Sequence alignment for CL0145

PF09325

Q6BQ29_DEBHA/424-659-------------VGNN----TGGFMSSIFSM.......SQ-------------K----IEEPDEYFIQKKEYIESLEHN
Q7PVK3_ANOGA/210-443-------------VMRL----FNKVGETVNKI.......TY-------------K----MDENDPWFNDKISEVETIDAH
VPS5_YEAST/439-673-------------IDAE----SHKGFMSISFS......SLP-------------K----YNEADEFFIEKKQKIDELEDN
SNX2_HUMAN/281-514-------------ILRM----VNKAADAVNKM.......TI-------------K----MNESDAWFEEKQQQFENLDQQ
Q86IF6_DICDI/292-523-------------ISSF----FGNSISTLTQG.......VH-------------S----VKEIDGWFGDKKSYILQLDST
Q5A1F2_CANAL/431-666-------------TAAA----TSGGFMSSLFS......MST-------------K----VTEPDQYFITKKQYIDDLEYN
Q5B786_EMENI/288-522-------------SKGM----FSSFGISVGG........GG-------------K----FIEHDDWFHDRKIYLDALENQ
A8WVN0_CAEBR/231-466-------------VKKI----FKNFQVVFSKM.......AF-------------H----MEEGDRWFEQVQSQIDELDEA
Q5KI36_CRYNJ/639-879-------------RKHQ----IAAQTSSTEKGGLLAGWTST-------------K----FVEQDDWFNSRRAFLEALESQ
VPS5_SCHPO/340-576-------------TSGL----LDSFTSAFHTS......GSS-------------K----FSEQDPILIEAKDTLDSLETQ
Q6CJR1_KLULA/428-663-------------LDTE----TGGSFMGLSFA......TAP-------------K----YKEPDQFFVDAAEKMDILEEQ
Q6CGR9_YARLI/393-628-------------GSGL----MSSLSSSFSF........SK-------------S----FIETDPWFSDKRGYVDVLESH
Q759R2_ASHGO/362-598-------------LESD----TGSLFMSLSFS......SVP-------------K----YTEPDTFIMEKRQHIDVMEEQ
Q4P3M6_USTMA/831-1062-------------TSSL----SSGALS............AY-------------S----FEETDEWFNEQRVYLDSLESA
Q6FKM2_CANGA/398-636-------------LDSE----YKKGFMNISFS......SIP-------------K----YNEPDKFFVDELDRITDLENQ
E4X2N5_OIKDI/242-473-------------..RF----VGKVENVITKQ......VTQ-------------K----MPETDSWFEDRAASVDNLQAQ
F7G234_MACMU/220-452-------------.LKM----FNKATDAVSKM.......TI-------------K----MNESDIWFEEKLQEVECEEQR
G4UCZ3_NEUT9/309-540-------------..GV----LSTFGISVGS........GN-------------K----FVEQDDWFHDRRVYLDALENQ
G4VRE2_SCHMA/197-429-------------..KV----MKNLGDAIGKL.......AY-------------K----VDDPEEFFYQKADELDGWEKQ
Q9VQQ6_DROME/221-452-------------.IRL----FNKVGETVNKI.......TY-------------K----MDENDPWFDDKITEVESLDAN

PF03114

RHG17_RAT/1-239-------------MKKQ....FNRMKQLANQT----VGRAE-------------K----TEVLSEDLLQIERRLDTVRSM
RHG44_HUMAN/1-242-------------MKKQ....FNRMRQLANQT----VGRAE-------------K----TEVLSEDLLQVEKRLELVKQV
SH3G3_MOUSE/6-242-------------LKKQ....FHKASQLFSEK----ISGAE-------------G----TK.LDEEFLNMEKKIDITSKA
SH3G3_DROME/6-241-------------LKKQ....INKANQYMTEK----MGGAE-------------G----TK.LDMDFMEMERKTDVTVEL
Q20005_CAEEL/8-266-------------IASDAGGFFSRAKQLTEET----FLKAE-------------R----TE.LDSHFENLLQRADKTEDH
HOB1_SCHPO/6-247-------------FTKA....LARTPQTLRSK----FNVGE-------------I----TK..DPIYEDAGRRFKSLETE
O61843_CAEEL/6-240-------------LRKQ....FNKANQYLSET----MGAAE-------------P----TK.LDDVFNEMEKNVDTTYNL
Q8SYD9_DROME/13-268-------------LVKEAGSTISRVVQLTEEK----LGTTE-------------R----TE.YDLHFQNLAERADVTKTW
AMPH_RAT/13-233-------------VQKR....LNRAQEKVLQK----LGKAD-------------E----TK..DEQFEEYVQNFKRQEAE
RV167_YEAST/6-247-------------FTKA....VSRAPQSFRQK----FKMGE-------------Q----TE..DPVYEDAERRFQELEQE
Q9XW43_CAEEL/24-258-------------AAKAG..LFNRIYVTVGQK----VGIVE-------------L----TK.LEPRFERNIEKLTTYHNI
Q94211_CAEEL/24-258-------------AAKAG..FVNRLYVNIGQK----VGVVE-------------L----TK.LEPRFERNIDKLTSYHNL
Q21004_CAEEL/9-230-------------LKKA....TNRTKEKLLEG----IGKAK-------------A----TQ..DEVFDQHAANLNKQSKS
YNQA_SCHPO/1-230-------------MNKH....FAKLSQWTGEK----FGFDR-------------Q----KTTLSDDFCSLKGETDAWLVG
DNMBP_HUMAN/997-1207-------------IIKK....SNRVSSHLKHL----TGFAP-------------Q----IK..DEVFEETEKNFRMQERL
SHLB1_HUMAN/11-254-------------LAADAGTFLSRAVQFTEEK----LGQAE-------------K----TE.LDAHLENLLSKAECTKIW
RV161_YEAST/6-232-------------FKKA....INRAGHSVIIK----..NVD-------------K----TI..DKEYDMEERRYKVLQRA
Q1K8A1_NEUCR/3-230-------------ITKK....FDRAFQWAGEK----MGAEQ-------------K----TT.MSEDFKQLEMEMALRFEG
Q1MT71_DANRE/6-241-------------LKKQ....FYKASQLMSEK----VGGAE-------------G----TK.LDEDFKDLERKADITSKA
Q6TGT7_DANRE/6-241-------------FKKQ....FHKASQLLKEK----INGVE-------------G----TK.LDEEFLSMERKTEITHKL
Q7S3B9_NEUCR/6-246-------------FQKS....VVRAPQQFKQK----FNLGE-------------H----TK..DPVYIDSERRFQELETE
Q7S814_NEUCR/6-229-------------FKKN....VNRATTQVMMK----TGHVE-------------K----TN..DRDYEVEERRFKTMEAA
Q8BXU5_MOUSE/6-241-------------LKKQ....FHKATQKVSEK----VGGAE-------------G----TK.LDDDFKEMERKVDVTSRA

PF10455

MUG64_SCHPO/18-286------------SITPF----AKKTTHYLRTK----IGSRV.............E----ELSLPEDYVELEQQVDSLKEA
A3GFN0_PICST/37-331------------SIQPF----ATKTTQLISTQ----LQQVQHLANL..NVNSNIE----VSELPAEYLQLETNCDLLLKL
A5DTV0_LODEL/37-351------------SIQPF----TNKTQQLLNEQ----LKQVQQLASNVSALPPNIE----VSELPKDYLELEVNCDLLLKL
A7TPP1_VANPO/27-288------------TIPTV----AQSTHRMVKEK----LGQVD.............D----ISPLPQEYLDLELKIDTYKSV
GVP36_YEAST/27-299------------ELPSL----AQSTQRMVQER----LGQVT.............D----ISQLPREYTELEDKVDTIKLI
YP148_YEAST/45-432------------R.LSI----KSRT.RFVQES----LGTVS.............D----ISKLPPQYQFLEKKSDSLEKV
Q59WJ7_CANAL/37-331------------SIQPY----TTKTTQLISEQ----LKHLEQLANN...TTDDID----VSELPQDYLQLESNCDLLLKL
Q6CPI5_KLULA/40-383------------R.LSI----LKRR.HQLQET----LGTVH.............D----ISQLPIQYKFLEQKSDALEKI
Q6FKU8_CANGA/30-382------------K.LSI----KAKT.RFLQEA----IGNER.............D----ISKLPPQYVVLEKKCDSIEKV
Q753K3_ASHGO/49-359------------TILSL----KTRK.RQLQET----LGSAK.............D----ISQLPPQYGFLERKCDAIEQV

PF06730

F92A1_HUMAN/1-219-------------------------------------MMRR-------------T....LENRNAQTKQLQTAVSNVEKH
Q9VK91_DROME/1-222-------------------------------------MFRR-------------GKLSFLNTKDDRVKIINERINITERH

PF08397

BAIP2_HUMAN/17-237--------------------------------------YKT-------------I----MEQFN...PSLRNFIAMGKNY
MTSS1_HUMAN/16-237--------------------------------------FQT-------------I----ISDMKGSYPVWEDFINKAGKL
MTSSL_HUMAN/15-239--------------------------------------FQA-------------I----VNDMKSSYPIWEDFNSKATKL
BI2L2_HUMAN/16-226--------------------------------------YKS-------------I----MEQFN...PALENLVYLGNNY
F6WG35_XENTR/28-238--------------------------------------...-------------.----....Y...PTWEDFVSKATKL

PF06456

ICA69_MOUSE/21-248VVNKMQ.......QKYW----ETKQAFIKATG----KKEDE-------------H----VVASDADLDAKLELFHSIQRT
PICK1_MOUSE/117-352VLKKVK.........HR----LVENMSSGTAD----ALGLS-------------R----AILCNDGLVKRLEELERTAEL
RIC19_CAEEL/27-255TVNTMQ.......RHYW----TARQFIRTKLG----KKEDE-------------H----LEASDNELDTCLNLYRSVHGT
YL87_CAEEL/59-286VAAKVESFKKWTIGTFK----NSKQQLLEHMG----KIDK.-------------.----..TVDPEFEAQCEVLKDIHRR
O18246_CAEEL/113-348LIKKVK.........HK----VVEFVDQDSAD----ALGLS-------------R----AILTNDPLAEKEKILEENAEF
ARFP2_HUMAN/89-316AGEKFDIVKKWGINTYK----CTKQLLSERFG----RGSR.-------------.----..TVDLELELQIELLRETKRK
ARFP1_HUMAN/121-348AMEKLELVRKWSLNTYK----CTRQIISEKLG----RGSR.-------------.----..TVDLELEAQIDILRDNKKK
ICA1L_MOUSE/15-242VVSRMQ.......KNYW----RTKQVFIKATG----KKEDE-------------H----VVASDAELDAKLEVFHSIQET
Q8SY07_DROME/119-354ILKKLK.........HR----IVDNLSSNTAD----TLGLS-------------R----AILCNDSLVKRLEELEGTELM
Q9VGQ8_DROME/106-331SASKIDSLKNWSISTYK----CTRQIMLEKLG----KSQR.-------------.----..TVDSELEAQIEQLRETQRK
Q9VP78_DROME/2-228LKSEVQ.......HQFW----ITKKVVQRKLG----TKEDK-------------H----IISSDAELDSKIEVFKSISDT

PF10456

LST4_CAEEL/336-566------------DEKDW----KNGKRRAEKDE----YIGGA-------------F----LNCITVPH..QPLDPNNVDMQ
SNX33_MOUSE/337-572------------DDKQW----KMGKRRAEKDE----MVGAS-------------F----LLTFQIPT..EHQDLQDVEDR
SNX9_MOUSE/358-593------------DEKEW----KTGKRKAEKDE----LVGVM-------------I----FSTME.PEA.PDLDLIEIEQK
B3DFM9_DANRE/328-561------------DEKAW----KQGKRKAEKDD----LVGAN-------------F----FLTIC.PPA.LPLDLQEVENK
H3D6R4_TETNG/309-534------------DEKAW----KQGKRKAEKDE----LVGAN-------------F----FLTISTPS..VPLDLQEVESK
Q5SPP2_DANRE/343-579------------DEKDW----KTGKRKAEKDE----TVGVM-------------I----FSTIE.PEGLPDMDLIEVEQK
Q7ZZB1_DANRE/321-560------------DEKEW----KLGKRKAEKDE----TVGVK-------------I----FSTID.PEL.PELDPAQVEQK

PF16746

B4JN99_DROGR/14-257----------------------LEFEECIVDS----PEFRD-------------N----LNRHEKELDHTSQQIKRIIKE
F4Q2Y2_DICFS/66-307----------------------IPLMDALDDS----PQFKK-------------Q----VKDTELNIEDLGSGIKKILKS
M3XXB2_MUSPF/5-238----------------------VDFEECLKDS----PRFRA-------------A----LEEVEGDVAELELKLDKLVKL
K7ITA3_NASVI/23-266----------------------LEFTDCLTDS----PYFRE-------------N----LHYHERELEKTSQQIKRLIKE
F1RM37_PIG/6-249----------------------LEFSDCCLDS----PHFRE-------------T----LKSHEAELDKTNKFIKELIKD
H2LTL2_ORYLA/7-250----------------------LEFSESYLDS----PSFRE-------------K----IKAHEAELDKTNRFIKELYKD
I3KTC3_ORENI/3-236----------------------VDFEECIKDS----PRFRA-------------G----IDDVETDVVEIEAKLDKLVKL
F4WSP8_ACREC/5-234----------------------IEFEECLRDT----PKFRL-------------C----IEEVEKNVELLEQKLDKVLKN
DP13B_MOUSE/7-247----------------------LLLEEALQDS----PQARS-------------L----LSVFEEDAGTLTDYTNQLLQA
G1PMF3_MYOLU/5-238----------------------LDFEECLKDS----PRFRA-------------S----VELVEAEVSELETRLEKLLKL
OPHN1_MOUSE/6-249----------------------LEFSDCYLDS----PDFRQ-------------R----LKYYEEELERTNKFIKDVIKD
F1Q973_DANRE/5-238----------------------VDFEECLKDS----PRFRA-------------T----IEEVEGDVCELESKLDKLVKL
F7FXM1_CALJA/7-247----------------------LPIEETLEDS----PQTRS-------------L----LGVFEEDATAISNYMNQLYQA
G3NM88_GASAC/5-238----------------------LDFEECVRDS----PHFRL-------------K----LELFEADVSVLETQLEKVMKL
H2V3K9_TAKRU/6-249----------------------LEFSDSFLDS----PEFRE-------------R----LQCHEIELERTNSFIKDLIKD
G3I418_CRIGR/3-236----------------------VEFEECIKDS----PRFRA-------------T----IDEVETDVVEIEAKLDKLVKL
D6X007_TRICA/5-238----------------------IDPEECLRDS----PKFRS-------------L----LEEEEASVDQLEQKLEKILKV
A1L1F5_DANRE/5-238----------------------LDFEECLKDS----PRFRS-------------E----IEKVEVNVGELETRLEKLVKQ
RHG10_HUMAN/6-249----------------------LEFSDCYLDS----PWFRE-------------R----IRAHEAELERTNKFIKELIKD
F1KTZ7_ASCSU/5-245----------------------IPLEELLYDT----PQNRT-------------L----IRLFEEDTYNLRTWSHQLDAA
Q7QFM2_ANOGA/6-239----------------------IDFGECLKDS----PKFRL-------------R----LEQEESEIEHLESKLEKIIKA
H3DNY8_TETNG/6-252----------------------LEFTDSFLDS----PDFRE-------------R----IACHEIELERTNKFIKELIKD
G3NIM1_GASAC/8-251----------------------LLLEDALQDS----PQTRS-------------L----LSVFEEDAGMLTDYTNQLLQS
M4AHM4_XIPMA/6-249----------------------LEFSDCYKDS----PDFRE-------------T----LKCYELELDRTSKFLKELIKD
G3VVX9_SARHA/37-270----------------------LDFEECLKDS----PRFRA-------------S----IELVESDVSELENRLEKLLKL
H2V5X4_TAKRU/5-237----------------------VDFEECLKDS----PRFRA-------------T----IEEVEGDVCELESKLDKLVKL
H2V5X3_TAKRU/5-238----------------------VDFEECLKDS----PRFRA-------------T----IEEVEGDVCELESKLDKLVKL
H2ZSD6_LATCH/7-247----------------------LLLEEALQDS----PQTRS-------------L----LSVFEEDAGTLTEYTNQLLQA
J0DMU1_LOALO/6-249----------------------LEFADCLSDS----PWFRQ-------------N----LREHESVLEDAHKNIKNIEIQ
H3D4E5_TETNG/3-236----------------------VDFEECVRDS----PRFRA-------------N----IHEVETEVVEMEAKLDKLVKL
F1RB27_DANRE/8-247----------------------LLLEEALQDS----PQTRS-------------L----LSVFEEDAGTLTNYTNQLLQS
B3LV47_DROAN/5-238----------------------IEFEECLKDS----PKFRQ-------------F----VSKEESDIEHLEQRLEKIIKL
I3JB30_ORENI/5-238----------------------LDFEEGLKDS----PRFRA-------------E----IEDVQNDVSELETRLEKLVKQ
F4P1K5_BATDJ/19-262----------------------ISFEHALKDS----PLFRS-------------S----VRLFADELDELEKWLVNISKI
E9G538_DAPPU/5-239----------------------ISYEECMRDS----PKFRD-------------A----LEENHANLDDLEIKLEKVLKN
H2L7W1_ORYLA/9-252----------------------LEFSDCYLDS----PQFRE-------------R----LKSHEAELDKTNKFIKELIKD
K1R604_CRAGI/6-250----------------------LHLEDALEDS----PQTRS-------------L----LSVFEKDAMTLKKYTTGLHNC
E4WY10_OIKDI/49-293----------------------LEFSECWLDP----PRYRQ-------------A----IGQYENTIEDTRDAIKKTTKH
E0W416_PEDHC/5-238----------------------IEFQECLRDS----PKFRA-------------V----LEAEEANIDLLEQRLDKVLKA
A7SEL6_NEMVE/10-244----------------------VDFDECLKDS----PKFRL-------------Q----IERGEHDVTTLEAGLEKVIKQ
H2KZV7_CAEEL/6-249----------------------LEFSDSISDS----PWFRQ-------------N----LHDHEVALDDAFKNIKLIENQ
F6SDM6_CIOIN/5-238----------------------LEFEECIKDS----PKFRD-------------L----VHQSEVDVVDLESQIDRMVKH
H2V5X0_TAKRU/5-235----------------------VDFEECLKDS----PRFRA-------------T----IEEVEGDVCELESKLDKLVKL
Q551Q8_DICDI/30-270----------------------IKLEESIEDS----PQFRK-------------H----LKDTEQSIDELTQNIKKMLKS
F6UY72_CIOIN/6-249----------------------LEFSDCFLDS----PFFRK-------------S----IQEYEDELERTNSQIKQLIKD
Q17GT7_AEDAE/5-238----------------------IDFSECLKDS----PKFRL-------------R----LEQEENEIDHLEQKLEKVIKM
G6CUX2_DANPL/8-251----------------------LEFTECLADS----PHFRE-------------N----LQRHEKELERTSQQIKRLIKE
E1G6B5_LOALO/11-246----------------------LDFTEALKDS----PRFRQ-------------A----ILAHEQYFAKLDSKLTEVLQL
C3ZIA5_BRAFL/5-238----------------------IDFEECLKDS----PKFRV-------------S----LEQVENDIHDLETKLEKVIKL
F5HLS9_ANOGA/7-247----------------------LEFIDCLIDS----PNFRE-------------N----LNKHEKELDKTSQQIKRIIKE
A7RS04_NEMVE/6-249----------------------LEFADCLLDS----PYFRE-------------N----VHEHERELERTNEAIKGLIKE
E9GSI6_DAPPU/6-249----------------------LEFTECLTDS----PYFRE-------------N----LQGHEKELEKTSLAIKVLIKE
F1Q975_DANRE/5-238----------------------LDFEDCIRDS----PAFRQ-------------S----LDKCESDMSELESRVEKVMKL
B7QNY3_IXOSC/6-251----------------------LEFTDCLTDS----PYFRE-------------N----LHAHENELDRTSQAIKGIIKE
G1MY05_MELGA/6-253----------------------LEFSDCYLDS----PWFRE-------------R----VRAHEAELEKTNKFIKDLLKD
G6DT66_DANPL/5-238----------------------IDFDECLRDS----PKFRE-------------Q----LETEEANIEGLEQKLDKVLKT
H3D0T3_TETNG/38-270----------------------LDFEECVRDS----PDFRR-------------K----LQQFEAEVSELETHLENVMKL
F1QMT1_DANRE/5-238----------------------VDFEECLKDS----PRFRA-------------T----IEDVEEDFGELESKLDKLVKL
H2RJ90_TAKRU/5-238----------------------LDFEESVRDS----PDFRR-------------K----LRLFEADVYELETHLDQVMHL
M4AKB4_XIPMA/5-238----------------------LDFEECIKDS----PEFRL-------------T----LDQFEADVSLLETHLDKVMKL
E9BWJ0_CAPO3/31-270----------------------LEFSDCQQDS----PYFRN-------------R----IREYEAETDNISDAIKSLVKQ
F6ZTY0_XENTR/7-247----------------------LLLEEALQDS----PQTRS-------------L----LSVFEEDAGTLTDYTNQLHQT
J9K1I7_ACYPI/5-235----------------------.SVSNCLQDS----PKFRT-------------Q----LDRHESNIDLLEHRLEKVVKV
W4YQP0_STRPU/5-238----------------------INFEECLRDS----PKFRS-------------A----LEDSEADISDLEHKLEKLVKL

PF09325

Q6BQ29_DEBHA/424-659LRVFYKSI-E--LINNQRQEMAGLVD------------------------------------------------------
Q7PVK3_ANOGA/210-443MQKLHSAI-K--ALVSHRKELATLTG------------------------------------------------------
VPS5_YEAST/439-673LKKLSKSL-E--MVDTSRNTLAASTE------------------------------------------------------
SNX2_HUMAN/281-514LRKLHVSV-E--ALVCHRKELSANTA------------------------------------------------------
Q86IF6_DICDI/292-523LHRLEDTI-N--NVIRKRRELAAAMG------------------------------------------------------
Q5A1F2_CANAL/431-666LKQFYKTI-E--LIGQQRLDMIGILD------------------------------------------------------
Q5B786_EMENI/288-522LKSLMKAI-D--TVVAQRKGLSEAAG------------------------------------------------------
A8WVN0_CAEBR/231-466LRKLYTVT-E--SLVASRREMATSGE------------------------------------------------------
Q5KI36_CRYNJ/639-879LKSLAKAI-E--ISSKHRVEVAISLA------------------------------------------------------
VPS5_SCHPO/340-576LKSVYHAL-L--LSIDQRIQFASAIH------------------------------------------------------
Q6CJR1_KLULA/428-663LKQLYKAL-E--LVDSQRSDLCSVIN------------------------------------------------------
Q6CGR9_YARLI/393-628LKSMSRGL-E--LVVHQRKDLAESMG------------------------------------------------------
Q759R2_ASHGO/362-598LRQMYKSL-E--LVDSQKNELVSVIK------------------------------------------------------
Q4P3M6_USTMA/831-1062LKGMVKSV-S--ALSNQRKQMVQATH------------------------------------------------------
Q6FKM2_CANGA/398-636LKKMLKAV-E--SIEEQRRELSSYTY------------------------------------------------------
E4X2N5_OIKDI/242-473LKRLSMAS-G--NLSVHRRELGLSSG------------------------------------------------------
F7G234_MACMU/220-452LRKLHAVV-E--TLVNHRKELALNTA------------------------------------------------------
G4UCZ3_NEUT9/309-540LKGLLKAM-D--SMVAQRKAMAEAAG------------------------------------------------------
G4VRE2_SCHMA/197-429LKRLHSSL-L--NLVSGDNDLANAEA------------------------------------------------------
Q9VQQ6_DROME/221-452LQKLHNAM-K--SLVTSRRELSLLTG------------------------------------------------------

PF03114

RHG17_RAT/1-239CHHSHKRL-I--ACFQGQHGTDAERRHKK....-----------------------------------------------
RHG44_HUMAN/1-242SHSTHKKL-T--ACLQGQQGAEADKRSKK....-----------------------------------------------
SH3G3_MOUSE/6-242VAEILSKA-T--EYLQPNPAYRAKLGMLNTVSK-----------------------------------------------
SH3G3_DROME/6-241VEELQLKT-K--EFLQPNPTARAKMAAVKGISK-----------------------------------------------
Q20005_CAEEL/8-266TRRLLSAI-E--GYLQPNPTVRMEEVFYEKLEL-----------------------------------------------
HOB1_SCHPO/6-247AKKLAEDA-K--KYTDAINGLLNHQI.......-----------------------------------------------
O61843_CAEEL/6-240ITDLVAGT-N--EYLQPNPATRAKMATQVALSK-----------------------------------------------
Q8SYD9_DROME/13-268TEKIVRDT-E--SVLIPNPQNRVEDFIFEKIEK-----------------------------------------------
AMPH_RAT/13-233GTRLQREL-R--GYLAAIKGMQEASM.......-----------------------------------------------
RV167_YEAST/6-247TKKLSEES-K--RYSTAVNGMLTHQI.......-----------------------------------------------
Q9XW43_CAEEL/24-258IYNMVNAI-E--LQVQVDPKAIVKNQVLCDP..-----------------------------------------------
Q94211_CAEEL/24-258IYKIVNVI-E--LQVQFMPKAMAKKAVLCAP..-----------------------------------------------
Q21004_CAEEL/9-230CEKLHKDV-K--NYSSALRTLLSAEK.......-----------------------------------------------
YNQA_SCHPO/1-230MDKIHRSC-T--RWVR..........NMDKRKG-----------------------------------------------
DNMBP_HUMAN/997-1207IKSFIRDL-S--LYLQHIRESACVKV.......-----------------------------------------------
SHLB1_HUMAN/11-254TEKIMKQT-E--VLLQPNPNARIEEFVYEKLDR-----------------------------------------------
RV161_YEAST/6-232GEALQKEA-K--GFLDSLRAVTASQT.......-----------------------------------------------
Q1K8A1_NEUCR/3-230MDRLQKSM-N--LYVK.WLGRRCDSY..EDK..-----------------------------------------------
Q1MT71_DANRE/6-241ISDVLCKT-T--EYLQPNPASRARLTMANTMSK-----------------------------------------------
Q6TGT7_DANRE/6-241ILDIVPKT-I--GYLQPNPAYRAKLSMLSTVSR-----------------------------------------------
Q7S3B9_NEUCR/6-246TKRLHDES-K--KYFEAINGMLQHQI.......-----------------------------------------------
Q7S814_NEUCR/6-229SLRLQKEA-K--GYLDSLRAMTASQM.......-----------------------------------------------
Q8BXU5_MOUSE/6-241VMEIMTKT-I--EYLQPNPASRAKLSMINTMSK-----------------------------------------------

PF10455

MUG64_SCHPO/18-286YNLVLPIV.E--TVEVDGYDYPT..NFRDSITD..FGKTVSGKVRNLGNLTPLEQTPLASVGKNLEEKEAAAKP......
A3GFN0_PICST/37-331YTDLIQYSNE--TFNNISYDYPPGNYTITKIKDANVGGVLATKFNQLKNVSSPQELENILLGKEAGDADSAEKDV.....
A5DTV0_LODEL/37-351YTELIQSNNS--TYGQLSYDYPPGNTAFNKLKDAHIGDSIGAKFNQLKNVSSPQELEKVLLGQASKDAGDDEEEGEEGED
A7TPP1_VANPO/27-288YEHFLKIT.S--IYERESYDYPK..EFSESVNE..FTDSIGNKMYEFSNGVSTEGSSGKT....................
GVP36_YEAST/27-299YNHFLGVT.A--IYENGSYDYPK..YINESVNE..FSRSVASKLTELTHATSASEAQNILVAPGPIKE............
YP148_YEAST/45-432CKRILLVS.K--TFEVEGYDYPP..NLTESISD..WW..............SLNKDGW..FGSKKSESSTKKKG......
Q59WJ7_CANAL/37-331YTDLIQTTNE--TYGKVSYDYPPGNYAINKIKDANVSGLIGQKFNQLKNVSSPQELEKVLLGQDVDAESKDESGV.....
Q6CPI5_KLULA/40-383CKRLLLVT.K--TFEVEGYDYPP..NLTESFND..WW..............SGNKDSIFSFSKKKAEVSPEVKE......
Q6FKU8_CANGA/30-382LKRILIVT.K--TYEIEGYDYPP..NISESLSS..WWQT.....KEWFNISELTKNVIPKHGNVEKAGTEASKTL.....
Q753K3_ASHGO/49-359CKKILVVS.K--TFEVEGYDYPP..NPTESISD..WWNT............STKETRFLKFGKGGTDKQKEDKQ......

PF06730

F92A1_HUMAN/1-219FGELCQIF-A--AYVRKTARLRDKAD------------------------------------------------------
Q9VK91_DROME/1-222LMEMCSSF-A--LVTRKMAKYRDSFD------------------------------------------------------

PF08397

BAIP2_HUMAN/17-237EKALAGVT-Y--AAKGYFDALVKMGE------------------------------------------------------
MTSS1_HUMAN/16-237QSQLRTTV-V--AAAAFLDAFQKVAD------------------------------------------------------
MTSSL_HUMAN/15-239HSQLRTTV-L--AAVAFLDAFQKVAD------------------------------------------------------
BI2L2_HUMAN/16-226LRAFHALS-E--AAEVYFSAIQKIGE------------------------------------------------------
F6WG35_XENTR/28-238QSHLKTMI-I--VTGSFLDAFQKIAD------------------------------------------------------

PF06456

ICA69_MOUSE/21-248CLDLSKAI-V--LYQKRICFLSQEEN------------------------------------------------------
PICK1_MOUSE/117-352YKGMTEHT-K--NLLRAFYELSQTHR------------------------------------------------------
RIC19_CAEEL/27-255SFQLLNNV-D--NYANFLLDETLVQN------------------------------------------------------
YL87_CAEEL/59-286YGLVVAAA-K--NFSHVLTQMAEAEK------------------------------------------------------
O18246_CAEEL/113-348YRHLVAYF-G--DMFQYQQKISECQK------------------------------------------------------
ARFP2_HUMAN/89-316YESVLQLG-R--ALTAHLYSLLQTQH------------------------------------------------------
ARFP1_HUMAN/121-348YENILKLA-Q--TLSTQLFQMVHTQR------------------------------------------------------
ICA1L_MOUSE/15-242CNELVKIV-E--KYQLRLNVISEEEN------------------------------------------------------
Q8SY07_DROME/119-354YKGLVEHA-R--RMLKAYYDLLQTYK------------------------------------------------------
Q9VGQ8_DROME/106-331YLSILRLT-R--AFSSHFQHVVVTQH------------------------------------------------------
Q9VP78_DROME/2-228SLNLCKII-D--QYQERLCILSQEEC------------------------------------------------------

PF10456

LST4_CAEEL/336-566VERFQRSV-K--TSEEAMRVMQERMN------------------------------------------------------
SNX33_MOUSE/337-572VDTFKAFS-K--KMDDSVLQLSNVAA------------------------------------------------------
SNX9_MOUSE/358-593CDAVGKFT-K--AMDDGVKELLTVGQ------------------------------------------------------
B3DFM9_DANRE/328-561VEGFKTFT-K--KMDENIIQVNVTIN------------------------------------------------------
H3D6R4_TETNG/309-534IEGFKTFT-K--KLDENIVVVNTTII------------------------------------------------------
Q5SPP2_DANRE/343-579CEQFSRFT-K--AMDDGVKDLLTVGN------------------------------------------------------
Q7ZZB1_DANRE/321-560YEVYNQFT-R--SMDNSVKELLAVGN------------------------------------------------------

PF16746

B4JN99_DROGR/14-257VKDLMSAA-K..VLSTRMKQLAILLN------------------------------------------------------
F4Q2Y2_DICFS/66-307AKQSCELG-I..EYNSSFKSFADGLL------------------------------------------------------
M3XXB2_MUSPF/5-238CIVMIDTG-K..AFCVANKQFMNGIR------------------------------------------------------
K7ITA3_NASVI/23-266VKDLLSAA-K..NLSRAQRAFSKTLQ------------------------------------------------------
F1RM37_PIG/6-249GKSLISAL-K..NLSSAKRKFADSLN------------------------------------------------------
H2LTL2_ORYLA/7-250GKNLINAT-K..QLGMAQRKFAQCLG------------------------------------------------------
I3KTC3_ORENI/3-236CSGMIEAG-R..AYVSANKLFVNGIR------------------------------------------------------
F4WSP8_ACREC/5-234CSLTIDTG-K..AFVGQQNQFANSLW------------------------------------------------------
DP13B_MOUSE/7-247MQRVYGAQ-N..EMCLATQQLSRQLL------------------------------------------------------
G1PMF3_MYOLU/5-238GNGLLESG-R..HYVAAGRAFVVGIC------------------------------------------------------
OPHN1_MOUSE/6-249GSALISAM-R..NYSSAVQKFSQTLQ------------------------------------------------------
F1Q973_DANRE/5-238CIGMIDAG-K..AYNTANKQFVSGIR------------------------------------------------------
F7FXM1_CALJA/7-247MHRIYDAQ-N..ELSAATHLTSKLLK------------------------------------------------------
G3NM88_GASAC/5-238CGKMVEAG-Q..AYNAANQLFLTGLA------------------------------------------------------
H2V3K9_TAKRU/6-249GNMLVSAL-K..SLSIAVQRFSQSLQ------------------------------------------------------
G3I418_CRIGR/3-236CSGMIEAG-K..AYVTTNRLFVSGVR------------------------------------------------------
D6X007_TRICA/5-238CGTMVDSG-K..TYVAQQSLFANSLW------------------------------------------------------
A1L1F5_DANRE/5-238CHTMLETG-R..AYCQNSKSFVNGLK------------------------------------------------------
RHG10_HUMAN/6-249GKNLIAAT-K..SLSVAQRKFAHSLR------------------------------------------------------
F1KTZ7_ASCSU/5-245LDQWCVAQ-K..AATAAASNLASVIA------------------------------------------------------
Q7QFM2_ANOGA/6-239CSAAVDSG-K..EYIRHQSTFATSLW------------------------------------------------------
H3DNY8_TETNG/6-252GNMLMAAF-RINNINVCKNMFRFLLN------------------------------------------------------
G3NIM1_GASAC/8-251MQRVFGAQ-S..EMGLATEQLSRQLL------------------------------------------------------
M4AHM4_XIPMA/6-249GNSVITAI-K..GYSLAVQKFSQTLS------------------------------------------------------
G3VVX9_SARHA/37-270GSSLLESG-R..HYLATCRAFISGIQ------------------------------------------------------
H2V5X4_TAKRU/5-237CISMIDAG-K..AYNAANKQFVSGIR------------------------------------------------------
H2V5X3_TAKRU/5-238CISMIDAG-K..AYNAANKQFVSGIR------------------------------------------------------
H2ZSD6_LATCH/7-247MQRVYGAQ-N..EMCLATQQLSNQLL------------------------------------------------------
J0DMU1_LOALO/6-249CRELIQCT-R..KLSVAQKAFAKSLK------------------------------------------------------
H3D4E5_TETNG/3-236CSGMMEAG-K..AYVGASRLFVGGIR------------------------------------------------------
F1RB27_DANRE/8-247MQRVFGAQ-N..EMALATEQLSKQLL------------------------------------------------------
B3LV47_DROAN/5-238CNVAVESG-K..EYVKNQSAFAMSLW------------------------------------------------------
I3JB30_ORENI/5-238CQAMLEAG-K..AYCQTSKSFVNGLR------------------------------------------------------
F4P1K5_BATDJ/19-262CRIYTESL-T..KTNDIGLAVSRRVS------------------------------------------------------
E9G538_DAPPU/5-239CNLTIDAG-K..TYLGFQNNLVQSML------------------------------------------------------
H2L7W1_ORYLA/9-252GKALVQAL-K..SLSTAKRKFADSLN------------------------------------------------------
K1R604_CRAGI/6-250CQRIMKAQ-N..ELCAATQSLSQHLR------------------------------------------------------
E4WY10_OIKDI/49-293IQDLINKG-R..AFSDAQQILNQDLQ------------------------------------------------------
E0W416_PEDHC/5-238CGLMLEMG-K..TYVIHQNLFTNSLW------------------------------------------------------
A7SEL6_NEMVE/10-244CNAMVDSG-K..AFISSTSLLLSSIH------------------------------------------------------
H2KZV7_CAEEL/6-249CKELIACT-K..KLSTAQRAFAKTLS------------------------------------------------------
F6SDM6_CIOIN/5-238CSVMVDSG-K..VYNNACKGFIGSVN------------------------------------------------------
H2V5X0_TAKRU/5-235CISMIDAG-K..AYNAANKQFVSGIR------------------------------------------------------
Q551Q8_DICDI/30-270SKQSCELG-E..DYNITFKNFVDDLL------------------------------------------------------
F6UY72_CIOIN/6-249AKNMLNAS-R..QQGKMMNVFNDRLQ------------------------------------------------------
Q17GT7_AEDAE/5-238CSLAVDSG-K..EYIRNQSAFATSLW------------------------------------------------------
G6CUX2_DANPL/8-251VKDVVQAA-K..RLGAAQLALAASME------------------------------------------------------
E1G6B5_LOALO/11-246LNSLAEHG-K..NYVNDFFTLSAIIS------------------------------------------------------
C3ZIA5_BRAFL/5-238CNGMMEAG-K..AYNTANGAFIRGVK------------------------------------------------------
F5HLS9_ANOGA/7-247IKDLLAAA-K..SLSRAQRTLSRSLK------------------------------------------------------
A7RS04_NEMVE/6-249CKALMKAT-E..NLSKAKRSFAQVLD------------------------------------------------------
E9GSI6_DAPPU/6-249VKDLVNAA-R..ALSRAQRSLATSLM------------------------------------------------------
F1Q975_DANRE/5-238CGQMVDAG-Q..NYTSCNQLFLCALS------------------------------------------------------
B7QNY3_IXOSC/6-251VKELLTAA-K..SLSRAQRSLANTFM------------------------------------------------------
G1MY05_MELGA/6-253GKNLIAAT-K..NLSAAQRKFAHSLR------------------------------------------------------
G6DT66_DANPL/5-238CSVMIESG-K..TYMNHRSTFTNALW------------------------------------------------------
H3D0T3_TETNG/38-270CGRMVEAG-Q..AYSAANQLFLSGLS------------------------------------------------------
F1QMT1_DANRE/5-238CIGMIDAG-R..VYNQANKQFVNGIR------------------------------------------------------
H2RJ90_TAKRU/5-238CSKMVEAG-Q..AYNAANQLFLSSLT------------------------------------------------------
M4AKB4_XIPMA/5-238CGKMVEAG-Q..AYNAANQLFLSGLA------------------------------------------------------
E9BWJ0_CAPO3/31-270QRAVVDAC-R..THSRSHRAFAEVLN------------------------------------------------------
F6ZTY0_XENTR/7-247MQRVYGAQ-N..EMCLATQQLSRQLL------------------------------------------------------
J9K1I7_ACYPI/5-235YSLMIDSG-K..TYVSQQSLFANSLW------------------------------------------------------
W4YQP0_STRPU/5-238CNIMVEAG-K..AYNNAFGSFITGTN------------------------------------------------------

PF09325

Q6BQ29_DEBHA/424-659---------------------E-ISLTIDELASLEIS..KIT--------------------------------------
Q7PVK3_ANOGA/210-443---------------------G-VAKSAALLSTCEEH..TGL--------------------------------------
VPS5_YEAST/439-673---------------------E-FSSMVETLASLNVS..EPN--------------------------------------
SNX2_HUMAN/281-514---------------------A-FAKSAAMLGNSEDH..TAL--------------------------------------
Q86IF6_DICDI/292-523---------------------E-LTSAGLSFSSCEIPVRQDI--------------------------------------
Q5A1F2_CANAL/431-666---------------------E-IALTMSELAGLEIS..KVT--------------------------------------
Q5B786_EMENI/288-522---------------------E-FSTSIQSLAAVELS..PLL--------------------------------------
A8WVN0_CAEBR/231-466---------------------L-LGKALSMLAACEES..TSL--------------------------------------
Q5KI36_CRYNJ/639-879---------------------D-YAESLTALAESDLG..ASL--------------------------------------
VPS5_SCHPO/340-576---------------------D-FGEAVGNLSLVDLE..PTL--------------------------------------
Q6CJR1_KLULA/428-663---------------------E-FSETLKALADLELS..NRT--------------------------------------
Q6CGR9_YARLI/393-628---------------------D-VAAVLSSLGTVEIS..KHL--------------------------------------
Q759R2_ASHGO/362-598---------------------E-FAATINSLVELEAS..KRI--------------------------------------
Q4P3M6_USTMA/831-1062---------------------D-LAQVLTTLSGSSLS..RSL--------------------------------------
Q6FKM2_CANGA/398-636---------------------D-LASLIESLGALDVT..KGS--------------------------------------
E4X2N5_OIKDI/242-473---------------------N-LARASNMLANAEDK..QDL--------------------------------------
F7G234_MACMU/220-452---------------------Q-FAKSLAMLGSSEDN..TAL--------------------------------------
G4UCZ3_NEUT9/309-540---------------------E-FSASLHALSTVELS..PTL--------------------------------------
G4VRE2_SCHMA/197-429---------------------G-LSRSVLLLANVEEN..TGL--------------------------------------
Q9VQQ6_DROME/221-452---------------------L-VAKSAAMLSTCEEH..TGL--------------------------------------

PF03114

RHG17_RAT/1-239------...........LPLTA-LAQNMQEASAQL.E--ESL-----------------------------------..L
RHG44_HUMAN/1-242------...........LPLTT-LAQCLMEGSAILGD--DTL-----------------------------------..L
SH3G3_MOUSE/6-242------LRGQVKATGYPQTEGL-LGDCMLKYGKELGE--DSA-----------------------------------..F
SH3G3_DROME/6-241------LSGQAKSNTYPQPEGL-LAECMLTYGKKLGE--DNS-----------------------------------.VF
Q20005_CAEEL/8-266------KK...DGAIRQNNLEQ-LSTAMTEAGEQFGE--TTP-----------------------------------..Y
HOB1_SCHPO/6-247------...............G-FADACIEIYKPISG--RAS-----------------------------------DPE
O61843_CAEEL/6-240------VRGTTKTSPYPQTEGM-LADVMQKYGQQLGD--NSD-----------------------------------..L
Q8SYD9_DROME/13-268------S.....KPKRLSNLEH-LALDMIEAGGDFGQ--DLP-----------------------------------..Y
AMPH_RAT/13-233------...............K-LTESLHEVYEPDWY--GRE-----------------------------------...
RV167_YEAST/6-247------...............G-FAKSMEEIFKPISG--KMS-----------------------------------DPN
Q9XW43_CAEEL/24-258------.........DESPWEL-LGGWINYMGTYHFN--GPQ-----------------------------------...
Q94211_CAEEL/24-258------.........GENPWEV-LGGWLNYLGKNQFD--GQH-----------------------------------...
Q21004_CAEEL/9-230------...............Q-LRDTIRDAYEPEWP--DRE-----------------------------------...
YNQA_SCHPO/1-230------LL...DEKDKQLPVTH-VGSSFVELGQALSH--SSS-----------------------------------..N
DNMBP_HUMAN/997-1207------...............V-AAVSMWDVCMERGH--RDL-----------------------------------...
SHLB1_HUMAN/11-254------K.....APSRINNPEL-LGQYMIDAGTEFGP--GTA-----------------------------------..Y
RV161_YEAST/6-232------...............T-IAEVISNLYDDSKY--VAG-----------------------------------GGY
Q1K8A1_NEUCR/3-230------........DKSIPTTY-LGKTMIGHGEDFAS--DSE-----------------------------------..F
Q1MT71_DANRE/6-241------MRGQVKSLGYPQAEGL-LGECMLKYGRDMGE--DTN-----------------------------------..F
Q6TGT7_DANRE/6-241------IRGHVKAVGYPQTEGI-LGDCMLQYGSELGA--ESG-----------------------------------..F
Q7S3B9_NEUCR/6-246------...............E-FSKAMTEIYKPISG--RMS-----------------------------------DPD
Q7S814_NEUCR/6-229------...............R-IAETIDAFYGEAGA--KDG-----------------------------------...
Q8BXU5_MOUSE/6-241------IRGQEKGPGYPQAEAL-LAEAMLKFGRELGD--DCN-----------------------------------..F

PF10455

MUG64_SCHPO/18-286...................SRT-LYNAISRAASEAT...TKM......................................
A3GFN0_PICST/37-331..........AIQTTSVLLPKT-LYGALSVLAEKHS...QEL......................................
A5DTV0_LODEL/37-351RKAGADGSLVTIQPTSGGIPRT-LFGHLSEILAKQS...EELQ.....................................
A7TPP1_VANPO/27-288...................PRT-LNYAVSKVSMGASEQFQKL......................................
GVP36_YEAST/27-299...................PKT-LNYALSKVALNSSECLNKM......................................
YP148_YEAST/45-432...........SNHDDAFLPRS-FAQAISKAAVDCECEFQNLEHNEKAELKKKKESIKTAQTTEAQGADHNEEDEEDEED
Q59WJ7_CANAL/37-331.........VSIQPTSPQLPKT-LFGHLAEICAKHS...DEL......................................
Q6CPI5_KLULA/40-383............TAENGLLPRS-FAQALSKAATDSALILKQLKAEETRTNQEESQEGADQK.PAEETKAEPELEAEADED
Q6FKU8_CANGA/30-382..........TDKEVSHEGPPS-FASAIARAGKDSQLIFESIETK..................................D
Q753K3_ASHGO/49-359...........KQAAGSSDPPS-FAHALHRAAKGSQGIIQELKEQAEE...........................EQEQE

PF06730

F92A1_HUMAN/1-219---------------------L-LVNE------INAY--AAT--------------------------------------
Q9VK91_DROME/1-222---------------------E-LAKS------VKSY--ADD--------------------------------------

PF08397

BAIP2_HUMAN/17-237---------------------L-ASES------QG.S--KEL--------------------------------------
MTSS1_HUMAN/16-237---------------------M-ATNT------RGGT--REI--------------------------------------
MTSSL_HUMAN/15-239---------------------M-ATNT------RGAT--RDI--------------------------------------
BI2L2_HUMAN/16-226---------------------R-ALQS------PT.S--QIL--------------------------------------
F6WG35_XENTR/28-238---------------------M-AINT------RGAT--KEI--------------------------------------

PF06456

ICA69_MOUSE/21-248---------------------E-LGKFLRSQGFQDKT--RA.--------------------------------------
PICK1_MOUSE/117-352---------------------A-FGDVFSVIGVREPQ--PAA--------------------------------------
RIC19_CAEEL/27-255---------------------V-LGKYLKEKGKIDKT--EAV--------------------------------------
YL87_CAEEL/59-286---------------------K-LSESFYQLSM..KE--EQI--------------------------------------
O18246_CAEEL/113-348---------------------E-FGSIFCDLAAHEKQ--QTA--------------------------------------
ARFP2_HUMAN/89-316---------------------A-LGDAFADLSQ..KS--PEL--------------------------------------
ARFP1_HUMAN/121-348---------------------Q-LGDAFADLSL..KS--LEL--------------------------------------
ICA1L_MOUSE/15-242---------------------E-LGLFLKFQAERDST--QA.--------------------------------------
Q8SY07_DROME/119-354---------------------S-FGDCFTQISVHEPQ--QRA--------------------------------------
Q9VGQ8_DROME/106-331---------------------A-LADSFADLAQ..KN--PEL--------------------------------------
Q9VP78_DROME/2-228---------------------V-FGRFLKEAGK..RS--RTT--------------------------------------

PF10456

LST4_CAEEL/336-566---------------------M-FQKVFAG-PVKQNW--QKM--------------------------------------
SNX33_MOUSE/337-572---------------------E-LVRKHVG-GFRKEF--QKL--------------------------------------
SNX9_MOUSE/358-593---------------------E-HWKRCTG-PLPKEY--QKI--------------------------------------
B3DFM9_DANRE/328-561---------------------E-FARKQIT-GFKKEY--QRV--------------------------------------
H3D6R4_TETNG/309-534---------------------E-FARKQAT-GFKKEY--QKV--------------------------------------
Q5SPP2_DANRE/343-579---------------------E-HWKRCTG-PLPKEY--QRI--------------------------------------
Q7ZZB1_DANRE/321-560---------------------L-HWKRCTG-PLQKEY--RQI--------------------------------------

PF16746

B4JN99_DROGR/14-257---------------------D.FNFEC.....IGTA--QTD--------------------------------------
F4Q2Y2_DICFS/66-307---------------------D.YRLDA....KVNDE--LLE--------------------------------------
M3XXB2_MUSPF/5-238---------------------D.LAQYS.....SNDA--VVE--------------------------------------
K7ITA3_NASVI/23-266---------------------N.FSFEC.....IGET--QTE--------------------------------------
F1RM37_PIG/6-249---------------------E.FKFQC.....IGDA--ETD--------------------------------------
H2LTL2_ORYLA/7-250---------------------E.FQFEY.....IGDA--KTD--------------------------------------
I3KTC3_ORENI/3-236---------------------D.LSQQC.....KKEE--MIS--------------------------------------
F4WSP8_ACREC/5-234---------------------E.LSLYF.....SDDP--EIM--------------------------------------
DP13B_MOUSE/7-247---------------------A.YEKQNFA.LGKGDE--EVI--------------------------------------
G1PMF3_MYOLU/5-238---------------------D.LARLG.....PPEP--MMA--------------------------------------
OPHN1_MOUSE/6-249---------------------S.FQFDF.....IGDT--LTD--------------------------------------
F1Q973_DANRE/5-238---------------------E.LAQQS.....ATDD--VIE--------------------------------------
F7FXM1_CALJA/7-247---------------------E.YEKQRFP.LGGDDE--VMS--------------------------------------
G3NM88_GASAC/5-238---------------------E.LSAHN.....KTDD--VIT--------------------------------------
H2V3K9_TAKRU/6-249---------------------E.FQFEC.....IGDA--ETD--------------------------------------
G3I418_CRIGR/3-236---------------------D.LSQQC.....QGDT--VIS--------------------------------------
D6X007_TRICA/5-238---------------------E.LSAHF.....REDS--AVL--------------------------------------
A1L1F5_DANRE/5-238---------------------E.LGHHC.....SEDR--SMG--------------------------------------
RHG10_HUMAN/6-249---------------------D.FKFEF.....IGDA--VTD--------------------------------------
F1KTZ7_ASCSU/5-245---------------------A.YRFQKLP.LDVASY--DMP--------------------------------------
Q7QFM2_ANOGA/6-239---------------------D.LQKHF.....QDSK--NST--------------------------------------
H3DNY8_TETNG/6-252---------------------D.LLKSC.....FSPA--KHD--------------------------------------
G3NIM1_GASAC/8-251---------------------D.YEKKNFA.LGKGDE--EVI--------------------------------------
M4AHM4_XIPMA/6-249---------------------A.FQFDF.....IGDS--LTD--------------------------------------
G3VVX9_SARHA/37-270---------------------E.LSNLG.....PPEP--MMI--------------------------------------
H2V5X4_TAKRU/5-237---------------------E.LAQQS.....TTDE--VIE--------------------------------------
H2V5X3_TAKRU/5-238---------------------E.LAQQS.....TTDE--VIE--------------------------------------
H2ZSD6_LATCH/7-247---------------------A.YEKQNFA.LGKGDE--EVI--------------------------------------
J0DMU1_LOALO/6-249---------------------E.FKIVT.....IGST--QTD--------------------------------------
H3D4E5_TETNG/3-236---------------------D.LSQHC.....QKDQ--VTS--------------------------------------
F1RB27_DANRE/8-247---------------------E.YEKQNFA.LAKGDE--EVI--------------------------------------
B3LV47_DROAN/5-238---------------------D.LQQHF.....LDNK--NAH--------------------------------------
I3JB30_ORENI/5-238---------------------E.LGHQC.....SGDK--MMA--------------------------------------
F4P1K5_BATDJ/19-262---------------------S.NKYIS....LLGNT--ENI--------------------------------------
E9G538_DAPPU/5-239---------------------Q.VSMHF.....KGDP--AVS--------------------------------------
H2L7W1_ORYLA/9-252---------------------D.FKFQC.....IGDA--ETD--------------------------------------
K1R604_CRAGI/6-250---------------------D.FEIQKFP.LESDDS--VLS--------------------------------------
E4WY10_OIKDI/49-293---------------------NGFQIGDIGELSQDEM--YMK--------------------------------------
E0W416_PEDHC/5-238---------------------D.LSSYF.....KEDV--EIV--------------------------------------
A7SEL6_NEMVE/10-244---------------------V.LTKYF.....NEDE--LVQ--------------------------------------
H2KZV7_CAEEL/6-249---------------------E.FKFET.....VGTN--QTD--------------------------------------
F6SDM6_CIOIN/5-238---------------------D.VGYAS.....TDDA--FVQ--------------------------------------
H2V5X0_TAKRU/5-235---------------------E.LAQQS.....TTDE--VIE--------------------------------------
Q551Q8_DICDI/30-270---------------------T.YKGEAGS.GFVRDE--LLE--------------------------------------
F6UY72_CIOIN/6-249---------------------N.FQFDC.....IGEN--LTD--------------------------------------
Q17GT7_AEDAE/5-238---------------------D.LQKHF.....QEDK--SST--------------------------------------
G6CUX2_DANPL/8-251---------------------Q.FEFAC.....IGAS--MTE--------------------------------------
E1G6B5_LOALO/11-246---------------------Q.LCYEF....LPQDP--SLL--------------------------------------
C3ZIA5_BRAFL/5-238---------------------E.LSVYF.....RGDQ--QVN--------------------------------------
F5HLS9_ANOGA/7-247---------------------E.FNFEC.....IGST--QTD--------------------------------------
A7RS04_NEMVE/6-249---------------------N.FRFEC.....IGEV--ETD--------------------------------------
E9GSI6_DAPPU/6-249---------------------S.FQFEC.....IGNS--QTD--------------------------------------
F1Q975_DANRE/5-238---------------------E.FTAYH.....KSDG--VIL--------------------------------------
B7QNY3_IXOSC/6-251---------------------N.FRLEC.....IGNS--QTD--------------------------------------
G1MY05_MELGA/6-253---------------------D.FKFEF.....IGDA--ETD--------------------------------------
G6DT66_DANPL/5-238---------------------D.LSSSF.....SEDS--TVV--------------------------------------
H3D0T3_TETNG/38-270---------------------Q.LSVFQ.....EKPS--IIT--------------------------------------
F1QMT1_DANRE/5-238---------------------D.LALQS.....TRDE--VIG--------------------------------------
H2RJ90_TAKRU/5-238---------------------K.LCSYQ.....EQHA--VLT--------------------------------------
M4AKB4_XIPMA/5-238---------------------E.LLLYQ.....KKES--VMM--------------------------------------
E9BWJ0_CAPO3/31-270---------------------G.FNFAR.....VSES--ATD--------------------------------------
F6ZTY0_XENTR/7-247---------------------A.YEKQNFA.LGKGDE--EVI--------------------------------------
J9K1I7_ACYPI/5-235---------------------E.MGLCF.....RDDT--SST--------------------------------------
W4YQP0_STRPU/5-238---------------------E.IMKYF.....RGDD--LVQ--------------------------------------

PF09325

Q6BQ29_DEBHA/424-659----------TDLLSSFSDVQLKL-KENLDRINLQDQLTL-GFTIEEYL-R-IIG---S-IK--YVFE--SRSKIYQQYY
Q7PVK3_ANOGA/210-443----------SQALSQLADVEEKV-ELLRSEQANSDLYIL-SETIKDYI-G-LFG---A-IK--DVFH--ERVKVFQNWQ
VPS5_YEAST/439-673----------SELLNNFADVHKSI-KSSLERSSLQETLTM-GVMLDDYI-R-SLA---S-VK--AIFN--QRSKLGYFLV
SNX2_HUMAN/281-514----------SRALSQLAEVEEKI-DQLHQEQAFADFYMF-SELLSDYI-R-LIA---A-VK--GVFD--HRMKCWQKWE
Q86IF6_DICDI/292-523----------ANGYQRLTEVENNI-RQGMEDLSNNEQGYF-EEGIRDYL-R-AIS---S-VK--ELLN--DRLDALMSMQ
Q5A1F2_CANAL/431-666----------SDLLSAFSEVELKI-KDNLDRINLQDQLTL-GFTIEEYL-R-IIG---S-IN--FVFD--TRLNVYQQYH
Q5B786_EMENI/288-522----------SGPLYGLSDLQLRI-KELYDRQAQQDVLTL-GITIDEYL-R-LIG---S-VK--TAFS--QRQKAYHSWH
A8WVN0_CAEBR/231-466----------SRALSALTDVTESV-SNAWGKQAEIDNAKF-SEAIYEYI-M-LIS---A-LK--DVFG--ERVRAWQQWQ
Q5KI36_CRYNJ/639-879----------SAALSQMSGLVARE-GDYAEWHAKSEVGEL-LNLADEYI-R-FIG---S-VR--SAFA--ARVDSWKVWQ
VPS5_SCHPO/340-576----------SSKFDGLSQLQVEL-RFVQERKVAQDNLTL-GTTLEEYI-R-YVE---S-AK--NAFT--TRQKLWQTWQ
Q6CJR1_KLULA/428-663----------SDLLQNFAEVHLRI-KESTSRSSMQDSLTL-GITIDDNL-R-AIG---S-VK--AVLN--QRKKLGYYIL
Q6CGR9_YARLI/393-628----------SNVLYQFSDAVERI-KEICARQSQQDMVTL-GSTMDEYL-R-VIG---S-VR--STFS--QRSKHFQVIQ
Q759R2_ASHGO/362-598----------SSILSNFAEVHLRI-MESLQRTSLQDSLTL-GVTIDEYL-R-SLG---S-IK--AVFN--QRAKLGYYLV
Q4P3M6_USTMA/831-1062----------STCFAGLAEVKRRA-IELEDMQAEADVRQL-GTTMYEYE-R-VVG---S-VR--KAFT--VRTEIWAKSA
Q6FKM2_CANGA/398-636----------TKLCYELAETQKRV-KESLERDALQEAITM-GATLDEYV-R-SLA---S-LR--SIFY--QRAKLGYYLV
E4X2N5_OIKDI/242-473----------SRRLANVGTIYENL-GEIYTDLSDKDLYDF-SELLSDQV-R-GLD---G-IK--NILE--ARQKMWQNWQ
F7G234_MACMU/220-452----------SRALSQLAEVEEKI-EQLHQEQANNDFFLL-AELLSDYI-R-LLA---I-VR--AAFD--QRMKTWQRWQ
G4UCZ3_NEUT9/309-540----------SGPLDALSELQLTI-RDVYDRQAQQDVLTF-GIIIEEYI-R-LIG---S-VK--QAFS--QRQKAFYSWH
G4VRE2_SCHMA/197-429----------AQALHHLAETEGHV-ADLHALQAEAHTCHL-VEYSRELL-G-MVQ---A-CK--DVLS--ERVRIYRTWK
Q9VQQ6_DROME/221-452----------SRALSNLADVEEKI-ELLRSEQANSDFFIL-AEFIKDYL-G-LFG---A-IK--CIFH--ERVKAFQNWQ

PF03114

RHG17_RAT/1-239G..........KMLETCGDAENQL.AFELSQHEVFVEKEI-MDPLYGIAEV-EIP---N-IQ--KQRK--QLARLVLDWD
RHG44_HUMAN/1-242G..........KMLKLCGETEDKL.AQELIHFELQVERDV-IEPLFLLAEV-EIP---N-IQ--KQRK--HLAKLVLDMD
SH3G3_MOUSE/6-242G..........NSLVDVGEALKLM.AEVKDSLDINVKQTF-IDPLQLLQDK-DLK---E-IG--HHLR--KLEGRRLDYD
SH3G3_DROME/6-241A..........QALVEFGEALKQM.ADVKYSLDDNIKQNF-LEPLHHMQTK-DLK---E-VM--HHRK--KLQGRRLDFD
Q20005_CAEEL/8-266G..........SALLKVAQTENRL.GQAERELCGQAATNT-LLPIRRFLEG-DMK---T-IQ--KERK--VLNSKRLDLD
HOB1_SCHPO/6-247SYEQEGNAEGIEAAEAYKEIVYDL.QKNLASEMDVINTRI-VNPTGELL.K-IVK---D-VD--KLLL--KRDHKQLDYD
O61843_CAEEL/6-240G..........KSLNDAAETYRQM.ADIKYQMEDNVKQNF-LDPLTHLQNN-ELK---D-VN--HHRT--KLKGRRLDYD
Q8SYD9_DROME/13-268G..........QALIKVGQAEQKL.GQCEHDFIATSGICF-TQPLRKFLDG-EMK---T-IG--KERG--ILETKRLDLD
AMPH_RAT/13-233...............DVKMVGEKC.DVLWEDFHQKLVDGS-LLTLDTYL.G-QFP---D-IK--NRIA--KRSRKLVDYD
RV167_YEAST/6-247ATIPEDNPQGIEASEQYRAIVAEL.QETLKPDLALVEEKI-VTPCQELL.K-IIT---Y-IR--KMAT--KRNHKKLDLD
Q9XW43_CAEEL/24-258S..........KILDAYSIACGKI.GQKERQLQKRTRSHC-IKKMRMYTAD-ESV---E-LN--NHVA--HLKDLLIAID
Q94211_CAEEL/24-258S..........KMLEKYSSACGRI.AQKEIQVQKRTRSHL-IKKMRLYTGE-ESE---I-LN--SNVE--NLNNLLHAID
Q21004_CAEEL/9-230...............HLTAIFDNL.DIQTNELEKTVCDDL-PQTVTQYV.N-QFP---D-LK--KKIE--KRGRKLVDYD
YNQA_SCHPO/1-230S..........HTYIMYGKSMVEI.GHLQEEFMDYLNNSF-LANLENSL.A-EFK---A-LD--VKEK--KMENRRLVFD
DNMBP_HUMAN/997-1207..............EQFERVHRYISDQLFTNFKERTERLV-ISPLNQLL.S-MFT---G-PH--KLVQ--KRFDKLLDFY
SHLB1_HUMAN/11-254G..........NALIKCGETQKRI.GTADRELIQTSALNF-LTPLRNFIEG-DYK---T-IA--KERK--LLQNKRLDLD
RV161_YEAST/6-232N..........VGNYYLQCVQDFD.SETVKQLDGPLRETV-LDPITKFS.T-YFK---E-IE--EAIK--KRDHKKQDFD
Q1K8A1_NEUCR/3-230G..........SCLISMGRANERI.GQFQETFVGEATTTW-LESLERSL.A-MMK---E-YQ--AARK--KLESRRLAYD
Q1MT71_DANRE/6-241G..........GALVEMGEAMKRL.AEVKDSLDIDVKQNF-IDPFQTIVDK-DLK---D-IQ--HHLK--KLEGRRLDYD
Q6TGT7_DANRE/6-241G..........FALLEMGEALKQV.AQARDCMDVRVKRAF-IDPLQSLQQK-ELK---E-IG--FHLR--KLEGRRLDFD
Q7S3B9_NEUCR/6-246SLVPHGNYEGIAACEEYEAVVKDL.QETLAPELEMIEARV-IRPANELL.D-VIK---V-IR--KTAV--KREHKKLDYD
Q7S814_NEUCR/6-229............VSKSYKQAVEDLDAETIKALDGPYRTTV-LDPITRFC.A-YFP---D-VN--ECIK--KRGHKLLDYD
Q8BXU5_MOUSE/6-241G..........PALGEVGEAMREL.SEVKDSLDMEVKQNF-IDPLQNLHDK-DLR---E-IQ--HHLK--KLEGRRLDFD

PF10455

MUG64_SCHPO/18-286....GAGNPLSSAFGQISVLEEKV-GNLQGERDSAISKNF-CEQVRAVLYP-RFA---E-AH--RVKA--DVQDKRLQLE
A3GFN0_PICST/37-331..KTSA.APLSLALLQVSSSYLEI-ANARLVQDEKILAEV-NDKLVAILNE-QFI---K-VN--ELRK--KVYSTRSEFD
A5DTV0_LODEL/37-351.AKSEELNPLSFVLLQISSTYHEI-AAARLVQDDKIIKGL-NNQLVEILNQ-QFI---K-VN--ELRK--KVYLTRSQFD
A7TPP1_VANPO/27-288..HDTDDKRIANLLTNVGNAEASI-AEARLLQDHSIQAKF-NFQLREEIAQ-SIE---R-AS--KYRK--EVYHKRLKYD
GVP36_YEAST/27-299..FPTEEQPLASALLQFSDVQAKI-AQARIQQDTLIQTKF-NKNLRERLSF-EIG---K-AD--KCRK--DVHSMRLRYD
YP148_YEAST/45-432EEDDEDLSNLIKVFDSWSTCYKNI-DEGKAEMDSMMVKEF-NKKLETLINQ-DFK---K-VH--DLRK--KVEESRLKFD
Q59WJ7_CANAL/37-331..KSSE.HPLSFALLQVSSTYQEI-AVARLDQDKKIMSGL-NAELIRTLNE-SFI---K-VN--ELRK--KVYATRGEFD
Q6CPI5_KLULA/40-383EDEDEDVDNLIKAFESWTKCQLSI-DQSKAEMDSLMVKEF-NAKLSKLIET-DFK---K-GH--ELRA--KVQDARLNFD
Q6FKU8_CANGA/30-382EDEKEDIDELVKIFKIWSDCFYEI-SDSKTEMDQMMIKEF-NVKLEDYLQK-NFQ---K-IH--TLRA--KVEESRLNFD
Q753K3_ASHGO/49-359VEIDEDVESLIKMFGTWADAQYNM-DIAKREMDQFMVKEF-NEKLKHLLEV-EFK---K-GH--TLRR--KVEESRLTFD

PF06730

F92A1_HUMAN/1-219----------ETPHLKL..GLMNF-ADEFAKL-QDYRQAE-VERLEAKVVE-PLKTYGTIVK--MKRD--DLKATLTARN
Q9VK91_DROME/1-222----------EEINESLCQGLKSF-TNAVTIM-GDYMDIN-VHRLEHKIVN-ELAQFEQLCK--STRD--NLRLAVIARD

PF08397

BAIP2_HUMAN/17-237----------GDVLFQMAEVHRQI-QNQLEEMLKSFHNEL-LTQLEQKVEL-DSRYLSAALK--KYQT--EQRSKGDALD
MTSS1_HUMAN/16-237----------GSALTRMCMRHRSI-EAKLRQFSSALIDCL-INPLQEQMEE-WKKVANQLDK--DHAK--EYKKARQEIK
MTSSL_HUMAN/15-239----------GSALTRMCMRHRSI-ETKLRQFTNALLESL-INPLQERIED-WKKAANQLDK--DHAK--EYKRARHEIK
BI2L2_HUMAN/16-226----------GEILVQMSDTQRHL-NSDLEVVVQTFHGGL-LQHMEKNTKL-DMQFIKDSRQ--HYEL--EYRHRAANLE
F6WG35_XENTR/28-238----------GSALTRMCMRHRNI-ESRLKHLTVALSDSL-INPLEGKIEE-WKKVANQLDK--DHAK--EYKKARADIK

PF06456

ICA69_MOUSE/21-248----------GKMMQATGKALCFS-SQQRLA-LRNPLCRF-HQEVETFRHR-AIS---D-TW--LTVN--RMEQYRTEYR
PICK1_MOUSE/117-352----------SEAFVKFADAHRSI-EKFGIR-LLKTIKPM-LTDLNTYLNK-AIP---D-TR--LTIK--KYLDVKFEYL
RIC19_CAEEL/27-255----------GRILIAVGRSLLFS-SHRLNA-ARIGVSTF-YNKLSVFVER-AIG---D-CS--QTIE--AVQMCRTEYR
YL87_CAEEL/59-286----------KAQCTMTSETMRGV-GEQAAS-LDACLRYF-ISSMETVYNQ-TIT---D-TL--HTIY--NTESARIEYD
O18246_CAEEL/113-348----------NEAFSSFGDKHRMI-AKKQSE-SAVPLQKM-VSDLQVYIDH-VVP---D-TR--LTIK--KYLDVKYEYL
ARFP2_HUMAN/89-316----------QEEFGYNAETQKLL-CKNGET-LLGAVNFF-VSSINTLVTK-TME---D-TL--MTVK--QYEAARLEYD
ARFP1_HUMAN/121-348----------HEEFGYNADTQKLL-AKNGET-LLGAINFF-IASVNTLVNK-TIE---D-TL--MTVK--QYESARIEYD
ICA1L_MOUSE/15-242----------GEMMDAAGKALCSS-AKQRLA-LCTPLSRL-KQEVATFSQR-AIS---D-TL--VTIN--RMERARTEYR
Q8SY07_DROME/119-354----------SEAFRTFGEFHRTL-EKDGLG-IIKQIKPV-LADLGTYLNK-AIP---D-TK--LTVR--RYADAKFTYL
Q9VGQ8_DROME/106-331----------QKEFTCNSETQRNL-TKNGEL-LLNALNFF-ISSVNTLCNK-TID---D-TL--LTIR--QYETARIEFD
Q9VP78_DROME/2-228----------GGSIAHTAKAVSFA-GQQRMC-VRVPLLRL-QHEVDVFRCR-AIK---D-TE--QTLQ--TMEKERTEYR

PF10456

LST4_CAEEL/336-566----------GSAFKTLQQSFEID-ETVASRRLTEALAYT-ASEYHEIGQV-FDA---H-TK--NDME--PVLENLYSYK
SNX33_MOUSE/337-572----------GSAFQAISHAFQMD-PPFRSDALNNAISHT-GRTYETVGEM-FAE---Q-PK--HDLF--QMLDTLSLYQ
SNX9_MOUSE/358-593----------GKALQSLAAVFSSS-GYQGETDLNDAITEA-GKTYEEIASL-VAE---Q-PK--KDLH--FLMECNHEYK
B3DFM9_DANRE/328-561----------GQAFRLLSQAFEVD-QQVFSSPLNKAMANT-GEVYETIGDY-FAE---Q-PR--QDLE--PISDLLAIYQ
H3D6R4_TETNG/309-534----------GQSFKLLAQAFELD-QQAYSAGLNRAIAGT-GDAYEAIGDY-FAE---Q-PR--QDLD--PISDLLDFYR
Q5SPP2_DANRE/343-579----------GKAFQNLSSVFTTS-GYEGEGTLTDAMTAA-GKTYEEIAQM-VAE---Q-PK--KDLH--FLMETNNEYK
Q7ZZB1_DANRE/321-560----------GKAFQNMSSVFNTS-GYPRESTLTEALTAT-GKTYEEIAEV-IAA---Q-PR--KDLH--FLLETNNEYK

PF16746

B4JN99_DROGR/14-257---DEN..VICESLKRFGAIIGTI-EDEREKMLTLADKHI.IESLEDFRKK.QIG...G.VK..ENKK..KFDKKTEKFC
F4Q2Y2_DICFS/66-307---........KGMIKFTNALKEI-CNYREVLHFEMEALI.HNPLQEFAEN.DLK...Q.VK..EHYK..KYDKYSQLHE
M3XXB2_MUSPF/5-238---........TSLTKFSDSLQEM-INFHTILFDQTQRSI.KAQLQNFVKE.DLR...K.FK..DAKK..QFEKVSEEKE
K7ITA3_NASVI/23-266---DET..HISQSLKEFGKLIALI-EDERDRMLERAYDQI.ILPLETFRKT.HIG...G.VK..EGKK..KFEKQTIKFC
F1RM37_PIG/6-249---DEM..CIARSLQEFATVLRNL-EDERIRMIENASEVL.LTPLEKFRKE.QIG...A.AK..EAKK..KYDKETEKYC
H2LTL2_ORYLA/7-250---DER..CIDESVQEFSSFLKNL-EDQRELMMRNITETL.MKPLEKFRKD.QLG...A.VR..AERK..KYEKETEKYY
I3KTC3_ORENI/3-236---........ECLEKCGESLQEM-VNYHTILFDQAQRSI.KQQLHTFIKE.DIR...K.FK..DTKK..QFDRVREDME
F4WSP8_ACREC/5-234---........AFLNKLIHALQEM-NKYHTILLDQASRTV.MKDLNNFIK........R.AK..ETRH..YFERISSDLD
DP13B_MOUSE/7-247---........STLHYFSKVMDEL-NGLHTELAKQLADTM.VLPVIQFREK.DLT...E.VS..TLKD..LFGLASSEHD
G1PMF3_MYOLU/5-238---........ECLEKFTESLNHK-LDSHAELLDATQHTL.QQQIQALVKE.GLR...G.FR..EARR..DFWRGAESLE
OPHN1_MOUSE/6-249---DEI..NIAESFKEFAELLNEV-ENERMMMVQNASDLL.IKPLETFRKE.QIG...F.TK..ERKK..KFEKDGERFY
F1Q973_DANRE/5-238---........SSLSTFAENLQEM-INYHTILFDQAQRSI.KSQLQTFIRE.DLR...K.FK..EAKK..QFDKVSEEKE
F7FXM1_CALJA/7-247---........STLQQFSKVIDEL-SSCHAVLSTQLADAM.MFPITQFKER.DLK...E.IL..TLKE..VFQIASNDHD
G3NM88_GASAC/5-238---........NCLSQFNQGLQEV-VSFHSMLFDQTQRAI.GQQLTNLCTQ.FLP...Q.LV..ETRR..EFVRIGEDLE
H2V3K9_TAKRU/6-249---DEI..SIAQSLKEFSQLLSTM-EEERKRLIQNADDVL.ISPLERFRKE.QIG...A.VK..EGKK..QFDKETERYY
G3I418_CRIGR/3-236---........ECLQRFGDSLQEM-VNYHTILFDQAQRSV.RQQLHNFVKE.DVR...K.FK..ETKK..QFDKVREDME
D6X007_TRICA/5-238---........ASLNKLIQSLQEM-NKFHTILLDQASRTI.LKNLTSFIKN.DIK...T.VR..DYKQ..HFEKISSEFD
A1L1F5_DANRE/5-238---........DCLEKFSKKLSAI-VSAQEELIETTQKDV.KLKLQNFVKD.DVK...R.FK..DVRK..EFERSSENLE
RHG10_HUMAN/6-249---DER..CIDASLREFSNFLKNL-EEQREIMALSVTETL.IKPLEKFRKE.QLG...A.VK..EEKK..KFDKETEKNY
F1KTZ7_ASCSU/5-245---........SVTSRVAQNLNEI-ASWMDLLVQQVGFCV.QCPVKKATAE.LDD...L.VE..TVRP..NYAEALSTMA
Q7QFM2_ANOGA/6-239---........NALAQLIQLLQEM-NRYHTTLLDQANRTV.LKNLTGFLRR.DIR...E.VK..EYRQ..IFNKVSENLD
H3DNY8_TETNG/6-252---DPV.CAARQSFKEFSQLLNMV-EEERRRLIQNADDVL.ITPLEKFRKE.QIG...A.AK..EGKK..KFDKETEKYY
G3NIM1_GASAC/8-251---........CTLQNFAKTVGEL-NSLHSELANQMADSM.VFPLIQFREK.DLSTLSE.IS..TLKE..IFGIATDEHE
M4AHM4_XIPMA/6-249---DEI..NIAESFQEFAGLLQEV-ERDRMMLVQNASNLL.IRPLEKFRKE.QIG...A.TK..EKKK..KFEKEGEKYY
G3VVX9_SARHA/37-270---........ECLDKFTESLSHK-INCHEDLLNATQQTL.KQQIQSFVKE.SLR...G.FW..EARR..EFWKGAESLE
H2V5X4_TAKRU/5-237---........SSLTKFAESLQEM-INYHTILFDQAQRSI.KTQLQTFVKD.QLR......F..EMAK..LFHGELDE.K
H2V5X3_TAKRU/5-238---........SSLTKFAESLQEM-INYHTILFDQAQRSI.KTQLQTFVKE.DLK...Q.GKGRNQRA..SLVYFILGFT
H2ZSD6_LATCH/7-247---........STLQHFAKVVDEL-NALHTELTRQLADKM.VLPIIQFREK.DLT...E.IS..TLKD..LFVLSSNEHD
J0DMU1_LOALO/6-249---DER..KIAECVSKFGDFITQI-EDHREKIIEDSEIHF.IEPLRKFRVE.GIG...K.VL.HVDKK..RYEKESNKFY
H3D4E5_TETNG/3-236---........EFLEKCGESLQEI-SNYQTILLDQAQRSV.KQQLHNFVRE.DVR...K.FK..ETKK..HFDKVREDLE
F1RB27_DANRE/8-247---........NTLQQFAKSVEEL-NALHSELSTQIADKM.VFPMVQFREK.DLT...E.IS..TLKE..IFSIATDEHE
B3LV47_DROAN/5-238---........NALGKLIDCFQEM-NKFHTILLDQASRTV.LKNLTLFVKD.DIN...Q.VK..DYKG..HFLKVSEGYD
I3JB30_ORENI/5-238---........DCLEKFSKKLNVI-FEAQGEVIETTQKSV.RAKLQSFVKE.DVR...R.FK..DRRK..EFEKSSEALE
F4P1K5_BATDJ/19-262---RT....VSESMINIHHLRLKM-ARRYQKYQGTLDSIFCMAFVNHTIKL.INR...S.IQ..EARL..DYEKSVEKFE
E9G538_DAPPU/5-239---........QALNKVANSLQET-IKYHSILIDQTSRSV.SRSLNNFLKK.DLK...Q.VK..DSRQ..HFDKISADLD
H2L7W1_ORYLA/9-252---DEI..CIAKSLQEFAAVLQNL-EDERTRMIENANDVL.ILPLERFRKE.QIS...A.AK..EAKK..KYDKETEKYC
K1R604_CRAGI/6-250---........STLKQFSSYLDDV-SSIQQVLSAQFSETM.MYPLSRFLQA.DLE...E.VT..TLCE..MYQIASNEHD
E4WY10_OIKDI/49-293---........NSLKECSEMFRTY-MDNFEIMLESMKKW..KMKIDRFREN.RLE...N.AY.SEKRR..AYKKYRDKYY
E0W416_PEDHC/5-238---........SYLNKLIHSLQEM-NKFQTILLDQANRII.TRNLTSFIKN.DIK...K.VK..ESHA..EFEKISSLFD
A7SEL6_NEMVE/10-244---........GPLKKFSQTFEEL-NNFFKTLLDQTQMSI.STTLQQFVKN.DVK...R.VK..ETKK..LFDKISDELD
H2KZV7_CAEEL/6-249---DER..FIATCLKEFGSLINQV-EDERMKLVGQAEESY.LEPIKKFRTE.AIG...RTLK..EEKN..KYDKESSKFY
F6SDM6_CIOIN/5-238---........GTLKRFTSTMSEL-SSFHTMLFDQAQRSV.RTQLNNFLRE.EVK...P.TK..DLKK..TFDKVSDDYL
H2V5X0_TAKRU/5-235---........SSLTKFAESLQEM-INYHTILFDQAQRSI.KTQLQTFVKEGGIR...G.PR..WSIS..YFATGSAGLT
Q551Q8_DICDI/30-270---........KSMIKFSTALKEI-CNFRELLHIEMDALI.TGPLQSFAEN.DLR...Q.VK..EQCK..KYDKYSQQYD
F6UY72_CIOIN/6-249---TEK..GIAGSLKEFGLMLEEV-ANDWSSTIERSELQL.IKPLEDFRKE.HIH...S.YR..SSKK..AFDKASERYY
Q17GT7_AEDAE/5-238---........SALTTLIHCLQEM-NKFHTTLLDQASRTV.LKNLTSFLKK.DVK...E.VK..DYKQ..IFTKVSENLD
G6CUX2_DANPL/8-251---DER..VIGRSLHHFANLIRTI-EDERDRMLGRAHEQI.IQPLEKFRKE.HIG...A.VK..EGKK..KFDKKTAKFC
E1G6B5_LOALO/11-246---........LALKSLSDVFAQV-AHIYKSFVEQSHLTI.AESLISFLKN.ERS...K.VT..ETRC..HFESLSNSLD
C3ZIA5_BRAFL/5-238---........DALCRFADGLTEM-LNYHTILFDQAKRAI.SKNLDHFVKN.DLK...K.VK..DTKK..HFEKISDDMD
F5HLS9_ANOGA/7-247---DEQ..VIADSLKQFSKLISAI-EEERDNMLDRAHEQI.LLPLEEFRKL.HIG...G.VK..ENKK..KYDKKTAKFC
A7RS04_NEMVE/6-249---DEI..LIAAALKEFAQVIDTV-EDERDRMINHANFQL.IQPLEQFRKE.QIG...G.AK..EEKK..KFDKQTEKFC
E9GSI6_DAPPU/6-249---DEI..VIAGSLKEFGRLINAI-EDERDRMLERAKDQF.IGPLENFRKE.HIG...G.AK..EEKK..KFEKQTAKFV
F1Q975_DANRE/5-238---........NCLRQFNQGLQEM-IQFQTMLFDQTQRAI.SQQLTNLLSQ.FVP...Q.IR..ETRR..EFVRIGDDLD
B7QNY3_IXOSC/6-251---DEI..VIAGSLKEFGRLLTTI-EDERDRMLENAHELF.IAPIEKFRKD.HIG...E.AK..ERKK..KFDKETAKYC
G1MY05_MELGA/6-253---DERYIVVDASLHEFSNFLKNL-EEQREILSLNLESRV.RDN.SYFSLK.NLH...W.LK..KKKKSAVFWQELKQHG
G6DT66_DANPL/5-238---........SALHRMIHALQEM-TKFHSILLDQASRTI.LKNLTAFIKV.DIK...G.VK..ESKH..HFDKISNELD
H3D0T3_TETNG/38-270---........ACLNQFSQGLQEM-VGFHTMLFDQMQRAI.NHQLSNLCTR.FLP...Q.LA..ETRR..DFVRIGDDLE
F1QMT1_DANRE/5-238---........SSLAAFSETLQEM-NNYHTILFDQAQRSI.RSQLQTFVKE.DLR...K.FK..DAKK..QFDKVSEEKE
H2RJ90_TAKRU/5-238---........TCLNQFNQGLREM-ISFHTMLFDQMQRAI.NHQLSNLCTR.FLP...Q.LA..ETRK..DYVRIREDLE
M4AKB4_XIPMA/5-238---........SCLNQFQQGLQEM-LSFHTMLLDQMQRAI.IQQLSSLCSQ.FQP...Q.LA..DTRK..EFVRIGEDLE
E9BWJ0_CAPO3/31-270---NEI..QISGALSTFGELLCSL-EDQREIMCEEADLTL.IKPLEEFRKN.EVN...A.VK..ECKK..RFDKQTERYY
F6ZTY0_XENTR/7-247---........STLQYFASAIDEL-NVLHTELAKHLADNM.VLPLIQFREK.DLT...E.VS..TLKD..LFLIASNEHD
J9K1I7_ACYPI/5-235---........KNLNKIIHALQEM-NKFLTTFLDQASRTV.LNNLTVFVKE.DIK...A.SK..ESKH..VFEKATYELD
W4YQP0_STRPU/5-238---RMLIYLFQNYLLKFMGAMNET-RNYQAILEDQAVRGV.SKSLSAFIKG.DLK...K.VK..EAKR..LFYRISDDYD

PF09325

Q6BQ29_DEBHA/424-659NFNQDYIK-----------------------------------KQAQLNK-----------------------LNKKFKV
Q7PVK3_ANOGA/210-443HAQMQLTK-----------------------------------KRENKAK-----------------------LELQ..D
VPS5_YEAST/439-673VIENDMNK-----------------------------------KHSQLGK-----------------------LGQNIHS
SNX2_HUMAN/281-514DAQITLLK-----------------------------------KREAEAK-----------------------MMVA..N
Q86IF6_DICDI/292-523NNERNVAA-----------------------------------KKEKAAK-----------------------TTGA...
Q5A1F2_CANAL/431-666NSNQELSK-----------------------------------KQAQLDK-----------------------YTRK.QQ
Q5B786_EMENI/288-522AAESELQK-----------------------------------RKHSQEK-----------------------LLRQGKS
A8WVN0_CAEBR/231-466DAQQTLSR-----------------------------------KRDQKTK-----------------------IDLAAGG
Q5KI36_CRYNJ/639-879EKDKEVAR-----------------------------------MKTAREK-----------------------ARISGKL
VPS5_SCHPO/340-576SSVQAVSR-----------------------------------AKTQLEK-----------------------CKKQAKS
Q6CJR1_KLULA/428-663LVENDLNK-----------------------------------KQTQFNK-----------------------VSGNSAN
Q6CGR9_YARLI/393-628NIESELTK-----------------------------------RKANLDK-----------------------LLRQGKT
Q759R2_ASHGO/362-598IVESDLHK-----------------------------------KQAHLQK-----------------------LTTSGKS
Q4P3M6_USTMA/831-1062RCADELRR-----------------------------------TRARFEK-----------------------YKQTNPS
Q6FKM2_CANGA/398-636IVENDFQK-----------------------------------KKQDVEK-----------------------MCHNNKQ
E4X2N5_OIKDI/242-473SSEQGLMK-----------------------------------KRDTVTR-----------------------LQAT..G
F7G234_MACMU/220-452DAQATLQK-----------------------------------KREAEAR-----------------------LLWA..N
G4UCZ3_NEUT9/309-540SAESELQK-----------------------------------RKASQDK-----------------------LLRQGKS
G4VRE2_SCHMA/197-429TAEANLRS-----------------------------------KREQKIR-----------------------MEMAPRN
Q9VQQ6_DROME/221-452YAQMQLSK-----------------------------------RRENRGR-----------------------FELA..N

PF03114

RHG17_RAT/1-239SVRARWNQ-----------------------------------AH..KSS-----------------------GTNFQGL
RHG44_HUMAN/1-242SSRTRWQ.-----------------------------------.QTSKSS-----------------------GLSSSLQ
SH3G3_MOUSE/6-242YKKRRVGK-----------------------------------IP.....-----------------------.......
SH3G3_DROME/6-241CKRRRQAK-----------------------------------.......-----------------------.......
Q20005_CAEEL/8-266ACKSRLKK-----------------------------------AKTVDLQ-----------------------TVTNSKT
HOB1_SCHPO/6-247RHRSSFKK-----------------------------------LQEKKDK-----------------------SLKDEKK
O61843_CAEEL/6-240CKKRQQRR-----------------------------------.......-----------------------.......
Q8SYD9_DROME/13-268ACKNRVKK-----------------------------------ARSMLGQ-----------------------QSKDGIS
AMPH_RAT/13-233SARHHLEA-----------------------------------LQ...SS-----------------------KRKDESR
RV167_YEAST/6-247RHLNTYNK-----------------------------------HEKKKEP-----------------------TAKDEER
Q9XW43_CAEEL/24-258DSRHQLKS-----------------------------------SRTTKEV-----------------------KAK....
Q94211_CAEEL/24-258DSRHHVKS-----------------------------------SKTTKEV-----------------------KAK....
Q21004_CAEEL/9-230SAKNSFNS-----------------------------------VKA..SS-----------------------KKDNDPK
YNQA_SCHPO/1-230ALSTKIQK-----------------------------------AKKEESK-----------------------L......
DNMBP_HUMAN/997-1207NCTERAEK-----------------------------------LKDKKT.-----------------------.......
SHLB1_HUMAN/11-254AAKTRLKK-----------------------------------AKAAETR-----------------------NSS....
RV161_YEAST/6-232AAKAKVRR-----------------------------------LV...DK-----------------------PAKDASK
Q1K8A1_NEUCR/3-230ATATKIQK-----------------------------------ARRDDFR-----------------------I......
Q1MT71_DANRE/6-241YKKKRQGK-----------------------------------IA.....-----------------------.......
Q6TGT7_DANRE/6-241YKKRRKGK-----------------------------------IA.....-----------------------.......
Q7S3B9_NEUCR/6-246RHRATLKK-----------------------------------LQDKKDR-----------------------SAKDEKA
Q7S814_NEUCR/6-229ALRAKVKK-----------------------------------LVEKPDK-----------------------DVTKL..
Q8BXU5_MOUSE/6-241YKKKRQGK-----------------------------------IP.....-----------------------.......

PF10455

MUG64_SCHPO/18-286MAKLDVES...................................AKPENLE..............................
A3GFN0_PICST/37-331LIRSKVDE...................................TDQENEE..............................
A5DTV0_LODEL/37-351QLRSKHEA...................................TDPENEE..............................
A7TPP1_VANPO/27-288IAREKY.....................................SKHEKNG..............................
GVP36_YEAST/27-299VARTNLANN..................................KKPEKEA..............................
YP148_YEAST/45-432TMRYEVKAKEAELEAKKAEATGEAHSKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVADRKED
Q59WJ7_CANAL/37-331LLRSKYEK...................................SDPENEE..............................
Q6CPI5_KLULA/40-383TLRHEIKLKLQEKEVVAS...............SEEAEKKVATETPETPEKKTNEEPV......................
Q6FKU8_CANGA/30-382TMRYEVAQTSKQTDSKELGN............EDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIA..DETKETK
Q753K3_ASHGO/49-359TLKYEQHERDAALAKKQ..................DEAKQAEGATPSTGVTQSS..........................

PF06730

F92A1_HUMAN/1-219REAKQLTQ-----------------------------------LERTRQR------------------------------
Q9VK91_DROME/1-222KEVLRQRQ-----------------------------------MLELKSK------------------------------

PF08397

BAIP2_HUMAN/17-237KCQAELKK-----------------------------------LRKKSQG------------------------------
MTSS1_HUMAN/16-237KKSSDTLK-----------------------------------LQKKAKK------------------------------
MTSSL_HUMAN/15-239KKSSDTLK-----------------------------------LQKKARK------------------------------
BI2L2_HUMAN/16-226KCMSELWR-----------------------------------MERKRDK------------------------------
F6WG35_XENTR/28-238KKSSDTIK-----------------------------------LQKKVKK------------------------------

PF06456

ICA69_MOUSE/21-248GALLWMKD-----------------------------------VSQELDP------------------------------
PICK1_MOUSE/117-352SYCLKVKE-----------------------------------MDDEEYS------------------------------
RIC19_CAEEL/27-255GSLLWMKK-----------------------------------TSEELDP------------------------------
YL87_CAEEL/59-286VDRNDISA-----------------------------------AT..NPP------------------------------
O18246_CAEEL/113-348SYCLKLKE-----------------------------------MDDEEVE------------------------------
ARFP2_HUMAN/89-316AYRTDLEE-----------------------------------LS..LGP------------------------------
ARFP1_HUMAN/121-348AYRTDLEE-----------------------------------LN..LGP------------------------------
ICA1L_MOUSE/15-242GALLWMKD-----------------------------------ASQELDP------------------------------
Q8SY07_DROME/119-354SYCLKVKE-----------------------------------MDDEEHG------------------------------
Q9VGQ8_DROME/106-331AYRMDLEN-----------------------------------TKPELTP------------------------------
Q9VP78_DROME/2-228AALSWMKS-----------------------------------ASQELDP------------------------------

PF10456

LST4_CAEEL/336-566GTVQNVPD-----------------------------------IIQVHK.------------------------------
SNX33_MOUSE/337-572GLLSNFPD-----------------------------------IIHLQK.------------------------------
SNX9_MOUSE/358-593GFLGCFPD-----------------------------------IIGAHK.------------------------------
B3DFM9_DANRE/328-561GHLANFPD-----------------------------------IIHVQK.------------------------------
H3D6R4_TETNG/309-534GHLANFPD-----------------------------------IIHVQK.------------------------------
Q5SPP2_DANRE/343-579GLLGCFPD-----------------------------------TIGVHK.------------------------------
Q7ZZB1_DANRE/321-560GLLGCFPD-----------------------------------TIGVHKV------------------------------

PF16746

B4JN99_DROGR/14-257QSQERFLN-----------------------------------MSTKKPE------------------------------
F4Q2Y2_DICFS/66-307VAVGKLGQ-----------------------------------IKKK.NN------------------------------
M3XXB2_MUSPF/5-238NALVKNAQ-----------------------------------VQRN.KQ------------------------------
K7ITA3_NASVI/23-266QSQERYLN-----------------------------------LSTKKQD------------------------------
F1RM37_PIG/6-249GILEKHLN-----------------------------------LSSKKKE------------------------------
H2LTL2_ORYLA/7-250SSLEKLLN-----------------------------------MSAKKKE------------------------------
I3KTC3_ORENI/3-236LAQVKNAQ-----------------------------------APRN.KV------------------------------
F4WSP8_ACREC/5-234IALNRNSQ-----------------------------------VPKS.RP------------------------------
DP13B_MOUSE/7-247LSMAKYSR-----------------------------------LPKKKEN------------------------------
G1PMF3_MYOLU/5-238TALTHNAE-----------------------------------VPRR.RA------------------------------
OPHN1_MOUSE/6-249SLLDRHLH-----------------------------------LSSKKKE------------------------------
F1Q973_DANRE/5-238AALSKNAQ-----------------------------------APRN.KA------------------------------
F7FXM1_CALJA/7-247AAINRYSR-----------------------------------LSKKREN------------------------------
G3NM88_GASAC/5-238TAAVKSAQ-----------------------------------VSRK..A------------------------------
H2V3K9_TAKRU/6-249SVLEKHLS-----------------------------------LSSKKKD------------------------------
G3I418_CRIGR/3-236LSLVRNAQ-----------------------------------APRH.RP------------------------------
D6X007_TRICA/5-238NVLVRNSQ-----------------------------------TPRS.KQ------------------------------
A1L1F5_DANRE/5-238AALSRNAQ-----------------------------------APRG.KQ------------------------------
RHG10_HUMAN/6-249SLIDKHLN-----------------------------------LSAKKKD------------------------------
F1KTZ7_ASCSU/5-245EAEEKFAK-----------------------------------ASRKDAS------------------------------
Q7QFM2_ANOGA/6-239AAVYKNSQ-----------------------------------VSRN.RP------------------------------
H3DNY8_TETNG/6-252STLERHLN-----------------------------------LSSRKKE------------------------------
G3NIM1_GASAC/8-251AAMVKYSR-----------------------------------LPKKKEN------------------------------
M4AHM4_XIPMA/6-249SLLDKHLN-----------------------------------ISAKKKE------------------------------
G3VVX9_SARHA/37-270AALSHNAE-----------------------------------VPRR.KA------------------------------
H2V5X4_TAKRU/5-237NSLPSFLN-----------------------------------SSESADV------------------------------
H2V5X3_TAKRU/5-238DFATGSAG-----------------------------------LTT....------------------------------
H2ZSD6_LATCH/7-247IAMAKYSR-----------------------------------LPKKREN------------------------------
J0DMU1_LOALO/6-249ASLEKHLH-----------------------------------LSTA.RK------------------------------
H3D4E5_TETNG/3-236MAQVRNAQ-----------------------------------APRN.KP------------------------------
F1RB27_DANRE/8-247AAMVKYSR-----------------------------------LPKKREN------------------------------
B3LV47_DROAN/5-238NALIKNAQ-----------------------------------ASKN.RP------------------------------
I3JB30_ORENI/5-238GALSRNAQ-----------------------------------APRG.KQ------------------------------
F4P1K5_BATDJ/19-262AATIKYAA-----------------------------------LPKSKES------------------------------
E9G538_DAPPU/5-239TALARHAQ-----------------------------------APKNSNK------------------------------
H2L7W1_ORYLA/9-252GVLEKHLS-----------------------------------LSAKKKE------------------------------
K1R604_CRAGI/6-250SAMNRYMR-----------------------------------LPKKKES------------------------------
E4WY10_OIKDI/49-293KNMASNSG-----------------------------------VGEGHKE------------------------------
E0W416_PEDHC/5-238SALSRNSQ-----------------------------------ATKS.KP------------------------------
A7SEL6_NEMVE/10-244NALNKHAQ-----------------------------------LPKTCKQ------------------------------
H2KZV7_CAEEL/6-249QTLEKHLH-----------------------------------LSTV.RN------------------------------
F6SDM6_CIOIN/5-238SSLNKHAA-----------------------------------ANKL.KP------------------------------
H2V5X0_TAKRU/5-235T...HHIS-----------------------------------PQRR...------------------------------
Q551Q8_DICDI/30-270ASASKLGQ-----------------------------------IKKK.NS------------------------------
F6UY72_CIOIN/6-249KQLEQTLA-----------------------------------LSHKKKC------------------------------
Q17GT7_AEDAE/5-238AAVYKNAQ-----------------------------------VNKN.RP------------------------------
G6CUX2_DANPL/8-251QSQERTLS-----------------------------------LSTKKPE------------------------------
E1G6B5_LOALO/11-246EALAKRAA-----------------------------------VHRA.RP------------------------------
C3ZIA5_BRAFL/5-238AALSRQAQ-----------------------------------ANRN.KP------------------------------
F5HLS9_ANOGA/7-247QAQERFLN-----------------------------------MSTKKSS------------------------------
A7RS04_NEMVE/6-249IAVQNYLN-----------------------------------MSSKKKE------------------------------
E9GSI6_DAPPU/6-249QSQERHLN-----------------------------------LSTKKQD------------------------------
F1Q975_DANRE/5-238SAVVKNAQ-----------------------------------VSRH.KP------------------------------
B7QNY3_IXOSC/6-251QSLERYLG-----------------------------------LSTKKGD------------------------------
G1MY05_MELGA/6-253ELTVIHMS-----------------------------------EHSKYWD------------------------------
G6DT66_DANPL/5-238IVLNRNSQ-----------------------------------VSRH.KS------------------------------
H3D0T3_TETNG/38-270TAAAKSAQ-----------------------------------ASRH.RG------------------------------
F1QMT1_DANRE/5-238VALVKNAQ-----------------------------------VPRN.KL------------------------------
H2RJ90_TAKRU/5-238MAAVKNAQ-----------------------------------VSRH.KA------------------------------
M4AKB4_XIPMA/5-238TAAAKNAQ-----------------------------------VSRH.KA------------------------------
E9BWJ0_CAPO3/31-270QHLEKTLT-----------------------------------LSAKKKD------------------------------
F6ZTY0_XENTR/7-247LSMAKYSR-----------------------------------LPKKREN------------------------------
J9K1I7_ACYPI/5-235AALLRNSQ-----------------------------------VLKS.RP------------------------------
W4YQP0_STRPU/5-238NALHKNAQ-----------------------------------TVRT.KP------------------------------

PF09325

Q6BQ29_DEBHA/424-659Q..NDKAGNLNFEVD-KLRAK--V----------QTFE-KKFNLI--SETIKS-ELE.RF--EFEKID-DFRNSVEIFIE
Q7PVK3_ANOGA/210-443R..RDKLEFAQKEVE-EWEGK--V----------QRCQ-KEFDNI--SSEIKK-EME.RF--ELARAR-DFKSTIIKYLE
VPS5_YEAST/439-673E....KFREMRKEFQ-TLERR--Y----------NLTK-KQWQAV--GDKIKD-EFQ.GF--STDKIR-EFRNGMEISLE
SNX2_HUMAN/281-514K..PDKIQQAKNEIR-EWEAK--V----------QQGE-RDFEQI--SKTIRK-EVG.RF--EKERVK-DFKTVIIKYLE
Q86IF6_DICDI/292-523.....KAANMQKEVD-DAVRK--L----------TEAT-TEYEKI--SASARL-ELT.KF--DEKRAY-EMKRILNYVIR
Q5A1F2_CANAL/431-666Q..PDKINQLNFEVD-KLKQR--T----------ESFE-KSFKEI--SETIKQ-ELE.NF--EYERID-DFRNSVEIFIE
Q5B786_EMENI/288-522Q..QDRLNQANADVA-DAERR--V----------HQAR-LLFEDM--GRLMRN-ELQ.RF--EKEKVE-DFKSGVETFLE
A8WVN0_CAEBR/231-466R..NEKSDQLKAEIE-ETVLR--I----------DQLE-QHFGEL--SKAIRE-EVA.RF--DTDRKT-DMKKILIDYME
Q5KI36_CRYNJ/639-879G...DRVQSSLKEIM-EAERR--V----------HEAS-LEFDRL--TKLVKS-EFV.RF--ERERVL-EFKETLERYLN
VPS5_SCHPO/340-576Q..QKSLPYLEEQYE-KYRAK--A----------ADLE-KEFSES--TTLLKR-DLS.SL--TTSRVD-DLKASVETWLE
Q6CJR1_KLULA/428-663S...EKATSIENELR-ILTSR--C----------NKIK-QEWQTI--AEVIRK-DVN.QH--DVDTIE-DFRNNMEIYLE
Q6CGR9_YARLI/393-628Q..QQRLNVLKDQVQ-EYEKK--L----------VNAK-VKFDDV--SSTIKK-EVDVRF--ENEKFD-DFRNAIEIFLE
Q759R2_ASHGO/362-598P..TDKAAAAKQELA-NLQRR--H----------KTIK-DHWEHI--AETLRD-ELA.AY--SEAKIT-DFRNNLEIYLE
Q4P3M6_USTMA/831-1062A.AGAQFQSLLSELT-EAETK--A----------LNAE-RLFQTV--SERCKD-EME.RL--DLERVL-DFKRVVGAWLE
Q6FKM2_CANGA/398-636PANKERFLAARDSVK-NIERR--A----------ITVK-KAWHDI--GEKIKK-EVS.SF--DRSKME-EFRNCMEITLE
E4X2N5_OIKDI/242-473R..TEKIPGAELEIK-EWETK--A----------ATSK-KGFEDM--TAVAKK-EIN.TW--ETQRVA-ETKMFILKWMK
F7G234_MACMU/220-452K..PDKLQQAKDEIL-EWESR--V----------TQYE-RDFERI--STVVRK-EVM.RF--EKEKSK-DFKNHVIKYLE
G4UCZ3_NEUT9/309-540Q..QDRLNQVNAEVA-DAERK--V----------HQAR-LLFEDM--GRLMRA-ELD.RF--EREKVE-DFKSGVETFLE
G4VRE2_SCHMA/197-429D..NKKMATITMELE-DLENR--V----------DQAQ-HKFNNI--SINIKK-EFQ.NF--DLNRFA-YFKQATTEYLE
Q9VQQ6_DROME/221-452R..ADKLDQAQQEVD-EWQGK--V----------QRCQ-QQFDDI--SAEIKR-EME.RF--ELTRVK-DFKVNIIKYIE

PF03114

RHG17_RAT/1-239P--------..SKID-TLKEE--M----------DEAG-NKVEQC--KDQLAA-DMY-NF--MAKEGE-YG.KFFVTLLE
RHG44_HUMAN/1-242P--------AGAKAD-ALREE--M----------EEAA-NRVEIC--RDQLSA-DMY-SF--VAKEID-YA.NYFQTLIE
SH3G3_MOUSE/6-242.--------......-..EEE--I----------RQAV-EKFEES--KELAER-SMF-NF--LENDVE-QV.SQLAVFVE
SH3G3_DROME/6-241.--------......-..DDE--I----------RGAE-DKFGES--LQLAQV-GMF-NL--LENDTE-HV.SQLVTFAE
Q20005_CAEEL/8-266S--------GGFTIE-QAEAD--V----------RVAQ-AEFDKQ--SEITKL-LLE-GI--QTAHNN-QL.KCLRDFVE
HOB1_SCHPO/6-247.--------....LY-EAETA--F----------EQSS-QEYEYY--NEMLKE-ELP-KL--FALAQS-FIAPLFQGFYY
O61843_CAEEL/6-240.--------......-..DDE--M----------IQAE-EKLEES--KRLAEM-SMF-NV--LSNDVE-QI.SQLRALIE
Q8SYD9_DROME/13-268P--------E.AVLE-QAERD--L----------RVAQ-AEFDRQ--AEITKL-LLD-GI--STSQAS-HL.RHLHAFIQ
AMPH_RAT/13-233.--------....IS-KAEEE--F----------QKAQ-KVFEEF--NVDLQE-ELP-SL--WSRRVG-FYVNTFKNVSS
RV167_YEAST/6-247.--------....LY-KAQAQ--V----------EVAQ-QEYDYY--NDLLKT-QLP-IL--FSLEAE-FVKPLFVSFYF
Q9XW43_CAEEL/24-258.--------......-..GEI--Y----------RKNI-QAFNCT--ANEVQA-RLD-EV--.PMIVP-HHENELLKFSR
Q94211_CAEEL/24-258.--------......-..GET--Y----------RKAI-NAFNET--ANEVQA-LID-EV--.AMVVP-LHENEFLKFSR
Q21004_CAEEL/9-230.--------....LA-KATME--L----------QAAE-QMYTEM--NNELLE-ILP-AV--FDSRIT-FFVDTLQTLFN
YNQA_SCHPO/1-230.--------......-..EED--L----------RNAR-AKYEES--LEEFED-RMV-QL--KELEPD-RV.ENVVRLLQ
DNMBP_HUMAN/997-1207.--------......-..LEE--L----------QSAR-NNYEAL--NAQLLD-ELP-KF--HQYAQG-LFTNCVHGYAE
SHLB1_HUMAN/11-254.--------......-..EQE--L----------RITQ-SEFDRQ--AEITRL-LLE-GI--SSTHAH-HL.RCLNDFVE
RV161_YEAST/6-232.--------....LP-RAEKE--L----------SLAK-DIFENL--NNQLKT-ELP-QL--VSLRVP-YFDPSFEALIK
Q1K8A1_NEUCR/3-230.--------......-..EEE--L----------RGAK-AKYEEA--SEDVGR-RMQ-DI--RDSEVD-SV.RDLTQFLD
Q1MT71_DANRE/6-241.--------......-..DEE--L----------RMAM-EKFEES--RDAAET-SMQ-NL--LDTDVE-QV.SQLCALVE
Q6TGT7_DANRE/6-241.--------......-..DSE--I----------KKAF-DKFEES--KEMAER-CMF-NL--LEKDVQ-RM.QHLSGLLE
Q7S3B9_NEUCR/6-246.--------....MW-KAENE--V----------EQAT-QEYNYF--NDLLKD-ELP-KL--FALERQ-FIQPLFQSFYY
Q7S814_NEUCR/6-229.--------.....P-RAEKE--M----------EMAK-AAYEQL--NEQLCT-ELP-QL--IDLRVP-YLDPSFEALVK
Q8BXU5_MOUSE/6-241.--------......-..DEE--L----------RQAL-EKFDES--KEIAES-SMF-NL--LEMDIE-QV.SQLSALVQ

PF10455

MUG64_SCHPO/18-286...............-HCKSA--V----------RSAE-DELNGA--IEHAKI-LYE-----QILNKD-YNTDLLRSIIK
A3GFN0_PICST/37-331...............-.....--L----------ISKE-DELVSA--TEVAVV-EMK-----RLLKPS-KNISLLKVFVD
A5DTV0_LODEL/37-351...............-.....--L----------IAKE-DELVSA--TELAVI-EMK-----KILKPS-KNINLLKIMVQ
A7TPP1_VANPO/27-288...............-TVKVE--L----------EILE-DEFNHA--TKDAIM-VMQ-----EIISNN-RFEQNLKDFAA
GVP36_YEAST/27-299...............-SLRVQ--M----------ETLE-DQFAQV--TEDATV-CLQ-----EVISHA-NFSEDLKELAK
YP148_YEAST/45-432LKSNKVNDEPPIEES-EDNKL--L----------EKLE-DEFVSN--TTAAVE-TME-----EITDSS-EILGLIKLFQN
Q59WJ7_CANAL/37-331...............-.....--L----------IAKE-DGFVSA--TEVAVV-EMK-----KLLKPS-KNIDLLKVLVA
Q6CPI5_KLULA/40-383.......DMAKTEED-PDSKL--F----------ERLE-DQFVSA--TSETVE-FLG-----ELTDSS-EIISLVKLFHN
Q6FKU8_CANGA/30-382DTKDSEDLKEDSKTS-TDGQL--L----------EQLE-DEFVSN--TTEAVE-VMT-----EVSENS-ELLSLIKLFQT
Q753K3_ASHGO/49-359...........TADL-AFYAQ--L----------EDAE-DEFVSN--TAEAVE-FMT-----SIADAT-KLISLVKLFQN

PF06730

F92A1_HUMAN/1-219---NPSDRHVISQAETELQRA--A----------MDAS-RTSRHLEETINNFE-RQK-MK--DIKTIFSEFITI------
Q9VK91_DROME/1-222---FSANN...SAADSELFKA--K----------MEVQ-RTNKEIDDIIGNFE-QRK-LR--DLKQIISDFILI------

PF08397

BAIP2_HUMAN/17-237---...SK---NPQKYSDKELQYI----------DAIS-NKQGELENYVSDGY-KTA-LT--EERRRFCFLVEKQCAVAK
MTSS1_HUMAN/16-237---...GR---GDIQPQLDSA..L----------QDVN-DKYLLLEETEKQAV-RKA-LI--EERGRFCTFISMLRPVIE
MTSSL_HUMAN/15-239---ELLGK---GDLQPQLDSA..L----------QDVN-DMYLLLEETEKQAV-RRA-LI--EERGRFCTFITFLQPVVN
BI2L2_HUMAN/16-226---.....---.....NVREM..K----------ESVN-RLHAQMQAFVSESQ-RAA-EL--EEKRRYRFLAEKHLLLSN
F6WG35_XENTR/28-238---...GK---DDARVQLDSV..L----------QDVN-DKYLLLEETEKKAV-YRA-LV--EERGRFCMFVSFLKPVLD

PF06456

ICA69_MOUSE/21-248---DLYKQ--MEKFR-KVQTQ--V-.........RLAK-KNFDKL--KMDVCQ-KVD-LL--GASRCN-LLSHMLATYQT
PICK1_MOUSE/117-352---CIGPR--RALYR-VSTGN--Y-EYRLILRCRQEAR-ARFSQM--RKDVLE-KME-LL--DQKHVQ-DIVFQLQRFVS
RIC19_CAEEL/27-255---EVDGS--MEKFR-EAQTT--V-.........KSNK-ERLDRL--KTDTLQ-KVD-LL--SASRSN-LLSYVLTHYQN
YL87_CAEEL/59-286---QGQLT--KNLPV-GATEK--C-.........EEKK-AKYEKL--KNDAKI-KMR-LL--EENRIS-VVAAQLEKLQS
O18246_CAEEL/113-348---FVAIQ--EPLYR-VETGN--Y-EYRVMLRCRQECR-ARFMKM--RDDVMV-KIE-LL--DQKHVR-DIAQHLAIFAK
ARFP2_HUMAN/89-316---RDAGT--RGRLE-SAQAT--F-.........QAHR-DKYEKL--RGDVAI-KLK-FL--EENKIK-VMHKQLLLFHN
ARFP1_HUMAN/121-348---RDANT--LPKIE-QSQHL--F-.........QAHK-EKYDKM--RNDVSV-KLK-FL--EENKVK-VLHNQLVLFHN
ICA1L_MOUSE/15-242---DTFKQ--MEKFR-KVQNQ--V-.........RNSK-DSFDKL--KKDVCQ-KVD-LL--GASRCN-MLSHSLTTYQR
Q8SY07_DROME/119-354---FAALQ--EPLYR-VETGN--Y-EYRLILRCRQDAR-SKFAKL--RTDVLE-KME-LL--ECKHAM-DLNKQLRSLLE
Q9VGQ8_DROME/106-331---SAVA.--...LE-ETQRS--Y-.........AQHK-EQYEKL--RSDVAV-KMQ-FL--DENRIK-VMHKQLILLHN
Q9VP78_DROME/2-228---DTGKG--LDKFR-TAQAH--V-.........RVAK-HNFDGY--SMDSIQ-KID-LL--AAARCN-MYSHALVAYVT

PF10456

LST4_CAEEL/336-566---...QA--VQKFR-DS...--..EGRLSSAEAEKMK-QRIDAM--SYTVIA-EVQ-HQ--TAEKVE-DMKSTMGTYLK
SNX33_MOUSE/337-572---...GA--FAKVK-ESQRM--SDEGRMAQEEADGIR-RRCRVV--GFALQA-EMN-HF--HQRREL-DFKHMMQSYLR
SNX9_MOUSE/358-593---...GA--IEKVK-ESDKL--VATSKITPQDKQTMV-KRVGTM--SYALQA-EMN-HF--HSNRIY-DYNSVIRLYLE
B3DFM9_DANRE/328-561---...GA--LTKAK-ESQKH--GEEK..DGTAGGGIN-DRCNII--SCATLA-EIQ-HF--HCIRVR-DFKAQMQYFLQ
H3D6R4_TETNG/309-534---...GA--LTKVK-DC...--.......PKQESELH-DRCNII--SCATLA-EIQ-HF--HRTRIR-DFRSQMQHHLR
Q5SPP2_DANRE/343-579---...AA--IEKVK-EADKL--VTAGKITASDKTTMG-KRASTM--SYALQA-EMN-HF--HNNRIY-DYNRVMQQYLE
Q7ZZB1_DANRE/321-560---TICAA--IDKVK-EADHL--VMTNKISQQDKHTME-KNLSTM--SYALQA-EMN-HF--HSNRIY-DYNRLMQFYLE

PF16746

B4JN99_DROGR/14-257-----------NTIQ.EADAS--L----------GMHE.REYIQE..SLSYVL.RIQ-EV..QERIKF-EFVEILLAFIS
F4Q2Y2_DICFS/66-307-----------SKIE.EVGQE--V----------NDIY.KSRVQY..GLDMVE.KMN-EV..QARRRF-EFLELFFVYLH
M3XXB2_MUSPF/5-238-----------HEVE.EATNI--L----------TATR.KCFRHI..ALDYVL.QIN-VL..QSKRRS-EILKSMLSFMY
K7ITA3_NASVI/23-266-----------NVLQ.EADAT--L----------DMAE.RHFCQA..SLEYVF.LLQ-EV..QERKKF-EFVETLLGFMF
F1RM37_PIG/6-249-----------SQLQ.EADSQ--V----------DLVR.QHFYEV..SLEYVF.KVQ-EV..QERKMF-EFVEPLLAFLQ
H2LTL2_ORYLA/7-250-----------PQLQ.EADIQ--V----------ETMR.QHFQEE..SLDYVC.KLQ-EI..QERKKF-ECVEPILAFFQ
I3KTC3_ORENI/3-236-----------HEAE.EATQA--L----------ILSR.KAFRHL..ALDYVL.QIN-VL..QAKKKF-EILDAMLSFMR
F4WSP8_ACREC/5-234-----------MEYE.ETSNI--L----------SATR.SCFRHT..ALDYIH.ALT-ML..QAHKRH-EILGTLLSYMH
DP13B_MOUSE/7-247-----------EKAKTEIVKE--V----------AAAR.RKQH.L.SSLQYYC.ALN-AL..QYRKRA-AMMEPLIGFAH
G1PMF3_MYOLU/5-238-----------QEAE.EAGAA--L----------KTAR.AGYRGR..ALDYAL.QIN-VI..EDKRKF-DIMEFALRLVE
OPHN1_MOUSE/6-249-----------SQLL.EADLQ--V----------DKER.HNFFES..SLDYVY.QIQ-EV..QESKKF-NIVEPVLAFLH
F1Q973_DANRE/5-238-----------HEVE.EASNI--L----------NATR.KCFRHI..VLDYVL.QIN-VL..QSKRRS-EILKSMLSFMY
F7FXM1_CALJA/7-247-----------DKVKYEVTED--V----------YTSR.KKQHQT..MMHYFC.ALN-TL..QYKKKI-ALLEPLLGYMQ
G3NM88_GASAC/5-238-----------GEAE.RASHL--L----------LATR.KCYQHF..ALDYCLFQLN-TF..KAQQRV-DILNSMFSFVH
H2V3K9_TAKRU/6-249-----------SHLQ.EADTQ--M----------SKDR.QVFYDA..SLQYVF.KIQ-EV..QERKKF-EFVEPLLAFLQ
G3I418_CRIGR/3-236-----------HEVE.EATGA--L----------TLTR.KCFRHL..ALDYVL.QIN-VL..QAKKKF-EILDSMLSFMH
D6X007_TRICA/5-238-----------QEVE.EMQNV--L----------LAVR.SCFGHQ..ALDYVN.SIS-LL..QTKKRH-EILSTLLSYMH
A1L1F5_DANRE/5-238-----------HEVE.EASNN--L----------LIAR.RAFRSG..ALDYVL.QIN-VI..ESRKKT-EILQAMLSLIQ
RHG10_HUMAN/6-249-----------SHLQ.EADIQ--V----------EQNR.QHFYEL..SLEYVC.KLQ-EI..QERKKF-EFVEPMLSFFQ
F1KTZ7_ASCSU/5-245-----------RRLE.ELNND--V----------FITK.MGYHKL..ALQYCS.RMN-VL..QSRRYS-ELIEPLLMLLY
Q7QFM2_ANOGA/6-239-----------ADVL.DAENV--L----------SASK.TCFNHT..ALDYVN.YIT-LL..QNRKRH-EILGTLLSYLQ
H3DNY8_TETNG/6-252-----------AYLQ.EADMQ--I----------DKER.QLFYDA..SLEYVF.KIQ-EV..QEKKKF-EFVEPLLAFLQ
G3NIM1_GASAC/8-251-----------EKLKSDLVKE--V----------AYTR.RKQHQA..SLQYYC.ALN-AL..QYRKRV-AMLEPMLGYTQ
M4AHM4_XIPMA/6-249-----------SQLQ.EADDL--L----------DRER.VNFYDS..SVEYVY.QIH-QV..QDRKKF-DVVEPVLAFLH
G3VVX9_SARHA/37-270-----------HEAE.EAMTT--L----------KTVR.AGYQGR..ALDYVL.QIN-VI..QDKRKF-DIMEFVLRLVE
H2V5X4_TAKRU/5-237-----------LFLV.KTFTA--L----------QIAERRLLCSK..ADVCSF.QIN-VL..QSKRRS-EILKSMLSFMY
H2V5X3_TAKRU/5-238-----------HHISPQSSEN--I----------LRNL.DSIQHF..ILDYVL.QIN-VL..QSKRRS-EILKSMLSFMY
H2ZSD6_LATCH/7-247-----------ERLKAGVVAE--V----------ADSR.RKQHLS..SLQYYC.SLN-AL..QYRKRV-AVIEPMLGYTE
J0DMU1_LOALO/6-249-----------NDFK.EADAQ--L----------DMQQ.RNFCSC..SLDYVT.AIQ-AV..QERMKF-EFVETLCSFVY
H3D4E5_TETNG/3-236-----------HEIE.EAAGA--L----------SITR.RCFRHL..ALDYVL.QIN-VL..QTKKKF-EILDAMLSFMQ
F1RB27_DANRE/8-247-----------EKVKAEVVRE--V----------AYSR.RKQHQA..AMQYYC.ALN-AL..QYRKRV-AMLEPMLGYTH
B3LV47_DROAN/5-238-----------QEMQ.EAANI--L----------SASK.SCFQHT..ALDYVN.YIT-LA..QARKVP-SILSTLLDYYQ
I3JB30_ORENI/5-238-----------HEVE.EASNA--L----------LNAR.KAFRSE..ALDYVL.EIN-VI..EAKKKT-DILLAMLSLMD
F4P1K5_BATDJ/19-262-----------SALL.EDAFI--L----------YEAR.KPFIKA..SISYVS.KII-ML..KYKLDI-HIPDILMALIK
E9G538_DAPPU/5-239-----------NQVD.ETSNV--L----------IATR.SCFRYT..ALDHLY.TIS-LV..QSKKRH-EILDPLLSYMH
H2L7W1_ORYLA/9-252-----------AHLH.EADNQ--V----------DNVR.QHFYEV..SLEYSS.KFK-TS..RHRACG-AIFLQLLAFLQ
K1R604_CRAGI/6-250-----------ERQKSEYNEE--L----------YLMR.KKFHQT..SLHYYS.SLN-AL..QYKRKC-SLLEPVMGYLH
E4WY10_OIKDI/49-293-----------SKQN.QAIRE--T----------KKSR.KDYHEH..ALAYVD.TLL-SI..EEEKKY-ELVENFAQIAG
E0W416_PEDHC/5-238-----------NEME.EAQNL--L----------SATR.SCFRHT..TLDHVY.TVS-VI..QTKKRH-EILGTLLSYMQ
A7SEL6_NEMVE/10-244-----------HELE.EDRNI--L----------TAMQ.SCFDHI..SLDYAF.QIN-LL..QSRKRI-EVLDALSKFMH
H2KZV7_CAEEL/6-249-----------NDFR.AADAQ--L----------ETQQ.KNFFQA..SLQYVA.EVQ-SV..QERMRF-EFVETLGSYVY
F6SDM6_CIOIN/5-238-----------NEVE.DTNSV--L----------TSSR.NCFRSV..AMDYVY.QIN-ML..HKKKKF-QSVDKILSYMH
H2V5X0_TAKRU/5-235-----------.SFQ.KCPFL--L----------KWKT.SSLGHFESXLDYVL.QIN-VL..QSKRRS-EILKSMLSFMY
Q551Q8_DICDI/30-270-----------VRIE.EVSQE--A----------NETL.KLRVQF..GLDLVE.SMN-QV..QARRRF-EFLEYFSVYLH
F6UY72_CIOIN/6-249-----------QQLQ.ESDNE--L----------FTHK.KTFHKE..ALNYVY.KLQ-EV..QERKKF-EFVEHLLMFMQ
Q17GT7_AEDAE/5-238-----------IDIV.EAENL--L----------SATK.SCYNHA..ALDYVN.YIT-ML..QNRKRH-EILATILSYIQ
G6CUX2_DANPL/8-251-----------AVFQ.EADAA--M----------DMAE.RDFCQA..SLEYVF.QLQ-AV..QERKKF-ELVETLLGFVF
E1G6B5_LOALO/11-246-----------TEIA.DARNA--L----------TAVG.TCFAHT..ALDYVA.QIN-IA..HAHKDY-TVLDALWSFVK
C3ZIA5_BRAFL/5-238-----------QELE.ETNNI--L----------TAMR.SCFGHV..TLDYVF.QIN-VV..QSKKRF-KVMDTMLSFMY
F5HLS9_ANOGA/7-247-----------P....AADAS--L----------GMLE.REYLRE..SLSYVL.SIQ-EV..QERIKF-EFVEIILRFIS
A7RS04_NEMVE/6-249-----------VQLQ.EADAQ--L----------QMER.RVFHQT..ALDYVF.KLQ-EV..NETKKF-QFVETLLSFMY
E9GSI6_DAPPU/6-249-----------SVLQ.EADAI--L----------EMEQ.RHFCQA..SLEYVY.RLQ-EV..HERKKF-EFVETLLGFMY
F1Q975_DANRE/5-238-----------VDAE.RATHL--L----------LATR.KCYQHF..ALDYCL.QLN-NF..KVQQKL-DILNSVFSYFH
B7QNY3_IXOSC/6-251-----------TQLK.EAFAV--L----------EMEK.RHFFKA..SLEYVL.MLQ-KV..QERKKT-EFVETILRFMY
G1MY05_MELGA/6-253-----------KH.L.NSKSC--L----------QQDQ.SQHH.F.ISCNALY.EIE-ALLADQRKRK-QGLAALLGLFR
G6DT66_DANPL/5-238-----------TDVE.EVMNL--L----------LATR.SCFRHT..ALDHVQ.KIT-ML..QVRKRH-EILATFLSYLQ
H3D0T3_TETNG/38-270-----------GEAE.RMSHL--L----------LATR.K.FQHF..ALDYCL.QIN-SF..KTQQRL-DTLNSVFSFVH
F1QMT1_DANRE/5-238-----------HEVE.EATNI--L----------TTTQ.KFFRNI..ALDYVL.QIN-VL..QSKRRL-EILKSMLAYMN
H2RJ90_TAKRU/5-238-----------GDAE.RSSHL--L----------IATR.KCFQHF..SLDYCL.QLN-SF..KTQQRL-DILNSVFSFIH
M4AKB4_XIPMA/5-238-----------ADAE.RASHL--L----------LATR.KCYQHF..ALDYCL.QLN-TF..KTQQNI-DVLNSVFSFVH
E9BWJ0_CAPO3/31-270-----------QMLQ.EADVS--L----------EAER.LAMHNA..SLEYVE.KLN-EL..EEKKKF-EFVERILGYIY
F6ZTY0_XENTR/7-247-----------EKVKAEVAKE--V----------ASTR.RKQHLS..SLQYYC.ALN-AL..QYRKRI-AMLDPILGYAE
J9K1I7_ACYPI/5-235-----------HEAD.ELLSQ--V----------ASAR.SSFRHA..ALDHVH.CIT-ML..LTRKKP-EIFSTLLSYIQ
W4YQP0_STRPU/5-238-----------LESE.ETLNV--L----------TATR.SAFGHT..ALDYVF.QIN-IV..QSKERH-EVLNTLLSFMH

PF09325

Q6BQ29_DEBHA/424-659SSIESQKEAIELW--ETFYE---------R------------------------
Q7PVK3_ANOGA/210-443DQMAHQQQQMRYW--EAIVP---------V------------------------
VPS5_YEAST/439-673AAIESQKECIELW--ETFYQ---------T------------------------
SNX2_HUMAN/281-514SLVQTQQQLIKYW--EAFLP---------E------------------------
Q86IF6_DICDI/292-523LNLDHFLKSSDCW--RELLT---------E------------------------
Q5A1F2_CANAL/431-666SAIESQKEAIELY--ETFYE---------R------------------------
Q5B786_EMENI/288-522SAVEAQKELIELW--ETFLL---------Q------------------------
A8WVN0_CAEBR/231-466SMIHTHTEMLQLW--EKFEP---------Q------------------------
Q5KI36_CRYNJ/639-879GLIEKEKEMIEGW--EGLHS---------.------------------------
VPS5_SCHPO/340-576SAIESQKEIIERW--ESFLD---------Q------------------------
Q6CJR1_KLULA/428-663SAIESQKECIEIW--ETFYQ---------N------------------------
Q6CGR9_YARLI/393-628NAVETQKEAIEVW--ETFYS---------R------------------------
Q759R2_ASHGO/362-598SAIETQKECIELW--ETFYQ---------N------------------------
Q4P3M6_USTMA/831-1062GMIQRQEEVVEEW--VRYAG---------L------------------------
Q6FKM2_CANGA/398-636SAIESQKESIELW--ETMYH---------E------------------------
E4X2N5_OIKDI/242-473HMLEAEKKVVAMW--EKYLP---------.------------------------
F7G234_MACMU/220-452TLLYSQQQLAKYW--EAFLP---------E------------------------
G4UCZ3_NEUT9/309-540SAVEAQKELIEKW--ETFLM---------.------------------------
G4VRE2_SCHMA/197-429LLLQIQLKVLENW--EKYLS---------.------------------------
Q9VQQ6_DROME/221-452DQMAHQQQIVSYW--EAFAP---------.------------------------

PF03114

RHG17_RAT/1-239AQADYHRKALAVL--EKALP---------EMRA---------------------
RHG44_HUMAN/1-242VQAEYHRKSLTLL--QAVLP---------QIKA---------------------
SH3G3_MOUSE/6-242AALDYHRQSTEIL--QELQS---------KLEL---------------------
SH3G3_DROME/6-241ALYDFHSQCADVL--RGLQE---------TLQE---------------------
Q20005_CAEEL/8-266AQMSFYAQSHQLM--ADLQR---------ELSG---------------------
HOB1_SCHPO/6-247MQLNVYYVLYEKM--SHCEI---------QYFD---------------------
O61843_CAEEL/6-240AQLDFHRQTAQCL--ENLQQ---------QLGH---------------------
Q8SYD9_DROME/13-268TQVRYYKQCGDVM--EQLQR---------ELAN---------------------
AMPH_RAT/13-233LEAKFHKEIAVLC--HKLYE---------VMTK---------------------
RV167_YEAST/6-247MQLNIFYTLYNRL--QDMKI---------PYFD---------------------
Q9XW43_CAEEL/24-258EVSIFNNSVENLL--KEVVF---------RLGY---------------------
Q94211_CAEEL/24-258EASVYHDTVHNSL--SEVIF---------RLGY---------------------
Q21004_CAEEL/9-230ANSVYQTDASKFH--KQIVM---------QLDK---------------------
YNQA_SCHPO/1-230MQIRFHQKSLDLL--KGLEM---------NGFS---------------------
DNMBP_HUMAN/997-1207AHCDFVHQA...L--EQLKP---------LLSL---------------------
SHLB1_HUMAN/11-254AQMTYYAQCYQYM--LDLQK---------QLGS---------------------
RV161_YEAST/6-232IQLRFCTDGYTRL--AQIQQ---------YLDQ---------------------
Q1K8A1_NEUCR/3-230AELEYHERCADEL--RRVRQ---------SWA.---------------------
Q1MT71_DANRE/6-241SQLQFHKQSMQVL--EELAG---------AMR.---------------------
Q6TGT7_DANRE/6-241AVIDYHRQSSQIL--ENLRS---------NLQ.---------------------
Q7S3B9_NEUCR/6-246MQLNIFYTLHEKM--QHCDI---------GYF.---------------------
Q7S814_NEUCR/6-229IQLRFCAEAYSRM--AQVQQ---------YLD.---------------------
Q8BXU5_MOUSE/6-241AQLEYHKQAVQIL--QQVTV---------RLE.---------------------

PF10455

MUG64_SCHPO/18-286NQLKFHQDAAAAL--....S---------DITI---------------------
A3GFN0_PICST/37-331AQKEYFEVGAKKL--AALSA---------SLDK---------------------
A5DTV0_LODEL/37-351AQKEYFETSAKKL--NDLLA---------NLDK---------------------
A7TPP1_VANPO/27-288AKLAYHEKSVDAL--RNLLD---------NAEL---------------------
GVP36_YEAST/27-299AQAEYFETSAGLM--KEFLS---------NSFA---------------------
YP148_YEAST/45-432FQLVYFRQCVQEV--EANLK---------VLNG---------------------
Q59WJ7_CANAL/37-331AQKDYFEVGAKKL--KEVLD---------NLDK---------------------
Q6CPI5_KLULA/40-383FQLIHYKQCVKSL--EEDLE---------VLNS---------------------
Q6FKU8_CANGA/30-382FQLSYHQHCVKSL--EQSLK---------DLNA---------------------
Q753K3_ASHGO/49-359FQLVYHRKCVQEL--EVSLN---------SLTS---------------------

PF06730

F92A1_HUMAN/1-219-EMLFHGKALEVY--TAAYQ--NIQNI-DEDEDLE-------------------
Q9VK91_DROME/1-222-AMKQHTKALEIL--SASYY--DIGTI-DERDDFI-------------------

PF08397

BAIP2_HUMAN/17-237NSAAYHSKGKELL--AQKLP--LWQQACADPSKIP-------------------
MTSS1_HUMAN/16-237EEISMLGE.ITHL--QTISE--DLKSLTMDPHKLP-------------------
MTSSL_HUMAN/15-239GELTMLGE.ITHL--QGIID--DLVVLTAEPHKLP-------------------
BI2L2_HUMAN/16-226TFLQFFGRARGML--QNRVL--LWKEQ.SEASRSP-------------------
F6WG35_XENTR/28-238EEIGMLGE.ITHL--QTILE--DLSSLTAEPSKLP-------------------

PF06456

ICA69_MOUSE/21-248TLLHFWEKTSHTM-----------------------------------------
PICK1_MOUSE/117-352TMSKYYNDCYAVL-----------------------------------------
RIC19_CAEEL/27-255ELYEYYSKTSRAF-----------------------------------------
YL87_CAEEL/59-286ALAAYYSGNAKLL-----------------------------------------
O18246_CAEEL/113-348TMAKCQQECAEIL-----------------------------------------
ARFP2_HUMAN/89-316AVSAYFAGNQKQL-----------------------------------------
ARFP1_HUMAN/121-348AIAAYFAGNQKQL-----------------------------------------
ICA1L_MOUSE/15-242TLLGFWEKTAQMM-----------------------------------------
Q8SY07_DROME/119-354SLAELHRSLVDRL-----------------------------------------
Q9VGQ8_DROME/106-331AIAAYFSGNAMAL-----------------------------------------
Q9VP78_DROME/2-228ELKNFAQKAASTF-----------------------------------------

PF10456

LST4_CAEEL/336-566KQAMFYQEVATKL--TSLAA---------------RYD----------------
SNX33_MOUSE/337-572QQILFYQRVGQQL--EKTLH---------------MYD----------------
SNX9_MOUSE/358-593QQVQFYETIAEKL--RQALS---------------RFP----------------
B3DFM9_DANRE/328-561QQISFFQKITGKL--EEALD---------------MYD----------------
H3D6R4_TETNG/309-534QQIDFFQKITTKL--QETLQ---------------KYD----------------
Q5SPP2_DANRE/343-579QQVKFYEMIAEKL--RQAHS---------------QFT----------------
Q7ZZB1_DANRE/321-560EQVKFYETIAEKL--KKALG---------------QYT----------------

PF16746

B4JN99_DROGR/14-257GWLVFYHTAHEQA..EDHRD..YLQDLRHKVQK..TRENF....EEAREKVTEL
F4Q2Y2_DICFS/66-307AQSTFFHQGYELF..RDLEP..HMRIFSTYLQS..TRKHYEDEKKRQTHDKKEL
M3XXB2_MUSPF/5-238AHLAFFHQGYDLF..SELGP..YMKDLGAQLDR..LVV.......DAAKEKREM
K7ITA3_NASVI/23-266GWLTFYHQGHEVA..KDFKP..YMTELQLKIQK..TRENF....DATRDKTESL
F1RM37_PIG/6-249GLFTFYHHGYELA..KDFSD..FKTQLTISIQN..TRNRF....EGTRSEVESL
H2LTL2_ORYLA/7-250TVFTFYHQGYELA..KDFEY..YKRSLQISIQN..TRSRF....EGARSEVYEL
I3KTC3_ORENI/3-236AQYTLFQQGFNIL..DEIDP..YMKKLAAQLDQ..LVI.......DSAVEKREL
F4WSP8_ACREC/5-234ACITYYHQGSDLA..QDLDP..FLKDLDENLIQ..MRG.......DSNKLEKEM
DP13B_MOUSE/7-247GQINFFKRGAEMF.SKSMDG..FLSSVKDMVQS..IQV.......ELEAEADKM
G1PMF3_MYOLU/5-238AQATHFQQGHEEL..SRLAQ..YRKELGAQLHQ..LVL.......NSARQKRDM
OPHN1_MOUSE/6-249SLFISNSLTVELT..QDFLP..YKQQLQLSLQN..TRNHF....SSTREEMEEL
F1Q973_DANRE/5-238AHLTFFHQGYDLF..SELQP..LMKQLTGQLDQ..LVL.......DATKERKDM
F7FXM1_CALJA/7-247AQISFFKMGSENL.NEQLEE..FLANIGTSVQN..VRR.......EMDSDVETM
G3NM88_GASAC/5-238AQFTFFHQGFDLL..RDLEP..AMKTMAAQLSQ..LSA.......ECAAQRKQL
H2V3K9_TAKRU/6-249GLFTFYHEGYELA..SEFEP..YKQQLQFNLQN..ARNNF....ESTRAEVERL
G3I418_CRIGR/3-236AQYSFFQQGYSLL..HQLDP..YMKKLAAELDQ..LVI.......DSAVEKREM
D6X007_TRICA/5-238ACTAYYHQGSDLC..ADLEP..FFKELADEIAD..MRE.......ETTTVEKEL
A1L1F5_DANRE/5-238AQALFFQQSHQSL..AELEN..YRKELHDENAQ..LVL.......NSARDKRDM
RHG10_HUMAN/6-249GMFTFYHQGHELA..KDFNH..YKMELQINIQN..TRNRF....EGTRSEVEEL
F1KTZ7_ASCSU/5-245AFKCFFNVGHDAFRKDALTQ..FLTQAQQQMLS..IGK.......EAESEKNEG
Q7QFM2_ANOGA/6-239ACSTYFHQGSDLC..EDYGT..FFKSLDEEIGV..MRS.......EYGVLDKQM
H3DNY8_TETNG/6-252GLFTFYHEGYELA..HEFEP..YKQQLQFNLQN..TRNNF....VSTKQEVEKL
G3NIM1_GASAC/8-251AQISFFKKGIELM.SKKMDN..CLSSVSDMTQS..IQA.......QLDTEAEAM
M4AHM4_XIPMA/6-249SILTLNNLTVEMT..QDFMP..YKQELQLSLQN..SRNHY....ESTCEELEEL
G3VVX9_SARHA/37-270AQAIYFQLGHEEL..NGLAV..YHKELGAQLHK..LVL.......ESAREKRDM
H2V5X4_TAKRU/5-237AHLTFFHQGYDLF..SELQP..LMKLLGGQLDQ..LVV.......DAAKEKRDM
H2V5X3_TAKRU/5-238AHLTFFHQGYDLF..SELQP..LMKLLGGQLDQ..LVV.......DAAKEKRDM
H2ZSD6_LATCH/7-247AQVNIFKKGMETF.SKRMED..FLSSVSNMIQS..IQR.......QLDEETEAM
J0DMU1_LOALO/6-249SWLTFYHVGHVTH..EDFKP..FLSEVQSKVQK..AKQSY....EETKEYYVQL
H3D4E5_TETNG/3-236AQHALFQQGYSLL..DDIQP..YMQNLAAQLDQ..LVI.......DSAVEKREM
F1RB27_DANRE/8-247AQINFFKKGMELV.SKKLDS..FLN....SVSN..MNESI....ESQLEIDAEV
B3LV47_DROAN/5-238ACVTYYHQGFDLC..NDFDE..FFKNISEDLGT..LRG.......DYHQLEKAM
I3JB30_ORENI/5-238AQAQFFLQGHQSL..SELDE..YRQKLNEEHKQ..FVL.......DCAREKRDM
F4P1K5_BATDJ/19-262VHTDYFEAGWDLF..HGIEV..ASQDLRQKLDN..ARAMS....SDTIKRLETV
E9G538_DAPPU/5-239AQSTFFHQGSDLF..QDTDP..FLKNIGSEVTQ..LRE.......ETNALEREL
H2L7W1_ORYLA/9-252GLFTYYHHGYELA..KDFNH..FKTDLTISIQN..TRNRF....ESTRSEVESL
K1R604_CRAGI/6-250AQRAFFQMGQDAVGKKEIED..FLNNISTSVQG..VQQEL....QTETKKTVEL
E4WY10_OIKDI/49-293DWLQFTKSCYECY..HEQNDEKIKQTLNLTNN...QRARH....KNTQEETDKL
E0W416_PEDHC/5-238ACSTFFHQGSDLC..EDLEL..FFKKLGDDLNK..MSS.......ETTKLEKEM
A7SEL6_NEMVE/10-244SHFTYYHQGYDLM..NDLER..YMKDMSHQLND..LST.......QFSCDKKGM
H2KZV7_CAEEL/6-249SWLSFFHVGSVIH..QDFKP..FLDNVQTKVQK..TKENY....NATNAEAEEL
F6SDM6_CIOIN/5-238ALFTFFHQGYDLL..KDLEP..YMKSVSGQLEE..MCK.......RHEESRKSM
H2V5X0_TAKRU/5-235AHLTFFHQGYDLF..SELQP..LMKLLGGQLDQ..LVV.......DAAKEKRDM
Q551Q8_DICDI/30-270AQSTFFHQGYELF..RDLEP..HMRVFSDYLQA..TRKHF....EDEKRKQTML
F6UY72_CIOIN/6-249VYFNFFHQSHETA..NDCKD..YMKELQIRLVS..TRAQY....DGTREKTKTL
Q17GT7_AEDAE/5-238ACSTYFHQGSDLC..EDYGS..FFKTLDEEISN..MRA.......EYNVLDKQM
G6CUX2_DANPL/8-251GWWTFHHTAHDVH..ADAEP..LVRDLQLRIQR..TRSNF....EETSKQTESL
E1G6B5_LOALO/11-246ECSTFFVRGHVFF..DEWTA..VES...GAIAD..TSSLLA...NKSKYVKRKM
C3ZIA5_BRAFL/5-238AVNTFYHQGYDLT..NDLEP..YMKTVAAQLEK..MTQ.......QAAAEKKEM
F5HLS9_ANOGA/7-247DWLVFYHLGHEVA..EDAKE..YLSDLQLKVQK..TRENF....DETRQKAQEL
A7RS04_NEMVE/6-249VQMTFFHSGHEAF..KDYME..YMTDLQLRLQN..TRDRF....SATKEQAESL
E9GSI6_DAPPU/6-249GWLTFYHQGYEVS..KEFRP..YMTDLQVRLQK..TRENF....NTTREEAESL
F1Q975_DANRE/5-238AQYTFFHQGFDLL..RDLEP..TMKTMASQLSQ..LST.......DCSAKRKDL
B7QNY3_IXOSC/6-251GWLTFYHQGHEVA..KEFNS..FNTDLQVRLQKASTRENF....EATHCEAEHL
G1MY05_MELGA/6-253ALYFFFFLGNELF..KNLDI..FQMKLKSFLHQ..TRNRF....EGTRSEVEEL
G6DT66_DANPL/5-238ACSTYNHQGADLS..EDLEP..FLKSTADEIAT..MRN.......DTKSLDKEM
H3D0T3_TETNG/38-270AQVTFFHQGSDLI..RDLEP..TMKTMAAQLSQ..LSA.......DCSARRKEL
F1QMT1_DANRE/5-238ANLTFFNQGHDLF..SQLQP..LMKQLSGQLDQ..LVV.......DSAKEKRDM
H2RJ90_TAKRU/5-238AQVTFFHQGSDLL..RDLEP..TMKTMAAQLSQ..LST.......ENSAKRKEL
M4AKB4_XIPMA/5-238AQFTFFHQGFDLL..RDLEP..SMKTMGAQLSQ..LSA.......ACAAKRKEL
E9BWJ0_CAPO3/31-270SQVTFFHLAYESF..HAMES..YMQNLALRLQN..TRFTF....DDQKEK....
F6ZTY0_XENTR/7-247GQISFLKKGSEIF.SKKMDG..VISSMSSMIRR..IQG.......ELDAEAESM
J9K1I7_ACYPI/5-235AWGTYFHQGFTLT..EDLQD..FIQSLNKEVIV..MTA.......EAAEMEN..
W4YQP0_STRPU/5-238AQFTFFHQGYDLM..KDLNP..TFKELGNKGYD..LMK.......D........

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window