Sequence alignment for CL0143

PF00251

SCR_ZYMMO/33-343--HVTP-----LTGWMNDP-----------------------------NGLIF..FKGEYHLFYQYYP.F------APV.
SCRB_PEDPE/37-339--HIQP-----TSGLLNDP-----------------------------NGFSY..FDGQWHLFYQVFP.F------GPV.
INV3_ARATH/43-365--HFQP-----LKNWMNDP-----------------------------NGPMI..YKGIYHLFYQYNP.Y------GAV.
INV4_ARATH/54-372--HFQP-----PKHWINDP-----------------------------NGPVY..YKGLYHLFYQYNT.K------GAV.
INV5_ARATH/47-369--HFQP-----PKNWMNDP-----------------------------NGPMI..YKGIYHLFYQWNQ.N------GAV.
SCRB_BACSU/33-338--HIMP-----PVGLLNDP-----------------------------NGVIY..WKGSYHVFFQWQP.F------QTG.
INV2_ARATH/52-371--HFQP-----PRHWINDP-----------------------------NAPML..YKGVYHLFYQYNP.K------GAV.
SCRB_KLEPN/31-336--HLAP-----VNGLLNDP-----------------------------NGFCQ..VAGRYHLFYQWNP.L------ACD.
Q9RGC0_9PSED/280-596--HVSP-----PAHWMNEP-----------------------------HAPIY..FNGQYHLFYQHNP.Q------GPY.
SCRB_VIBCL/98-398--HISP-----PQGLLNDP-----------------------------NGFIY..HQGEYHLFYQWHP.F------VCE.
O02490_TRIFO/111-409--HFTP-----PFGWMNDP-----------------------------NGLFY..LDGVYHLYYQHNP.F------AST.
Q8DY03_STRA5/37-340--HLEA-----KTGLLNDP-----------------------------NGFSY..FNGKFHLFYQNWP.F------GAA.
INV1_SCHPO/87-407--HFTP-----SSGFMNDP-----------------------------NGLVY..TGGVYHMFFQYSP..------KTL.
Q834P0_ENTFA/38-341--HIQP-----QTGLLNDP-----------------------------NGFSY..FNNQWHLFYQAFP.F------GSV.
Q6PVN1_TRIMO/132-444--HFQP-----EKNWMNDP-----------------------------NGPVY..YRGWYHLFYQYNP.E------GAV.
SACC_BACSU/39-349--HFTP-----EANWMNDP-----------------------------NGMVY..YAGEYHLFYQYHP.Y------GLQ.
Q93X59_CICIN/50-368--HFQP-----PSNWMNDP-----------------------------NGPML..YQGVYHFFYQYNP.Y------AAT.
Q65DN5_BACLD/32-337--HIMP-----PVGLLNDP-----------------------------NGFIQ..WKGVYHLFYQWMP.F------KTG.
Q42691_CHERU/44-365--HFQP-----RKNWINDP-----------------------------NGPML..FKGIYHLFYQYNP.N------GVK.
Q43855_VICFA/51-371--HFQP-----NRNWINDP-----------------------------NGPMY..YRGIYHLFYQYNP.K------GAV.
INV4_ORYSJ/64-381--HFQP-----PKNWINDP-----------------------------NGPMY..YNGIYHEFYQYNP.N------GSV.
INV3_DAUCA/58-376--HFQP-----QKHWINDP-----------------------------NGPMF..YKGYYHLFYQYNP.K------GSV.
Q7WWP6_LACAI/37-338--HLHP-----ISGLINDP-----------------------------NGFSY..FNGAYHLFYQSYP.F------GAV.
Q82YR4_ENTFA/37-340--HIEP-----KTGLLNDP-----------------------------NGFSF..FNGKFTLFYQNWP.F------GAA.
O94224_CYBJA/34-356--HLTP-----PVGWMNDP-----------------------------NGLFYDSSESTYHVYYQYNP.N------DTI.
Q65EI7_BACLD/46-355--HLTT-----PDKWKNDP-----------------------------QKPVY..FNGEYHYYYLYNR..------DYP.
Q43856_VICFA/53-374--HFQP-----PKNWINDP-----------------------------NGPLI..YKGVYHLFYQYNP.K------GAQ.
INU1_KLUMA/43-375--HFTP-----SHGWMNDP-----------------------------NGLWYDAKEEDWHLYYQYNP.A------ATI.
RAFD_ECOLX/28-329--HLAP-----PAGWMNDP-----------------------------NGLIY..FNGRYHAFFQHHP.A------SAY.
INV6_ORYSJ/42-371--HFQP-----AKNWQNDP-----------------------------NGPVY..YNGMYHLFYQYNP.H------GAL.
1FEH_HORVU/68-385--HFQP-----AKNWMNDP-----------------------------SGPMY..FNGIYHEFYQYNL.N------GPI.
Q9RBJ1_GLUDI/47-372--HFSP-----AAYWMNDP-----------------------------NGPIL..LDGVYHLFYQYAP.G------SMT.
O00056_PENPU/33-356--HFCP-----AENWMNEP-----------------------------NGLIK..IDSTWHLFYQADP.T------ANV.
SCRB_STRMU/37-340--HIEP-----KTGLLNDP-----------------------------NGFSY..FNGKFNLFYQNWP.F------GAA.
Q9FNS9_CICIN/46-362--HFQP-----PKNWINDP-----------------------------NGPMY..FNGVYHLFYQYNP.Y------GPL.
Q9ZHJ7_CLOBE/31-333--HIEM-----PFGLINDP-----------------------------NGLSY..YDNKFHIFYQWNP.F------GCE.
Q62DJ1_BURMA/55-380--HYTP-----RRNWMNDP-----------------------------NGLVY..ENGVYHLFYQYNP.H------GNF.
Q888X9_PSESM/32-333--HLAP-----PAGWMNDP-----------------------------NGVVY..FRGEYHVFYQHHP.F------DAK.
INV6_ARATH/21-341--HFQP-----QRNWLNDP-----------------------------NAPMY..YKGFYHLFYQNNP.L------APE.
Q6F0T9_MESFL/38-341--HIAP-----PNGLLNDP-----------------------------NGLVY..IDGEHYIHYQWSP.L------QPY.
Q8GT63_TRIMO/48-366--HFQP-----AKNWQNDP-----------------------------NGPMY..HNGLYHFFYQYNP.D------GVT.
INV2_DAUCA/65-383--HFQP-----KKHWINDP-----------------------------NGPMY..YKGFYHLFYQYNP.K------GAV.
Q65U44_MANSM/56-359--HLAP-----STGLLNDP-----------------------------NGLVF..DGEKFHLFYQWFP.F------DAI.
Q944U7_CARPA/59-376--HFQP-----PKHWINDP-----------------------------NAPMY..YNGVYHLFYQYNP.K------GAV.
Q84V21_SOLLC/57-376--HFQP-----PKHWINDP-----------------------------NAPMY..YNGVYHLFYQYNP.K------GSV.
P94466_GEOSE/34-339--HLMP-----PVGLMNDP-----------------------------NGLIH..WNGVYHVFYQWMP.F------HTG.
Q45155_BACFG/137-443--HHTP-----LYGWMNDA-----------------------------NGLVY..KDGEYHLFYQYNP.Y------GSM.
O81118_WHEAT/47-373--HFQP-----PKHWINDP-----------------------------NGPMY..YKGLYHLFYQYNP.K------GAV.
Q9L8G4_CLOAT/31-337--HLMP-----KVGFMNDP-----------------------------NGLIE..INGEYHVFYQYNP.F------YPD.
INV1_MAIZE/129-459--HFQP-----PKNWMNDP-----------------------------NGPLY..HKGWYHLFYQWNP.D------SAV.
GFT_ALLCE/75-405--HFRT-----VRNYMNDP-----------------------------SGPMY..YKGWYHLFYQHNK.D------FAY.
Q8LK75_LAGSI/143-463--HFQP-----EGNWMNDP-----------------------------NGPLY..HKGWYHLFYQYNP.E------SAV.
O82119_SOLLC/56-375--HFQP-----PKNWINDP-----------------------------NGPMY..YNGVYHLFYQYNP.K------GAT.
Q8L6W2_BETVU/147-465--HFQP-----QKNWMNDP-----------------------------NGPLY..YNGWYHFFYQYNP.A------GAV.
Q8XQE3_RALSO/19-318--HLCP-----PQGLLNDP-----------------------------NGLIF..WRGAYHVFYQWNP.H------GCR.
Q41604_TULGE/99-420--HFQP-----EKNWMNDP-----------------------------DGPMF..YKGWYHIFYQYNP.V------SAV.
Q64ML3_BACFR/121-408--HFTT-----RRGWINDP-----------------------------NGLVF..YEGEYHLFYQHNP.Y------ERE.
Q8DNP0_STRR6/31-336--HFSA-----EIGWINDP-----------------------------NGFVY..FRGEYHLFYQFYP.Y------DSV.
Q8W3M2_CITUN/123-441--HFQP-----QKNWMNDP-----------------------------NGPVF..YKGWYHLFYQYNP.N------GAI.
Q8XK71_CLOPE/29-331--HFEP-----PFGLINDP-----------------------------NGLSY..YKGEYYIFFQWNP.Y------GCE.
Q9ZP42_FRAAN/53-372--HFQP-----RKNWINDP-----------------------------NGPLI..YKGIYHLFYQYNP.S------SVV.
Q5WDB1_BACSK/36-338--HLMA-----PSGWMNDP-----------------------------NGLIY..FNGQYHAFYQHYP.Y------GET.
O65778_CYNSC/94-412--HFQP-----AKNFIYDP-----------------------------NGPLF..HMGWYHLFYQYNP.Y------APF.
Q8DNS7_STRR6/37-340--HVEP-----KTGLLNDP-----------------------------NGFSY..FDGKWILFYQNFP.F------GAA.
Q6AW26_LOLPR/94-412--HYQP-----EGHFMSDP-----------------------------NGPVY..YRGYYHLFFQYNR.R------GVA.
Q5WBG3_BACSK/35-336--HIQP-----VTGLLNDP-----------------------------NGFAY..FAGEYHLFYQWFP.L------GTY.
Q8CRR2_STAES/37-337--HIQP-----EMGLLNDP-----------------------------NGLIY..YEGYYYISHQWFP.L------GAV.
Q752P4_ASHGO/54-389--HATP-----SQGWMNDP-----------------------------NGLWYDTKEEVYHVYYQYNP.A------DTV.
Q8DWH3_STRMU/37-353--HYNT-----PKGFMNDI-----------------------------QTIFK.GSDGYYHMYYLLNSNY------KLA.
Q5LY63_STRT1/37-340--HIEP-----ETGLLNDP-----------------------------NGFSY..FNGKFQLFYQSWP.F------GAA.
SCRB_LACLL/37-342--HIEP-----ETGLLNDP-----------------------------NGFSY..FNEKWHLFYQHFP.F------GPV.
Q84F22_9BIFI/57-368--HIAS-----NGGWINDP-----------------------------NGLCR..YNGRWHVFYQLHP.H------GTQ.
Q6G7R6_STAAS/38-338--HIQP-----ETGLLNDP-----------------------------NGLIF..YKGKYYVSHQWFP.L------GAV.
Q5XA96_STRP6/37-340--HVEP-----KTGLLNDP-----------------------------NGFSY..FNGRYHLFYQNWP.Y------GAA.
Q9KBR7_BACHD/33-338--HLMP-----PVGLLNDP-----------------------------NGFID..WDGTYHLFYQWHP.F------EAA.
LEVB_BACSU/48-356--HFTT-----PDKWKNDP-----------------------------QKPIY..FDGKYHYFYLYNR..------DYP.
Q5ZQK6_9ASTR/50-366--HFQP-----PQNWMNDP-----------------------------NGPMY..YKGVYHFFYQYNP.N------GPL.
INV1_DAUCA/64-384--HFQP-----KQNWINDP-----------------------------NGPMY..YKGVYHLFYQYNP.K------GAV.
O04372_ASPOF/122-447--HFQP-----EKNWMNDP-----------------------------NGPLY..YKGWYHFFYQYNP.N------AAV.
O65341_SACRO/23-357--HFQP-----QKNWMNDP-----------------------------NGPVY..YKGWYHLFYQYNP.D------GAI.
Q5WDB0_BACSK/20-318--HFST-----PVGNLADP-----------------------------NGLVF..YKGEYHLFHQKNG..------....
Q6KCH6_HORVU/127-454--HFQP-----EKNWMNDP-----------------------------NGPVY..YKGWYHLFYQYNP.D------GAI.
SCRB_SALTM/31-336--HHAP-----VTGLMNDP-----------------------------NGFIE..FAGRYHLFYQWNP.L------ACD.
O86076_ECOLX/29-330--HLAP-----PAGWMNDP-----------------------------NGLIW..FNDRYHAFYQHHP.M------SEH.
INV1_ORYSJ/53-369--HFQP-----PMNWINDP-----------------------------NGPLY..YKGWYHLFYQYNP.K------GAV.
Q8W431_WHEAT/84-403--HFQT-----AKNYMSDP-----------------------------NGLMY..YRGWYHMFFQYNP.V------GTD.
Q6DA94_ERWCT/31-336--HLSP-----CVGLLNDP-----------------------------NGFIH..HNGRYHLFYQWNP.L------ACA.
INVB_DAUCA/135-453--HFQP-----QENWMNDP-----------------------------NGPLF..HMGWYHLFYQYNP.D------SAI.
Q97I80_CLOAB/49-358--HFTV-----PNKWKNDP-----------------------------QRPVF..FDGEYHYYYLYNK..------DYP.
Q84XV1_MUSAC/62-379--HFQP-----PRNWINDP-----------------------------NGPMY..FNGVYHLFYQYNP.N------GSV.
Q94C07_ORYSA/140-471--HFQP-----AQNWMNDP-----------------------------NGPLY..YKGWYHLFYQWNP.D------TAV.
INV3_ORYSJ/51-377--HFQP-----PKHWINDP-----------------------------NGPMY..YKGLYHLFYQYNP.K------GAV.
Q65D73_BACLD/27-331--HMMP-----RANWINDP-----------------------------NGLIQ..YKGEYHVFYQHHP.Y------DEN.
Q9S943_VITVI/137-455--HFQP-----EKNWMNDP-----------------------------NGPMF..YGGWYHFFYQYNP.D------AAV.
Q74HI7_LACJO/37-340--HIHP-----LSGLINDP-----------------------------NGFSY..YNGEYHLFCQSYP.F------GPV.
Q70LF5_HORVU/96-419--HFQP-----DKYYQNDP-----------------------------NGPVY..YGGWYHFFYQYNP.S------GSV.
O23786_CYNSC/107-426--HFQP-----DKNYISDP-----------------------------DGPMY..HMGWYHLFYQYNP.E------SAI.
O81082_ALLCE/87-413--HFQP-----PNHFMADP-----------------------------NAAMY..YKGWYHFFYQYNP.N------GSA.
O74641_ASPNG/33-356--HFTP-----DQYWMNEP-----------------------------NGLIK..IGSTWHLFFQHNP.T------ANV.
Q9ZR55_CICIN/25-343--HFQP-----PQNWMNDP-----------------------------NGPMC..YNGVYHLFYQYNP.F------GPL.
O81189_MAIZE/58-383--HFQP-----PKNWINDP-----------------------------NAPMY..YKGWYHFFYQYNP.K------GAV.
Q6F0V0_MESFL/34-333--HLAG-----YSGSTNDP-----------------------------NGLTY..HKGKYYIFMQSCP.F------SIQ.
BFRA_THEMA/7-294--HFFP-----ITGWMNDP-----------------------------NGLIF..WKGKYHMFYQYNP.R------KPE.
INV2_YEAST/32-353--HFTP-----NKGWMNDP-----------------------------NGLWYDEKDAKWHLYFQYNP.N------DTV.
Q8GM36_BACME/30-333--HIMA-----PANWINDP-----------------------------NGLVQ..YKGEYHVFYQHHP.Y------DEN.
Q9S944_VITVI/115-433--HFQP-----EKNWMNDP-----------------------------DGPLF..HMGWYHLFYQYNP.D------SAV.
Q9LAL1_9PSED/15-331--HFTP-----ETNWMNDP-----------------------------NGLVY..YEGEYHLFYQYHP.F------GNT.
INV1_HANAN/32-354--HLTP-----DQGWMNDP-----------------------------NGMFYDRKDKLWHVYFQHNPDK------KSI.
Q9CJZ0_PASMU/57-355--HLAP-----ETGLLNDP-----------------------------NGLVF..DGEKYHIFYQWFP.Y------AAI.
Q8GI55_GEOSE/14-329--HFSP-----KKNWMNDP-----------------------------NGLVY..FKGEYHLFFQHNP.N------DSI.
Q7XA49_SOYBN/45-362--HFQP-----PKNWINDP-----------------------------NGPLR..YAGLYHLFYQYNP.K------GAV.
INVA_SOLLC/108-427--HFQP-----QKNWMNDP-----------------------------NGPLY..HKGWYHLFYQYNP.D------SAI.
Q5WI15_BACSK/12-315--HITP-----THGLLNDP-----------------------------NGLAY..FQGQYHVFYQWNP.Y------GTE.
Q9F498_ERWAM/31-336--HLAP-----PVGLLNDP-----------------------------NGFIH..FEQRYVLCYQWNP.L------DCK.
Q8A6W7_BACTN/150-451--HFSP-----LYGWMNDP-----------------------------NGMVY..KDGEYHLFYQYNP.Y------GSK.
SCRB_STAXY/38-338--HIQP-----QIGLLNDP-----------------------------NGLIY..FKGNYYVSHQWFP.L------GPV.
Q45372_PAEPO/17-347--HYSP-----EKNWMNDP-----------------------------NGLVY..FEGEYHLFYQHTP.H------DTQP
SCRB_VIBAL/41-341--HIAP-----KFGLLNDP-----------------------------NGLCY..FNGEHHIFYQWTP.V------GPV.
INV7_ORYSJ/44-366--HFQP-----AKNWQNDP-----------------------------NGPMY..HNGMYHLFYQYNP.H------SAL.
Q5KUA8_GEOKA/34-339--HLMP-----PVGLMNDP-----------------------------NGLID..WHGTYHVFYQWMP.F------RTG.
O42801_9EURO/31-371--HFSP-----QKNWMNDP-----------------------------NGLLY..HNGTYHLFFQYNP.G------GIE.
Q7WWQ7_LACAI/24-321--HFNA-----PVGWINDP-----------------------------NGLIY..YKNYYQLYYQYNP.Y------APH.
Q6HN59_BACHK/32-333--HIHP-----PFGLMNDP-----------------------------NGVSY..YNDEYHVFYQWYP.F------GPI.
INV1_ARATH/56-378--HFQP-----PKNWMNDP-----------------------------NGPMI..YKGIYHLFYQWNP.K------GAV.
Q84V20_SOLLC/57-375--HFQP-----EKHWINDP-----------------------------NAPMY..FNGVYHLFYQYNP.N------GSV.
Q6EVL5_ECOLX/31-336--HLAP-----VTGLMNDP-----------------------------NGFCW..SGGRYHLFYQWNP.L------ACD.
Q9FR47_POASE/86-409--HFQT-----EKNFMSDP-----------------------------NGPVY..YRGYYHLFYQYNT.K------GVV.
Q9ZR32_DAUCA/105-423--HFQP-----QKNWMNDP-----------------------------NGPLF..HMGWYHFFYQYNP.N------SAV.
Q94C08_ORYSA/125-454--HFQP-----EKNWMNDP-----------------------------NGPLY..HKGWYHIFYQWNP.E------GAA.
Q6F4N3_LOLPR/116-437--HFQP-----LKHYMNDP-----------------------------NGPVY..YGGWYHLFYQHNP.Y------GDS.
O81083_ALLCE/154-479--HFQP-----VKNWMNDP-----------------------------NGPLY..YKGWYHFFYQYNP.E------GAV.
Q42722_DAUCA/122-441--HFQP-----NQNWMNDP-----------------------------NGPLF..YKGWYHLFYQYNP.D------GAI.
Q8LRN6_SOLLC/7-325--HFQP-----PKNWINDP-----------------------------NAPMY..YNGVYHLFYQYNP.Y------GSV.
Q5NEI9_FRATT/30-331--HFTA-----KKAWMNDP-----------------------------NGLVY..FKGKYHMFYQHYP.Y------GKH.
INVA_PHAVU/120-440--HFQP-----EKNWMNDP-----------------------------NGPMY..YKGWYHFFYQYNP.N------GAV.
6FEH_BETVU/60-382--HFQS-----PKNWMNDP-----------------------------NGPMI..YKGIYHLFYQYYP.Y------DPV.
Q8RLU2_PAEPO/14-330--HFSP-----KSGWMNDP-----------------------------NGMVY..YEGRYHLFYQHHP.F------GTT.
INVA4_ARATH/125-445--HFQP-----EQNWMNDP-----------------------------NGPLF..YKGWYHFFYQYNP.N------AAV.

PF04616

O30426_CALSA/54-321--SSNP-----IILSDIPD-----------------------------PDIIR--VGND...YYMVST-T------MHL-
Q9K6P5_BACHD/5-295--IQNP-----ILPGFHPD-----------------------------PSIVR--VGDD...YYIATS-T------FEW-
Q8P3K7_XANCP/60-332--YRNP-----IVAGDRPD-----------------------------PTILK--DGDD...YSMTFS-S------FFS-
Q8A1K5_BACTN/22-288--YPKV-----VLSGDYPD-----------------------------PSVMR--DGED...YYMTHS-P------FYY-
Q93J96_STRCO/52-335--FRNP-----L..NSGPD-----------------------------PFMTH--WKGA...YYLTTT-Q------G..-
Q9A4M8_CAUCR/35-330--YRNP-----VVQGFYPD-----------------------------PSVTR--AGKD...FYLVNS-T------FAW-
Q9A9Z8_CAUCR/61-333--FLNP-----ILTGDRPD-----------------------------PSILK--DGAD...YYMTHS-S------FDA-
Q8A3Q4_BACTN/26-309--YKNP-----VVNYSLPD-----------------------------PSVIR--AEDGY..FYLYAT-E------DI.-
Q9KBQ8_BACHD/8-311--YRNP-----FIEQRADP-----------------------------WVYKH--ADG....FYYFTG-S------VPA-
Q92P74_RHIME/5-303--IRNP-----ILPGFNPD-----------------------------PSICR--VGED...YYIATS-T------FEW-
Q8A0C6_BACTN/25-303--FTNP-----VIRGDVPD-----------------------------PSVIR--IEDT...YYATGT-S------SEW-
Q82P90_STRAW/37-336--FTNP-----LAEKRADP-----------------------------HIFKH--TDG....YYYFTA-T------VPE-
Q8PBE4_XANCP/26-318--YRNP-----VLAGFYPD-----------------------------PSAIR--VGNA...FYLVTS-S------FGY-
YAGH_ECOLI/3-303--ITNP-----ILTGFNPD-----------------------------PSLCR--QGED...YYIATS-T------FEW-
Q97TI6_CLOAB/24-307--ADNP-----VVQTLYTT-----------------------------DPAPM--VYNGT..CYLYTG-H------DED-
Q8A3V2_BACTN/35-295--YINP-----ILNADYSD-----------------------------PDVIR--VGDK...YYMVNS-D------FHY-
Q8PE34_XANCP/46-319--FLNP-----VLAGDHPD-----------------------------PSVLK--DGQD...YYLTLS-S------FDA-
Q9A9J1_CAUCR/6-306--IRNP-----VLRGFNPD-----------------------------PSIVR--VGED...YYIATS-T------FEW-
Q9RI60_STRCO/4-282--YDNP-----VISGFHPD-----------------------------PSVCR--VGDD...YYLVCS-S------FEY-
Q9KXY8_STRCO/30-319--PGRV-----TGSVVTHD-----------------------------PTMIR--TSSGQ..YRLYAT-G------...-
O52729_9BACI/3-301--IINP-----VLKGFNPD-----------------------------PSICR--VGED...YYIAVS-T------FEW-
Q8A6K8_BACTN/42-323--FTIP-----VSSLRLRD-----------------------------PFILV--DKKT.SMYYLHFN-N------N..-
Q8EPL4_OCEIH/6-297--FKNP-----IIPGFYPD-----------------------------PSICR--VDED...YYLVTS-T------FEY-
Q8CWF7_OCEIH/4-302--IKNP-----ILTGFNPD-----------------------------PSICR--AGED...YYIAVS-T------FEW-
O52575_SELRU/3-304--IQNP-----VLKGFNPD-----------------------------PSIVR--AGDD...YYIATS-T------FEW-
Q8A1Z2_BACTN/337-620--YANP-----VINFSLPD-----------------------------PTIIK--GDDEY..YYLYAT-E------SI.-
Q9CFH1_LACLA/4-305--IQNP-----ILPGFNAD-----------------------------PSIIR--VEDT...YYIANS-T------FEW-
Q8P3G6_XANCP/43-335--YRNP-----ILAGFYPD-----------------------------PSITR--VGER...YYLVNS-T------FAY-
XYLB_BUTFI/4-291--ANNP-----ILKGFYPD-----------------------------PSICR--KGDD...FYLVCS-S------FVY-
Q8CK14_STRCO/11-285--YTNP-----VLNADWSD-----------------------------PDVVR--VGDD...FYLTAS-S------FGR-
Q97DM1_CLOAB/2-300--IKNP-----ILRGFNPD-----------------------------PSICR--ADTD...YYIATS-T------FEW-
Q81ZV8_STRAW/441-719--TRSP-----VLPGLYAD-----------------------------PDIQY--LDG....RYWIYP-T------TDG-
XYNB_BACPU/3-301--ITNP-----VLKGFNPD-----------------------------PSICR--AGED...YYMAVS-T------FEW-
Q82P89_STRAW/52-348--YTNP-----VKAQKGAD-----------------------------PWLEY--YNGN...YYLVTT-S------FT.-
Q97IW1_CLOAB/6-309--ILNP-----IIIQRADP-----------------------------MIYKH--NDG....YYYFTA-S------VPE-
Q8A1I6_BACTN/28-326--SGNP-----ILPGFHAD-----------------------------PEVLY--SHQTK..RYYIYP-T------SDG-
Q8Z9F3_SALTI/4-306--WPNP-----FIEQRADP-----------------------------FILRD--GSD.....YYFIA-S------VPE-

PF04041

Q9YFA2_AERPE/23-354RYRRRH-----TVDIARRIGYIRPENVEL......ERGSTRRVVSFFNSTLRL--AREGLEVYGRVVVGY------YKY-
O58834_PYRHO/1-299MLKKLP-----K.PILE.PS.KEGFDSKN................VYNPSVI.--YVREK.....FIMLY------RAE-
Q9WZN9_THEMA/15-332SLRKDE-----TIDVFNRVTYFFPKDFVITN.......YPRNPVAVFNPGAVL--VGKALHVFPRLIFDY------YKY-
Q9X0V2_THEMA/4-323FTEKIP-----NIPWEERPEGYTGPVWRYSKNPIIGRNPVPKGARVFNSAVVP--YNGE......FVGVF------RID-
Q9X2G7_THEMA/4-296KLERHP-----ANPILE.PSPYFLWESRF................VFNPAVV.--YDGEL.....FHLLY------RAQ-
Q9HH03_PYRFU/31-329PPKKIP-----Q.PILS.PS.REGFDSRN................TYNPAVI.--KEKD.....RIVMLY------RAE-
O67215_AQUAE/17-345EKRRFE-----TKDLVKRLKVITGHDIHIQN......YPVETPRVAFNPSIHV--FENRLRIYARVVMGY------YTY-
Q9UZM0_PYRAB/1-299MLKKMP-----K.PIIV.PS.ENGFDSRC................SYNPAVI.--REGST.....YVMLY------RGE-

PF02435

SACB_ZYMMO/1-400--MLNKAGIAEPSLWTRADAMKVHTD.DPTA...........TMPTIDYDFPVMTD.....KYWVWDTWPLRDIN.GQVV
INVB_ZYMMO/1-398--MFNFNA....SRWTRAQAMKVNKF.DLTT...........SMPEIGTDFPIMRD.....DLWLWDTWPLRDIN.GNPV
SACB_STRSL/223-685--FSDDAIKGTGTSLTYRNLKDIVASFLKQDSKLAVPYFKADTIINMPAFNTVDAQTMKKEEIDVWDSWPVQDAKSGVVS
SACB_BACAM/37-470--YKETYG...VSHITRHDMLQIPK..QQQNEKYQVPQFDQSTIKNIESAKG..........LDVWDSWPLQNAD.GTVA
SACB_GLUDI/77-540--AYDPQS.DFTARWTRADALQIKAHSDATVAAGQNSLPAQLTMPNIPADFPVINP.....DVWVWDTWTLIDKH.ADQF
SACB_STRMU/184-637--LTSDA..QTGHQMTYQEFDKIAQTLIAQDERYAIPYFNAKAIKNMKAATTRDAQTGQIADLDVWDSWPVQDAKTGEVI
O82854_BACSP/38-487--YKEDYG...FAHITRADMLKIPG..QQNSPQFKVPQFNASAIKNIDSAKGYDKSGN.LIDLDVWDSWPLQNAD.GTAA
Q9Z5E5_PAEPO/37-482--LKTDNA...FTQITRNDMLNIFK..QQGKEKYEVPSFDASTIKNIPSAMGRDSSGK.LIDFDVWDSWPLQNAD.GTVA
SACB_ERWAM/1-407--MSDYN..YKPTLWTRADALKVHED.DPTT...........TQPVIDIAFPVMSE.....EVFIWDTMPLRDFD.GEII
SACB_RAHAC/1-407--MTNLN..YTPTIWTRADALKVNEN.DPTT...........TQPIVDADFPVMSD.....EVFIWDTMPLRSLD.GTVV
SACB_PSESG/1-407--MSNIN..YAPTIWSRADALKVNEN.DPTT...........TQPLVSPDFPVMSD.....TVFIWDTMPLRELD.GTVV

PF03664

XYNC_CELJU/321-555--CELKA----PLRWTSTGPLISPKNPGWISI----------------KDPSIVKYNDTYHVYATYY..D------TAY-
Q9X583_9ACTO/516-788--CALPS----TYRWTSTDALAQPAN.GWASL----------------KDFTTVTYNGKHLVYGSNY.SG------SSY-
Q9HEY3_COCCA/26-295--CKLPT----SYKWTSSGALAQPKS.GWANL----------------KDFTISSLNGKHIVYATDHDTG------SKY-
AXHA_ASPSO/28-298--CALPS----SYSWTSTGALAEPKA.GWAAL----------------KDFTNVVFNGQHIVYGSVADTS------GNY-
AXHA_ASPNG/28-302--CALPS----TYSWTSTDALATPKS.GWTAL----------------KDFTDVVSNGKHIVYASTTDTQ------GNY-

PF00251

SCR_ZYMMO/33-343.W-----------------------------------..G..PMHWGHAK.SRDL------VHWETLP.VALAPG.DSFD
SCRB_PEDPE/37-339.H-----------------------------------..G..LKSWQHVT.SKNL------VDWHDEG.LAIRPD.TPYD
INV3_ARATH/43-365.W-----------------------------------..D.VRIVWGHST.SVDL------VNWISQP.PAFNPS.QPSD
INV4_ARATH/54-372.W-----------------------------------..G..NIIWAHSV.SKDL------VNWEALE.PALSPS.KWFD
INV5_ARATH/47-369.M-----------------------------------..DVNKTVWGHAT.STDL------INWITLS.PAIRPS.RPSD
SCRB_BACSU/33-338.H-----------------------------------..G..AKFWGHYT.TQDV------VNWKREE.IALAPS.DWFD
INV2_ARATH/52-371.W-----------------------------------..G..NIVWAHSV.SKDL------INWEALE.PAIYPS.KWFD
SCRB_KLEPN/31-336.H-----------------------------------..T..YKCWGHWS.SADL------LHWRHEP.IALMPD.EEYD
Q9RGC0_9PSED/280-596.W-----------------------------------..H..QIHWGHWV.SDDL------VHWRDLP.VALSPEKNAVD
SCRB_VIBCL/98-398.H-----------------------------------..K..DKYWVHLK.SLDL------VHWQWQS.VALTPS.DWFD
O02490_TRIFO/111-409.W-----------------------------------..G..NMSWGHAT.TKDF------VHYEHHP.IVLFPD.ELGH
Q8DY03_STRA5/37-340.H-----------------------------------..G..LKQWVHTE.SDDL------VHFKETG.IKLKPD.HVND
INV1_SCHPO/87-407.T-----------------------------------.AG..EVHWGHTV.SKDL------IHWENYP.IAIYPD.EHEN
Q834P0_ENTFA/38-341.H-----------------------------------..G..LKSWAHLT.SSDL------IHWDYEG.IALYPD.SEYD
Q6PVN1_TRIMO/132-444.W-----------------------------------..G.N.IAWGHAV.FRDL------IHWRHLP.LAMVPD.QWYD
SACC_BACSU/39-349.W-----------------------------------..G..PMHWGHAV.SKDL------VTWEHLP.VALYPD.EKGT
Q93X59_CICIN/50-368.F-----------------------------------..G.DVIIWAHAV.SYDL------VNWIHLD.PAIYPT.QEAD
Q65DN5_BACLD/32-337.H-----------------------------------..G..AKLWGHYS.SADL------VNWRHEE.IALTPS.DWFD
Q42691_CHERU/44-365.L-----------------------------------..R.GPPVWGHST.SKDL------VNWMPQP.LTMEPE.MAAN
Q43855_VICFA/51-371.W-----------------------------------..G.N.IVWGHSV.SKDL------INWKELE.PALFPS.KPFD
INV4_ORYSJ/64-381.W-----------------------------------..G.N.IVWGHSV.STDL------INWIRLE.PAIEGN.TPSD
INV3_DAUCA/58-376.W-----------------------------------..G.N.IVWAHSV.SKDL------INWIALE.PAIFPS.KPFD
Q7WWP6_LACAI/37-338.H-----------------------------------..G..LKSWVHFK.SKDL------VHWENLG.LAIEPD.TMAD
Q82YR4_ENTFA/37-340.H-----------------------------------..G..LKKWVHAE.SDDL------VHFNITG.TELLPD.TKYD
O94224_CYBJA/34-356.W-----------------------------------..G.LPLYWGHAT.SDDL------LTWDHHA.PAIGPE.N..D
Q65EI7_BACLD/46-355.D-----------------------------------..G.NGTEWRHAV.SDDL------VHWQDKG.VAIPKY.TNKN
Q43856_VICFA/53-374.W-----------------------------------..G.N.IVWAHSV.STDL------INWIPLD.PAIFPS.QPSD
INU1_KLUMA/43-375.W-----------------------------------..G.TPLYWGHAV.SKDL------TSWTDYG.ASLGPG.S..D
RAFD_ECOLX/28-329.Q-----------------------------------..G..PMHWGHAT.STDM------LHWQHEL.VALAPG.DKYD
INV6_ORYSJ/42-371.W-----------------------------------DVG.N.LSWGHSV.SGDL------VNWAALD.NALDPT.APFD
1FEH_HORVU/68-385.F-----------------------------------..G.D.IVWGHSV.STDL------VNWIGLE.PALVRD.TPSD
Q9RBJ1_GLUDI/47-372.W-----------------------------------..G..HPSWGHAT.STDL------LHWTEHG.VAIAAT.PGEE
O00056_PENPU/33-356.W-----------------------------------..G..NECWGHAT.SSDL------LHWDHLP.VAIP......V
SCRB_STRMU/37-340.H-----------------------------------..G..LKSWIHTE.SEDL------VHFKETG.TVLYPD.TSHD
Q9FNS9_CICIN/46-362.W-----------------------------------..G.N.ISWGHSI.SYDL------VNWFLLE.PALSPK.EPYD
Q9ZHJ7_CLOBE/31-333.H-----------------------------------..K..TKHWGLVT.TTNF------INFTKPQ.MALKPQ.DWFD
Q62DJ1_BURMA/55-380.W-----------------------------------..G..DMSWGHAT.SRDL------VHWDEQP.VAMPAN.ARED
Q888X9_PSESM/32-333.W-----------------------------------..G..PMYWGHAK.SADL------VHWQHLP.IALAPG.DDFD
INV6_ARATH/21-341.F-----------------------------------..SRTRIIWGHSV.SQDM------VNWIQLE.PALVPS.ESFD
Q6F0T9_MESFL/38-341.H-----------------------------------..G..MKHWRLVK.TKDF------VNYDDLG.VSVIPT.EEFE
Q8GT63_TRIMO/48-366.W-----------------------------------..GNGNLSWGHSV.SVDL------VNWFALD.AALQPS.RPFD
INV2_DAUCA/65-383.W-----------------------------------..G.N.IVWAHSI.SKDL------INWVALE.PAIFPS.KPFD
Q65U44_MANSM/56-359.H-----------------------------------..G..MKHWKHFT.TEDF------HIYTEAD..PLIPC.ELFE
Q944U7_CARPA/59-376.W-----------------------------------..G.N.IVWAHSV.STDL------INWIPLK.PAIVPS.EPFD
Q84V21_SOLLC/57-376.W-----------------------------------..G.N.IIWAHSV.SKDL------INWIHLE.PAIYPS.KKFD
P94466_GEOSE/34-339.H-----------------------------------..G..AKFWGHYT.SCDL------IHWKQEK.IALAPS.EWYD
Q45155_BACFG/137-443.W-----------------------------------..G..NMHWGHSV.SKDL------VHWEHLE.PALARD.TLGH
O81118_WHEAT/47-373.W-----------------------------------..G.N.IIWAHSV.STDL------VDWVALE.PGIYPS.KPFD
Q9L8G4_CLOAT/31-337.E-----------------------------------..K..HVCWGHFR.SKDL------ITWECLP.VALSPL.EWYD
INV1_MAIZE/129-459.W-----------------------------------..G.N.ITWGHAV.SRDL------LHWLHLP.LAMVPD.HPYD
GFT_ALLCE/75-405.W-----------------------------------..G.N.ITWGHAV.SRDL------INWQHLP.VAVGPD.HWYD
Q8LK75_LAGSI/143-463.W-----------------------------------..G.N.ISWGHAV.SRDL------ITLAYISAYAMVPD.QPYD
O82119_SOLLC/56-375.W-----------------------------------..G.N.IVWAHSV.SKDL------INWIPLE.PAIYPS.KVFD
Q8L6W2_BETVU/147-465.W-----------------------------------..G.N.IVWGHAV.SKDL------IRWKHLP.IAMVAD.RWYD
Q8XQE3_RALSO/19-318.H-----------------------------------..E..NKHWAHAR.STDL------IHWELLP.PALAPD.APYD
Q41604_TULGE/99-420.W-----------------------------------..G.N.ITWGHAV.SRNL------IHWFHLP.IAFVPD.QWYD
Q64ML3_BACFR/121-408.W-----------------------------------..E..NMHWGHAV.SRDL------VHWEELP.DALHPD.ELGT
Q8DNP0_STRR6/31-336.W-----------------------------------..G..PMHWGHAK.SKDL------VTWEHLP.VALAPD.QDYD
Q8W3M2_CITUN/123-441.W-----------------------------------..G.D.IVWGHAV.SKDL------IHWYHLP.LAMVAD.QWYD
Q8XK71_CLOPE/29-331.H-----------------------------------..K..NKHWGIVK.TKNF------KDFSIPK.IALTPK.EYFD
Q9ZP42_FRAAN/53-372.W-----------------------------------..G.N.IVWAHST.STDL------VNWIPHE.AAIYPS.ILSD
Q5WDB1_BACSK/36-338.W-----------------------------------..G..PMHWGHGI.SDDL------IHWHHLP.VALAPG.EAYD
O65778_CYNSC/94-412.W-----------------------------------..G.N.MTWGHAV.SKDM------INWFELP.IALAPT.EWYD
Q8DNS7_STRR6/37-340.H-----------------------------------..G..LKSWAQLE.SDDL------VHFKETG.IKVLPD.TPLD
Q6AW26_LOLPR/94-412.W-----------------------------------..D.DYIEWGHVV.SQDL------VHWRPLP.LAMRPD.HWYD
Q5WBG3_BACSK/35-336.H-----------------------------------..G..LKYWYHTA.SKDL------VHWRNVG.KAIAPD.TSFD
Q8CRR2_STAES/37-337.H-----------------------------------..G..LKYWFNYK.SKDL------LHFEPQG.TLLKPD.TKYD
Q752P4_ASHGO/54-389.W-----------------------------------..G.VPLYWGHLT.SKDL------QSWEDHG.VAIRPP.R..N
Q8DWH3_STRMU/37-353.N-----------------------------------.DG...TEWYHVR.TKDW------EHFENLG.VAI.PK....F
Q5LY63_STRT1/37-340.H-----------------------------------..G..LKQWVHTE.SEDL------VHFTETG.VKLLPD.HEND
SCRB_LACLL/37-342.H-----------------------------------..G..LKSWVHLV.SDDL------VHFEKTG.LVLYPD.TKYD
Q84F22_9BIFI/57-368.W-----------------------------------..G..PMHWGHVS.SDNM------VDWHREP.IAFAPS.LEQE
Q6G7R6_STAAS/38-338.H-----------------------------------..G..LKYWYNYT.SDDL------INFKAEG.PILNPD.TKYD
Q5XA96_STRP6/37-340.H-----------------------------------..G..LKQWVHMT.STDL------VHFTETR.SRLLPD.HAHD
Q9KBR7_BACHD/33-338.H-----------------------------------..G..PKFWGHFV.SGDL------VFWEEKE.PALTPS.DWFD
LEVB_BACSU/48-356.K-----------------------------------..G.NGTEWRHAV.SEDL------VHWTDEG.VAIPKY.TNPD
Q5ZQK6_9ASTR/50-366.F-----------------------------------..G.DIMIWGHSV.SYDL------VNWIHID.PAIYPT.DPAD
INV1_DAUCA/64-384.W-----------------------------------..G.N.IVWAHSV.STDL------INWTPLE.PAIFPS.KPFD
O04372_ASPOF/122-447.W-----------------------------------..G.D.IAWGHAV.SKDL------LSWRHLP.LAMVPD.RWYD
O65341_SACRO/23-357.W-----------------------------------..G.NKIAWGHAV.SRDL------IHRRHLP.LAMVPD.QWYD
Q5WDB0_BACSK/20-318..-----------------------------------.......TWAHAV.SKDL------LHWEHLP.IALERD.HLGQ
Q6KCH6_HORVU/127-454.W-----------------------------------..G.NKIAWGHAA.SRDL------LRWRHLP.VAMSPD.QWYD
SCRB_SALTM/31-336.H-----------------------------------..T..FKCWAHWS.SIDL------LHWQHEP.IALMPD.EEYD
O86076_ECOLX/29-330.W-----------------------------------..G..PMHWGHAT.SDDM------IHWQHEP.IALAPG.DDND
INV1_ORYSJ/53-369.W-----------------------------------..G.N.IVWAHSV.SQDL------INWIALE.PAIKPD.IPSD
Q8W431_WHEAT/84-403.W-----------------------------------..D.DGMEWGHAV.SRNL------VQWRTLP.IAMVAD.QWYD
Q6DA94_ERWCT/31-336.H-----------------------------------..G..AKFWGHWS.SADL------VNWKHEP.VALVPS.ESYE
INVB_DAUCA/135-453.W-----------------------------------..G.N.ITWGHAI.SRDL------INWLHLP.FAMQPD.QWYD
Q97I80_CLOAB/49-358.N-----------------------------------..G.NGTEWRQAT.SKDL------VTWKDEG.VCIPKY.TNEN
Q84XV1_MUSAC/62-379.W-----------------------------------..G.N.IVWAHSV.STDL------VNWIALD.PAIRPS.KPFD
Q94C07_ORYSA/140-471.W-----------------------------------..G.NKISWGHAV.SKDL------LHWHHLP.IAMVPD.NWYD
INV3_ORYSJ/51-377.W-----------------------------------..G.N.IEWAHSV.STDL------IDWTALE.PGIYPS.KTFD
Q65D73_BACLD/27-331.W-----------------------------------..G..PMHWGHLK.SKDL------IHWEHLP.VALAPG.DEFD
Q9S943_VITVI/137-455.W-----------------------------------..G.N.IVWGHAV.SKDL------IEWLHLP.LAMVAD.QWYD
Q74HI7_LACJO/37-340.H-----------------------------------..G..VKSWIHYA.SPDL------VHWHYLG.SAIDPD.SDLD
Q70LF5_HORVU/96-419.W-----------------------------------..E.PQIVWGHAV.SKDL------IHWRHLP.PALVPD.QWYD
O23786_CYNSC/107-426.W-----------------------------------..G.N.ITWGHSV.SKDM------INWFHLP.FAMVPD.QWYD
O81082_ALLCE/87-413.W-----------------------------------..D.YSISWGHAV.SKDM------IHWLHLP.VAMVPD.HWYD
O74641_ASPNG/33-356.W-----------------------------------..G..NICWGHAT.STDL------MHWAHKP.TAIA......D
Q9ZR55_CICIN/25-343.W-----------------------------------..N.LRMYWAHSV.SHDL------INWIHLD.LAFAPT.EPFD
O81189_MAIZE/58-383.W-----------------------------------..G.N.IVWAHSV.SRDL------INWVALE.PALRPS.IPGD
Q6F0V0_MESFL/34-333.H-----------------------------------....FNKSWALYT.TTDF------INYNYEG.LTLIPS.TKYD
BFRA_THEMA/7-294.W-----------------------------------..G..NICWGHAV.SDDL------VHWRHLP.VALYPD.D..E
INV2_YEAST/32-353.W-----------------------------------..G.TPLFWGHAT.SDDL------TNWEDQP.IAIAPK.R..N
Q8GM36_BACME/30-333.W-----------------------------------..G..PMHWGHVK.SKDL------VHWQHLP.IALAPG.DSFD
Q9S944_VITVI/115-433.W-----------------------------------..G.N.ITWGHAV.SRDM------IHWLYLP.LAMVPD.RWFD
Q9LAL1_9PSED/15-331.W-----------------------------------..G..PMHWGHAV.SKDL------IHWDHLP.IALYPD.HIGQ
INV1_HANAN/32-354.W-----------------------------------..A.TPVTWGHST.SKDL------LTWDYHG.NALEPE.N..D
Q9CJZ0_PASMU/57-355.H-----------------------------------..G..MKHWKHFM.TYDF------HHFQVAD..PLIPD.ELFE
Q8GI55_GEOSE/14-329.W-----------------------------------..G..PMHWGHAV.SKDM------IEWEELD.IALYPD.ENGT
Q7XA49_SOYBN/45-362.W-----------------------------------..G.N.IVWAHSV.SKDL------VNWTPLD.PAIFPS.QPSD
INVA_SOLLC/108-427.W-----------------------------------..G.N.ITWGHAV.SKDL------IHWLYLP.FAMVPD.QWYD
Q5WI15_BACSK/12-315.H-----------------------------------..K..NKSWGHVV.SDDL------VNWHRKE.TALVPS.EWYD
Q9F498_ERWAM/31-336.H-----------------------------------..G..AKFWGQWS.SCDL------VHWRHEP.LALAPS.ENYE
Q8A6W7_BACTN/150-451.W-----------------------------------..G..NMNWGHAI.SKDL------VNWEHRP.VAIAPD.ALGT
SCRB_STAXY/38-338.H-----------------------------------..G..LKYWYTYQ.SKDL------VDFKAIG.PTIKPD.TKDD
Q45372_PAEPO/17-347DF-----------------------------------..G..NMHWGHAV.SKDL------VHWTELP.PAIPPG.EDGA
SCRB_VIBAL/41-341.H-----------------------------------..G..MKYWYHLS.TKDF------IHFTDHG.VGLHPD.QDYD
INV7_ORYSJ/44-366.W-----------------------------------DIG.N.LSWGHSV.SGDL------LNWAALD.TALDPT.SPFD
Q5KUA8_GEOKA/34-339.H-----------------------------------..G..AKFWGHYT.SPDL------VHWQAAP.IALAPS.EWYD
O42801_9EURO/31-371.W-----------------------------------..G..NISWGHAT.SEDL------THWEEQP.VALLAR.GYGS
Q7WWQ7_LACAI/24-321.W-----------------------------------..D..SMHWGHAR.SKDG------IHWQDMP.VAMKPD.HEYD
Q6HN59_BACHK/32-333.H-----------------------------------..G..MKHWGHVK.SKDL------INWERMP.VAIIPT.ESYE
INV1_ARATH/56-378.W-----------------------------------..G.N.IVWAHST.STDL------INWDPHP.PAIFPS.APFD
Q84V20_SOLLC/57-375.W-----------------------------------..G.N.IVWAHSV.SKDL------INWINLE.PAIYPS.KPFD
Q6EVL5_ECOLX/31-336.H-----------------------------------..K..YKCWGHWS.STDL------LHWQHEP.LALMPD.KEYD
Q9FR47_POASE/86-409.W-----------------------------------..D.DGIVWGHVV.SRDL------VHWRHLP.IAMVPD.HWYD
Q9ZR32_DAUCA/105-423.W-----------------------------------..G.N.ITWGHAV.SKDL------INWFHLP.IAMVPD.NWYD
Q94C08_ORYSA/125-454.W-----------------------------------..G.NKISWGHAVDSKDL------LHWYHLP.WAMYPD.QPYD
Q6F4N3_LOLPR/116-437.W-----------------------------------..G.N.VSWGHAV.SKDL------VNWRHLP.VALVPD.QWYD
O81083_ALLCE/154-479.W-----------------------------------..G.N.IAWGHAV.SRDL------VHWTHLP.LAMVPD.QWYD
Q42722_DAUCA/122-441.W-----------------------------------..G.NKIVWGHAV.SSDL------IHWKHLP.VAMVTD.HWYD
Q8LRN6_SOLLC/7-325.W-----------------------------------..G.N.IVWAHSV.STDL------INWIPLE.PAIYPS.KVFD
Q5NEI9_FRATT/30-331.T-----------------------------------..A..MLHWGHAV.STDL------VNWQHLP.IAIYPQNDLND
INVA_PHAVU/120-440.W-----------------------------------..G.D.IVWGHAV.SRDM------IHWLHLP.LAMVAD.QWYD
6FEH_BETVU/60-382.W-----------------------------------..H.TEIVWGHST.STDL------INWTQQP.IALSPS.EPYD
Q8RLU2_PAEPO/14-330.W-----------------------------------..G..PMHWGHAV.STDL------MNWEEQP.IALEPD.ELGT
INVA4_ARATH/125-445.W-----------------------------------..G.D.IVWGHAV.SRDL------IHWVHLP.IAMVAD.QWYD

PF04616

O30426_CALSA/54-321-T-----------------------------------......PGVPIMH-STDL------VNWRIIG-YVYDRL-EDND
Q9K6P5_BACHD/5-295-F-----------------------------------......PGVRIHH-SRDL------KHWRFVS-SPLTRT-SQLD
Q8P3K7_XANCP/60-332-Y-----------------------------------......PGIVLWH-STDL------VNWTPIG-PALRQQ-LGTI
Q8A1K5_BACTN/22-288-A-----------------------------------......PGFLIWH-SRDL------MNWEPVC-RVMPEY-EGSA
Q93J96_STRCO/52-335-.-----------------------------------......GSIRMWR-SPSL------GTLLTAD-PVTVWT-DTDP
Q9A4M8_CAUCR/35-330-F-----------------------------------......PGLPVFH-STDL------VHWEQIG-NAIDRP-GMLD
Q9A9Z8_CAUCR/61-333-Y-----------------------------------......PGLLIWH-SRDL------VNWTPVT-TTLKTN-VGSI
Q8A3Q4_BACTN/26-309-.-----------------------------------......RNLPIHR-SKDL------IKWESVG-TAFTDE-TRPT
Q9KBQ8_BACHD/8-311-Y-----------------------------------......DCIELRR-AKTL------DGLREAE-PKVVWR-KYDR
Q92P74_RHIME/5-303-Y-----------------------------------......PGVQIHH-SRDL------VNWRLVR-RPLERA-SQLD
Q8A0C6_BACTN/25-303-A-----------------------------------......PFYPMFT-SKDL------VNWKQVG-HVFTKQ-PSWT
Q82P90_STRAW/37-336-Y-----------------------------------......DRIVLRR-ATTL------QGLATAP-ETTIWT-KHAS
Q8PBE4_XANCP/26-318-F-----------------------------------......PGLPVFK-SSDL------VHWIQIG-NAIDRP-GQIN
YAGH_ECOLI/3-303-F-----------------------------------......PGVRIYH-SRDL------KNWSLVS-TPLDRV-SMLD
Q97TI6_CLOAB/24-307-G-----------------------------------STWYTMKDWRCYS-STDM------VNWTDNG-.SPLAY-NTFS
Q8A3V2_BACTN/35-295-.-----------------------------------......MGMPVLE-SDDM------INWKIIS-QVYRRL-DFPD
Q8PE34_XANCP/46-319-Y-----------------------------------......PGLPIWH-SRDL------VNWQPLG-HAITQN-VGAI
Q9A9J1_CAUCR/6-306-F-----------------------------------......PGVQIHH-SRDL------RNWRLIG-RPLRRP-SQLN
Q9RI60_STRCO/4-282-F-----------------------------------......PGLPLFH-SKDL------VHWEQIG-NVLDRP-GQLP
Q9KXY8_STRCO/30-319-.-----------------------------------......GGISSKA-SSDR------TAFSAGA-DAFGSR-PGWW
O52729_9BACI/3-301-F-----------------------------------......PGVQIHH-SKDL------VNWRLIA-HPLQRV-SQLD
Q8A6K8_BACTN/42-323-.-----------------------------------......LKIRVYK-SKDL------STWKDEG-YSFIAK-SDFW
Q8EPL4_OCEIH/6-297-F-----------------------------------......PGVPIFH-SRDL------VNWNQIG-HVLDRP-SQLN
Q8CWF7_OCEIH/4-302-F-----------------------------------......PGVGIYH-SRDL------KNWKLVS-RPLNRL-SQLN
O52575_SELRU/3-304-F-----------------------------------......PGVQIHH-SKDL------VHWHLVA-HPLSTT-EFLD
Q8A1Z2_BACTN/337-620-.-----------------------------------......KNVPIHR-SRDL------VNWYYVG-TAFTDA-TRPN
Q9CFH1_LACLA/4-305-F-----------------------------------......PGVRLHE-SKDL------EHWSLLP-SPLSTT-TLLD
Q8P3G6_XANCP/43-335-F-----------------------------------......PAIPVFE-STDL------VHWTQVG-NVVERR-EQLD
XYLB_BUTFI/4-291-A-----------------------------------......PGVPIFH-TKDL------AHFEQIG-NILDRE-SQLP
Q8CK14_STRCO/11-285-V-----------------------------------......PGLPLLH-SRDL------VHWTLVG-HALERL-EPER
Q97DM1_CLOAB/2-300-F-----------------------------------......PGVQIHH-SKDL------VNWHLVA-HPLNRT-SLLD
Q81ZV8_STRAW/441-719-F-----------------------------------PGWSG.TRFKAFS-SKDL------VHWKDHG-VILDLG-PDVT
XYNB_BACPU/3-301-F-----------------------------------......PGVQIYH-SKDL------IHWRLAA-RPLQKT-SQLD
Q82P89_STRAW/52-348-.-----------------------------------......NELTMRK-SPTL------AGLATAP-SVQIWS-DTTS
Q97IW1_CLOAB/6-309-Y-----------------------------------......DRIEVRK-AKTI------EGLRNAE-PVDVWR-RHES
Q8A1I6_BACTN/28-326-F-----------------------------------PGWGG.SYFKVFS-SKNL------KTWKEET-VILEMG-KNVS
Q8Z9F3_SALTI/4-306-Y-----------------------------------......DRLEIRR-ADSL------EGLRAAD-PVVVWR-KPES

PF04041

Q9YFA2_AERPE/23-354-V-----------------------------------.SLVASLRIGLED-ISSGRCSRCEEKHTARPE..VLPG-DWID
O58834_PYRHO/1-299-G-----------------------------------.EDNVTGRIGLAL-SEDG......INFVKHPEPVMEPE-YQWE
Q9WZN9_THEMA/15-332-V-----------------------------------.SSIGHFIVNIDD-LLNG.....EVKKPLEMEVVFWPR-DIQE
Q9X0V2_THEMA/4-323-H-----------------------------------.KNTRP.FLHFGR-SKDG......INWEIEPEEIQWVD-VNGE
Q9X2G7_THEMA/4-296-G-----------------------------------.EDMVS.RIGYAV-STDG......IHFNKFEKPVFAPK-SDDE
Q9HH03_PYRFU/31-329-S-----------------------------------KEDKLTGRIGLAI-SYDG......INFFRHPEPIIEPE-YKWE
O67215_AQUAE/17-345-T-----------------------------------.SAIAEFDIDLEE-LYNP......ERKTYEANLTVLPN-IKYD
Q9UZM0_PYRAB/1-299-S-----------------------------------.EDGLTGRIGLAL-SSDG......VSFVKHPLPVLEPE-LGCE

PF02435

SACB_ZYMMO/1-400SFQGWSVIFALVADRT...............KYGWHNRNDGARIGYFYSRGGS.........NWIFGG-HLLKDG-AN..
INVB_ZYMMO/1-398SFKGWNVIFSLVADRN................IPWNDRHSHARIGYFYSKDGK.........SWVYGG-HLLQES-AN..
SACB_STRSL/223-685NWNGYQLVISMAGAP......................NKNSNHIYLLYRKYGDND.....FTHWKNAG-PIFGYN-ALED
SACB_BACAM/37-470EYNGYHVVFALAGSPK.....................DADDTSIYMFYQKVGDNS.....IDSWKNAG-RVFKDS-DKFD
SACB_GLUDI/77-540SYNGWEVIFCLTADPNA..............GYGFDDRHVHARIGFFYRRAGIPASRRPVNGGWTYGG-HLFPDG-ASAQ
SACB_STRMU/184-637NWNGYQLVVAMMGIP......................NTNDNHIYLLYNKYGDNN.....FDHWKNAG-SIFGYN-ET..
O82854_BACSP/38-487NYHGYHIVSALAGDPK.....................NSDDTPLHLFYQKVGDTS.....IDSWKNAG-RVFEDM-DKFV
Q9Z5E5_PAEPO/37-482NYKGYNIVFGLAGDPK.....................RGEDTFIYLFYQKAGNTS.....LSGWKKAG-RVFKDN-DKLL
SACB_ERWAM/1-407SVNGWCIIFTLTADRNTDNPQFQDENGNYDITRDWEDRHGRARICYWYSRTGK.........DWIFGG-RVMAEG-VA..
SACB_RAHAC/1-407SVDGWSVIFTLTAQRNNNNSEYLDAEGNYDITSDWNNRHGRARICYWYSRTGK.........DWIFGG-RVMAEG-VS..
SACB_PSESG/1-407SVNGWSVIVTLTADRHPDDPQYVGANGRYDIKRDWEDRHGRARMCYWYSRTGK.........DWIFGG-RVMAEG-VS..

PF03664

XYNC_CELJU/321-555-----------------------------------------RSM.YTSFT------------DWNTAQ-QAPHIS-MNGS
Q9X583_9ACTO/516-788-----------------------------------------GSMAFGPFT------------NWSDMA-SARQTG-MSQN
Q9HEY3_COCCA/26-295-----------------------------------------GSMAFSPFG------------SFSEMA-SASQTA-TPFT
AXHA_ASPSO/28-298-----------------------------------------GSMNFGPFS------------DWSEMA-SASQNA-MSQG
AXHA_ASPNG/28-302-----------------------------------------GSMGFGAFS------------DWSDMA-SASQTA-TSFS

PF00251

SCR_ZYMMO/33-343R--DG..-C---------FSGCAV----DNNG..V..............LTLIYTGH...IVLSN......DSLDAIREV
SCRB_PEDPE/37-339S--HG..-A---------YTGTAL----PIDD..Q..............LFIMYTGN...VRTA.......DWQ.R.ESY
INV3_ARATH/43-365I--NG..-C---------WSGSVT----ILPN.GK..............PVILYTGI...DQ...........N.K.GQV
INV4_ARATH/54-372I--GG..-T---------WSGSIT----IVPG.KG..............PIILYTGV...NQ...........N.E.TQL
INV5_ARATH/47-369I--NG..-C---------WSGSVT----ILPN.GK..............PVILYTGN...DR...........Y.N.RQV
SCRB_BACSU/33-338K--NG..-C---------YSGSAV----TKDD..R..............LYLFYTGN...VRDQ.......DGN.R.ETY
INV2_ARATH/52-371I--NG..-T---------WSGSAT----HVPG.KG..............PVILYTGI...TE...........N.Q.TQI
SCRB_KLEPN/31-336R--NG..-C---------YSGSAV----EFEG..A..............LTLCYTGN...VKFPD......GGR...TAW
Q9RGC0_9PSED/280-596P--DG..-D---------WSGSAT----YDEH.GL..............PVLFFTA......GDD......SAK.PNQRV
SCRB_VIBCL/98-398S--HG..-V---------FSGHAV----SHQQ..D..............LWLFYTGN...TRLGV.....DRQR...QTM
O02490_TRIFO/111-409.--....-I---------FSGSIV----IDKD..NTAGF......GANAVIAFYTNA...GGD..........D.YQIQT
Q8DY03_STRA5/37-340S--HG..-A---------YSGSAL----AIDD..K..............LFLFYTGN...VRDMK......WNR...DPR
INV1_SCHPO/87-407G--VLSL-P---------FSGSAV----VDVH..NSSGLFSNDTIPEERIVLIYTDH...W............T.GVAER
Q834P0_ENTFA/38-341S--HG..-V---------YSGSAL----TIDN..Q..............LCLFYTGN...VRDQT......WQR...FAY
Q6PVN1_TRIMO/132-444I--NG..-V---------WTGSAT----VLPD.GS..............LVMLYTGS...TN...........A.S.VQV
SACC_BACSU/39-349.--....-I---------FSGSAV----VDKN..NTSGFQ...TGKEKPLVAIYTQD................R.EGHQV
Q93X59_CICIN/50-368S--KS..-C---------WSGSAT----ILPG.NI..............PAMLYTGS...DS...........K.S.RQV
Q65DN5_BACLD/32-337K--NG..-C---------YSGSAI----AEND..V..............LHLFYTGN...VRDGE......GNR...ETY
Q42691_CHERU/44-365I--NG..-S---------WSGSAT----ILPG.NK..............PAILFTGL...DP...........N.Y.EQV
Q43855_VICFA/51-371K--YG..-C---------WSGSAT----ILPG.KG..............PVILYTGV..VDK...........Q.S.NEV
INV4_ORYSJ/64-381I--NG..-C---------WTGSAT----ILTG.DQ..............PVIIYTGA...DT...........E.K.RQV
INV3_DAUCA/58-376Q--YG..-C---------WSGSAT----ILPG.NK..............PVILYTGIVSPDP...........E.N.AQV
Q7WWP6_LACAI/37-338S--HG..-A---------YSGSAR----EIDG..K..............LFLMYTGN...HRDEN......WIR...TPY
Q82YR4_ENTFA/37-340S--HG..-A---------YSGSAY----EVDG..K..............LLLLYTGN...VRDKN......WRR...DSF
O94224_CYBJA/34-356D--EG..-I---------YSGSIV----IDYD..NTSGFFDDSTRPEQRIVAIYTNN................L.PDVET
Q65EI7_BACLD/46-355G--D...-P---------WSGSVV----VDSK..NTAGF......GKGTIVAVMTQP...SA...........N.DGKEE
Q43856_VICFA/53-374I--NG..-C---------WSGSTT----ILHG.NK..............PSILYTGI...NK...........L.N.HQV
INU1_KLUMA/43-375D--AG..-A---------FSGSMV----IDYN..NTSGFFNSSVDPRQRAVAVWTLS................K.GPSQA
RAFD_ECOLX/28-329R--DG..-C---------FSGSAV----DDDG..V..............LSLIYTGH...ICLEDRG..NDSII...REV
INV6_ORYSJ/42-371A--NG..-C---------ASGSVT----ILPD.GV..............PVVMYSGI...DA...........R.R.RQV
1FEH_HORVU/68-385I--DG..-C---------WTGSVT----ILPG.GK..............PVIIYTGG...NI...........D.Q.HQT
Q9RBJ1_GLUDI/47-372.--....-I---------FSGSLV----PDPL..NRSGLG...STDAPPLLAFHTSV...FHDNP......AHP.DGTQA
O00056_PENPU/33-356E--NGIE-S---------FTGTSY----YDAN..NTSSLG...TSTNPPYLAFFTGY...TS...........S.NGTQD
SCRB_STRMU/37-340S--HG..-A---------YSGSAY----EIGD..Q..............LFLFYTGN...VRDEN......WVR...HPL
Q9FNS9_CICIN/46-362I--NG..-C---------LSGSAT----ILPG.PR..............PIILYTGQ...DV...........N.N.SQV
Q9ZHJ7_CLOBE/31-333R--NG..-C---------YSGCGL----VKDN..E..............LKLYYTGN...VKGPN......GER...ESY
Q62DJ1_BURMA/55-380.--....-I---------FSGSIV----ADAR..NTSGLG...TPNAPPLVALYTSV...YKAGF......GHE.PGTQA
Q888X9_PSESM/32-333R--DG..-C---------FSGSAV----VCGD..T..............LALIYTGH...TWLGEVG..DERFI...RQV
INV6_ARATH/21-341I--NS..-C---------WSGSAT----ILPD.GR..............PVILYTGL...DV...........N.NKQQV
Q6F0T9_MESFL/38-341R--TG..-A---------FSGSAF----KEKD..G..............VKIYYTGN...IEEN........GE.MIEEV
Q8GT63_TRIMO/48-366A--NG..-C---------WSGSAT----ILPD.GS..............PVMLYTGI...DA...........R.G.DQV
INV2_DAUCA/65-383K--YG..-C---------WSGSAT----VLPG.GK..............PVIMYTGIVTPSP...........V.N.TQV
Q65U44_MANSM/56-359S--HG..-C---------YSGGAL----PVGD..K..............IAAFYTGN...TRRA.......ADN.QRVPF
Q944U7_CARPA/59-376I--KG..-C---------WSGSAT----VLPN.NI..............PIILYTGL...DS...........N.E.TQL
Q84V21_SOLLC/57-376K--YG..-T---------WSGSST----ILPN.NK..............PVIIYTGV..VDS...........Y.N.NQV
P94466_GEOSE/34-339K--DG..-C---------YSGSAI----DHDG..V..............LTLFYTGN...VKDEH......GNR...QTY
Q45155_BACFG/137-443.--....-I---------FSGSSV----VDDA..NTAGY......GAGAIVAFYTSA...S............D.KNGQI
O81118_WHEAT/47-373I--NG..-C---------WSGSAT----ILPN.GV..............PVIMYTGI...EP...........K.E.TPS
Q9L8G4_CLOAT/31-337S--HG..-C---------YSGSAV----NKGG..K..............LVLMYTGN...VKDSK......GER...ETY
INV1_MAIZE/129-459A--NG..-V---------WSGSAT----RLPD.GR..............IVMLYTGS...TA...........E.SSAQV
GFT_ALLCE/75-405I--SG..-V---------WTGSII----VVSE.DR..............VVMLFTGG...TK...........S.F.DQS
Q8LK75_LAGSI/143-463V--NG..-V---------WTGSAT----ILPD.GR..............IIMLYTGD...TI...........D.G.VQV
O82119_SOLLC/56-375K--YG..-T---------WSGSAT----ILPG.NK..............PVILYTGI..VDA...........N.K.TQV
Q8L6W2_BETVU/147-465F--NG..-V---------WTGSAT----ILPD.GQ..............IMMLYTGS...TN...........E.S.VQV
Q8XQE3_RALSO/19-318E--DG..-C---------YSGCAV----EVDG..D..............LFLLYSGN...VRSPD......GGR...ASY
Q41604_TULGE/99-420A--NG..-A---------LTGSAT----FLPD.GR..............IAMLYTGI...TT...........E.F.VQV
Q64ML3_BACFR/121-408.--....-I---------FSGSAV----IDYD..NTAGFN...KKNEPALVAAYTVD................N.PEKQR
Q8DNP0_STRR6/31-336R--NG..-C---------FSGSAI----VKDD..R..............LWLMYTGH...I.EEK......TGV...RQV
Q8W3M2_CITUN/123-441I--MG..-V---------WTGSAT----ILPD.GK..............LMMLYTGS...TN...........E.S.VQV
Q8XK71_CLOPE/29-331K--DG..-C---------YSGGSI----VKDG..N..............LQVFYTGN...VKGEK......GER...ISY
Q9ZP42_FRAAN/53-372I--NG..-C---------WSGSVT----ILPS.GK..............PAILYTGI...NP...........D.K.EQV
Q5WDB1_BACSK/36-338R--DG..-C---------FSGSAV----DDQG..T..............LTLIYTGH...NVIDPE....KDVI...VQN
O65778_CYNSC/94-412I--EG..-V---------LSGSTT----ILPD.GR..............IFALYTGN...TN...........D.L.EQL
Q8DNS7_STRR6/37-340S--HG..-A---------YSGSAM----QFGD..N..............LFLFYTGN...VRDEN......WIR...HPY
Q6AW26_LOLPR/94-412K--KG..-V---------LSGTIT----VLHN.GT..............LVLLYTGV...TE...........DPM.AES
Q5WBG3_BACSK/35-336S--HG..-V---------YSGSGI----VKDS..Q..............LHLMYTGN...ARDEN......WNR...QTS
Q8CRR2_STAES/37-337S--HG..-V---------YSGSAF----EYQN..H..............LYYMYTGN...HRDQH......WNR...ISS
Q752P4_ASHGO/54-389D--SG..-A---------FSGSAV----VDTN..NTSGFFNDSIDPAQRVVAIWTYN................T.PESET
Q8DWH3_STRMU/37-353V--NGWS-A---------VATGSI----FQNS..NQFFKD....LPTSAIVAYFTSY................T.DTGQH
Q5LY63_STRT1/37-340S--HG..-A---------YSGSAY----QIGD..K..............LFIFYTGN...VRDEN......WIR...DPR
SCRB_LACLL/37-342N--AG..-V---------YSGSAL----AFEN..F..............LFLIYTGN...HRGED......WVR...TPY
Q84F22_9BIFI/57-368R--HG..-V---------FSGSAV----IGDD..G.............KPWIFYTGH...RWANGK....DNTG.GDWQV
Q6G7R6_STAAS/38-338S--HG..-V---------YSGSAF----EYNG..H..............LYYMYTGN...HRDNH......WQR...HAS
Q5XA96_STRP6/37-340S--HG..-A---------YSGSAY----AIDD..K..............LFLFYTGN...VRDAN......WVR...TPL
Q9KBR7_BACHD/33-338K--NG..-C---------YSGSAV----ADNG..K..............LKLFYTGN...VKNEN......DER...ESY
LEVB_BACSU/48-356G--D...-I---------WTGSVV----VDKE..NTAGF......GKNALVAIVTQP...SA...........K.DKKQE
Q5ZQK6_9ASTR/50-366I--NS..-C---------FSGSAT----FLPG.YK..............PVMLYTGL...DT...........E.K.RQV
INV1_DAUCA/64-384K--YG..-C---------RSGSAT----ILPG.NK..............PVILYTGIVEGPP...........K.N.VQV
O04372_ASPOF/122-447I--NG..-V---------WTGSAT----ILPD.GR..............IIMLYTGA...TN...........E.S.VQV
O65341_SACRO/23-357T--NG..-V---------WTGSAT----TLPD.GR..............LAMLYTGS...TN...........A.S.VQV
Q5WDB0_BACSK/20-318.--....-A---------LSGSVV----VDEK..DTSGLF....GGKPGLVAIYTNT..................EGGEA
Q6KCH6_HORVU/127-454I--NG..-V---------WSGSAT----VLPD.GR..............IVMLYTGS...TN...........A.S.VQV
SCRB_SALTM/31-336R--NG..-C---------YSGSAV----DNNG..T..............LTLCYTGN...VKFAE......GGR...TAW
O86076_ECOLX/29-330K--DG..-C---------FSGSAV----DDNG..V..............LSLIYTGH...VWLDGAG..NDDAI...REV
INV1_ORYSJ/53-369Q--YG..-C---------WSGSAT----ILPD.GT..............PAILYTGIDRPNI...........N...YQV
Q8W431_WHEAT/84-403I--LG..-V---------LSGSMT----VLPN.GT..............VIMIYTGA...TN...........ASA.VEV
Q6DA94_ERWCT/31-336S--HG..-C---------YSGSAV----VDHG..A..............ITLIYTGN...VKYDD......GSR...TAF
INVB_DAUCA/135-453I--NG..-V---------WTGSAT----VLPD.GK..............IVMLYTGD...TD...........D.L.VQV
Q97I80_CLOAB/49-358G--D...-I---------WSGSFV----VDAQ..NTAGF......GKGAIVAIVTQP...SA...........S.MDKQE
Q84XV1_MUSAC/62-379I--NG..-C---------WSGSAT----VLPG.NR..............PVIVYTGI...DP...........Q.Q.RQL
Q94C07_ORYSA/140-471L--NG..-V---------WSGSAT----DLPD.GK..............LMMLYTGS...TV...........DQS.VQD
INV3_ORYSJ/51-377E--KG..-C---------WSGSAT----VLPS.GV..............PVIMYTGI...DP...........D.E.RQV
Q65D73_BACLD/27-331E--SG..-C---------FSGSAV----EYNG..D..............LALIYTGH...NMIDEE....KDDF...YQT
Q9S943_VITVI/137-455T--NG..-V---------WTGSAT----LLSD.GQ..............VIMLYTGA...TN...........E.S.VQV
Q74HI7_LACJO/37-340N--AG..-A---------YSGSAM----EHDG..K..............LLLMYTGN...HRDKD......WTR...IPY
Q70LF5_HORVU/96-419I--KG..-V---------LTGSIT----VLPD.GK..............VIPLYTGN...TE...........T.F.AQV
O23786_CYNSC/107-426I--EG..-V---------MTGSAT----VLPD.GQ..............IIMLYTGN...AY...........D.L.SQL
O81082_ALLCE/87-413S--KG..-V---------WSGYAT----TLPD.GR..............IIVLYTGG...TD...........Q.L.VQV
O74641_ASPNG/33-356E--NGVE-A---------FTGTAY----YDPN..NTSGLG...DSANPPYLAWFTGY...TT...........S.SQTQD
Q9ZR55_CICIN/25-343I--NG..-C---------LSGSAT----VLPG.NK..............PIMLYTGI...DT...........E.N.RQV
O81189_MAIZE/58-383R--YG..-C---------WSGSAT----VLPDGGG..............PVIMYTGVDHPDI...........N...YQV
Q6F0V0_MESFL/34-333I--NG..-V---------FSGSAR----INEN..D.............EIEIYYTGN...IKFNDVDRTAYTLK.AFIDL
BFRA_THEMA/7-294T--HG..-V---------FSGSAV----EKDG..K..............MFLVYTYY...R.DPT......HNK.GEKET
INV2_YEAST/32-353D--SG..-A---------FSGSMV----VDYN..NTSGFFNDTIDPRQRCVAIWTYN................T.PESEE
Q8GM36_BACME/30-333K--DG..-C---------FSGSAV----DNEG..E..............LTLIYTGH...NYIDKE....LDTF...FQN
Q9S944_VITVI/115-433L--NG..-V---------WTGSAT----ILPN.GQ..............IIMLYTGD...TN...........D.S.VQV
Q9LAL1_9PSED/15-331.--....-I---------FSGSAV----IDWQ..DTSGFF....NGGAGMVALFTHA...DKFP.......DSG.RPRQR
INV1_HANAN/32-354D--EG..-I---------FSGSVV----VDRN..NTSGFFNDSTDPEQRIVAIYTNN..................AQLQT
Q9CJZ0_PASMU/57-355S--HG..-C---------YSGGAL----LWQD..Q..............IVAFYTGN...TRNA........EN.QRIPH
Q8GI55_GEOSE/14-329.--....-I---------FSGSVV----IDWN..NTSGFF....PKEPGMVAIFTQN...LHDA.......DHT.TPIQT
Q7XA49_SOYBN/45-362I--NG..-C---------WSGSTT----LLPG.NK..............PVILYTGI...DL...........L.N.QQV
INVA_SOLLC/108-427I--NG..-V---------WTGSAT----ILPD.GQ..............IMMLYTGD...TD...........D.Y.VQV
Q5WI15_BACSK/12-315K--DG..-I---------YSGGSI----VHEG..K..............LYLFYTGN...VINKD......GTR...ASY
Q9F498_ERWAM/31-336S--HG..-C---------YSGCAV----NNQG..V..............LTLIYTGN...VKFDD......GSR...TAW
Q8A6W7_BACTN/150-451.--....-I---------FSGSAV----VDHN..NTAGF......GAGAIIAIYTQ.................N.SDRQV
SCRB_STAXY/38-338S--HG..-V---------YSGSAF----EYHD..H..............LYYMYTAN...HRDSD......WNR...IST
Q45372_PAEPO/17-347.--....-I---------FSGSAV----VDKN..NTSGFF...DEEGSGLVAIYTNE...GNKS.......QPG.KP.QV
SCRB_VIBAL/41-341S--HG..-V---------YSGGAL----VENN..Q..............VLLFFTGN...KRDQN......WNR...IPT
INV7_ORYSJ/44-366A--NG..-C---------WSGSAT----ILPG.AL..............PAILYTGI...DA...........S.K.EQV
Q5KUA8_GEOKA/34-339K--DG..-C---------YSGSAI----SCDG..K..............LVLFYTGN...VKDEQ......GNR...QTY
O42801_9EURO/31-371D--VTEM-Y---------FSGSAV----ADVN..NTSGFG...KDGKTPLVAMYTSY...YPVAQTLPSGQTVQ.EDQQS
Q7WWQ7_LACAI/24-321K--SG..-V---------FSGSAI----EKGG..K..............LYVIYTGH.....VDE.....NGKA...VET
Q6HN59_BACHK/32-333S--HG..-A---------YSGSAI----VKDD..L..............LHLLYTGN...IKNPD......DSR...DAK
INV1_ARATH/56-378I--NG..-C---------WSGSAT----ILPN.GK..............PVILYTGI...DP...........K.N.QQV
Q84V20_SOLLC/57-375Q--FG..-T---------WSGSAT----ILPG.NK..............PVILYTGI..IDA...........N.Q.TQV
Q6EVL5_ECOLX/31-336R--NG..-C---------YSGSAV----NNQG..V..............LTLCYTGN...VKFDD......GSR...TAW
Q9FR47_POASE/86-409N--MG..-V---------LSGSIT----VLNS.GR..............LVMIYTGVFSNTTD.........RSGM.MEV
Q9ZR32_DAUCA/105-423I--AG..-V---------WTGSAT----ILPD.GQ..............IIMLYTGK...TA...........N.L.TEV
Q94C08_ORYSA/125-454L--NG..-V---------WTGSAT----TLPD.GK..............LAMLYTGE...TE...........D.ELVQD
Q6F4N3_LOLPR/116-437I--NG..-V---------LTGSIT----VLPD.GR..............VILLYTGN...TD...........T.F.SQV
O81083_ALLCE/154-479I--NG..-V---------WTGSAT----ILPD.GQ..............IVMLYTGA...TN...........E.S.VQV
Q42722_DAUCA/122-441V--NG..-V---------WTGSAT----ILPD.GQ..............IVMLYTGS...TN...........E.S.VQV
Q8LRN6_SOLLC/7-325K--YG..-T---------WSGSAT----ILPD.NK..............PIILYTGI..VDA...........K.N.TQV
Q5NEI9_FRATT/30-331R--YIGG-A---------FSGSAM----VVDD..E..............LFLIYTEH...FEDLD.....NTPN.IFIEK
INVA_PHAVU/120-440K--QG..-V---------WTGSAT----ILPN.GE..............IIMLYTGS...TN...........E.S.VQV
6FEH_BETVU/60-382I--NG..-C---------WSGSIT----ILPQ.NK..............PVILYTGI...NN...........K.N.YQV
Q8RLU2_PAEPO/14-330.--....-I---------FSGSAV----VDEQ..DTSGFF....GGKPGLVAIFTHH...ASLP.......GTE.QVRQC
INVA4_ARATH/125-445S--NG..-V---------WTGSAT----FLPD.GS..............IVMLYTGS...TD...........K.A.VQV

PF04616

O30426_CALSA/54-321A..HNLK-NGMNIYGKGQWAPCIR....YYKG--K--------------FYVLFG..---.........ALDTGK.....
Q9K6P5_BACHD/5-295M..KGNM-NSGGI.....WAPCLS....YHDG--T--------------FYLIYT.D---VKQW.........HGAFKDA
Q8P3K7_XANCP/60-332.......-..........WALDLC....KHDG--R--------------YFIYIP..---......ANPDDRGWS.....
Q8A1K5_BACTN/22-288.......-..........MAPDLL....KYKG--K--------------YYIYYP..---...........AKGT.....
Q93J96_STRCO/52-335S..RNRN-I.........WAPEFY....RFGD--R--------------WYLYYT..---.....ADDGVDDHHR.....
Q9A4M8_CAUCR/35-330F..KRLG-LSRAV.....FAPAIQ....AHQG--M--------------FYILNT..---..............CVDC.G
Q9A9Z8_CAUCR/61-333.......-..........WAPELC....KHKG--R--------------YYIYLP..---.......AKFPGNNT.....
Q8A3Q4_BACTN/26-309F..EPKG-NL........WAPDIN....KIGD--K--------------YVLYYS..---...M.SCWGGEWTCG.....
Q9KBQ8_BACHD/8-311G..PMSA-NI........WAPEIH....YIEG--K--------------WYIYFA.A---ARTA.ETKAGLFDHR.....
Q92P74_RHIME/5-303M..RGNP-DSCGV.....WAPCLS....YCDG--L--------------FWLVYT.D---VKRL.........DGNFKDA
Q8A0C6_BACTN/25-303S..NSF.-..........WAPELF....YHNN--K--------------VYCYYT..---.....ARQKSTGISY.....
Q82P90_STRAW/37-336G..VMGA-HI........WAPEIH....FIDG--K--------------WYVYFA..---...A.GSTSDVWAIR.....
Q8PBE4_XANCP/26-318Y..GNDA-LTRGL.....FAASIS....HHDG--T--------------FYIANT..---..............CFYCDG
YAGH_ECOLI/3-303M..KGNP-DSGGI.....WAPCLS....YADG--K--------------FWLLYT.D---VKIV.........DSPWKNG
Q97TI6_CLOAB/24-307W..AKGD-A.........WAGQCI....PRNG--K--------------FYYYVP..---......VTQKSGGMA.....
Q8A3V2_BACTN/35-295W..DTNG-NYGGGS....WAPSIR....HHDG--K--------------FWIYFC..---..........TPREG.....
Q8PE34_XANCP/46-319.......-..........WAPDLI....KHGK--R--------------YYIYFP..---.....ARRGDQGERS.....
Q9A9J1_CAUCR/6-306M..MGDP-DGCGV.....WAPCLT....HADG--R--------------FWLIFT.D---VKRYGRTTVGGASGASLRDF
Q9RI60_STRCO/4-282LPVPGAK-ASGGL.....YAPTIR....HHDG--R--------------YWVINT..---...............NIDGG
Q9KXY8_STRCO/30-319S..RYSS-VPEA......WAPDIS....YHGG--K--------------YLMYYS..---.....VSSFGSNTSA.....
O52729_9BACI/3-301M..KGNP-DSGGV.....WAPCLS....YSEG--K--------------FWLIYT.D---VKVV.........DGAWKDC
Q8A6K8_BACTN/42-323G..QQDF-..........WAPDVY....EYEG--R--------------YYLFTT..---......FSNAGVKRG.....
Q8EPL4_OCEIH/6-297L..NGIP-CSRGI.....YAPTIR....YHNG--I--------------FYMITT..---...........FVESRTGLR
Q8CWF7_OCEIH/4-302M..MGNP-NSGGV.....WAPALS....YKDG--K--------------FWLIYT.D---VKVT.........GGQWKDC
O52575_SELRU/3-304M..KGNP-DSGGI.....WAPDLS....YADG--K--------------FWLIYT.D---VKVV.........DGMWKDC
Q8A1Z2_BACTN/337-620F..EPKG-RI........WAPDIN....KIGD--K--------------YVMYYS..---...M.STWGGEWTCG.....
Q9CFH1_LACLA/4-305M..RGNS-ASGGI.....WAPDLS....YADG--K--------------FWLVYT.D---VKVV.........NGAFKDM
Q8P3G6_XANCP/43-335Y..DGLG-VSRGM.....FAASIR....HHAG--R--------------FYVVGT..---...............AVDSG
XYLB_BUTFI/4-291L...SGD-ISRGI.....FAPTIR....EHNG--I--------------FYMITT..---...............NVSSG
Q8CK14_STRCO/11-285E..FARP-RHDCGV....WAPSLR....HHAG--R--------------FWIFWG..---..........DPDQG.....
Q97DM1_CLOAB/2-300M..KGNP-NSGGI.....WAPDLS....YHDG--K--------------FWLIYT.D---VKVT.........DGMWKDC
Q81ZV8_STRAW/441-719W..ADKN-A.........WAPAIA....ERDG--K--------------YYFYFC..---...........AEQQ.....
XYNB_BACPU/3-301M..KGNP-DSGGV.....WAPCLS....YADG--Q--------------FWLIYS.D---IKVV.........DGPFKDG
Q82P89_STRAW/52-348G..RNAN-F.........WAPEIH....FFNG--K--------------WYLYYS..---.GAQ.SGAACCDTQR.....
Q97IW1_CLOAB/6-309G..EMSN-LI........WAPEIH....FING--A--------------WYIYFA.A---APDK.NIEDDTFNHR.....
Q8A1I6_BACTN/28-326W..ANGN-A.........WAPCIEEKKIDGKY--K--------------YFFYYS..---.....ANPTTNKGKQ.....
Q8Z9F3_SALTI/4-306G..PMSQ-LI........WAPEMH....RING--K--------------WYIYFAAT---HTQA.LDKLGMFQHR.....

PF04041

Q9YFA2_AERPE/23-354F--WG...A---------EDPRYT----SVNS--H--------------DVLTYTGR------------------TLAYY
O58834_PYRHO/1-299K--KG...I---------EDPRVV----KLGK--R--------------YVMTYTGY------------------DGRIA
Q9WZN9_THEMA/15-332F--LG...C---------EDPRVF----FRNS--R--------------FELLYTAK------------------GYKDW
Q9X0V2_THEMA/4-323P--FQPSYA---------YDPRVV----KIED--T--------------YYITFC.T------------------DDHGP
Q9X2G7_THEMA/4-296L--YG...V---------EDPRIT----KIGD--E--------------YYMVYTAY------------------SPRGV
Q9HH03_PYRFU/31-329S--VG...V---------EDPRIV----KVGK--T--------------YYMTYTGY------------------DGKTA
O67215_AQUAE/17-345L--WG...V---------EDPRVY----EIDG--K--------------LFMTYTGR------------------TVNYF
Q9UZM0_PYRAB/1-299I--MG...V---------EDPRIV----KIGK--D--------------YLMTYTGY------------------DGKIA

PF02435

SACB_ZYMMO/1-400.......PRSWE------WSGCTIMAPGTANS-----------------VEVFFTS..V.......NDTPS..ESVPAQC
INVB_ZYMMO/1-398.......TRTAE------WSGGTIMAPGSRNQ-----------------VETFFTSTLF........DKNGVREAVAAVT
SACB_STRSL/223-685.........DQQ------WSGSATVNS..DGS-----------------IQLYYTKNDT......SG.GKLNWQQLASAT
SACB_BACAM/37-470ANDPILKDQTQE------WSGSATFTS..DGK-----------------IRLFYTDYSG.........KHYGKQSLTTAQ
SACB_GLUDI/77-540VYAGQTYTNQAE------WSGSSRLMQIHGNT-----------------VSVFYTDVAFNRDANANNITPP..QAIITQT
SACB_STRMU/184-637.......PLTQE------WSGSATVNE..DGS-----------------LQLFYTKVDT.......SDKNSNNQRLATAT
O82854_BACSP/38-487PNDPYLKYQTQE------WSGSATLTK..DGQ-----------------VRLFYTDYSGNP...EDGGTGAGNQIISTAQ
Q9Z5E5_PAEPO/37-482ANDPILKNQSEE------WSGSATLTS..DGQ-----------------VRLFYTSRQPY....DPNNNLYGKQTLSTAQ
SACB_ERWAM/1-407.......PTTRE------WAGTPILLN.DRGD-----------------IDLYYTC...........VTPG...ATIAKV
SACB_RAHAC/1-407.......PTSRE------WAGTPILLN.EDGD-----------------IDLYYTC...........VTPG...ATIAKV
SACB_PSESG/1-407.......PTTRE------WAGTPVLLN.DKGD-----------------IDLYYTC...........VTPG...AAIAKV

PF03664

XYNC_CELJU/321-555RVGNT-------------VAPQVF----YFRPHNK--------------WYLITQ----------------------WAG
Q9X583_9ACTO/516-788....A-------------VAPTLF----YFAPKNI--------------WVLAYQ----------------------WGS
Q9HEY3_COCCA/26-295....A-------------VAPTLF----RFAPKNI--------------WVLAYQ----------------------WGP
AXHA_ASPSO/28-298....T-------------VAPTLF----YFAPKDV--------------WILAYQ----------------------WGP
AXHA_ASPNG/28-302....A-------------VAPTLF----YFQPKSI--------------WVLAYQ----------------------WGS

PF00251

SCR_ZYMMO/33-343QCMATS..IDG....IHFQK....EGIVLEK..--APMP...QV---------------------AHFRDPRV.WK----
SCRB_PEDPE/37-339QLGAWM..DTD....NHIKK..LS.RPLIAH..--APAG...YT---------------------SSFRDPDL.IR----
INV3_ARATH/43-365QNVAVPV.NISDPYLREWSK.PPQ.NPLMTT..--NAVNG.INP---------------------DRFRDPTTAWL----
INV4_ARATH/54-372QNYAIPE.DPSDPYLRKWIK.PDD.NPIAIP..--DYTM...NG---------------------SAFRDPTTAWF----
INV5_ARATH/47-369QNLVKPK.NLTDPYLRHWTK.SPE.NPLVTP..--SPVNH.INS---------------------SAFRDPTTAWF----
SCRB_BACSU/33-338QCLAVS..DDG....LSFEK.....KGVVAR..--LPEG...YT---------------------AHFRDPKV.WE----
INV2_ARATH/52-371QNYAIPQ.DLSDPYLKTWIK.PDD.NPIVK...--.PDNG.ENG---------------------SAFRDPTTAWF----
SCRB_KLEPN/31-336QCLATE..NAD....GTFRK....LGPVLP...--LPEG...YT---------------------GHVRDPKV.WR----
Q9RGC0_9PSED/280-596GLARSTFAQDGDNDLVHWVK...HPTPVVVQQQ--GVGK....F---------------------GDFRDPFV.WK----
SCRB_VIBCL/98-398QCAARM..NAN....GEFEK.....LGPVIR.C--LPEG...VT---------------------EHIRDPKV.IY----
O02490_TRIFO/111-409NSIAYST.DGG....YTFTK.YE.NNPVVT...--F......DC---------------------RDFRDPTVIRY----
Q8DY03_STRA5/37-340QIGAWM..TND....GKITK....FDKVLIS..--QPND...VT---------------------EHFRDPQI.FN----
INV1_SCHPO/87-407QAIAYTT.DGG....YTFKK.YS.GNPVLDI..--.......NS---------------------LQFRDPKVIWD----
Q834P0_ENTFA/38-341QNIAWL..NSL....GAITKESTPFLPIDPN..--.......YS---------------------SHFRDPMV.FP----
Q6PVN1_TRIMO/132-444QCLAVPA.DPNDSLLRNWTK.YEA.NPILV...--.PPPG.IGD---------------------KDFRDPTTAWF----
SACC_BACSU/39-349QSIAYSN.DKG....RTWTK.YA.GNPVIPN..--P......GK---------------------KDFRDPKVFWY----
Q93X59_CICIN/50-368QDLAWPK.NLSDPFLREWVK.HPK.NPLII...--.PPEG.VKD---------------------DCFRDPSTAWR----
Q65DN5_BACLD/32-337QCLAVS..KDG....ISFEK.....QGVVAR..--LPKG...YT---------------------AHFRDPKV.WK----
Q42691_CHERU/44-365QVLAYPK.DLNDPYLKEWFL.APK.NPVMF..P--TPQNQ.INA---------------------TSYRDPTTAWM----
Q43855_VICFA/51-371QCIAIPA.NASVPLLTNWGK.PDRLNPILT...--.ADHR.MNG---------------------SVFRDPTTAWF----
INV4_ORYSJ/64-381QNIVLPK.NRSDPYLREWTK.PKN.NPLIE...--PVGPG.LNS---------------------NQFRDPTTGWI----
INV3_DAUCA/58-376QNYAVPA.NYSDPFLREWVK.PDN.NPLVG...--.VHT..ENP---------------------SAFRDPTTAWF----
Q7WWP6_LACAI/37-338QIGAWM..DKN....GKVS.....DKTILFK..--NPDH...IT---------------------EHFRDPQI.LK----
Q82YR4_ENTFA/37-340QLGAWM..DRS....YNITK....CEDVFIN..--KPED...VT---------------------DHFRDPQI.FD----
O94224_CYBJA/34-356QDIAYST.DGG....YTFEK.YE.NNPVIDV..--.......NS---------------------TQFRDPKVIWY----
Q65EI7_BACLD/46-355QFLWYSQ.NGG....KTFKP.YG.EEPVLPN..--......PGT---------------------VDFRDPKVIWD----
Q43856_VICFA/53-374QNLAYPK.DFSDPFLREWIK.SPE.NPVIE..P--TSENK.INA---------------------SSFRDPTTGWL----
INU1_KLUMA/43-375QHISYSL.DGG....YTFEH.YT.DNAVLDI..--.......NS---------------------SNFRDPKVFWH----
RAFD_ECOLX/28-329QCLATS..HDG....IRFEK.....QGCVLT..--PPEG....I---------------------MHFRDPKV.WH----
INV6_ORYSJ/42-371QNVAFPK.NPRDPLLREWTK.PGY.NPVIPV..--.PAD..VSP---------------------DNFRDPTTAWL----
1FEH_HORVU/68-385QNIAFPK.NRSDPYLREWIK.AAN.NPVLR...--.PDEPGMNV---------------------IEFRDPTTGWI----
Q9RBJ1_GLUDI/47-372QSVSVSH.DGG....FTWRP.YA.HNPVLTL.H--P......DS---------------------RQFRDPSVFWY----
O00056_PENPU/33-356QRLAYST.DLG....TTWLK.FS.GNPIISAAL--EAPHDVTGG---------------------LESRDPKVFFH----
SCRB_STRMU/37-340QIGAFM..DKK....GNIQK....FTDVLIK..--QPND...VT---------------------EHFRDPQI.FN----
Q9FNS9_CICIN/46-362QNLAFPK.NLSDPLLKEWIK.WSG.NPLLT...--.PVDD.IKA---------------------GQFRDPSTAWM----
Q9ZHJ7_CLOBE/31-333QCLAIY..RKD....GIIEK.....HGVIID.K--QPNG...YT---------------------AHFRDPYV.FI----
Q62DJ1_BURMA/55-380QSLAYSI.DHG....KTWRP.YA.HNPVLTL.A--P......ES---------------------RHFRDPNVTWY----
Q888X9_PSESM/32-333QCLATS..LDG....INFVK.....HGAVID.S--PPQD...TI---------------------IHFRDPKV.WQ----
INV6_ARATH/21-341TVVAEPK.DVSDPLLREWVK.PKY.NPVMV...--.PPSN.VPF---------------------NCFRDPTEAWK----
Q6F0T9_MESFL/38-341QIKADFI.DEK...........IVNKRVVVEHD--KNLF....T---------------------PHVRDPKIFEY----
Q8GT63_TRIMO/48-366QNVAYPK.NASDPLLVDWVK.PEY.NPVIP...--.VPAD.IKR---------------------DDFRDPSTAWL----
INV2_DAUCA/65-383QNFAVPA.NYSDPYLREWIK.PDN.NPIVR...--.ARS..ENS---------------------SSFRDPTTAWF----
Q65U44_MANSM/56-359QNLAIF..DRT....GKLLS....KRPLIEN..--APKG...YT---------------------EHVRDPKPYFT----
Q944U7_CARPA/59-376QNYAVPA.NISDPHLENWIK.PAN.NPLVA...--.PDHT.VNR---------------------TAFRDPTTAWL----
Q84V21_SOLLC/57-376QNYAIPA.NLSDPFLRKWIK.PNN.NPLIV...--.PDNS.INR---------------------TEFRDPTTAWM----
P94466_GEOSE/34-339QCMAMS..KNG....IDFEK.....KGIVVT..--LPDG...YT---------------------AHFRDPKV.WK----
Q45155_BACFG/137-443QCMAYST.DNG....RTFTK.YE.KNPVLTP.F--D......GL---------------------KDFRDPKVFWY----
O81118_WHEAT/47-373AERRVPG.QPLRPFLRKWVK.PDY.NPIIN...--.PDHG.INA---------------------SAFRDPTTAWY----
Q9L8G4_CLOAT/31-337QCLAES..SDG....VEFKK..PYINPVIKN..--QHEG...YT---------------------RHFRDPKV.WK----
INV1_MAIZE/129-459QNLAEPA.DASDPLLREWVK.SDA.NPVLV...--.PPPG.IGP---------------------TDFRDPTTACR----
GFT_ALLCE/75-405INLAEAA.DPSDPLLLKWIK.YDN.NPILW...--.PPPG.IVR---------------------DDFRDPNPIWY----
Q8LK75_LAGSI/143-463QNLAYPA.NLSDPLLLNWVK.YPG.NPVLV...--.PPPG.IGP---------------------KDFRDPTTAWL----
O82119_SOLLC/56-375QNYAIPA.NMSDPYLRKWIK.PDN.NPLIV...--.ADKN.INK---------------------IQFRDPTTAWM----
Q8L6W2_BETVU/147-465QNLAYPA.NLSDPLLLEWVK.YPG.NPVLV...--.PPPG.IGK---------------------LDFRDPTTAWL----
Q8XQE3_RALSO/19-318QCLAHS..RDG....VGFDK.....LGPVINGV--LP.G...YT---------------------GHFRDPKA.WR----
Q41604_TULGE/99-420QCQVYPE.DVDDPLLLKWFK.SDA.NPILV...--.PPPG.IGS---------------------KDFRDPTTAWY----
Q64ML3_BACFR/121-408QCIAYSL.DKG....RTFTK.YE.GNPVIDSKA--KW.....NS---------------------KDTRDPKVFWY----
Q8DNP0_STRR6/31-336QNMAFS..DDG....IHFEK..ISQNPVATGSD--LPDE..LIA---------------------ADFRDPKL.FE----
Q8W3M2_CITUN/123-441QNLAYPA.DPSDPLLIKWVK.YPG.NPVLV...--.PPPG.IGS---------------------KDFRDPTTAWL----
Q8XK71_CLOPE/29-331QCKGIL..EEN....GQLKK.....LGPVIS.T--LPKG...YT---------------------AHFRDPYI.WE----
Q9ZP42_FRAAN/53-372QNLAFPK.NLSDPFLREWVK.VPQ.NPLMA..P--TQANQ.INA---------------------SSFRDPTTAWL----
Q5WDB1_BACSK/36-338QNIARS..RDG....IHFYK..ANANPVIHQ..--QPAG...MG---------------------QDFRDPKV.WR----
O65778_CYNSC/94-412QCKAVPV.NASDPLLVEWVR.YDA.NPILY...--.APSG.IGL---------------------TDYRDPSTVWT----
Q8DNS7_STRR6/37-340QIGALM..DKE....GKITK....IDKILID..--QPAD...ST---------------------DHFRDPQI.FN----
Q6AW26_LOLPR/94-412QCIAVPT.DPNDPLLRHWTK.HPA.NPVLA...--.HPQG.VQG---------------------MDFRDPTSAWW----
Q5WBG3_BACSK/35-336QCIAVM..DEN....RAVSK...WEKPVIDQ..--VPAG...YT---------------------AHFRDPKV.WK----
Q8CRR2_STAES/37-337QMIARM..NKD....GKIEK...FPKPVIHG..--QPEG...YT---------------------SHFRDPKV.FE----
Q752P4_ASHGO/54-389QWISYSL.DGG....YTFID.YA.NNPVLDL..--.......NS---------------------TQFRDPKVIWH----
Q8DWH3_STRMU/37-353QYVAYSL.DNG....SSYQP.YNNGKPVMISQT--KEQN.....---------------------..ARDPYIWYD----
Q5LY63_STRT1/37-340QIGAWM..DKN....YKIKK....IDKVLIK..--KPTD...VT---------------------EHFRDPQI.FD----
SCRB_LACLL/37-342QLGAKI..DKN....NQLVK...FTEPLIYP..--DFSQ...TT---------------------DHFRDPQI.FS----
Q84F22_9BIFI/57-368QMLAKPNDDEL....KTFTK.....EGMIID..--CPTDE.V.D---------------------HHFRDPKV.WK----
Q6G7R6_STAAS/38-338QMIARL..KED....GSVEK...FPKPVISQ..--QPEG...YT---------------------SHFRDPKV.FK----
Q5XA96_STRP6/37-340QVGAWM..DKQ....GNISK....IPQVLIE..--QPDD...VT---------------------EHFRDPQL.FS----
Q9KBR7_BACHD/33-338QCVAES..EDG....LTFTK.....KGVILH..--VPDG...YT---------------------AHFRDPKV.WK----
LEVB_BACSU/48-356QYLWYST.DKG....KSFKF.YS.GNPVMPN..--......PGT---------------------DDFRDPKVIWD----
Q5ZQK6_9ASTR/50-366QNLAVPK.NLSDPFLREWVK.HKA.NPIMT...--.TPEG.VKA---------------------DDFRDPSTAWL----
INV1_DAUCA/64-384QNYAIPA.NLSDPYLRKWIK.PDN.NPLVV...--.ANNG.ENA---------------------TAFRDPTTAWL----
O04372_ASPOF/122-447QNLAVPA.DLSDPLLLEWTKVDDA.NPILV...--.PPPG.VGA---------------------TDFRDPTTAWF----
O65341_SACRO/23-357QCLAVPA.DDADPLLTNWTK.YEG.NPVLY...--.PPPG.IGP---------------------RDFRDPTTAWF----
Q5WDB0_BACSK/20-318QSIAYSK.DDG....RTWER.YV.GNPVIPN..--T......GM---------------------KDFRDPKVFWH----
Q6KCH6_HORVU/127-454QCLAFPT.DPSDPLLINWTK.YEN.NPVMY...--.PPPG.VGE---------------------KDFRDPTTAWF----
SCRB_SALTM/31-336QCLATE..NAD....GTFRK.....IGPVLP..--LPEG...YT---------------------GHVRDPKV.WR----
O86076_ECOLX/29-330QCLATS..RDG....IHFEK.....QGVILT..--PPEG....I---------------------MHFRDPKV.WR----
INV1_ORYSJ/53-369QNIAFPK.NASDPLLREWVK.PAY.NPVAT...--.PEPG.MNA---------------------TQFRDPTTAWY----
Q8W431_WHEAT/84-403QCIATPA.DPTDPLLRRWTK.HPA.NPVIW...--.SPPG.VGT---------------------KDFRDPMTAWY----
Q6DA94_ERWCT/31-336QCLARE..NPN....GEYDK.....LGAVLT..--LPDG...YT---------------------GHVRDPKV.WR----
INVB_DAUCA/135-453QNLAYPA.NLSDPLLLDWIK.YPD.NPVMF...--.PPPG.IGS---------------------TDFRDPTTAWI----
Q97I80_CLOAB/49-358QFLWYST.DRG....RTFKP.YS.NQPIIPN..--......PCT---------------------KDFRDPKIIWD----
Q84XV1_MUSAC/62-379QNVAYPK.DLSDPYLREWVK.PDY.NPVIA...--.PGDG.INA---------------------SAFRDPTTAWR----
Q94C07_ORYSA/140-471QNLADPV.NITDPLLRDWVK.TDV.NPVLY...--.PPPG.IGA---------------------KDFRDPTTAFK----
INV3_ORYSJ/51-377QNVAYPV.NLSDPYLREWYK.PDY.NPIIN...--.PDGG.INA---------------------SAFRDPTTAWY----
Q65D73_BACLD/27-331QNIAVS..KDG....IVFEK..LKENPVIAE..--PPED...SA---------------------RHFRDPKV.WK----
Q9S943_VITVI/137-455QNLAYPA.DLSDPLLVDWVK.YPG.NPVLV...--.PPPG.IDD---------------------KDFRDPTTAWY----
Q74HI7_LACJO/37-340QVIAEM..DKD....NHITK..PKDPAIL....--PPDH...VS---------------------EHFRDPQL.FE----
Q70LF5_HORVU/96-419TCLAEPA.DPSDPLLREWVK.HPA.NPVVF...--.PPPG.IGM---------------------KDFRDPTTAWF----
O23786_CYNSC/107-426QCLAYAV.NSSDPLLLDWKK.YEG.NPILF...--.PPPG.VGY---------------------KDFRDPSTLWL----
O81082_ALLCE/87-413QNLAEPA.DPSDPLLIEWKK.SNG.NPILM...--.PPPG.VGP---------------------HDFRDPFPVWY----
O74641_ASPNG/33-356QRLAFSV.DNG....ATWTK.FQ.GNPIISTSQ--EAPHDITGG---------------------LESRDPKVFFH----
Q9ZR55_CICIN/25-343QNLAVPK.DLSDPYLREWVK.HTG.NPIIS...--.LPEE.IQP---------------------DDFRDPTTTWL----
O81189_MAIZE/58-383QNVAYPK.NVSDPLLREWVK.PSH.NPVIV...--.PEGG.INA---------------------TQFRDPTTAWR----
Q6F0V0_MESFL/34-333KEKLVTK...ELLFEADLTK.............--.......YT---------------------GHYRDPIVFEK----
BFRA_THEMA/7-294QCVAMS..ENG....LDFVK.YD.GNPVISK..--PPEE...GT---------------------HAFRDPKVNRS----
INV2_YEAST/32-353QYISYSL.DGG....YTFTE.YQ.KNPVLAA..--.......NS---------------------TQFRDPKVFWY----
Q8GM36_BACME/30-333QNIAVS..KDG....ITFEK..AEANPVIAE..--PPAD...SS---------------------HHFRDPKV.WK----
Q9S944_VITVI/115-433QNLAYPA.NLSDPLLLHWIK.YEN.NPVMV...--.PPAG.IGS---------------------DDFRDPTTMWV----
Q9LAL1_9PSED/15-331QSLAYST.DRG....RTWIK.YE.GNPFFAD..--E......AM---------------------TDFRDPKVFWH----
INV1_HANAN/32-354QEIAYSL.DKG....YSFIK.YD.QNPVINV..--.......NS---------------------SQQRDPKVLWH----
Q9CJZ0_PASMU/57-355QNIAIF..KKD....GTLLK....KRCLLNQ..--APTG...YT---------------------EHVRDPKPFIT----
Q8GI55_GEOSE/14-329QSLAFSH.DRG....RTWTK.YE.KNPVLKH..--P......TK---------------------VDFRDPKVFWH----
Q7XA49_SOYBN/45-362QNLAQPK.NLSDPFLREWVK.SPK.NPLMA..P--TSANK.INS---------------------SSFRDPTTAWL----
INVA_SOLLC/108-427QNLAYPA.NLSDPLLLDWVK.FKG.NPVLV...--.PPPG.IGV---------------------KDFRDPTTAWT----
Q5WI15_BACSK/12-315QCAAVS..EDG....HQFQK.....LGPLFE..--HPAG...YT---------------------RHVRDPKV.WK----
Q9F498_ERWAM/31-336QCLATR..DQQ....GEFHK.....LGPVLA..--LPEG...YT---------------------GHVRDPKV.WQ----
Q8A6W7_BACTN/150-451QSIAYST.DNG....RTFTK.YE.NNPVLVS..--.......EA---------------------RDFRDPKVFWY----
SCRB_STAXY/38-338QHIAKM..SKD....GSINK...FPKAVISA..--PPSG...YT---------------------QHFRDPKV.HV----
Q45372_PAEPO/17-347QSIAYSK.DKG....RTWTK.YE.GNPVLFP..--T......DT---------------------LDFRDPKVIWH----
SCRB_VIBAL/41-341QCFATM..DSD....GSIEK.....HGVVIE..--.NEH...YT---------------------EHFRDPKV.WK----
INV7_ORYSJ/44-366QNVAFAK.NPSDPLLREWEK.PAY.NPVIA...--LPAD..VPG---------------------DKFRDPSTAWL----
Q5KUA8_GEOKA/34-339QCMAVS..EDG....IHFTK.....KGVVIT..--LPDG...YT---------------------AHFRDPKV.WR----
O42801_9EURO/31-371QSIAYSL.DDG....LTWTT.YDAANPVIPNPP--QPYQ..AQY---------------------QNFRDPFVFWH----
Q7WWQ7_LACAI/24-321QCVAVS..DDG....VDFKK..YKNNPVMTIAD--LPGE..VDE---------------------SNFRDPKVFEH----
Q6HN59_BACHK/32-333QCMATM..DSQ....YTMTK..YSNNPVIDI..--IPDG...YT---------------------KHVRDPKV.WK----
INV1_ARATH/56-378QNIAEPK.NLSDPYLREWKK.SPL.NPLMA..P--DAVNG.INA---------------------SSFRDPTTAWL----
Q84V20_SOLLC/57-375QNYAIPA.NLSDPYLREWIK.PDN.NPLII...--.ADES.INK---------------------TKFRDPTTAWM----
Q6EVL5_ECOLX/31-336QCLATE..NNQ....GGFDK.....LGPVIP..--LPDG...YT---------------------GHVRDPKV.WK----
Q9FR47_POASE/86-409QCLAVPA.EPNDPLLRRWTK.HPA.NPVLV...--.HPPG.IKD---------------------MDFRDPTTAWF----
Q9ZR32_DAUCA/105-423QNLAYPA.NLSDPLLLEWVK.HPG.NPVMV...--.PPPG.IGF---------------------KDFRDPTTAWL----
Q94C08_ORYSA/125-454QCLADPV.NPTDPLLVDWVK.YSV.NPVIY...--.PPPG.IGV---------------------KDFRDPTTACR----
Q6F4N3_LOLPR/116-437QCLAVPA.DPFDPLLRSWIK.HPA.NPILF...--.PPPG.IGL---------------------KDFRDPLTAWF----
O81083_ALLCE/154-479QNLAVPA.DQSDTLLLRWKK.SEA.NPILV...--.PPPG.IGD---------------------KDFRDPTTAWY----
Q42722_DAUCA/122-441QNLAYPA.DPSDPLLIEWVK.YPG.NPVLV...--.PPPG.IDF---------------------KDFRDPTTAWR----
Q8LRN6_SOLLC/7-325QNYAIPA.DLSDPFLRKWIK.PDN.NPLID...--.ADVN.INK---------------------TQFRDPTTCWL----
Q5NEI9_FRATT/30-331QNLIKS..KDG....IHFSK....PKTVINH..--KPDF...CS---------------------YDFRDPKVWFD----
INVA_PHAVU/120-440QNLAYPA.DPSDPLLVDWIK.HPG.NPVLV...--.PPPG.IGA---------------------KDFRDPTTAWL----
6FEH_BETVU/60-382QNLALPK.NLSDPYLKEWIK.LPQ.NPLMAGTP--TNNNN.INA---------------------SSFRDPSTAWQ----
Q8RLU2_PAEPO/14-330QSLAYST.DSG....KTWIK.YT.GNPVLED..--K......EC---------------------IDFRDPKVFWH----
INVA4_ARATH/125-445QNLAYPE.DPNDPLLLKWVK.FPG.NPVLV...--.PPPG.ILP---------------------KDFRDPTTAWK----

PF04616

O30426_CALSA/54-321.TYLFSS-KNIT...GPWER------VEF..----........N---------------------EYLHDPSLLFD----
Q9K6P5_BACHD/5-295HNYLVTA-QNIE...GPWSD------PIYL.----........N---------------------SSGFDPSLFHD----
Q8P3K7_XANCP/60-332.IFVIWA-DDIR...GPWSA------PIDLK----........I---------------------AGCIDPGHVVG----
Q8A1K5_BACTN/22-288.NWVIWA-NDIK...GPWSK------PIDL.----........K---------------------VSGIDPGHIAD----
Q93J96_STRCO/52-335.LYVLES-ERDDPT.GPYHF------TAKLA----PPNHA...D---------------------DFAIDAGILQL----
Q9A4M8_CAUCR/35-330GNYLITA-KDPK...GPWSD------PVWLP----........K---------------------VGGIDPSIFFD----
Q9A9Z8_CAUCR/61-333.SYVIWA-DKIE...GPWSE------PIDLK----........L---------------------PRYIDPGHIVD----
Q8A3Q4_BACTN/26-309.IGVATA-DKPE...GPFVD------HGMMF----RSNEIG..V---------------------QNSIDPFYIED----
Q9KBQ8_BACHD/8-311.MFVLEN-ESANPLEGSWIE------KGQIF----TKW.....E---------------------SFSLDATTFEH----
Q92P74_RHIME/5-303HNYIVTA-EAVE...ATWSD------PVYV.----........N---------------------SSGFDPSLFHD----
Q8A0C6_BACTN/25-303.IGVATS-DSPL...HEFTD------HGPIV----EY......G---------------------KEAIDAFIYDD----
Q82P90_STRAW/37-336.MYVLES-GAANPLTGSWTE------KGQIA----TPV.....S---------------------SFSLDATTFVV----
Q8PBE4_XANCP/26-318GNFLITA-KDPA...GPWSD------PIWL.----........D---------------------AKGIDPSLFFD----
YAGH_ECOLI/3-303RNFLVTA-PSIE...GPWSE------PIPM.----........G---------------------NGGFDPSLFHD----
Q97TI6_CLOAB/24-307.IGVAVS-NSPT...GPFVD------ALGHP----LAYTG....---------------------TGDIDPTVFID----
Q8A3V2_BACTN/35-295.LMMSTA-TDPH...GPWSP------LHCVK----R.......I---------------------GGWEDPCPIWD----
Q8PE34_XANCP/46-319.NFVVWA-DDIK...GPWSK------PIDIG----........L---------------------GKYIDPGHAVG----
Q9A9J1_CAUCR/6-306HNYLVTC-ETID...GDWSD------PIHL.----........N---------------------SSGFDPSLFHD----
Q9RI60_STRCO/4-282GNFVVSA-RRPE...GPWRD------PVWI.----........D---------------------LPGIDPDLAWE----
Q9KXY8_STRCO/30-319.IGLAGS-TTGAP..GSWSD------YGIVY----TSGSAS..D---------------------YNAIDPNLFVD----
O52729_9BACI/3-301HNYLVTC-ETVD...GDWGE------PIQL.----........N---------------------SSGFDASLFHD----
Q8A6K8_BACTN/42-323.TSILVS-DSPK...GPFTP------LVNKA----ITPS....G---------------------WMCLDGSLYID----
Q8EPL4_OCEIH/6-297RDFYVTA-EDPG...GPWSD------PNWLG----........P---------------------TPGIDPSLFFD----
Q8CWF7_OCEIH/4-302HNYLVTC-NSID...GEWSE------PIYL.----........N---------------------SSGFDPSLFHD----
O52575_SELRU/3-304HNYLTTA-EDIK...GPWSK------PILL.----........N---------------------GAGFDASLFHD----
Q8A1Z2_BACTN/337-620.IGIATA-DKPE...GPFTD------LGKLF----RSNEIN..I---------------------QNCIDPFYIED----
Q9CFH1_LACLA/4-305TNYLTTA-TDIK...GPWTD------PIKL.----........N---------------------GLGFDASLFHD----
Q8P3G6_XANCP/43-335GNFIASA-TSAA...GPWST------LSWLP----........G---------------------VDGIDPSLFFD----
XYLB_BUTFI/4-291GNFIVTA-KDPA...GPWSE------PYYLG----ED......E---------------------APGIDPSLFFD----
Q8CK14_STRCO/11-285.VFQVNA-PDVR...GPWTA------PHLVK----A.......G---------------------KGLIDPCPLWD----
Q97DM1_CLOAB/2-300HNYLTTC-ESVD...GVWSD------PITL.----........N---------------------GSGFDASLFHD----
Q81ZV8_STRAW/441-719.IGVAVA-DSPA...GPFKD------ALGKP----LVAKG.KLA---------------------GQMIDPAVFTD----
XYNB_BACPU/3-301HNYLVTA-DAVD...GEWSD------PVRL.----........N---------------------SSGFDPSLFHD----
Q82P89_STRAW/52-348.THVLES-AGADPM.GPYTY------KNSLT----GSNLNP..G---------------------GWLIDASVLQY----
Q97IW1_CLOAB/6-309.MFVIQN-ENENPFTGNWVE------KGRIK----TAW.....E---------------------SFSLDATIFEH----
Q8A1I6_BACTN/28-326.IGVAVA-DSPT...GPFTD------LGKPI----ITSSP.TGR---------------------GQQIDVDVFTD----
Q8Z9F3_SALTI/4-306.MFALEC-ADADPLTGKWTE------KGQIK----TPF.....D---------------------TFSLDATTFYH----

PF04041

Q9YFA2_AERPE/23-354SSSVGQT-FPV----VAVRRAPNGEWVKEAYIT--LEPDEAPLA---------------------TSIKNAFILSH....
O58834_PYRHO/1-299RLCIAVS-KNL----LSWEKGE....PLFPNFP--GNRLRPRGW---------------------TKSGAILPQKI....
Q9WZN9_THEMA/15-332SQEGKPH-TDF----LAYAVLD....EDLNLIE--KR..YISIK---------------------STLGEYVPVSM....
Q9X0V2_THEMA/4-323TIGVGMT-KDF----KTFVRLP....NAYVPFN--.........---------------------.RNGVLFPRKI....
Q9X2G7_THEMA/4-296RIAMAST-KNF----ITWKRYG....VVIPEVD--.N.......---------------------.KDAALFPEKI....
Q9HH03_PYRFU/31-329RLCLATS-KNM----LTWKKHG....PIFEGFE--YKKNNIKGW---------------------TKSGAILPKKLEKGN
O67215_AQUAE/17-345RTDIRTE-RTL----PVTARYENGQWKKIAVFR--MPEDIRSFV---------------------VSDKNAFLVKT....
Q9UZM0_PYRAB/1-299RLCLAIS-RNL----LSWGKVG....AIFDEFP--GNYLRPKNW---------------------TKSGAILPEKV....

PF02435

SACB_ZYMMO/1-400KGYIYA--DDK----SVWFDGFDKVTDLF.Q.A--DGLYYADYAENNF.................WDFRDPHVFIN----
INVB_ZYMMO/1-398KGRIYA--DSE----GVWFKGFDQSTDLF.Q.A--DGLFYQNYAENNL.................WNFRDPHVFIN----
SACB_STRSL/223-685LNLAVE--ND.----EVVIKSVENDHILF..GG--DNYHYQSYPKFMSTFDDDHNHDGNPDRTDNYCLRDPHIIED----
SACB_BACAM/37-470VNVSKS--DD.----TLKINGVEDHKTIF.DG.--DGKTYQNVQQFIDEGNY........TSGDNHTLRDPHYVED----
SACB_GLUDI/77-540LGRIHA--DFN----HVWFTGFTAHTPLL.Q.P--DGVLYQNGAQNEF.................FNFRDPFTFED----
SACB_STRMU/184-637VNLGFD--DQ.----DVRILSVENDKVLTPEGG--DGYHYQSYQQWRSTFT..........GADNIAMRDPHVIED----
O82854_BACSP/38-487VNLSQP--DAA----TLKVDGVSDHKSVF.DGG--DGTVYQNIQQFIDEGKW........ISGDNHTLRDPHYVED----
Q9Z5E5_PAEPO/37-482INVSQP--DDK----TLKIDGVEDLKSIY.DGG--DGKIYQNVQQSVGVD............MDNHTFRDPHYVED----
SACB_ERWAM/1-407RGKIVT--SDQ----SVSLEGFQQVTSLF.S.A--DGTIYQTEEQNAF.................WNFRDPSPFID----
SACB_RAHAC/1-407RGKVLT--SEE----GVTLAGFNEVKSLF.S.A--DGVYYQTESQNPY.................WNFRDPSPFID----
SACB_PSESG/1-407RGRIVT--SDK----GVELKDFTEVKTLF.E.A--DGKYYQTEAQNST.................WNFRDPSPFID----

PF03664

XYNC_CELJU/321-555A...YAT-TDDIRNPN.WSA----KQKL....L..QGEP--------------------------NGALDFWVICN----
Q9X583_9ACTO/516-788WPFSYRT-SSDPTDPNGWSA----PQPLFTGSIPRTDSG--------------------------TGPIDQTLIAD----
Q9HEY3_COCCA/26-295TTFSYRT-SSDPTNPNSWGG----VQTLFSGKI..SGSS--------------------------TGAIDQTVIGD----
AXHA_ASPSO/28-298TSFSYKT-SSDPTDANGWSA----AQPLFSGTI..SDSD--------------------------TGVIDQTVIGD----
AXHA_ASPNG/28-302STFTYRT-SQDPTNVNGWSS----EQALFTGKI..SGSS--------------------------TGAIDQTVIGD----

PF00251

SCR_ZYMMO/33-343-E....N.--NHWFMVVGYRTDD---------------------------------------EKHQGIGHVALYRS..EN
SCRB_PEDPE/37-339-N....D.--HGYYALIGAQTT.---------------------------------------...TEIGAILVYFS..KD
INV3_ARATH/43-365-G...RD.--GEWRVIVGSSTD.---------------------------------------...DRRGLAILYKS..RD
INV4_ARATH/54-372-S...KD.--GHWRTVVGSKRK.---------------------------------------....RRGIAYIYRS..RD
INV5_ARATH/47-369-G...RD.--GRWRITTGSQEG.---------------------------------------....RRGLAILHTS..KD
SCRB_BACSU/33-338-H....E.--GTWYMVIGAQTE.---------------------------------------...NLKGQAVLFAS..DN
INV2_ARATH/52-371-NK..KD.--GYWRMLVGSKRK.---------------------------------------....NRGIAYMYKS..RD
SCRB_KLEPN/31-336-Q....D.--GRWYMVLGAQDV.---------------------------------------...QQRGKVLLFTA..SD
Q9RGC0_9PSED/280-596-D....G.--DTWYMLVGSGTD.---------------------------------------...GEGGTALAYTS..KN
SCRB_VIBCL/98-398-T....Q.--GKWHMLLGAQTL.---------------------------------------...AHQGRLAVYHS..DD
O02490_TRIFO/111-409-......N--DQWNLFIATGQ..---------------------------------------.......CIRIYSS..LN
Q8DY03_STRA5/37-340-Y....D.--NQFYAVIGAQNS.---------------------------------------...KKCGFIKLYKALNND
INV1_SCHPO/87-407-F....DA--NRWVMIVAMSQ..---------------------------------------.....NYGIAFYSS..YD
Q834P0_ENTFA/38-341-Y....Q.--EGLVLLIGASDL.---------------------------------------...NGQGKIVVYFS..KD
Q6PVN1_TRIMO/132-444-DE..SD.--KTWRTVIGSKDNH---------------------------------------...GHTGIVMTYKT..KD
SACC_BACSU/39-349-E....KE--KKWVMVLAAGD..---------------------------------------.......RILIYTS..KN
Q93X59_CICIN/50-368-G...PD.--GVWRIVVGGDRD.---------------------------------------....NNGMSLLYQS..TD
Q65DN5_BACLD/32-337-K....N.--GSWYMVLGAQTE.---------------------------------------...NLEGRAVLFQS..DN
Q42691_CHERU/44-365-L...PD.--GNWRVLIGKSKR.---------------------------------------...RQRGLSLLYRS..RD
Q43855_VICFA/51-371-G...KD.--GHWRILIGGKTG.---------------------------------------....DTGVAYLYRS..KN
INV4_ORYSJ/64-381-G...PD.--GLWRIAVGAELN.---------------------------------------....GYSAALLYKS..KD
INV3_DAUCA/58-376-D...GG.--.HWKMLVGSSRK.---------------------------------------....HRGIAYLYRS..KD
Q7WWP6_LACAI/37-338-K....N.--DTYYAILGAQDNA---------------------------------------...EKHGHIDVWKS..KD
Q82YR4_ENTFA/37-340-Y....K.--GQFYAIVGGQSL.---------------------------------------...EKRGVIKLYKAVGNS
O94224_CYBJA/34-356-E....ET--EQWVMTVAKSQ..---------------------------------------.....EYKIQIYTS..DN
Q65EI7_BACLD/46-355-E....QD--DKWVMALAEGT..---------------------------------------.......KVGFYES..QN
Q43856_VICFA/53-374-G...KD.--GKWRGIVGSKRS.---------------------------------------....TRGIAILYKS..KD
INU1_KLUMA/43-375-EGENGED--GRWIMAVAESQ..---------------------------------------.....VFSVLFYSS..PN
RAFD_ECOLX/28-329-E....D.--GSWWMVIGARDA.---------------------------------------...SDNGQVLLYRG..TS
INV6_ORYSJ/42-371-G...SD.--GLWRFAISAVAD.---------------------------------------....GVGATLVYRS..AD
1FEH_HORVU/68-385-G...PD.--GHWRMAVGGELN.---------------------------------------....GYSAALLYKS..ED
Q9RBJ1_GLUDI/47-372-Q....DG--GCWIMTTVVGD..---------------------------------------.....AQLVKLYRS..TD
O00056_PENPU/33-356-E....PS--GKWVMVLAHGG..---------------------------------------.....QDKLTFWTS..LD
SCRB_STRMU/37-340-Y....K.--GQFYAIVGAQSL.---------------------------------------...DKKGFIKLYKAVDND
Q9FNS9_CICIN/46-362-G...PD.--GKWRIVIGSEID.---------------------------------------....GHGTALLYRS..TN
Q9ZHJ7_CLOBE/31-333-E....D.--DTYYMILGVQSE.---------------------------------------...DLKGRALIYES..ID
Q62DJ1_BURMA/55-380-A....PG--GYWMMTAVVAD..---------------------------------------.....APVVKLYRS..SD
Q888X9_PSESM/32-333-Q....D.--EHWYLIAGARLG.---------------------------------------....DKPLLPLYRS..AD
INV6_ARATH/21-341-G...QD.--GKWRVLIGAKEKD---------------------------------------...TEKGMAILYRS..DD
Q6F0T9_MESFL/38-341-E......--NNKYMIFGAQCKA---------------------------------------...DMLGGLVFYKT..DD
Q8GT63_TRIMO/48-366-G...AD.--GLWRIAVAARVH.---------------------------------------...DVGGATLIYRS..KD
INV2_DAUCA/65-383-D...GV.--.HWKILVGSRRK.---------------------------------------....HRGIAYLYRS..RN
Q65U44_MANSM/56-359-K....E.--GKIRFICGAQRE.---------------------------------------...DLTGTAIIFEM..DN
Q944U7_CARPA/59-376-G...SD.--GWWRMLVGSKNK.---------------------------------------....RRGIAHLYKS..KD
Q84V21_SOLLC/57-376-G...QD.--GLWRILIASMRK.---------------------------------------....HRGMALLYRS..RD
P94466_GEOSE/34-339-K....G.--DKWYMIVGAQSE.---------------------------------------...SLDGKAVLFRS..QN
Q45155_BACFG/137-443-A....PD--QKWVMVVSADK..---------------------------------------.......EMRFYSS..EN
O81118_WHEAT/47-373-G...PD.--GHWRLVVGSKEN.---------------------------------------....MRGIAVLYRS..RD
Q9L8G4_CLOAT/31-337-H....N.--DKWYMVLGAQRE.---------------------------------------...EEKGSTVLYCS..DD
INV1_MAIZE/129-459-TPAGND.--TAWRVAIGSKDR.---------------------------------------...DHAGLALVYRT..ED
GFT_ALLCE/75-405-NA..SE.--STYHIVVGSKNDS---------------------------------------..LQHTGIALVYLT..KD
Q8LK75_LAGSI/143-463-G...HD.--GKWRITIGSRVG.---------------------------------------...TTLGVSLVYTT..ND
O82119_SOLLC/56-375-G...RD.--GYWRVLVGSVRN.---------------------------------------....HRGKVIMYKS.NKN
Q8L6W2_BETVU/147-465-T...SE.--GKWRITIGSKIN.---------------------------------------....KTGISLVYDT..TD
Q8XQE3_RALSO/19-318-Q....G.--DHWYAVLGAQRT.---------------------------------------...DLTGTVLLLKS..PD
Q41604_TULGE/99-420-DV..AE.--ASWKLAIGSKDE.---------------------------------------...QHNGISLIYRT..YD
Q64ML3_BACFR/121-408-A....PG--KHWVMVLNERD..---------------------------------------.......GHSIYNS..AD
Q8DNP0_STRR6/31-336-K....D.--GRYYSVVAAKHK.---------------------------------------...NNVGCIVLLGS..DN
Q8W3M2_CITUN/123-441-T...SE.--GKWRIAIGSRIN.---------------------------------------....RTGITFVYDT..KD
Q8XK71_CLOPE/29-331-N....N.--GYYYMILGIQTE.---------------------------------------...KLKGRCVIYKS..ND
Q9ZP42_FRAAN/53-372-G...PD.--KRWRLIIGSKRN.---------------------------------------....HRGLAILYRS..KD
Q5WDB1_BACSK/36-338-E....N.--GVWFMVVGATKH.---------------------------------------....DQGQVLLYES..AN
O65778_CYNSC/94-412-G...PD.--GKHRMIIGTKRN.---------------------------------------....TTGLVLVYHT..TD
Q8DNS7_STRR6/37-340-F....K.--GQYYAVVGGQDL.---------------------------------------...EKKGFVRLYKAVNND
Q6AW26_LOLPR/94-412-DK..SD.--STWRILIGSKDDD---------------------------------------N.GSHAGIAFIFKT..KD
Q5WBG3_BACSK/35-336-D....D.--DMYRCVIGTQRN.---------------------------------------...DFTGTAVVYES..PD
Q8CRR2_STAES/37-337-K....N.--SQLYAILGAQNE.---------------------------------------...NEMGRLLLYRS..QD
Q752P4_ASHGO/54-389-E....ES--QKWIMTVVLSH..---------------------------------------.....KYAIQIYSS..DN
Q8DWH3_STRMU/37-353-S....NS--KRLMMYLAEGD..---------------------------------------.......KIGIYAS..SD
Q5LY63_STRT1/37-340-Y....K.--GQFYAIIGAQNH.---------------------------------------...NKQGFIKFYKAVDND
SCRB_LACLL/37-342-F....Q.--GQIYCLIGAQSS.---------------------------------------...QKNGIIKLYKAIENN
Q84F22_9BIFI/57-368-T....G.--DTWYMTFGVSSK.---------------------------------------...EHRGQMWLYTS..SD
Q6G7R6_STAAS/38-338-Y....S.--EKYYAIIGAQNN.---------------------------------------...DQQGRLLLYNT..ED
Q5XA96_STRP6/37-340-Y....Q.--GQFYAIIGAQGL.---------------------------------------...DGKGKIKLYKAVDNH
Q9KBR7_BACHD/33-338-R....D.--GIWYLVIGAQTK.---------------------------------------...QIDGHVLLFRS..DD
LEVB_BACSU/48-356-D....QD--NKWVMVMAEGS..---------------------------------------.......KIGFYES..DN
Q5ZQK6_9ASTR/50-366-G...YD.--GKWRVLVGSKKN.---------------------------------------....DLGVAYLYQS..KD
INV1_DAUCA/64-384-D...KS.--GHWKMLVGSKRN.---------------------------------------....RRGIAYLYRS..KD
O04372_ASPOF/122-447-EP..SD.--STWRIAIGTKDA.---------------------------------------...DHSGVALVYST..KD
O65341_SACRO/23-357-DP..SD.--STWRIVIGSKDDA---------------------------------------E.GDHAGIAVVYRT..RD
Q5WDB0_BACSK/20-318-E....ET--AKWVMVVSTNQ..---------------------------------------.......TVSFYHS..DN
Q6KCH6_HORVU/127-454-DG..PD.--DMWRLVIGPKDD.---------------------------------------...RHAGMVMTYKT..KD
SCRB_SALTM/31-336-H....E.--DLWYMVLGAQDR.---------------------------------------...QKRGKVLLFSS..AD
O86076_ECOLX/29-330-E....A.--DTWWMVVGAKDP.---------------------------------------...GNTGQILLYRG..SS
INV1_ORYSJ/53-369-A...D..--GHWRMLVGGLKG.---------------------------------------...ARLGLAYLYRS..RD
Q8W431_WHEAT/84-403-DE..SD.--DTWRTLLGSKDDN---------------------------------------N.GHHDGIAMMYKT..KD
Q6DA94_ERWCT/31-336-H....G.--DHWYMVLGAQDL.---------------------------------------...DLQGKVVLYRS..AD
INVB_DAUCA/135-453-G...RD.--GKWRITIGSKVN.---------------------------------------....KTGISLMYKT..TD
Q97I80_CLOAB/49-358-F....KN--NKWVMVLAEGT..---------------------------------------.......KIGFYES..YN
Q84XV1_MUSAC/62-379-G...PG.--THWKLVVGSKWN.---------------------------------------....RRGKAILYRS..RD
Q94C07_ORYSA/140-471-ENEVDD.--KRWRAIIGSKEK.---------------------------------------...EKVGLSVVYKT..DN
INV3_ORYSJ/51-377-G...PD.--GHWRLLVGSKVN.---------------------------------------....MKGLAVLYRS..RD
Q65D73_BACLD/27-331-H....R.--ENWYMVVGNSSK.---------------------------------------...ENVGRVILYRS..PN
Q9S943_VITVI/137-455-W...PD.--GKWRIAIGSKVN.---------------------------------------....KTGISLVYNT..ED
Q74HI7_LACJO/37-340-H....D.--GKYYVLLGAQDAK---------------------------------------...TKKGHIDIYES..TD
Q70LF5_HORVU/96-419-DA..SD.--GTWRTIIGSKNDS---------------------------------------...DHSGIVFSYKT..KD
O23786_CYNSC/107-426-G...PD.--GEYRMVMGSKHN.---------------------------------------...ETIGCALIYHT..TN
O81082_ALLCE/87-413-NE..SD.--STWHMLIGSKDD.---------------------------------------...NHYGTVLIYTT..KD
O74641_ASPNG/33-356-R....QS--GNWIMVLAHGG..---------------------------------------.....QDKLSFWTS..AD
Q9ZR55_CICIN/25-343-E...ED.--GTWRLLVGSQKD.---------------------------------------....KTGIAFLYHS..GD
O81189_MAIZE/58-383-GP..GP.--EQWRLLVGSAAGS---------------------------------------..SPPRGVAYVYRS..RD
Q6F0V0_MESFL/34-333-N......--NQLYMLNGAQTK.---------------------------------------...DLKAMLNVYRF...N
BFRA_THEMA/7-294-N......--GEWRMVLGSGKD.---------------------------------------...EKIGRVLLYTS..DD
INV2_YEAST/32-353-E....PS--QKWIMTAAKSQ..---------------------------------------.....DYKIEIYSS..DD
Q8GM36_BACME/30-333-H....E.--GFWYMILGNSTK.---------------------------------------...KQEGRVILYRS..SN
Q9S944_VITVI/115-433-G...AD.--GNWRVAVGSLVN.---------------------------------------....TTGIVLVFQT..TN
Q9LAL1_9PSED/15-331-K....AS--NKWIMILAAGN..---------------------------------------.......CVRIYHS..SN
INV1_HANAN/32-354-D....ES--NQWIMVVAKTQ..---------------------------------------.....EFKVQIYGS..PD
Q9CJZ0_PASMU/57-355-E....E.--GKIRFILGAQRE.---------------------------------------...DLSGTALIYEM..TD
Q8GI55_GEOSE/14-329-Y....ES--EKWIMVLATGQ..---------------------------------------.......TVSIYSS..PN
Q7XA49_SOYBN/45-362-G...KD.--GHWRVLVGSKRR.---------------------------------------....TRGIAILYRS..KD
INVA_SOLLC/108-427-GP..QN.--GQWLLTIGSKIG.---------------------------------------....KTGVALVYET..SN
Q5WI15_BACSK/12-315-D....DS--GNWWLIVGAQRE.---------------------------------------...DLTGDALVYKS..ED
Q9F498_ERWAM/31-336-H....D.--GQWYMVLGAQDL.---------------------------------------...QLQGKVLLLRS..AD
Q8A6W7_BACTN/150-451-E....AT--KRWIMVLAVGQ..---------------------------------------.......EMQIFSS..PN
SCRB_STAXY/38-338-Q....D.--GVYYAMIAAQNI.---------------------------------------...KKQGRILQYRS..TD
Q45372_PAEPO/17-347-D....ES--SMWIMVLAVRD..---------------------------------------.......RVEFYTS..PN
SCRB_VIBAL/41-341-K....G.--DDYLMVVGAQTK.---------------------------------------...TEHGSMALYQS..KD
INV7_ORYSJ/44-366-G...RD.--GLWRIAVSAEVD.---------------------------------------....GVASTLVYRS..KD
Q5KUA8_GEOKA/34-339-Y....Q.--GHWYMILGAQSE.---------------------------------------...SGDGKAVLFRS..AD
O42801_9EURO/31-371-D....ES--QKWVVVTSIAE..---------------------------------------.....LHKLAIYTS..DN
Q7WWQ7_LACAI/24-321-D......--GKYYCVIAAAIN.---------------------------------------....GHGSLILFES..ED
Q6HN59_BACHK/32-333-H....N.--DIYYMLLGAQRK.---------------------------------------...NKTGTLLLYKS..KD
INV1_ARATH/56-378-G...QD.--KKWRVIIGSKIH.---------------------------------------....RRGLAITYTS..KD
Q84V20_SOLLC/57-375-G...KD.--GHWRIVMGSLRK.---------------------------------------...HSRGLAIMYRS..KD
Q6EVL5_ECOLX/31-336-H....N.--SQWYMVLGAQDK.---------------------------------------...EKRGKVLLYSS..VD
Q9FR47_POASE/86-409-DE..SD.--STYRTVIGSKDDN---------------------------------------Q.GDHAGFAMVYKT..KD
Q9ZR32_DAUCA/105-423-G...LD.--GMWRITIGSKVN.---------------------------------------....NNGLSLVYKT..AN
Q94C08_ORYSA/125-454-SPAGND.--.TRLITIGSKLG.---------------------------------------....KTGISLVYET..TN
Q6F4N3_LOLPR/116-437-EH..SD.--NTWRTIIGSKDDD---------------------------------------...GHAGIVLSYKT..TD
O81083_ALLCE/154-479-EP..SD.--DTWRIVIGSKDS.---------------------------------------...SHSGIAIVYST..KD
Q42722_DAUCA/122-441-T...PE.--GKWRLIIGSKLN.---------------------------------------....KTGISLVYDT..VD
Q8LRN6_SOLLC/7-325-G...QD.--GHWRTLIGSLWG.---------------------------------------....NKGMAILYKS..RD
Q5NEI9_FRATT/30-331-K....IF--NCYYMVIGTYAN.---------------------------------------....NYPSVALYRS..DN
INVA_PHAVU/120-440-T...SE.--GKWRITIGSKLN.---------------------------------------....KTGIALVYDT..DD
6FEH_BETVU/60-382-L...SD.--GKWRVIVGTQQG.---------------------------------------....KRGLAVLFTS..DD
Q8RLU2_PAEPO/14-330-K....PT--EQWVMVLACGQ..---------------------------------------.......TIRIYHS..PN
INVA4_ARATH/125-445-T...SE.--GKWRITIGSKLN.---------------------------------------....KTGISLVYDT..ID

PF04616

O30426_CALSA/54-321-D----N...GKAYIIYGGSEIR......--------------------------------...........VKEL----
Q9K6P5_BACHD/5-295-D----D...GRKWLVNMIWDYR......--------------------------------.KGNHPFAGIILQEY----
Q8P3K7_XANCP/60-332-E----D...SARYLFVNGIRKI......--------------------------------.............RL----
Q8A1K5_BACTN/22-288-Q----E...GNRYLYVDKGEVI......--------------------------------.............RL----
Q93J96_STRCO/52-335-G----....GRLYLAYSGINQY......--------------------------------.....QHNGINIAPM----
Q9A4M8_CAUCR/35-330-D----EDGGGRVWIVNNDGPPG......--------------------------------PPEYPGHRALWIHEY----
Q9A9Z8_CAUCR/61-333-E----A...GERWLFLSGGDRI......--------------------------------.............KL----
Q8A3Q4_BACTN/26-309-G----....GRKYMFWGSFRG.......--------------------------------.........IYGIEL----
Q9KBQ8_BACHD/8-311-K----....GVRYLVWPQKDPS......--------------------------------...IEGNSNLYIAEM----
Q92P74_RHIME/5-303-D----D...GRKWFLNMQWNHRSESFAG--------------------------------SPKSPAFDGILLQEW----
Q8A0C6_BACTN/25-303-N----....GQLYISWKAYGLD......--------------------------------....TRPIELLGCKL----
Q82P90_STRAW/37-336-N----....GVRHLAWAQRNPA......--------------------------------...EDNNTSLFIAKM----
Q8PBE4_XANCP/26-318-D----D...GSAWLVNNDVPAG......--------------------------------TLRYDGHRAIWLQQL----
YAGH_ECOLI/3-303-D----D...GRKYYIYRPWGPR......--------------------------------.HHSNPHNTIVLQAF----
Q97TI6_CLOAB/24-307-N----D...GQAYLYWGN..........--------------------------------.......PNLYYVKL----
Q8A3V2_BACTN/35-295-D----N...GQAYLGRSQLGAG......--------------------------------........PIILHKM----
Q8PE34_XANCP/46-319-E----D...GKRYLFLSGGDYV......--------------------------------.............QL----
Q9A9J1_CAUCR/6-306-D----D...GRKWLVNQLWDHR......--------------------------------.PGRNRFAGIVLQAF----
Q9RI60_STRCO/4-282-E----D...GTCWCAFSGPEGG......--------------------------------.........INMARI----
Q9KXY8_STRCO/30-319-D----D...GTWWLSFGSWWTG......--------------------------------.........IKMIRI----
O52729_9BACI/3-301-V----D...GRKYLLNMLWDHR......--------------------------------.IGRHSFGGIVMQEF----
Q8A6K8_BACTN/42-323-K----E...GNPWLLFCREWLE......--------------------------------....TIDGEIYAQRL----
Q8EPL4_OCEIH/6-297-D----N...GKVYYTANRQPPD......--------------------------------GQEYPKHMEIYLQEL----
Q8CWF7_OCEIH/4-302-E----D...GKKYLVNMVWDSR......--------------------------------.ISTHPFYGIVLQEY----
O52575_SELRU/3-304-P----S...GKKYLVNMYWDQR......--------------------------------.VYHHNFYGIALQEY----
Q8A1Z2_BACTN/337-620-N----....GKKYLFWGSFHG.......--------------------------------.........IYGTEL----
Q9CFH1_LACLA/4-305-K----D...GRKYLVQQTWDHR......--------------------------------.EYKHPFDGITLTEF----
Q8P3G6_XANCP/43-335-T----D...GSAYLLNNGPPEG......--------------------------------TPLYEGHRAIWMQRF----
XYLB_BUTFI/4-291-D----D...GKCYYVGTRPNPD......--------------------------------GVRYNGDWEIWVQEL----
Q8CK14_STRCO/11-285-E----E..TGEAFLVHAWARSR......--------------------------------...SGIKNRLTGHRM----
Q97DM1_CLOAB/2-300-N----D...GKKYLVNMYWDQR......--------------------------------.TYNHNFYGIVLQEY----
Q81ZV8_STRAW/441-719-D----D...GTSYLYWGN..........--------------------------------.......GHGYVVPL----
XYNB_BACPU/3-301-P----S...GKKYVLNMLWDHR......--------------------------------.EKHHSFAGIALQEY----
Q82P89_STRAW/52-348-N----....SKLYLVGSGSING......--------------------------------.....STQSLVIAPM----
Q97IW1_CLOAB/6-309-N----....EKLYYVWAQQDIN......--------------------------------...IKGHSNIYIAEM----
Q8A1I6_BACTN/28-326-P----V.S.GKSYLYWGN..........--------------------------------.......GYMAGAEL----
Q8Z9F3_SALTI/4-306-Q----....GKQWYLWAQKAPD......--------------------------------...IAGNSNIYLAEL----

PF04041

Q9YFA2_AERPE/23-354.R--------GILLAFYR....-----------------------------------------VHDVSGRFHLLAG.ISD
O58834_PYRHO/1-299.N--------GEYIMYFG....-----------------------------------------....DSNIWIAYS..SD
Q9WZN9_THEMA/15-332.K--------DSSFVESK....-----------------------------------------....VILTRLTVG..DA
Q9X0V2_THEMA/4-323.N--------GKYVMLNRPSDN-----------------------------------------GHTPFGDIFLSES..PD
Q9X2G7_THEMA/4-296.N--------GKYVMFHRI...-----------------------------------------....PPDMWLAFS..DD
Q9HH03_PYRFU/31-329FK--------GNYLMYFG....-----------------------------------------....DSNIWMAVS..KD
O67215_AQUAE/17-345.D--------.KLMLYHR....-----------------------------------------LHMLNEKFYLAVCNVPE
Q9UZM0_PYRAB/1-299.S--------GEYVMYFG....-----------------------------------------....DSNVWIAYS..DD

PF02435

SACB_ZYMMO/1-400------P.EDGKTYALFEGNVAMER.........GTVAVGEEEIGPVP..PKTETP.....DGARYCAAAIGIAQALNEA
INVB_ZYMMO/1-398------P.EDGETYALFEANVATVR.........GEDDIGEDEIGPVP..ANTVVP.....KDANLCSASIGIARCLSPD
SACB_STRSL/223-685------...NGSRYLIFESNTGDENYQGE.KQIYKWSNYGGDDAFNLKSFLNIVNNK.HLYNLASWANGSIGILKLDDNE
SACB_BACAM/37-470------...KGHKYLVFEANTGTENGYQGEESLFNKAYYGGGTNFFRKESQKLQQSA..KKRDAELANGALGIIELNNDY
SACB_GLUDI/77-540------PKHPGVNYMVFEGNTAGQR.........GVANCTEADLGFRPNDPNAETLQEVLDSGAYYQKANIGLAIATDST
SACB_STRMU/184-637------..ENGDRYLVFEASTGTENYQGE.DQIYNFTNYGGSSAYNVKSLFRFLDDQ.DMYNRASWANAAIGILKLKGDK
O82854_BACSP/38-487------...KGHKYLVFEANTGTTDGYQGDQSFNNKAYYGGSDVFFQNEKNKLLQSP..KKQIASLANGALGIVELADDY
Q9Z5E5_PAEPO/37-482------...QGHKYIIFEANTGTETGYQGEDSIQNPAYYGGNKKFFTEEQQNLLQSP..KKKGAELANGALGIVELNDDY
SACB_ERWAM/1-407------R.NDGKLYMLFEGNVAGPR.........GSHEITQAEMGNVP..PGYEDV.....GGAKYQAGCVGLAVAKDLS
SACB_RAHAC/1-407------P.HDGKLYMVFEGNVAGER.........GSHVIGKQEMGTLP..PGHRDV.....GNARYQAGCIGMAVAKDLS
SACB_PSESG/1-407------P.NDGKLYMVFEGNVAGER.........GTHTVGAAELGPVP..PGHEET.....GGARFQVGCIGLAVAKDLS

PF03664

XYNC_CELJU/321-555-D--------THCYLYFSRDD-----------------------------------------------GVLYVSKTTLAN
Q9X583_9ACTO/516-788-D--------KNMYLFFAGDN-----------------------------------------------GKIYKASMPIGN
Q9HEY3_COCCA/26-295-A--------INMYLFFAGDN-----------------------------------------------GKIYRSSMPKAN
AXHA_ASPSO/28-298-D--------TDMYLFFAGDN-----------------------------------------------GKIYRASMPIDN
AXHA_ASPNG/28-302-D--------TNMYLFFAGDN-----------------------------------------------GKIYRSSMSIND

PF00251

SCR_ZYMMO/33-343..LKDW.IFVKTLLGDNS--QLP---------LGKRAFMWECPDFFSLGN.R........................S...
SCRB_PEDPE/37-339..LTTW.TCQGELNVPAN--AR.---------....GYMIECPNLVWIDQ.Q.......................P....
INV3_ARATH/43-365..FFNW.TQSMKPLHYED--.L.---------....TGMWECPDFFPVSI.T.....GSDG..........VETSSVGEN
INV4_ARATH/54-372..FKHW.VKAKHPVHSKQ--.S.---------....TGMWECPDFFPVSL.T.....DFRN..........GLDLDYVGP
INV5_ARATH/47-369..FVIW.KQSPKPLHYHD--.G.---------....TGMWECPDFFPVAR.T.....DSRG..........LDTSFSSGP
SCRB_BACSU/33-338..LTEW.RFLGPITGAGF--NGL---------D.DFGYMWECPDLFSLQG.S.......................D....
INV2_ARATH/52-371..FKKW.VKSKRPIHSRK--.K.---------....TGMWECPDFFPVSV.T.....DKKN..........GLDFSYDGP
SCRB_KLEPN/31-336..LREW.RLVGEIAGHDV--NGL---------A.NAGYMWECPDLFPLAD.T........................H...
Q9RGC0_9PSED/280-596..LTEW.EYRGPFYISDH--KNY---------P.YLGKVWELPVLLPLGK.D........................K.KG
SCRB_VIBCL/98-398..LLHW.HFDKLYGDE..--..L---------G.NYGYMWECPDWFELQG.E........................A...
O02490_TRIFO/111-409..LKEW.KYESTFGRGI.--GC.---------...HDGVWECPAV..LKV.D........................G...
Q8DY03_STRA5/37-340..IHHW.EFVGDLDFGGT--GS.---------....EYMIECPNIIFVKG.K........................P...
INV1_SCHPO/87-407..LIHW.TELSVFSTSGY--L..---------....GLQYECPGMARVPV.E.......................GTDEY
Q834P0_ENTFA/38-341RNVHNF.HQLGELTFTNQ--EL.---------....GYMVECPNLVFIDG.Q........................P...
Q6PVN1_TRIMO/132-444..FINY.ELIPGLLHSVP--.G.---------....TGMWECIDFYPVGG.A.........................DGS
SACC_BACSU/39-349..LKQW.TYASEFGQDQ.--GS.---------...HGGVWECPDLFELPV.D.....G.................NPNQK
Q93X59_CICIN/50-368..FVNW.KRYDQPLSSAI--.A.---------....TGTWECPDFYPVPL.N.....STNG...........LDTSVYGG
Q65DN5_BACLD/32-337..LKDW.QFLGDITGSNT--DQL---------G.EFGYMWECPDMFELDG.K........................D...
Q42691_CHERU/44-365..FVHW.VKAKHPLYSYE--.R.---------....SGMWECPDFFPVYK.N.....GNTM..........GIDTSVIGP
Q43855_VICFA/51-371..FLKW.IRAKHPIHSAK--.R.---------....TGMWECPDFYPVSL.E.....GKNG..........LDLSMMMGN
INV4_ORYSJ/64-381..FMQW.TRVDHPLYSSN--.A.---------....SNMWECPDFFAVLP.G.....KNNG..........LDLSAAIPN
INV3_DAUCA/58-376..FKKW.KRSPHPIHTKA--.E.---------....TGMWECPDFYPVSP.R.....SEDG...........LDNSKMGR
Q7WWP6_LACAI/37-338..LKNW.EELGYLDFTDQ--DM.---------....GYMIECPNLVEVDG.H........................V...
Q82YR4_ENTFA/37-340..VEKW.SEVGNLDFCSS--GS.---------....EYMIECPNLLFVND.T........................P...
O94224_CYBJA/34-356..LKDW.SLASNFSTKGY--V..---------....GYQYECPGLFEATI.......ENP.............KSGDPEK
Q65EI7_BACLD/46-355..LKEW.RYTGSFQTEN.--...---------....IGIIECPDLYKMRA.D........................DGTY
Q43856_VICFA/53-374..FVKW.KKSKHPLHSAK--.G.---------....TGMWECPDFFPVLK.N.....GIKG...........VDTSLNDD
INU1_KLUMA/43-375..LKNW.TLESNFTHHGW--T..---------....GTQYECPGLVKVPY.......DSVVDS.......SNSSDSKPDS
RAFD_ECOLX/28-329..LRDW.HLEHVLAHSAA--GE.---------....SYMWECPDFFRCGN.F........................H...
INV6_ORYSJ/42-371..FLRW.ERNAAPLHAS.--RD.---------....AVMAECPDLFPVAE.H.....GEDGLD......LDASAIGGAGA
1FEH_HORVU/68-385..FLNW.TKVDHPPYSHN--.G.---------....SNMWECPDFFAALP.G.....NNGG..........LDLSAAIPQ
Q9RBJ1_GLUDI/47-372..LLHW.SFLSDFQPSGY--RK.---------...PGMLWEMPTLVPLKL.D.....G.................NPRAT
O00056_PENPU/33-356..AKSW.TWMSDLLASQI--EGF---------P.SSVTGWEVPDMFQLPI.Q........................G.TN
SCRB_STRMU/37-340..IKNW.QEVGNLDFGGS--KS.---------....EYMIECPNLVFINE.Q........................P...
Q9FNS9_CICIN/46-362..GTKW.IRSKKPLHFSS--.K.---------....TGMWECPDFYPVTN.G.....DKKG...........LDTSVQGN
Q9ZHJ7_CLOBE/31-333..SVKW.NLLGELKTD..--..M---------K.DFGYMWECPNIIRISKGK........................H...
Q62DJ1_BURMA/55-380..LIRW.DFLSDFTLPDV--PH.---------...RGALWEMPELLPMPL.D.....G.................DAARM
Q888X9_PSESM/32-333..LHAW.ELVSYVSSGNE--GD.---------....GYMWECPDLFRLDG.R........................D...
INV6_ARATH/21-341..FVQW.TKYPVPLLESE--.G.---------....TGMWECPDFFPVSI.T.....GKEG...........VDTSVNNA
Q6F0T9_MESFL/38-341..MEKY.TFDRILKPSLD--QT.---------...YGYMWECPNLDYLEG.K........................M...
Q8GT63_TRIMO/48-366..FLRW.ERNADPLYLAH--.A.---------....AGMVECPDLFPVSE.P.....GVE............VGLPASGA
INV2_DAUCA/65-383..FLKW.TKAKHPLHSKD--.R.---------....TGMWECLDFYPVAP.K.....GMNG...........LDTSVTGQ
Q65U44_MANSM/56-359..LDDEPRLLGELSLPAF--DNQ---------...KVFMWECPDLLKVGD.N........................D...
Q944U7_CARPA/59-376..FMNW.VKAKHPIHSRP--.D.---------....TGMWECPDFFPVPK.S.....GENG...........LDVGITGR
Q84V21_SOLLC/57-376..FMKW.IKAQHPLHSST--.N.---------....TGNWECPDFFPVLF.N.....STNG...........LDVSYRGK
P94466_GEOSE/34-339..LRDW.EHLGPITGGNS--RQL---------G.KFGYMWECPDLFELDG.Q........................E...
Q45155_BACFG/137-443..LKEW.TYMSGWGEGY.--GV.---------...QPSQFECPDMVELPV.D.....G.................NPDHK
O81118_WHEAT/47-373..FRRW.IKAHHSLHAGL--...---------....TGMWECPDFYPVAV.A...G.GRRHHR.......SGVDTRELHD
Q9L8G4_CLOAT/31-337..LQNW.SIVHEILGSNL--SKF---------D.FLGYMWECPNLFTLDN.K........................D...
INV1_MAIZE/129-459..FVRY.DPAPALMHAVP--.G.---------....TGMWECVDFYPVAA.GSGAAAGSGDG.........LETSAAPGP
GFT_ALLCE/75-405..FKKF.DLLPTVLHSVD--.K.---------....VGMWECVEVYPVAT.TGPLLHKAIDN........FDVDRVLDRS
Q8LK75_LAGSI/143-463..FIKY.ELVDRFLHAVP--.G.---------....TGMWECVDFYPVSV.H.....GSKG...........LDTSVNGH
O82119_SOLLC/56-375..FMKW.TKAKHPLHSAQ--.G.---------....TGNWECPDFFPVSL.K.....NENG...........LDTSYDGK
Q8L6W2_BETVU/147-465..FKNY.ELLSNILHAVQ--.G.---------....TGMWECVDFYPVSV.A.....EPNG...........LDTSTNDQ
Q8XQE3_RALSO/19-318..LRQW.QLLGELIAPAL--PC.---------.....YMYECPDLFTLDR.R........................T...
Q41604_TULGE/99-420..FVSY.ELLPILLHAVE--.G.---------....TGMWECVDFYPVLT.......NSTVG.........LDTSVPPGP
Q64ML3_BACFR/121-408..LKNW.EYKSHV.....--...---------....TGFWECPELFELPV.D.....G.................DKNHT
Q8DNP0_STRR6/31-336..LVEW.QFESIF....L--KGV---------E.HQGFMWECPDYFELDG.K........................D...
Q8W3M2_CITUN/123-441..FINY.ELLRGVLHGVP--.N.---------....TGMWECVDFYPVST.T.....GEHG...........LDTSHNGL
Q8XK71_CLOPE/29-331..LDNW.KFYGELKTS..--..Y---------E.DFGFMWECPSFFKIDN.K........................D...
Q9ZP42_FRAAN/53-372..FMHW.TKAKHPLYSTP--.K.---------....NGMWECPDFFPVSK.T.....KLLG...........LDTSAIGP
Q5WDB1_BACSK/36-338..LEEW.TYRGVLAQNDG--GN.---------...EGYMWECPDFFKLGD.K........................Y...
O65778_CYNSC/94-412..FTNY.VMLDEPLHSVP--.N.---------....TDMWECVDLYPVST.T.....NDSA...........LDVAAYGP
Q8DNS7_STRR6/37-340..YTNW.QAVGDLDFAND--RT.---------....AYMMECPNLVFVEE.H........................P...
Q6AW26_LOLPR/94-412..FLSF.ERVPGIVHRVE--.G.---------....TGMWECIDFYPVGG.G.......................HNSSS
Q5WBG3_BACSK/35-336..LLEW.RFVGEMGTN..--..L---------N.DFGYMWECPDYFELDG.Q........................G...
Q8CRR2_STAES/37-337..VVDW.HFEGEIKTN..--..L---------T.QFGYMWECPDYFRLGN.K........................D...
Q752P4_ASHGO/54-389..LREW.TLESEFKNHGL--L..---------....GFQYECPGLAKIPV.......SKPANCEMQLKDVSYPVKNNTDY
Q8DWH3_STRMU/37-353..GKNW.AYQGATVLNQY--TLG---------G.KDLGLVECPNLKTFYD.S........................A.TN
Q5LY63_STRT1/37-340..VENW.VEVGDLDFGGT--GS.---------....EYMIECPNIVFVDG.K........................P...
SCRB_LACLL/37-342..LTDW.KDLGNLDFSKE--KM.---------....GYMIECPNLIFING.R........................S...
Q84F22_9BIFI/57-368..MVHW.SFDRVLFEHPD--PN.---------...V.FMLECPDFFPIRD.A........................RGNE
Q6G7R6_STAAS/38-338..IINW.HYLGEINTE..--..L---------D.DFGYMWECPDYFNVDN.Q........................D...
Q5XA96_STRP6/37-340..VDNW.RFIADLDFDDS--GT.---------....EYMIECPNLVFVDD.K........................P...
Q9KBR7_BACHD/33-338..LKEW.QFAGIVTGSNV--RSM---------G.DFGYMWECPDLFHLDG.E........................D...
LEVB_BACSU/48-356..LKDW.HYTSGFFPEQ.--...---------....AGMVECPDLYMMRA.S........................DGTN
Q5ZQK6_9ASTR/50-366..FVKW.ERFDYPLMSMM--.E.---------....TSTWECPDFFPVSV.S.....STNG..........LDTSGVINP
INV1_DAUCA/64-384..FIKW.TKAKHPIHSQA--.N.---------....TGMWECPDFFPVSL.K.....GLNG...........LDTSVTGE
O04372_ASPOF/122-447..FLNY.TLLPGTLHTVK--.H.---------....VGMWECIDFYPIAT.SG..A.GANRG.........LDPSVRPSK
O65341_SACRO/23-357..FVHF.ELLPDLLHRVA--.G.---------....TGMWECIDFYPVAT.RG..K.VSGNGVDM..SDALGKNGAVVG.
Q5WDB0_BACSK/20-318..LIDW.AFASQFGAEE.--GL.---------...HAAVWECPDLFRLPV.D.....G.................DEDNQ
Q6KCH6_HORVU/127-454..FMDY.ELVPGLLHRVP--.G.---------....TGMWECIDLYPVGG.......VRGIDMT....DAVTAASNNGGD
SCRB_SALTM/31-336..LHQW.TSMGEIAGHGI--NGL---------D.DVGYMWECPDLFPLGD.Q........................H...
O86076_ECOLX/29-330..LREW.TFDRVLAHADA--GE.---------....SYMWECPDFFSLGD.Q........................H...
INV1_ORYSJ/53-369..FKTW.VRAKHPLHSAL--...---------....TGMWECPDFFPLQA.P.....GLQA...........GLDTS.VP
Q8W431_WHEAT/84-403..FLNY.ELIPGILHRVE--.R.---------....TGEWECIDFYPVGR.R.....T.................SDNSS
Q6DA94_ERWCT/31-336..LLAW.EKIAEIAGSRL--GGL---------G.DFGYMWECPDLFPLDG.E........................D...
INVB_DAUCA/135-453..FITY.ELLDNLLHAVP--.G.---------....TGMWECVDFYPVSV.T.....GSNG...........LDTSVNGP
Q97I80_CLOAB/49-358..LKNW.QHTGDFFTNN.--...---------....IGIVECPDIFMMQS.N........................DGNY
Q84XV1_MUSAC/62-379..FVHW.VKAKHPLHTVK--.D.---------....TGMWECPDFYPVAV.K.....GRRG...........LDTSAYGD
Q94C07_ORYSA/140-471..FSHF.RPVPVIMHRVP--.G.---------....TGMWECVDFYPVST..V.ADVATDEGS.......DSTEYSVPGI
INV3_ORYSJ/51-377..FKKW.VKAHHPLHSAH--...---------....TGMWECPDFFPVAV.AG.GSRHYRRGVD.....TAELHDAAVAE
Q65D73_BACLD/27-331..FVDW.EYVGVLAQSDG--NL.---------....GFMWECPDFFELDG.K........................H...
Q9S943_VITVI/137-455..FKKY.ELIEGVLHAVP--.G.---------....TGMWECVDLYPVSL.K.....EDNG...........LDTSFNGP
Q74HI7_LACJO/37-340..LKNW.HENGYLDLGKD--EM.---------....GYMIECPNLVFINN.Y........................P...
Q70LF5_HORVU/96-419..FVSY.ELMPGYMYRGP--KG.---------....TGEYECIDLYAVGG.G.....SRAS...........DMYNSTAE
O23786_CYNSC/107-426..FTHF.ELKEEVLHAVP--.H.---------....TGMWECVDLYPVST.T.....HTNG...........LDMVDNGP
O81082_ALLCE/87-413..FETY.TLLPDILHKTK--DS.---------....VGMLECVDLYPVAT.TG..N.QIGNG.........LEMKGGSGK
O74641_ASPNG/33-356..TINW.TWQSDLKSTSI--NGL---------S.SDITGWEVPDMFELPV.E........................G.TE
Q9ZR55_CICIN/25-343..FVNW.TKSDSPLHKVS--.G.---------....TGMWECVDFFPVWV.D.....STNG...........VDTSIINP
O81189_MAIZE/58-383..FRRW.RRVRRPLHSAP--...---------....TGMWECPDFYPVSK.G.....GAPRA........GLETSVPPGP
Q6F0V0_MESFL/34-333..GSNW.ENFKDIKFDEA--DEQ---------...NAYMLECPNYFKLDG.R........................E...
BFRA_THEMA/7-294..LFHW.KYEGVIFEDET--...---------....TKEIECPDLVRIGE.K........................D...
INV2_YEAST/32-353..LKSW.KLESAFANEGF--L..---------....GYQYECPGLIEVPT.......E................QDPSKS
Q8GM36_BACME/30-333..LQKW.EYVGVLAKSDG--DL.---------....GYMWECPDFFELDG.K........................H...
Q9S944_VITVI/115-433..FTDF.ELFDGELHGVP--.G.---------....TGMWECVDFYPVSI.N.....GVYG...........LDTSAHGP
Q9LAL1_9PSED/15-331..LKQW.KFASEFGANE.--GS.---------...HTGVWECPDLFELPV.D.....G.................DRNRK
INV1_HANAN/32-354..LKKW.DLKSNFTSNGY--L..---------....GFQYECPGLFKLPI.......ENP.............LNDTVTS
Q9CJZ0_PASMU/57-355..LDATPQLIGEFKLPDF--DNQ---------...QVFMWECPDLLKLQE.Q........................D...
Q8GI55_GEOSE/14-329..LIDW.QFESEFGENI.--GC.---------...HDGVWECPDLFELPV.E.......................NSEEK
Q7XA49_SOYBN/45-362..FVNW.VQAKHPLYSIL--.G.---------....SGMWECPDFFPVLN.N.....DQLG...........VDTSVNGY
INVA_SOLLC/108-427..FTSF.KLLDGVLHAVP--.G.---------....TGMWECVDFYPVST.K.....KTNG...........LDTSYNGP
Q5WI15_BACSK/12-315..LISW.SCQGSFLEQEH--SF.---------....GYMWECPDVLQFPE.H........................D...
Q9F498_ERWAM/31-336..LHHW.TLLGEIAGSQL--NGL---------G.DFGYMWECPDLFELDG.S........................H...
Q8A6W7_BACTN/150-451..LKDW.AFESSFGEGY.--GA.---------...HGNVWECPDLFELPV.E.......................GTNEK
SCRB_STAXY/38-338..IVNW.EFQGEVQTN..--..L---------D.DFGYMWECPDYFNLNG.Y........................D...
Q45372_PAEPO/17-347..LKEW.SFASEFGSDIP--HI.---------...HRGIFECPDIFRIQV.D.....E.................DLNTT
SCRB_VIBAL/41-341..LKTW.QHKGPIKTK..--..F---------S.DLGYMWECPDFFEING.Q........................S...
INV7_ORYSJ/44-366..FVRW.ERNAAPLHAS.--RA.---------....AGMVECPDLFPVAE.R.....GEDG...........LDTSANGA
Q5KUA8_GEOKA/34-339..LCHW.EHLGPIAGGNM--NGL---------G.PFGYMWECPDLFPLDG.Q........................D...
O42801_9EURO/31-371..LKDW.KLVSEFGPY..--NA.---------...QGGVWECPGLFKLPL.D.......................GGSST
Q7WWQ7_LACAI/24-321..LLHW.SFKSILLQGEK--Y..---------....GLMTECPDYFNIDG.K........................D...
Q6HN59_BACHK/32-333..LYNW.NFQGEITTN..--..L---------K.EFGFMWECPDYFQLSG.K........................D...
INV1_ARATH/56-378..FLKW.EKSPEPLHYDD--.G.---------....SGMWECPDFFPVTR.F.....GSNG...........VETSSFGE
Q84V20_SOLLC/57-375..FMKW.VKAKHPLHSTN--.G.---------....TGNWECPDFYPVSS.K.....GTD............GLDQY.GE
Q6EVL5_ECOLX/31-336..LYTW.SFHGEIAGNGL--NEI---------D.NAGYMWECPDFFALDG.E........................Y...
Q9FR47_POASE/86-409..FLSF.QRIPGILHRVE--.H.---------....TGMWECMDFYPVGG.G.......................DNSSS
Q9ZR32_DAUCA/105-423..FTEF.ELLDELLHEVP--.G.---------....SGMWECIDFYPVSL.A.....STDG...........LDTSANGA
Q94C08_ORYSA/125-454..FTTF.KLLYGVLHAVP--.G.---------....TGMWECVDLYPVST.KSVIVITQEN..........GLDTSVHGL
Q6F4N3_LOLPR/116-437..FVNY.ELMPGNMHRGP--DG.---------....TGMYECLDIFPVGG.N.....SSE............MLGGDSSP
O81083_ALLCE/154-479..FINY.KLIPGILHAVE--.R.---------....VGMWECVDFYPVAT.AD..SSHANHG.........LDPSARPSP
Q42722_DAUCA/122-441..FKNF.TLLDGVLHAVH--.G.---------....TGMWECVDFYPVSK.F.....GENG...........LDTSFDGV
Q8LRN6_SOLLC/7-325..LMKW.TKVQQPLHSVD--.G.---------....TGNWECPDFFPVLL.R.....GTNG...........LDASYKGE
Q5NEI9_FRATT/30-331..AESW.NYHSILFQEKT--IS.---------....GRTLECLDLFYLDG.K........................Y...
INVA_PHAVU/120-440..FKTY.ELKNGHLRAVP--.G.---------....TGMWECVDFFPVSK.K.....NENGL.........DTSLSINGA
6FEH_BETVU/60-382..FVKW.NNTGNPLHSTE--.G.---------....NGIWECPDFFPVYV.G.....KSLG...........ADTSIIGD
Q8RLU2_PAEPO/14-330..LKEW.TFASEFGHGI.--GS.---------...HDAVWECPDLFPLYI.D.....E.................KREQV
INVA4_ARATH/125-445..FKTY.EKLDTLLHRVP--.N.---------....TGMWECVDFYPVSK.T.....AGNG...........LDTSVNGP

PF04616

O30426_CALSA/54-321--MPDLKAINLKGLNKVI--IKS...........KIDGLEEGSHAYKING------------------------------
Q9K6P5_BACHD/5-295--SEAEQKLVGPV.KNIY--KGT............DIQLTEGPHLYKKDG------------------------------
Q8P3K7_XANCP/60-332--RADGLATDGPL.EPAY--APW....RYPDDWVVENFAPEGPKLNWHNG------------------------------
Q8A1K5_BACTN/22-288--TDDGLATIGQK.QKVY--EGW....RYPNHWETECMCLESPKLNYHNG------------------------------
Q93J96_STRCO/52-335--SNPYTVSGNAVAIDAA--GGC.............PEVREGPEFLYRGG------------------------------
Q9A4M8_CAUCR/35-330--DPKTQTTVGPATLLLD--KGV........DPATKPIWPEGPHILKKDG------------------------------
Q9A9Z8_CAUCR/61-333--APDGLSTVGKP.EHVY--DPW....RYPDDWDVEGFSPEGPKLMRRGE------------------------------
Q8A3Q4_BACTN/26-309--TADGLKVKSGADKKQI--AGT...............AYEGTYIHKKNG------------------------------
Q9KBQ8_BACHD/8-311--ENPWTIKGEQV.MLSK--PEF.......DWEVIGYKVNEGPAVIKRNG------------------------------
Q92P74_RHIME/5-303--DERTRKLVGPV.KNIF--AGS............PLGLVEGPHLFKRDG------------------------------
Q8A0C6_BACTN/25-303--SADGLHLDGEPFTLLV--DEK.............GIGMEGQYHFKEGD------------------------------
Q82P90_STRAW/37-336--ANPWTISGTPT.EISQ--PTL.......SWETVGYKVNEGPAVIQHGG------------------------------
Q8PBE4_XANCP/26-318--DLARMKLVGPRQVIVD--SGF........QPASNPEHIEGPHLFRRDG------------------------------
YAGH_ECOLI/3-303--DPQTGTLSPER.KTLF--TGT............PLCYTEGAHLYRHAG------------------------------
Q97TI6_CLOAB/24-307--NQDMISYSGKIVQVPL--TTA.GFGVRKGNSSRPTLYEEGPWFYKRNG------------------------------
Q8A3V2_BACTN/35-295--SADGRTLEDDG.HVIY--TGP...............VAEGTKFHKRDG------------------------------
Q8PE34_XANCP/46-319--SDDGLKVVGTP.KHVY--DGW....KYPESWDVEGYAQEGPKITRHNG------------------------------
Q9A9J1_CAUCR/6-306--SVAEQRLVGER.KVIF--EGT............AIGLTEAPHLYKRDG------------------------------
Q9RI60_STRCO/4-282--DPVEGTVLEQP.FVTW--SGS............GLKYPEAPHLYRIGD------------------------------
Q9KXY8_STRCO/30-319--DPATGKQLASDTARRS--LAS.........RPTGTKAVEAPYVVKRNG------------------------------
O52729_9BACI/3-301--SVREKRLIHQP.KIIF--EGT............DIKLTEAPHLYHIGD------------------------------
Q8A6K8_BACTN/42-323--AKDLKTTEGDPYLLFK--ASEAPWVGSITSSGVTGNVTDAPFIYRLDD------------------------------
Q8EPL4_OCEIH/6-297--DLESKQLIGDK.YSLW--DGA..........LKNAHAQEAPHLYKVNG------------------------------
Q8CWF7_OCEIH/4-302--DSVKGKLVGKK.EIIF--KGT............DVKLTEAPHLYKIND------------------------------
O52575_SELRU/3-304--SVAEEKLIGKP.EIIY--KGT............DIAYTEGPHLYYIND------------------------------
Q8A1Z2_BACTN/337-620--TDDGLSLKKGAPIEQI--AGT...............AYEGTYIHKRDG------------------------------
Q9CFH1_LACLA/4-305--DMTTMKLQPKKAKTIY--NGT............NVKLVEGPHLYQIND------------------------------
Q8P3G6_XANCP/43-335--DLATHQPVGLRKVLLN--GGV........DLASKPIWIEGPHLYQRDG------------------------------
XYLB_BUTFI/4-291--DLEQMKLVGPS.MAIW--KGA..........LKDVIWPEGPHLYKKDG------------------------------
Q8CK14_STRCO/11-285--RPDGTGVLDEG.KVIV--DAD.........RLPGWFTLEGPKLYRHDG------------------------------
Q97DM1_CLOAB/2-300--SDKEKKLIGKA.KIIY--KGT............DIKYTEGPHIYHIGD------------------------------
Q81ZV8_STRAW/441-719--NDDMVSYDATKVKDIT--QPD...............FREGSFVVERQG------------------------------
XYNB_BACPU/3-301--SVSEKKLVGER.KVIF--KGT............PIKLTEAPHLYYIND------------------------------
Q82P89_STRAW/52-348--SNPYTLSSSSFTVISS--PTL.......SWETSGAPVNEGPEPLYHDG------------------------------
Q97IW1_CLOAB/6-309--ENPWTLKTKPV.MLTK--PEL.......EWEIKGFWVNEGPAVLKKNG------------------------------
Q8A1I6_BACTN/28-326--NDDMLSIKEETTVVLT--PKG........GTLQTYAYREAPYVIYRKG------------------------------
Q8Z9F3_SALTI/4-306--ENPWTLKGEPV.RLSK--PEY.......DWECRGFWVNEGPAVVVHGD------------------------------

PF04041

Q9YFA2_AERPE/23-354--GLP.EGPISP....LAPKSVW-------------RIMDPAPFEEKIG-------------------------------
O58834_PYRHO/1-299--GIHWEYYNSP....VM..KPR-------------KGKFDS...LLVE-------------------------------
Q9WZN9_THEMA/15-332--KVCWRGRLEGSYIDLY..SLD-------------PVFFPEEWETKVG-------------------------------
Q9X0V2_THEMA/4-323--MIHWGNHRFV....LG..RSS-------------YNWWEN...LKIG-------------------------------
Q9X2G7_THEMA/4-296--LVHWDNFVK.....IA..SPR-------------PGMWDD...LKIG-------------------------------
Q9HH03_PYRFU/31-329--LVNWEYMKEP....VL..SPR-------------EGYFDN...VLVE-------------------------------
O67215_AQUAE/17-345--EVLYTNEFKE..IEIG..ENI-------------TIMEEAPFETKIG-------------------------------
Q9UZM0_PYRAB/1-299--GLNWEYEREP....VM..KPR-------------KGKFDS...LLVE-------------------------------

PF02435

SACB_ZYMMO/1-400R..TEW-KLLPPLVTAFG-----------------VNDQTERPHVVFQNG------------------------------
INVB_ZYMMO/1-398R..TEW-ELLPPLLTAFG-----------------VNDQMERPHVIFQNG------------------------------
SACB_STRSL/223-685KNPSVA-ELYTPLVTSHM-----------------VTDEVERPSVVKMGG------------------------------
SACB_BACAM/37-470...TLK-KVMKPLITSNT-----------------VTDEIERANVFKMNG------------------------------
SACB_GLUDI/77-540L..SKW-KFLSPLISANC-----------------VNDQTERPQVYLHNG------------------------------
SACB_STRMU/184-637KTPEVD-QFYTPLLSSTM-----------------VSDELERPNVVKLGD------------------------------
O82854_BACSP/38-487...TVK-SVMKPLVASNT-----------------VADEVERANIFKMNN------------------------------
Q9Z5E5_PAEPO/37-482...TLK-NVMPPLIASNL-----------------VTDEIERANVFKMNG------------------------------
SACB_ERWAM/1-407G..SEW-QILPPLITAVG-----------------VNDQTERPHFVFQDG------------------------------
SACB_RAHAC/1-407G..DEW-EILPPLVTAVG-----------------VNDQTERPHFVFQDG------------------------------
SACB_PSESG/1-407G..DEW-EILPPLVTAVG-----------------VNDQTERPHYVFQDG------------------------------

PF03664

XYNC_CELJU/321-555--FPNFSG..YSIVMEDHRGNGN-------------SYLFEAANVYKLDG..----------------------------
Q9X583_9ACTO/516-788--FPGSFGSSYTTVMSDTTKN..-------------..LFEAPQVYKV..Q.----------------------------
Q9HEY3_COCCA/26-295--FPGSFGTASTVIMSDSTNN..-------------..LFEAVQVYTVKG..----------------------------
AXHA_ASPSO/28-298--FPGDFGTQSEIILSDTKEN..-------------..LFEAVQVYTVDG..----------------------------
AXHA_ASPNG/28-302--FPGSFGSQYEEILSGATND..-------------..LFEAVQVYTVDGGE----------------------------

PF00251

SCR_ZYMMO/33-343.......--..VLMF----SP.QGLK--------ASG...YKNRNLFQNGY.ILGK.W...Q-A------PQFTPE....
SCRB_PEDPE/37-339.......--..VLLF----CP.QGLS--------QAT...IPYQNIYPNMY.LVADQLNL.A-Q------AQFTEP....
INV3_ARATH/43-365G.....I--KHVLKV----SL.....--------.........IETLHDYY.TIGS.YDR.E-K------DVYVPDLGF.
INV4_ARATH/54-372N.....T--KHVLKV----SL.....--------.........DITRYEYY.TLGK.YDL.K-K------DRYIPDGNT.
INV5_ARATH/47-369M.....V--KHVLKV----SL.....--------.........TDTFNDYY.TIGT.YDE.V-R------DVYVPDKGF.
SCRB_BACSU/33-338.......--..VLIV----SP.QGLE--------ADG...FRYQNVYQSGY.FVGR.LDY.N-K------PEL.KH....
INV2_ARATH/52-371N.....A--KHVLKV----SL.....--------.........DLTRYEYY.TLGT.YDT.K-K------DRYRPDGYT.
SCRB_KLEPN/31-336.......--..LLIC----CP.QGLA--------REA...QRFLNTYPAVW.MAGR.FDA.E-R------GIF.DH....
Q9RGC0_9PSED/280-596H.....D--KHVFLI----SP.VGAG--------..........ADVEVFY.WIGT.FDK.E-Q------FRFIPD....
SCRB_VIBCL/98-398.......--..FFVF----GP.QGIA--------SAN...PHHTIEHQNRI.FRAT.QNA.Q-G------EIALLQ....
O02490_TRIFO/111-409K.....W--VILLNI----NP.GGPF--------..........GGSATQY.FVGE.F...D-G------HQFICES...
Q8DY03_STRA5/37-340.......--..VLLY----SP.QGLD--------KNE...LDYQNIYPNTY.KIGQYFDA.N-S------SKIVEP....
INV1_SCHPO/87-407K.....W--VLFISI----NP.GAPL--------..........GGSVVQY.FVGD.W...N-G------TNFVPD....
Q834P0_ENTFA/38-341.......--..VLLF----CP.QGLS--------PSV...KSYQNIYPNMY.TLAETFDL.E-N------LSLVQA....
Q6PVN1_TRIMO/132-444E.....E--LYVMKE----SS.....--------.........DDDRHDWY.ALGR.YDA.A-A------NKY.TPIDA.
SACC_BACSU/39-349K.....W--VMQVSV----GN.GAVS--------..........GGSGMQY.FVGD.F...D-G------THFKNEN...
Q93X59_CICIN/50-368S.....V--RHVMKA----GF.....--------.........E..GHDWY.TIGT.YSP.D-R------ENF.LPQNG.
Q65DN5_BACLD/32-337.......--..VLIV----CP.QGLE--------AEE...MLYQNVYQSGY.FVGE.LNE.L-K------PWF.TH....
Q42691_CHERU/44-365N.....I--KHVLKV----SL.....--------.........DVSKHDVY.TIGG.YDT.K-K------DAY.TPDVG.
Q43855_VICFA/51-371N.....V--KHVLKN----SL.....--------.........DITRYEYY.TIGT.YLQ.N-Q------DKY.IPDKT.
INV4_ORYSJ/64-381G.....A--KHVLKM----SL.....--------.........DSC..DKY.MIGV.YDL.K-H------DMF.VPDTV.
INV3_DAUCA/58-376G.....I--KHVLKV----SL.....--------.........NSTRYEYY.TIGR.YNR.V-R------DFY.VPDNT.
Q7WWP6_LACAI/37-338.......--..VLIF----CP.QGLD--------KKV...ADYDDIYPNMY.VIADGIDF.E-N------HKLINP....
Q82YR4_ENTFA/37-340.......--..ILIY----CP.QGLD--------KSE...LSYDNIYPNTY.KICQSFDE.R-T------AKLVGS....
O94224_CYBJA/34-356K.....W--VMVLAI----NP.GSPL--------..........GGSINEY.FVGD.F...N-G------TEFIPD....
Q65EI7_BACLD/46-355K.....W--VLGASA----NG.KGTG--------..........KPNTYAY.WTGS.F...N-G------NEFTAD....
Q43856_VICFA/53-374Y.....V--RHVLKV----SL.....--------.........DDKKHDYY.LIGS.YDE.E-K------DRF.VPDRG.
INU1_KLUMA/43-375A.....W--VLFVSI----NP.GGPL--------..........GGSVTQY.FVGD.F...N-G------THFTPI....
RAFD_ECOLX/28-329.......--..WLMF----SP.QGMN--------PSG...YRFRNLFQSGV.LAGN.WKPGS-V------FALKGV....
INV6_ORYSJ/42-371G.....V--RHVLKV----SM.....--------.........PDTLEDYY.MVGR.YDD.A-D------DTFTVPPEDL
1FEH_HORVU/68-385G.....A--KHALKM----SV.....--------.........DSV..DKY.MIGV.YDL.Q-R------DAF.VPDNV.
Q9RBJ1_GLUDI/47-372R.....W--VMIVSV----NP.WSIA--------..........GGSGVQY.FVGR.F...D-G------VTFTPDALPP
O00056_PENPU/33-356E.....T--TWVIIF----TPAQGSP--------..........AGGNGVVALTGS.F...D-G------ETFLANPV..
SCRB_STRMU/37-340.......--..VLIY----SP.QGLS--------KSE...LDYHNIYPNTY.KVCQSFDT.E-K------PALVDA....
Q9FNS9_CICIN/46-362N.....T--LHVLKV----SF.....--------.........NSR..EYY.VIGT.YDP.I-K------DKFSVVTND.
Q9ZHJ7_CLOBE/31-333.......--..AFIF----SP.QGLE--------KEE...LKNQNLYQSGY.VIGE.LDI.E-S------VELKNH....
Q62DJ1_BURMA/55-380K.....W--VMIVNV----NP.WSIA--------..........GGSGAMY.FIGE.F...D-G------RTFTPDRAAP
Q888X9_PSESM/32-333.......--..VLLY----SP.QGMP--------AQG...YERLNKFHTGY.RVGQ.ID..S-Q------WQFSGG....
INV6_ARATH/21-341S.....V--RHVLKA----SF.....--------.........GGN..DCY.VIGK.YSS.E-T------EDF.SADYE.
Q6F0T9_MESFL/38-341.......--..LFMQ----SS.EGWF--------NEEN.PYELNSSRNVVYTQIDK.LDF.E-N------NKLNEK....
Q8GT63_TRIMO/48-366G.....A--RHVLKM----SV.....--------.........MDTVQDYY.VVGR.YDD.A-A------DTFV..PED.
INV2_DAUCA/65-383D.....I--KHVLKV----SL.....--------.........YSTRYEYY.TVGE.YDR.D-N------DIY.VPDNT.
Q65U44_MANSM/56-359.......--..IFIW----SP.QGKR--------REA...RRFQNNFHAVY.AVGK.L...D-D------RTFNAA....
Q944U7_CARPA/59-376D.....V--RHVLKV----SL.....--------.........DLTRYEYY.TIGR.YYP.E-I------DRY.IPYDT.
Q84V21_SOLLC/57-376N.....V--KYVLKN----SL.....--------.........DVARFDYY.TIGM.YHT.K-I------DRY.IPNNN.
P94466_GEOSE/34-339.......--..VLIV----CP.QGLE--------AEA...MRYQNVHQSGY.FVGR.LDY.E-P------AQF.LH....
Q45155_BACFG/137-443K.....W--ALIVNV----NP.GCYF--------..........GGSATQY.FIGD.F...D-G------EKFVCDN...
O81118_WHEAT/47-373STVAAEV--KYVLKV----SL.....--------.........DVTRYEYY.TIGW.YDH.A-K------DRY.TPDLD.
Q9L8G4_CLOAT/31-337.......--..VLLF----CP.QGVD--------KQG...DLYNNIYQCGY.VLGS.LNY.E-T------GEF.SC....
INV1_MAIZE/129-459G.....V--KHVLKA----SL.....--------.........DDDKHDYY.AIGT.YDP.A-T------DTW.TPDSA.
GFT_ALLCE/75-405T.....V--KHVLKA----SM.....--------.........NDEWHDYY.AIGT.FDP.I-G------NKW.TPDDE.
Q8LK75_LAGSI/143-463G.....V--KHVLKA----SL.....--------.........DDTKMDHY.AIGT.YFS.N-N------DTW.VPDNP.
O82119_SOLLC/56-375D.....V--KHVLKV----SF.....--------.........DVTRFDHY.TVGT.YDT.K-K------DKY.FPDNT.
Q8L6W2_BETVU/147-465S.....V--KHVLKA----SM.....--------.........DDDRNDYY.TLGT.YIE.D-N------VTW.VPDNP.
Q8XQE3_RALSO/19-318.......--..VLVC----CQ.QTME--------TGA...GGNRRSDVAGY.MLGQ.IDL.E-R------AQF.PH....
Q41604_TULGE/99-420G.....V--RHVLKA----SL.....--------.........DDDKHDYY.AIGT.YDV.V-S------GTW.IPDDV.
Q64ML3_BACFR/121-408K.....W--VM....----.......--------..........YGASGTY.MLGS.F...D-G------QTFTPE....
Q8DNP0_STRR6/31-336.......--..CLIM----SP.MRYQ--------REG...DSYHNINSSLL.FTGK.VDW.G-E------KCF.IP....
Q8W3M2_CITUN/123-441G.....V--KHVVKA----SM.....--------.........DDDRHDYY.AIGT.YHE.K-N------VTW.VPDNP.
Q8XK71_CLOPE/29-331.......--..ILIF----SP.QGIK--------EEE...FRYQNIYQSGY.LIGN.LNY.D-T------LEFKNN....
Q9ZP42_FRAAN/53-372D.....V--KHVLKV----SL.....--------.........DNTRKEYY.TIGT.YNV.S-K------DIY.IPDDG.
Q5WDB1_BACSK/36-338.......--..VLLA----SP.QGVE--------PEG...DRYLNHHQTVY.MVGD.YV..N-G------QFIRSS....
O65778_CYNSC/94-412G.....I--KHVLKE----SW.....--------.........EGHAMDFY.SIGT.YDA.F-N------DKW.TPDNP.
Q8DNS7_STRR6/37-340.......--..VLLY----CP.QGLD--------KKV...LDYDNIFPNMY.KIGASFDP.K-N------AKMVDV....
Q6AW26_LOLPR/94-412E.....E--LYVIKA----SM.....--------.........DDERHDYY.SLGR.YDA.A-A------NTW.TPLDA.
Q5WBG3_BACSK/35-336.......--..VFLF----CP.QGLA--------PEG...DRFLNLYQSGY.VTGKPLNR.E-T------LVF.SH....
Q8CRR2_STAES/37-337.......--..VILM----CP.QGVE--------AEG...DKYRNIYQSGY.MIGD.LNF.N-N------LFF.DH....
Q752P4_ASHGO/54-389V.....W--VMFLAI----NP.GGPQ--------..........GGNFNQY.FIGD.F...D-G------KKFTPF....
Q8DWH3_STRMU/37-353T.....T--KHVLFF----GA.NGYQ--------........YGSTTGTYY.MIGH.LD..T-Q------GNFVPE....
Q5LY63_STRT1/37-340.......--..VLLY----CP.QGLD--------KAE...LDYNNIYPNTY.KIFQDFDP.E-K------AALVGG....
SCRB_LACLL/37-342.......--..VLVF----CP.QGLD--------KSI...VKYDNIYPNVY.VIADDFTTGS-K------NQLKNA....
Q84F22_9BIFI/57-368K.....W--..VIGF----SA.MGAK--------PNG...FMNRNVNNAGY.MVGT.WK..P-G------ESFKPE....
Q6G7R6_STAAS/38-338.......--..VILI----CP.QGIE--------PKG...DQFKNIYQSGY.ILGK.FDI.E-K------LTY.EH....
Q5XA96_STRP6/37-340.......--..VLIF----SP.QGLA--------KAD...LDYQNIYPNTY.KIFESFNP.E-T------GQLLGG....
Q9KBR7_BACHD/33-338.......--..VLLV----SP.QGLE--------KQG...YLYHNVHNTGY.FIGR.LDY.E-T------GEL.VH....
LEVB_BACSU/48-356K.....W--VLGASA----NG.KPWG--------..........KPNTYAY.WTGS.F...D-G------KEFKAD....
Q5ZQK6_9ASTR/50-366G.....V--KHVVKV----GF.....--------.........NGI..DWY.TIGT.LS..E-R------DNY.VPENG.
INV1_DAUCA/64-384S.....V--KHVLKV----SL.....--------.........DLTRYEYY.TVGT.YLT.D-K------DRY.IPDNT.
O04372_ASPOF/122-447L.....V--KHVLKE----SS.....--------.........DDDRQDWY.AIGT.YDP.D-T------NKW.TPDDE.
O65341_SACRO/23-357D.....V--VHVMKA----GM.....--------.........DDDRHDYC.ALGR.YDA.A-A------NAW.TPLDA.
Q5WDB0_BACSK/20-318K.....W--VLHVSV----GD.NDET--------..........NGSTAQY.FVGE.F...D-G------TAFTNDN...
Q6KCH6_HORVU/127-454D.....V--LHVMKE----SS.....--------.........DDDRHDYY.ALGR.YDA.T-K------NTW.TPLDV.
SCRB_SALTM/31-336.......--..ILIC----CP.QGIA--------REE...ECYLNTYPAVW.MAGE.FDY.A-A------GAF.RH....
O86076_ECOLX/29-330.......--..YLMF----SP.QGMN--------AEG...YSYRNRFQSGV.IPGM.WSPGR-L------FAQSGH....
INV1_ORYSJ/53-369S.....S--KYVLKN----SL.....--------.........DLTRYDYY.TVGI.YNK.V-T------ERY.VPDNP.
Q8W431_WHEAT/84-403E.....M--LHVLKA----SM.....--------.........DDERHDYY.SLGT.YDS.A-A------NRW.TPIDP.
Q6DA94_ERWCT/31-336.......--..ILIC----CP.QGVP--------AED...ERYLNTFQAGY.FIGS.LDY.E-N------GDY.SH....
INVB_DAUCA/135-453G.....V--KHVLKS----SL.....--------.........DDDRHDYY.ALGT.YDP.I-N------DKW.TPDNP.
Q97I80_CLOAB/49-358K.....W--ILGTSA----NG.KVSG--------..........EPNTYAY.WVGN.Y...D-G------KKFIAD....
Q84XV1_MUSAC/62-379G.....V--KHVLKV----SL.....--------.........DLRKYEYY.TLGK.YYH.Y-Q------DKY.VPDNT.
Q94C07_ORYSA/140-471G.....V--KHVLKS----RL.....--------.........DDDKDDYK.ALGT.YFA.A-T------GTF.AADDA.
INV3_ORYSJ/51-377E.....V--KYVLKV----SL.....--------.........DLTRYEYY.TVGW.YDH.A-T------DRY.VPDAA.
Q65D73_BACLD/27-331.......--..ILLI----SP.QGIE--------ADG...ESYQNLYQTGY.LIGD.YDEET-N------EFVHGS....
Q9S943_VITVI/137-455G.....V--KHVLKA----SL.....--------.........DDDKNDYY.AIGT.YSL.E-S------GNW.TPDNP.
Q74HI7_LACJO/37-340.......--..VLIF----CP.QGLD--------KSV...ADYKNIYPNMY.WIGKDINL.S-E------AKF.......
Q70LF5_HORVU/96-419D.....V--LYVLKE----SS.....--------.........DDDRHDWY.SLGR.FDA.A-A------NKW.TPIDD.
O23786_CYNSC/107-426N.....V--KHVLKQ----SG.....--------.........DEDRHDWY.ALGT.YDV.V-N------DKW.YPDDP.
O81082_ALLCE/87-413G.....I--KHVLKA----SM.....--------.........DDERHDYY.AIGT.FDL.E-S------FSW.VPDDD.
O74641_ASPNG/33-356E.....T--TWVVMM----TPAEGSP--------..........AGGNGVLAITGS.F...D-G------KSFTADPV..
Q9ZR55_CICIN/25-343SN...RV--KHVLKL----GI.....--------.........QDHGKDCY.LIGK.YSA.D-K------ENY.VPEDE.
O81189_MAIZE/58-383R.....V--KHVLKN----SL.....--------.........DLRRYDYY.TVGT.YHP.R-A------ERY.VPDDP.
Q6F0V0_MESFL/34-333.......--......----...YVFA--------CLEQDAPLKDGSHYVKY.REVE.IDNDI-N------FTYKTS....
BFRA_THEMA/7-294.......--..ILIY----SI.....--------.........TSTNSVLF.SMGE.L...K-E------GKLNVEK...
INV2_YEAST/32-353Y.....W--VMFISI----NP.GAPA--------..........GGSFNQY.FVGS.F...N-G------THFEAF....
Q8GM36_BACME/30-333.......--..VLMI----SP.QGIE--------AKG...DSYHNLFQTGY.LVGE.YNYGT-N------TFHHGS....
Q9S944_VITVI/115-433G.....I--KHVLKA----SM.....--------.........DDNRHDYY.ALGE.YDP.M-T------DTW.TPDDP.
Q9LAL1_9PSED/15-331K.....W--VMVVSI----GN.SDEY--------........L.EGSRTQY.FIGQ.F...D-G------IRFTNEN...
INV1_HANAN/32-354K.....W--VLLLAI----NP.GSPL--------..........GGSINEY.FIGD.F...D-G------TTFHPD....
Q9CJZ0_PASMU/57-355.......--..LFLW----SP.QGKA--------QKT...YCFQNHYHATY.ALGQ.Y...A-N------LHFSAQ....
Q8GI55_GEOSE/14-329K.....W--VMFVSI----GD.NRQF--------........D.SGSRTQY.FIGS.F...D-G------SNFKVDE...
Q7XA49_SOYBN/45-362D.....V--RHVLKV----SL.....--------.........DDKKHDYY.MIGS.YNA.A-K------DAF.IPDE..
INVA_SOLLC/108-427G.....V--KHVLKA----SL.....--------.........DDNKQDHY.AIGT.YDL.G-K------NKW.TPDNP.
Q5WI15_BACSK/12-315.......--..VFVF----SP.QGLP--------EEG...DQYKNPNQSGY.IIGR.IS..E-S------GKFLGT....
Q9F498_ERWAM/31-336.......--..VLVV----CP.QGLA--------SEA...RRYRNTFQSGY.FCGQ.LDH.D-S------ASF.CH....
Q8A6W7_BACTN/150-451K.....W--VLLCSL----GD..GPF--------..........GDSATQY.FIGS.F...D-G------KKFSCDN...
SCRB_STAXY/38-338.......--..MLLF----CP.QGID--------SEG...ERFKNIYQSGY.IMGQ.YDI.N-N------LTM.NH....
Q45372_PAEPO/17-347K.....W--ILMLSV----GD.RNGV--------NPDD.PEPPAGGSGMMY.FVGS.F...D-G------KSFTPDEAL.
SCRB_VIBAL/41-341.......--..VMLF----SP.QGVS--------SSN..PYDFKNIYSVAY.IVGDQLNL.E-S------MTLENH....
INV7_ORYSJ/44-366G....GV--RHVLKL----SV.....--------.........MDTLQDYY.MVGT.YDD.A-A------DAF.SPAEPE
Q5KUA8_GEOKA/34-339.......--..VLIV----CP.QGLK--------PDG...MRYQNVYQSGY.FVGR.FDY.E-R------AEF.LH....
O42801_9EURO/31-371K.....W--VITSGL----NP.GGPP--------G.......T.VGSGTQY.FVGE.F...D-G------TTFTPDADT.
Q7WWQ7_LACAI/24-321.......--..YLAF----SV.....--------I......LGDDKHSIVYIAEGH.MDW.Q-T------FKFELEK...
Q6HN59_BACHK/32-333.......--..VLLF----SP.QGIE--------KDR...ENFHNIYNVVY.AIGH.FDI.K-N------LYF.HI....
INV1_ARATH/56-378PN..EIL--KHVLKI----SL.....--------.........DDTKHDYY.TIGT.YDR.V-K------DKF.VPDNG.
Q84V20_SOLLC/57-375E.....H--KYVLKN----SM.....--------.........DLTRFEYY.TLGK.YDT.K-K------DRY.VPDPD.
Q6EVL5_ECOLX/31-336.......--..ILLC----CP.QGMV--------REH...ERYLNTYPCAW.LHGQ.FDY.E-T------GKF.TH....
Q9FR47_POASE/86-409E.....V--LYVIKA----SM.....--------.........NDERHDYY.ALGR.YDA.A-G------NTW.TPLDP.
Q9ZR32_DAUCA/105-423G.....V--KHVLKA----SL.....--------.........DQYMQDYY.AIGT.YDP.M-S------DKW.TPDDP.
Q94C08_ORYSA/125-454G.....V--KHVLKT----SF.....--------.........DDDKHDYY.ALGT.YDL.Q-A------DTF.VPDDP.
Q6F4N3_LOLPR/116-437E.....V--LFVLKE----SA.....--------.........NDEWHDYY.ALGW.FDA.A-A------NTW.TPQDP.
O81083_ALLCE/154-479A.....V--KHVLKA----SM.....--------.........DDDRHDYY.AIGT.YDP.A-Q------NTW.VPDDA.
Q42722_DAUCA/122-441G.....V--KHVMKA----SL.....--------.........DDDRNDYY.AIGT.YDP.V-S------GKW.VPDNP.
Q8LRN6_SOLLC/7-325N.....I--KYVLKV----SL.....--------.........DVTRFEYY.TVGI.YDT.K-K------DKY.IPDKT.
Q5NEI9_FRATT/30-331.......--..VLVL----SI.....--------FET..KNKKDFNYQSYY.YIGN.F...D-G------KHFSAE....
INVA_PHAVU/120-440E.....V--KYVMKV----SL.....--------.........DDDRHDYY.TIGT.YDE.N-K------VLF.TPDDV.
6FEH_BETVU/60-382D.....V--KHVLKL----SL.....--------.........FDTQYEYY.TIGR.YDI.E-K------DIY.VPDEG.
Q8RLU2_PAEPO/14-330K.....W--VMLVSI----GD.VPEI--------........R.EGSRTQY.FTGE.F...D-G------TTFVADA...
INVA4_ARATH/125-445D.....V--KHIVKA----SM.....--------.........DDTRFDHY.AVGT.YFD.S-N------GTW.IPDDP.

PF04616

O30426_CALSA/54-321------K..YYITTIRWEKGGIREEC--------V...........YRADK-IDG.PYEGRV-V------LSD...----
Q9K6P5_BACHD/5-295------Y..YYLLVA....EGGTEYE--------....HAATL...ARSQS-IDG.PYETDP-S------YPLVTS----
Q8P3K7_XANCP/60-332------W..LYLVTA....VGGTAGP--------....VTGHMVIAARSRS-VHG.PWEHCP-H------NPLVRT----
Q8A1K5_BACTN/22-288------Y..YYLTSA....QGGTAGP--------....ATSHMAVAARSKS-VTG.PWENSP-Y------NPVVHT----
Q93J96_STRCO/52-335------R..VWMTYS....TCDTGKP--------D...YQVRMMSMPLNAD-PLV.PGNWHQ-H------QGAVFS----
Q9A4M8_CAUCR/35-330------W..YYLTAA....EGGTAEG--------....HSQVV...LRSKS-VTG.PYVPYT-N------NPILTQ----
Q9A9Z8_CAUCR/61-333------Y..FYMITA....VGGTAGP--------....PTGHMVIAARAKS-LAG.PWENHP-R------NPLVRT----
Q8A3Q4_BACTN/26-309------Y..YYLFASTGTCCEGLKST--------....YQTVV...GRSSS-LWG.PYLDKQ-G------RSMLDN----
Q9KBQ8_BACHD/8-311------K..VFIAYS....ASATDHH--------....YCMGLLWANEEAD-LLD.PASWTK-S------PTPVFQ----
Q92P74_RHIME/5-303------W..YYLTVA....EGGTGYD--------....HAVGM...ARSRT-IDG.PYEMHP-N------VHLITS----
Q8A0C6_BACTN/25-303------Y..YYIVYA....AHGCCGP--------SSD.YDVYV...ARARN-YGG.PYEKYS-G------NPILH.----
Q82P90_STRAW/37-336------K..VFLTYS....ASATDAN--------....YCLGMLSASASAD-LLN.AASWTK-S------SQPVFK----
Q8PBE4_XANCP/26-318------Y..YYLTAA....EGGTGEQ--------....HAQMV...YRSRQ-IAG.PYEPWS-G------NPVLTQ----
YAGH_ECOLI/3-303------W..YYLMAA....EGGTSYE--------....HAVVV...LRSKN-IDG.PYELHP-D------VTMMTS----
Q97TI6_CLOAB/24-307------M..YYMVYA....AGGIP..--------....EYISY...STSKS-PTG.P..WYY-K------GVIMPS----
Q8A3V2_BACTN/35-295------Y..YYISIP....EGGVGEG--------WQTI........LRSKN-IYG.PYEKKV-V------LE....----
Q8PE34_XANCP/46-319------W..YYMTTA....VGGTAGP--------....PTGHMVITARSRS-IHG.PWQNAP-N------NPITRT----
Q9A9J1_CAUCR/6-306------W..YYLLTA....EGGTGWG--------....HAATL...ARSRA-IDG.PYELHP-D------TYLLTA----
Q9RI60_STRCO/4-282------W..WYLLIA....EGGTERG--------....HSVSV...ARSRS-PRG.PWQGAP-S------NPLLSH----
Q9KXY8_STRCO/30-319------Y..YYLFASYDTCCAGTGST--------....YKVKV...GRATS-VTG.PYRDRN-G------VAMTDN----
O52729_9BACI/3-301------Y..YYLLTA....EGGTRYE--------....HAATI...ARSKH-IEG.PYEIHP-D------NPILTS----
Q8A6K8_BACTN/42-323------GKLIMLWSS....FRKTDGK--------....YAIGQAVSASG.N-VLG.PWVQE.-.------......----
Q8EPL4_OCEIH/6-297------W..YYLMIA....EGGTGFT--------....HAVTI...ARSRS-LLG.PYESAK-T------NPILTH----
Q8CWF7_OCEIH/4-302------Y..YYLLTA....EGGTRYD--------....HQATI...ARSKN-LHG.PYEVHP-D------NPLISS----
O52575_SELRU/3-304------M..YYLMTA....EGGTTYQ--------....HSETI...ARSKT-IHG.PYEIQP-D------YPLLSA----
Q8A1Z2_BACTN/337-620------Y..YYLFASIGRCCEGLKST--------....YTTVV...GRSKN-LFG.PYVDKK-G------RSMSDN----
Q9CFH1_LACLA/4-305------Y..YYLFAA....QGGTVFT--------....HQEVV...ARSKT-LDTLSFETEP-G------DPFITN----
Q8P3G6_XANCP/43-335------W..YYLSCA....EGGTGPQ--------....HSQVV...LRSRN-VWG.PYAPAP-H------NPILTQ----
XYLB_BUTFI/4-291------Y..YYLLHA....EAGTSFE--------....HAISV...ARSKE-LFK.WFEGCP-R------NPIFTH----
Q8CK14_STRCO/11-285------W..YWILAP....AGSVETG--------WQGA........FRSRE-FFG.PYEEKV-V------LE....----
Q97DM1_CLOAB/2-300------Y..YYLFTA....EGGTTYE--------....HSETV...ARSKN-IDG.PYEIDP-E------YPLLTS----
Q81ZV8_STRAW/441-719------T..YYFMWS....EDDTGSE--------N...YHVSY...ATGPS-PLG.P..WTK-R------GTILSK----
XYNB_BACPU/3-301------V..YYLLTA....EGGTRYE--------....HAATI...ARSSR-IDG.PYEVHP-D------NPILTA----
Q82P89_STRAW/52-348------R..TFLTFS....ASYCQTA--------D...YKLGQLELTGG.D-PLS.PASWTK-K------QNPVFQ----
Q97IW1_CLOAB/6-309------K..IFITYS....ASATDVN--------....YCIGMLTAEENSN-LLD.KNSWTK-S------QTPVFK----
Q8A1I6_BACTN/28-326------I..YYFFWS....VDDTGSP--------N...YHVVY...GTAQS-PLG.PIEVAK-E------PIVLIQ----
Q8Z9F3_SALTI/4-306------K..LFISYS....ASATDEN--------....YCMGLLWINVNDD-PRD.PANWHK-S------PRPVFT----

PF04041

Q9YFA2_AERPE/23-354------WATPVNGYK----GGSLLVL--------LHG...VD...TEQQVY-RVLAAELDLE-G..RELVLKAVTP----
O58834_PYRHO/1-299------PGPPPILTE----DS..IVL--------FY...NSA...NENLVY-RVGVALFDRD-EPWK...VKIRSR----
Q9WZN9_THEMA/15-332------WSTNTVEVK----EG.YLVG--------WH....AV...LKDLTY-KNGLALVDGR-G......RLLGTT----
Q9X0V2_THEMA/4-323------AGPYPIETS----EG.WLLI--------YHG.VTLT...CNGYVY-SFGAALLDLD-DPSK...VLYRSR----
Q9X2G7_THEMA/4-296------VGAPPIKTE----YG.WLVL--------YHGVQNTG...TSRPIY-RLGFMLLDLE-DPTK...VIKRSK----
Q9HH03_PYRFU/31-329------PGPPLFETS----YG..IAL--------IY...NSAGRYGDKLKY-KVGVVIFDKE-YPDK...VVARTE----
O67215_AQUAE/17-345------WATPPVKVG----EE.NLVL--------IHG...VD...KELTAY-RVFAVLMNKE-G..Y...FTAVTP----
Q9UZM0_PYRAB/1-299------PGSPPVKVG----DS..IVL--------IY...NSA...DENLVY-RPGIAVFDAD-DPSR...LVWRSE----

PF02435

SACB_ZYMMO/1-400------L--TYLFTI----SHHSTYA........DGLSGPDGVYGFVSENG-IFGP-YEPLN.G------SGLVLGNP..
INVB_ZYMMO/1-398------L--TYLFTI----SHDSTYA........DGLTGSDGLYGFVSENG-IFGP-YEPLN.G------SGLVLGGP..
SACB_STRSL/223-685------K--YYLFTA----SRINKSTDAEGTVAAREAVGDDVVMLGFVSDS-LRGK-YRPLN.G------SGVVLTAS..
SACB_BACAM/37-470------K--WYLFTD----SRGSKMT.......IDGINSNDIYMLGYVSNS-LTGP-YKPLN.K------TGLVLQMG..
SACB_GLUDI/77-540------K--YYIFTI----SHRTTFA........AGVDGPDGVYGFVGDG.-IRSD-FQPMNYG------SGLTMGNPTD
SACB_STRMU/184-637------K--YYLFTA----SRLNHGSNNDAWNKANEVVGDNVVMLGYVSDQ-LTNG-YKPLN.N------SGVVLTAS..
O82854_BACSP/38-487------K--WYLFTD----SRGSKMT.......SDGINDKDVYMLGPGGDS-LNGP-HNPIN.E------TGLVLNMN..
Q9Z5E5_PAEPO/37-482------L--WYLFTS----TRGSKVT.......VDAIGDDDIYMLGYVSTS-LTGP-YKPLN.G------TGLVLHQD..
SACB_ERWAM/1-407------K--YYLFTI----SHKYTFA........DNLTGPDGVYGFVSDK.-LTGP-YTPMN.S------SGLVLGNP..
SACB_RAHAC/1-407------K--YYLFTI----SHKFTYA........DGLTGPDGVYGFLSDN.-LTGP-YSPMN.G------SGLVLGNP..
SACB_PSESG/1-407------K--YYLFTI----SHKFTYA........DGVTGPDGVYGFVGEH.-LFGP-YRPMN.A------SGLVLGNP..

PF03664

XYNC_CELJU/321-555------.QNRYLLMV-------------------------EAYISGP.RFF-------------------RSWTAT----
Q9X583_9ACTO/516-788------GQNQYFMIV-------------------------EARGASEQRYF-------------------RSFTAT----
Q9HEY3_COCCA/26-295------..GGYLMIV-------------------------EAVGSGG.RYF-------------------RSFTAS----
AXHA_ASPSO/28-298------.QNKYLMIV-------------------------EAMGANG.RYF-------------------RSFTAD----
AXHA_ASPNG/28-302------GDSKYLMIV-------------------------EAIGSTGHRYF-------------------RSFTAS----

PF00251

SCR_ZYMMO/33-343.......TS..FQ....ELDYGHD.FYAAQRFEA...-..KDG.RQILIAWFD.MWENQ.KPSQR......DGWAG..CM
SCRB_PEDPE/37-339.......HA..LT....QLDDGFD.VYATQAINA...-..PDG.RALAVSWIG.LPEIS....YPT...DRENWAH..CL
INV3_ARATH/43-365...VQN.ES..AP....RLDYGK..YYASKTFYD...-..DVKKRRILWGWVN.ESSPA.KDDIE......KGWSG..LQ
INV4_ARATH/54-372...PDG.WE..GL....RFDYGN..FYASKTFFD...-..YKKNRRILWGWAN.ESDTV.EDDIL......KGWAG..LQ
INV5_ARATH/47-369...VQD.ET..AP....RYDYGK..FYASKTFYD...-..SVNQRRILWGWVN.ESSPE.KDNIK......KGWAG..LQ
SCRB_BACSU/33-338.......GE..FT....ELDQGFD.FYAPQTLED...-..DQG.RRILFAWMA.VPDQD.EGSHPT...IDCHWIH..CM
INV2_ARATH/52-371...PDG.WD..GL....RFDYGN..YYASKTFFD...-..DKTNRRILWGWAN.ESDTV.QDDTV......KGWAG..IQ
SCRB_KLEPN/31-336.......GP..LH....ELDSGFE.FYAPQTMQA...-..DDG.RRLLVGWMG.VPDGD.EMHQPT...RAQGWIH..QM
Q9RGC0_9PSED/280-596......QNE..PQ....LIDVGDSHFTGPSGMVD...-..PNTGRKILFTIAQ.......GERTPAL.DYSAGWAH..NG
SCRB_VIBCL/98-398.......G....W....PLDEGFD.FYAPQTAQT...-..TDG.RRVLCGWMG.LPDET.Q..HPS...CDQGWIH..QL
O02490_TRIFO/111-409....DP.WN..TK....WMDYGRD.AYATVCFHNA..-.P....VNTAIAWMS.NWDY..AKIAP.....THQFRS..AF
Q8DY03_STRA5/37-340.......SP..IY....NLDYGFE.AYATQGFNT...-..SDG.RAFIVSWIG.LPDID....YPS...DQFDYQG..AM
INV1_SCHPO/87-407......DGQ..TR....FVDLGKD.FYASALYHSS..-.SANA.DVIGVGWAS.NWQY..TNQAP.....TQVFRS..AM
Q834P0_ENTFA/38-341.......GP..FE....NLDEGFD.VYATQAFNA...-..PDG.RALAVSWIG.LPEIT....YPS...DVEGWAN..GL
Q6PVN1_TRIMO/132-444...EMDVGI..GL....RYDWGK..FYASKTFYD...-..PSKNRRVLWGWIG.ETDSE.RADVA......KGWAS..LQ
SACC_BACSU/39-349....PP.NK..VL....WTDYGRD.FYAAVSWSDI..-.PSTDSRRLWLGWMS.NWQY..ANDVP.....TSPWRS..AT
Q93X59_CICIN/50-368...LSLTGSTLDL....RYNYGQ..FYASKSFFD...-..DAKNRRVLWAWVP.ETDAP.EDDIE......KGWAG..LQ
Q65DN5_BACLD/32-337.......GD..FE....ELDRGFD.FYAPQTTKD...-..ESG.RRILVAWMG.VPDQD.EQSQPT...IPHQWVH..CM
Q42691_CHERU/44-365...FMNDSS...L....RYDYGK..YYASKTFYD...-..GAKKERILLGWAN.ESSSE.EDDAK......KGWSG..IH
Q43855_VICFA/51-371...SEDGWG..GL....RYDYGN..FYASKSFFD...-..PTKNRRIIWGWAN.ESDTK.EDDVK......KGWAG..IQ
INV4_ORYSJ/64-381...LDDRRL..WL....RIDYGN..YYASKSFFD...-..SKKGRRIIWGWTN.ETDST.SDDVA......KGWAG..IH
INV3_DAUCA/58-376...SVDGWA..GL....RYDYGN..FYASKTFYD...-..PIKKRRILWGWAN.ESDSQ.IDDVQ......KGWAG..IQ
Q7WWP6_LACAI/37-338.......GP..LQ....NLDKGFD.VYATQAFNA...-..LDG.KAYEISWVG.LPDIT....YPT...DDENWAN..CL
Q82YR4_ENTFA/37-340.......SK..IK....NLDYGFD.VYATQGFNS...-..PDG.RTLIVSWIG.LPDVE....YPT...DKYDYQG..AM
O94224_CYBJA/34-356......DDA..TR....FMDTGKD.FYAFQAFFN...-..APENRSIGVAWSS.NWQY..SNQVP....DPDGYRS..SM
Q65EI7_BACLD/46-355......EAE..PQ....WLDYGFD.WYAGVTFEDGET-NDPYE.KRYALAWMN.NWDY..ANRTPT...WKDGFNG..TD
Q43856_VICFA/53-374...FEEVEIEEVF....RYDYGK..YYASKTFFD...-..YEKNRRILLGWVN.ESSSI.PDDIK......KGWSG..IH
INU1_KLUMA/43-375......DGQ..TR....FLDMGKD.YYALQTFFNT..-.PNEK.DVYGIAWAS.NWQY..AQQAP.....TDPWRS..SM
RAFD_ECOLX/28-329...........FE....ELDYGHD.FYAPQSMLA...-..EDG.RRIIMAWMN.MWDSP....VPT...RSEAWAG..CL
INV6_ORYSJ/42-371EAHGDDYRR..WR....RIDHGH..LYASKTFYD...-..AGKKRRVLWAWVN.ESDSE.ADDVT......KGWSG..LQ
1FEH_HORVU/68-385...VDDRRL..WL....RMDYGT..FYASKSFFD...-..SKKGRRIVWGWSG.ETDSP.SDDLA......KGWAG..LH
Q9RBJ1_GLUDI/47-372..PGSDPSR..YD....WLDHGAD.QYATTLFANT..-.G..SGAPVLIGWMD.NWDY..ATDLP.....TAPWR