ALVAAATAL--------------------------------------I.LANPLDALSYG-----DETALSLGY
A8H8F5_SHEPA/17-341------VALGYGLIH--------------------------------------T.LRYRLNVLCLG-----DHQCRSLGV
A4W6Q0_ENT38/19-325------LLGGVLLTL--------------------------------------L.LLRPLTLMGLD-----DGVARNLGL
O58520_PYRHO/11-323------TIIGSSMLF--------------------------------------L.TWKELNLLLLG-----EE.SIALGL
Q17WF3_HELAH/19-322------LSLGFIPLF--------------------------------------L.LRWRINLLSLS-----DAQSLSLGI
A5WEG3_PSYWF/387-689------AAGLVALSM--------------------------------------L.LIKPLRVLGLG-----ESVAKSLGV
A6F9M2_9GAMM/35-348------MTVIIAVFL--------------------------------------L.LSRYINPLNFG-----YQHAMSLGV
Q5KVV1_GEOKA/17-326------SLAGLLLSI--------------------------------------M.IASKMDLLELG-----DDTAKGLGV
Q03SH9_LACBA/15-312------GVIGLIGAL--------------------------------------L.IAPWANYLKLT-----DTALSHVGV
Q87G79_VIBPA/12-323------STIAIVILI--------------------------------------V.APRILTLMKLG-----QEGAAARGL
Q631N2_BACCZ/34-330------IVIITVLIF--------------------------------------M.YANRLTLAGLG-----EDVATSLGV
A5L0T4_9GAMM/1-312------IIVGLGLAI--------------------------------------S.LARNLNLLALG-----EEVAVGLGS
Q9PPX4_UREPA/42-345------MIISTIILL--------------------------------------F.LSPYLNIIRKD-----YILAKSLGI
A1S042_THEPD/21-338------ASALLPVYV--------------------------------------A.FHKDLDLLSFG-----DELAASSGV
Q9RCF5_VIBCL/33-344------VLLGLIAAI--------------------------------------L.LARGLDTVVLG-----HDAGKALGV
Q9PPX3_UREPA/27-335------IIIGLLIVL--------------------------------------F.NFKKIQIVSSN-----QDLANQLGI
A6AQM9_VIBHA/8-312------LSVFAFFVK--------------------------------------R.WSRELDVIGLG-----RDQAMSLGL
A6F9M3_9GAMM/34-346------ALLAIGVLL--------------------------------------S.QGRSLDVMIMG-----EKQARSAGV
A3ZGV6_CAMJU/15-317------SLPLFILAY--------------------------------------F.LAHKITIVGMG-----EDIALNLGI
A1AFV0_ECOK1/14-324------SLGGFVLAL--------------------------------------Y.LAPSLNMLALG-----DRMAQGLGV
A3JJ56_9ALTE/20-327------LMLPLLAVL--------------------------------------F.LRRPFWVLQFD-----DELALSMGL
Q6LGA7_PHOPR/59-365------LLLLCPFIV--------------------------------------Y.FSRQLNVLRLG-----VSTAQSLGI
Q30UD5_SULDN/9-317------TSVLVIVVY--------------------------------------L.YRFELQLLATS-----DESAKLKGL
A6TAD2_KLEP7/17-327------LAMAAGALW--------------------------------------K.LRWRINLLALE-----ERDARSLGV
A3KIF2_STRAM/39-360------VLGGLVHLG--------------------------------------W.SARRLNALAMG-----DETAAALGV
Q9PQ90_UREPA/27-331------IIISSLANL--------------------------------------F.MAPYYTIIAKD-----YLLAKSLGI
Q129V6_POLSJ/5-323------VVTVGGFAI--------------------------------------F.KTRALDAMLAG-----DHTAHSLGV
A6TUM4_ALKMQ/16-325------GIIGLILAT--------------------------------------L.LSKKINLLSLG-----DDVAISLGE
A3VEF7_9RHOB/16-333------LIVATLILV--------------------------------------M.VGRRVRQLVLD-----PETAQATGV
Q4JT63_CORJK/46-360------VIACCPLLA--------------------------------------W.IGYQALATTLG-----PDLARALGQ
Q97ZU1_SULSO/12-320------AILLLYFSL--------------------------------------S.NSRLIDLLSIS-----DEISYSQGV
Q3IX97_RHOS4/12-310------ALSAMGTAL--------------------------------------V.LAPRLDVLALG-----RRTSVPLGL
Q2JZ26_RHIEC/14-331------VSFGLAACL--------------------------------------L.YARVLDAFAFG-----DEAASSLGV
A4QFH8_CORGB/19-335------AGLCAAVIM--------------------------------------S.CARLLDVMAVG-----DVEARTLGV
Q49VF6_STAS1/13-310------LSIGMIILL--------------------------------------S.LVSKIKILQLG-----DLRAQSLGL
A5WD74_PSYWF/27-334------TGALALVAY--------------------------------------F.LADKLTIVGLG-----EAIAINLGV
A1RVX0_PYRIL/6-302------SVVLLATVY--------------------------------------L.NSRHISALVHG-----EEAAAGLGV
A4VU24_STRSY/44-354------IIIGLILAQ--------------------------------------L.FSHQLTILSLN-----ETVAKNLGQ
A6U9A9_SINMW/17-325------VAIGIGAAL--------------------------------------A.CHRVIGLLSLG-----DEAAAGMGL
Q76BS8_VIBMI/28-336------NHSPNTTIT--------------------------------------DECNAHCPRCNLG-----WR.ASSLGV
A2RG79_STRPG/17-331------LLCFWLLTY--------------------------------------S.QAHFLNIMGLA-----DNTAIGLGL
Q5WBH7_BACSK/359-661------LIALVPISY--------------------------------------S.FSRQLDVLALN-----QEVSVTLGL
A6VX05_MARMS/48-354------LAICLVACL--------------------------------------L.FASQFALMPFS-----DQVITGLGA
A0B6B4_METTP/21-333------ALAGCAVIF--------------------------------------L.LRWRLNVLAMG-----DEEARSVGM
Q2K6T4_RHIEC/8-328------TIACLAMLP--------------------------------------V.IHRPLMLLQFD-----APVARSFGL
Q7CHR7_YERPE/34-340------LGLVMPGLV--------------------------------------Y.LSRQLNYLSLG-----AAIAQPLGV
Q65F32_BACLD/24-345------FAAGAAALL--------------------------------------I.SGRELNVMTYG-----EEKARLLGV
Q83NW1_TROW8/30-337------LIACVSLAV--------------------------------------I.VIPKMRVLEMG-----DDNAASLGV
A6U3Q5_STAA2/30-338------IIGALIVTI--------------------------------------F.IGRQLTIMELG-----DDIAKGLGQ
A7VNB1_9CLOT/26-334------IFLGLAVSL--------------------------------------A.FSGKIQLLCLG-----DSMALSLGV
A6VN37_ACTSZ/353-655------SLLLLAASL--------------------------------------I.FCRWLELLALQ-----TPMAQALGL
Q8XM97_CLOPE/21-331------IIVTIILTF--------------------------------------F.IWKKLNVFSLG-----EEMARSLGI
Q3JCU5_NITOC/12-323------VIGGTFVIL--------------------------------------L.LSQELNLLATG-----ELLAASRGL
Q11M36_MESSB/26-335------LALGGVMAA--------------------------------------M.LARPLDALQTD-----DATAQSLGA
Q5M4D4_STRT2/13-320------LVFVLLVVR--------------------------------------W.YSNTFSIMALG-----EDTSRTLGL
A6EUM8_9ALTE/34-356------TAIGLVGVA--------------------------------------L.LVRPLEVMQLD-----DQHVRTLGL
A6T636_KLEP7/15-325------ILLMLVGSA--------------------------------------L.LVRRMRLLEMG-----DDTACALGV
A7MZ09_VIBHB/22-322------VIPAFILLA--------------------------------------A.THRQRGYLLLD-----DTVARGLGI
Q9PRC2_UREPA/30-332------VFISTIILL--------------------------------------C.YAKKIQILDTD-----HYLAKSLGI
A6TUM3_ALKMQ/16-333------VAFMFILVV--------------------------------------L.NYKKLDVLNLS-----DEHAIALGL
Q9PQD3_UREPA/50-363------FLFLMIWCF--------------------------------------L.RSAKFKVVITD-----TMIAEQLGL
A1ANB5_PELPD/15-334------TLVALLGTL--------------------------------------F.FARDLNLLMLG-----EETAANLGV
A3WNU5_9GAMM/8-317------IVLAFPIVW--------------------------------------L.GRRFLYALTLS-----EETVATMGF
Q2S814_HAHCH/54-360------LCLLLPVSV--------------------------------------V.LAKSLTLLQFG-----EDTAASLGL
Q9CPB8_PASMU/14-325------FVLSLLFCT--------------------------------------F.FASQLNLLNLS-----DESAQSLGV
Q9PQ91_UREPA/44-347------VILGLLWLL--------------------------------------F.NSYKLNIIATN-----QQVAKQLGI
Q7A870_STAAN/15-326------VLILILIAF--------------------------------------S.MAAHINILMTS-----DDIATGLGQ
Q12X02_METBU/48-366------FVFCTPLLY--------------------------------------L.KANDLNIMAIG-----DENAKSLGI
Q8Y5U7_LISMO/26-336------LLGALIAAI--------------------------------------L.LSKSITILSLG-----DDIAVGLGE
A3KJ26_STRAM/379-687------LAVGIVVAV--------------------------------------V.RRTELDLVSLD-----EDTPRLLGL
Q4JUP3_CORJK/57-360------VLVVIVVAI--------------------------------------V.LSRHLDMLNLD-----SSAMAGVGV
A6A112_VIBCL/7-312------LLLACVLLF--------------------------------------R.QHRVLDVFWLD-----KDNAVSLGV
A6F9Z0_9GAMM/16-319------ALLLLLLPL--------------------------------------L.CHRHLDMLSMG-----DEMANTAGL
Q8FDJ1_ECOL6/35-344------MLPAALLLL--------------------------------------F.TARTADIALLG-----HQVATGLGV
Q28Q47_JANSC/15-330------LAGVTTYAR--------------------------------------L.HAQNLDALLLG-----DERAMALGI
Q72EC9_DESVH/10-344------LVLGLAAVV--------------------------------------R.HARDLDVLALG-----DTQASQLGM
A3YGJ6_9GAMM/27-335------LICAMVGCF--------------------------------------A.LVRSLNAFHLG-----ERVAASLGV
Q5HJQ6_STAAC/19-328------ILAVVPLLF--------------------------------------L.VIPKMKISILD-----DPVAIGLGL

PF02653

Q9YG34_AERPE/1-252------VALHLILYN--------------------------------------TVTGTALRVVGEN.....PAAAKERGV
O06762_MYCFE/85-368------IVLFVIYNF--------------------------------------TTLGYKINMVGKN.....PSNAKYIGL
LIVM_METJA/5-317------YLFFERLLN--------------------------------------TPFGRVLRAMREN.....ENTVKAFGR
Y121_MYCGE/6-281------GFVWYLMSF--------------------------------------TKTGLRYRAVGEN.....PNVIDTQGI
Q9I6Z5_PSEAE/59-338------AAVWVLAQR--------------------------------------SFLGFQVRVLGLD.....RRAAGFVGF
Q98MD6_RHILO/14-287------FAALYMFFR--------------------------------------TEKGTAVRAVGAN.....PDMAEAQGI
Q9CLF9_PASMU/36-307------LVFWLLMHK--------------------------------------TTIGRSIFLIGQS.....ERTSRYSAV
O52371_RHITR/57-322------VVVALSFRF--------------------------------------LILGRYFRAVGNN.....PRAAEITGI
LIVH_ECOLI/11-292------LALTIFIRY--------------------------------------SRMGRACRACAED.....LKMASLLGI
Q9KWA8_AGRRH/45-310------VVAWKLLYG--------------------------------------SRFGLHLFAIGGGIASGVEDATRNFGV
Q98EK5_RHILO/53-315------LVVHFGLMR--------------------------------------TSYGVILRGSGGN.....PAALKRAGW
Q9I2F6_PSEAE/53-318------FAAQAVLTR--------------------------------------TVFGRYLIGIGTN.....EEAVRLAGV
P73350_SYNY3/7-371------LAVYLIFYR--------------------------------------SNWGLRIRAVTQN.....RGMSACLGI
Q9KZH2_STRCO/67-346------ALATWVLLR--------------------------------------TKYGNWIFAVGGS.....QESARAVGV
Q98JY4_RHILO/41-309------FLFFLFLRY--------------------------------------TKWGRYIYFAGDN.....PVAARNIGI
O59405_PYRHO/50-320------IFYYYLLYF--------------------------------------TDVGYKLRVSGLS.....PASAKYAGF
Q98JL3_RHILO/52-340------ALIVFTLAR--------------------------------------TGFGRLLYAVGDN.....EHATRLSGV
O83343_TREPA/7-293------ALAWYVLYR--------------------------------------TPFGVHVRATGDQ.....PYAVDGAGL
P74318_SYNY3/6-274------VVLHLILQR--------------------------------------TKVGKAMRAVADN.....VDLAKVSGI
Q987K1_RHILO/554-814------ALVVLTIDR--------------------------------------LPLGVVLRGFGNN.....PTAMVRSGW
Y259_MYCPN/73-364------IFIAVLMKF--------------------------------------TVFGHKLKSTGLS.....VTGSQAAGY
O30014_ARCFU/51-321------LVVMKKVVD--------------------------------------SRIGLRFMALRDS.....EELAESLGI
P73351_SYNY3/61-355------YILCRWLTS--------------------------------------GRFGRILVAIRDD.....ETRVRFTGY
Q98MN6_RHILO/59-339------VLIWILMGR--------------------------------------MLKGFEVRVLGSS.....PRAGRFAGF
O30015_ARCFU/8-272------TALEVFVTR--------------------------------------TKLGKKVIATAQD.....SRAAMMVGI
Q99Q30_ENTCL/81-358------VVGHFVLWR--------------------------------------TTFGFRLRLIGES.....HAAADYAGV
Q98JL4_RHILO/36-311------CVIWIPLRR--------------------------------------SRLGLSIYAIGSS.....ELAAFRSGV
LIVM_ECOLI/110-398------LFVINRLLR--------------------------------------MPLGRAWEALRED.....EIACRSLGL
ALSC_ECOLI/52-318------LILWFLTTR--------------------------------------MRLGRNIYALGGN.....KNSAFYSGI
Q9HR22_HALSA/99-387------VGVAYLLAR--------------------------------------TSFGYDLRTSGSQ.....PEAAAYGGV
LIVH_METJA/14-293------IGLYLLLYK--------------------------------------TKFGIALRASMEN.....PSLAQTMGI
O29434_ARCFU/24-292------TLLYWLIIR--------------------------------------SSFGSIIVAIREN.....ELLAEYAGV
Q9PRD1_UREPA/65-355------IIIWVILKY--------------------------------------TVFGHKVLSVGKS.....FDAAKYAGY
Q98LJ0_RHILO/59-359------LLATWVLLR--------------------------------------TRFGNWIFAAGGD.....PRAARKSAV
Q98PV1_MYCPU/73-354------IIFWIIFSK--------------------------------------TTIGYKIKMIGLN.....PNASDYSGT
O28879_ARCFU/13-293------ASLVTLLYK--------------------------------------TKFGVALRASMEN.....PALAEVMGV
P74455_SYNY3/5-354------YAGLEFWVH--------------------------------------SPWGRILKAIRED.....EEIPRALGK
Y120_MYCGE/76-367------IIVAVVLKY--------------------------------------TVFGHKLKSIGSS.....VFGSQAMGF
Q98J21_RHILO/47-326------ILCHIVLRY--------------------------------------TRYGRAVYAVGGN.....AEAARLSGL
Q98JY6_RHILO/57-328------IVTHIALTR--------------------------------------SRPGWHVLAVGGS.....RRSAHNAGI
Q987G4_RHILO/75-353------VLSWVLIEK--------------------------------------TRWGFAARIAGGN.....VRAAQVQGL
YTFT_ECOLI/55-321------ILFWLLTRK--------------------------------------TALGMFIEAVGIN.....IRAAKNAGV
O29433_ARCFU/11-282------ASLLYFLRR--------------------------------------TVTGIALEAVAQS.....PIGAKLVGI
Y260_MYCPN/10-286------LLVWYLMNF--------------------------------------TKTGLRYRAVGEN.....PNVIDTQGI
Q988C0_RHILO/13-289------FGMGYLYRR--------------------------------------TQLGLNLQAAGDK.....PAALDVAGI
Q9RKT4_STRCO/53-332------AVASWILLR--------------------------------------TRAGNWIFAVGGN.....KDAARAVGV
Q98JJ2_RHILO/56-323------IAGILLLHY--------------------------------------SVYGRRVYAAGGN.....PTAALYSGV
O28878_ARCFU/110-423------YIFVERLLN--------------------------------------SPYGRLLRAMREN.....ESVVEAMGK
O29302_ARCFU/25-274------VFFLMAVKR--------------------------------------SALGLKIEAVRDD.....EVAARAVGI
Q985L1_RHILO/86-358------LIVGFILNF--------------------------------------SRFGNWILAMGGD.....AVSARNAGI
Q98IE3_RHILO/52-351------LACTWLLTR--------------------------------------SRFGNWIFAAGGE.....ANAARNLGV

PF08566

PAM17_CRYNJ/36-212-------------------------------------------------------GATLFSLTHPS-----IARGNPAPL
PAM17_SCHPO/33-205-------------------------------------------------------GRKIWTLLH..-----..KSQARQI
PAM17_ASPFU/74-246-------------------------------------------------------GNAIWRLVY..-----..RKYKPAF
PAM17_DEBHA/12-177-------------------------------------------------------GTALFSLKN..-----..KAAMHQF
A5DHA4_PICGU/2-166-------------------------------------------------------GNPVFRLMN..-----..RNQLAQF
PAM17_YEAST/25-197-------------------------------------------------------GSQVFKLSH..-----..NQQLAQF
A7TFJ6_VANPO/18-188-------------------------------------------------------GSQLFQLSN..-----..RSKLTAF
A2Q923_ASPNC/72-247-------------------------------------------------------GNAVWGLVY..-----..RRYKPAV
A6RWX6_BOTFB/58-240-------------------------------------------------------GTAAFNVKN..-----..RKFRQQM
PAM17_CANGA/18-186-------------------------------------------------------GSQVFKLTK..-----..GNKLAQY
PAM17_CANAL/11-185-------------------------------------------------------GSSIFRLTN..-----..RAQLKQF
PAM17_GIBZE/62-235-------------------------------------------------------GNQVFYILN..-----..RQWKKQM
A3LZW7_PICST/19-186-------------------------------------------------------GTSVFKLKN..-----..KSTLTQY
Q2URA5_ASPOR/67-241-------------------------------------------------------GNAAWGLVN..-----..RRYRQAF
A7S783_NEMVE/36-226-------------------------------------------------------FGSIWRFFN..-----..RDTSKML
PAM17_YARLI/17-185-------------------------------------------------------GQLIFKATN..-----..SKQWPAF
PAM17_KLULA/26-196-------------------------------------------------------GTALFKATS..-----..GPKLLQF
PAM17_NEUCR/88-267-------------------------------------------------------GGMVFNALK..-----..SKYRGQM
A6R0Y4_AJECN/108-295-------------------------------------------------------GNSLWGLVH..-----..RKYKAAV
Q0UWY5_PHANO/108-281-------------------------------------------------------GNQLFSLAY..-----..RGVLAEF
A5DXH9_LODEL/6-189-------------------------------------------------------GSFVFKMLN..-----..RSQLRQY
PAM17_USTMA/50-232-------------------------------------------------------GNSIWGLLH..-----..RSDAKQI
PAM17_ASHGO/16-186-------------------------------------------------------GSAFFRVKH..-----..RGQLEGY
Q2HF36_CHAGB/90-267-------------------------------------------------------GSAVFNALK..-----..SKYKGPM

PF05145

ABRB_ECOLI/29-344------VVAGTVGCL--------------------------------------LRLPSGTMLIPML-----AGAVLQSG.
O69766_PSEPU/200-509------ALLAWVWER--------------------------------------LRHANPWLFGPLL-----VSAAVSIG.
Q9I5H8_PSEAE/33-345------ALVALGWQK--------------------------------------LRQPNPWLLGPLL-----LAAGVSLG.
YHJN_BACSU/33-370------WGACKAAKF--------------------------------------LKFPAPWLLGSML-----GVAIVHVGG
Q98HN9_RHILO/33-349------LVGGLAGKL--------------------------------------CRLPSPFFLGTFI-----FGAIVHLG.
Q9KLW2_VIBCH/33-345------LLLGKASTL--------------------------------------LGIPAPYMLAALL-----ITASFNGFA
Q9RC51_BACHO/27-340------VLTIFLSKH--------------------------------------VTFPGASLFFAIG-----LGFLVHTL.
Q99TJ6_STAAM/31-352------FIVYLIMSK--------------------------------------IKFPTFQLLAPLI-----VLIVWNFS.

PF01098

RODA_HELPY/1-357A.....LLVASPIAY....HFLHDY....QKKRIADFLSEKPN..........YHVMQSIIAIGSG-----GFLGKSKEA
FTSW_BACSU/11-377LGGIVFILVSPIIYLNQDKILTEG.....RLARFESLEDPFKYAN.....SSGLQVINSYYAISSG-----GIFGLGLGE
FTSWL_MYCLE/79-442.....FTAGSTIAYFTFEHIRVRM.....QV.....WWDPFTN.L...DVG.GYQIVQSLFSFATG-----GIFGTGLGN
SP5E_BACSU/10-366......IGLSGFVGL....VLSAPY....RIKRITSYLNPWEDPL.....GSGFQIIQSLYAVGPG-----GLFGMGLGQ
FTSW_ENTHR/8-376AAIASLILVAGLVLLLEKHHLLPSFFE.HAYDRIAMVHNPFLDEH.....GAGYQMSNSYYALYNG-----GLFGRGMGN
FTSW_ECOLI/46-403......MGISAVVLL....ILAEPY....RIRRVTAFWNPWEDPF.....GSGYQLTQSLMAFGRG-----ELWGQGLGN
FTSW_CYAPA/41-395......VGLSMAITS....ISLKPY....QLSRITSFLDPWKDPR.....GKGYQLVQSLITIGSG-----GIFGTGYGI
RODA_BACSU/7-385SG.ILLISLILLVMINFPDVAKSVGIQDYQIKRVTSWVSASNETQE..DSNDSWQVDQAIMAIGSG-----GILGNGISN
RODA_SHIFL/18-365L....VAAFIPILWF....FLMHDY....QRQRVMMLLDPESDPL.....GAGYHIIQSKIAIGSG-----GLRGKGWLH
RODA_HAEIN/19-366G....LAGFIPIMWL....YLMHDY....QRTRVLTLLDPEKDPL.....GAGYHILQSKIAIGSG-----GLSGKGWMQ
FTSW_SYNY3/26-379......LGITTAVTS....ISIRDY....QRARVTSFLDPFADPR.....GDGYQLVQSLYAIASG-----GVLGRGFGM
FTSW_HAEIN/26-383......LGGILFVWL....VLTASY....RLKRFIGFLEPFKEPY.....GTGFQLTNSLIAFGRG-----EITGEGLGN
FTSW_BORBU/9-363......TFLPVSAIF....LMLEPY....RVSRIFAFLNPYDDPS.....G