Sequence alignment for CL0146

PF05702

Q9E207_9ALPH/1-87M.AS......NCSLELFMLLLLSVFTSAHTT...................HKLPEHRN.....FWHASCSARGVYIDGSA
Q9DH60_MEHV1/1-94M.GSVGVHHISPSWSVYVIWIVCVHVVLAVD...................GERSIAGA....DFWDSTCSAVGVSIAFSS
O56867_ILTV/1-117M.RLPWERSFMLLGAVVYLLHLALVFAQPGVTPGHGMEHGYYGLGAGNMLGAENSMYSANMEHFYHSACSSRGFSLVNGT
Q66598_9ALPH/1-99M.LS.ARL.VALAILTCLLVVFGLTRGASGDLEAK...............QRLDVAREEERRDFWHAACSGHGFPITTPS
Q69317_ILTV/1-95M.GLMDIHNAVCSLVIGVAILIATSQATFVD...................WGSSITSMG...DFWESTCSAVGVSIAFSS
O89248_9ALPH/1-95M.GLSDIHHVVCKVLICVIASLVESRATSID...................SGRPIAVAG...NFWESTCSAVGVSIAFSS
Q9IF47_9ALPH/1-98M.VSSARLSLTLVAALCALVTPALSSIVFSE...................GSLPLLREESRTSFWSAACAARGVPVDQPT
Q89806_9ALPH/1-91MPRS......PLIVAVVAAALFAIVRGRDPL.....................LDAMRREGAMDFWSAGCYARGVPLSEPP

PF03554

GN_MUHVS/56-137V--------------PVSVAASVPDTTVNKI-------------------VISDGSEAHNINEFYDVKCHSHFYGLSVSS
GN_EBVB9/20-101A--------------TWLLTGVLPAGASSPT-------------------NAAAASLTEAQDQFYSYTCNADTFSPSLTS
Q99CY8_BHV4/8-89H--------------YIFMLILLCLLTNVTL-------------------QQNNTTVTHDFDMFHQYNCTADRFPPTLLS
Q9E7L5_HCMV/52-133T--------------ATSTSSTTSAKPGSTT-------------------HDPNVMRPHAHNDFYNAHCTSHMYELSLSS
GN_HHV7J/3-84L--------------YKIVSKPIILLAFFFT-------------------RVVFTNEVDGEELFYKPTCHSDTYEIILKK
GN_HHV6Z/1-82M--------------SCKKGARQRLYVSLWL-------------------FYILVFAAATEMDFYSSECHSHTYEIVLNS
Q9WRP9_9GAMA/22-103C--------------ATVTTSSTTGTGTPPV-------------------TTNPSAAPSVTPSFYDYDCSADTYQPVLSS
GN_HCMVA/55-136T--------------TTTTLSTTSTKLSSTT-------------------HDPNVMRRHANDDFYKAHCTSHMYELSLSS
Q9YTL3_ATHV3/8-89C--------------WLIIFKTCLSAAQMTD-------------------TAATTSGAPLNNNFYSYSCSADTFVPSIKT
GN_ALHV1/19-100Y--------------ITSCDSSSTPRAVTHP-------------------VLNATSNFNPTAGFYSFSCNADTYLLRLNS
P88941_HHV8/28-109V--------------ASSTERSSPSTAGLSA-------------------RPSPGPTSVTTPGFYDVACSADSFSPSLSS
Q9DWC7_RCMVM/41-122L--------------FVVCFSCLGAVSATEP-------------------VAADASSRINVQEFYDVSCHSHYYHLSVVS
P88990_MHV68/4-85L--------------VVVLFLMCAFVCGITQ-------------------ETTPTPKPDDSSDFYGHGCNADTYVPQWGS
GN_EHV2/7-88V--------------LLLICLCLMDNVSQVV-------------------CSQNSTTPSKFPTFYSYDCNADTYAPQLTS
Q993G2_9GAMA/21-102G--------------TNSTPTSLLPLLEDLT-------------------HDTPPPDKQPLPIFYSYMCNADTFSPSLTS
GN_SHV21/9-90F--------------LSFGVIFLRVSSLTEK-------------------SHTTSYTILHNNNFYSNSCSADTYVPSIKT

PF05702

Q9E207_9ALPH/1-87IATLFFYASLLGVCVALTALAYNACFRLFTRSVLRSTW
Q9DH60_MEHV1/1-94GFSVLFYLGLAAAISALLVGSYSACFRLFTADMFREEW
O56867_ILTV/1-117AASVFFFISLAVALIGLLAVLYNGCFNSFKSSVISSRW
Q66598_9ALPH/1-99TAAILFYVSLLAVGVAVACQAYRAFLRIVTLEML.RHL
Q69317_ILTV/1-95GFSVLFYMGLVAVISALLAGSYHACFRLFTADMFKEEW
O89248_9ALPH/1-95GFSVLFYLGLVAVISALLAGSYHACFRLFTASMFDDGW
Q9IF47_9ALPH/1-98AAAVTFYICLLAVLVVALGYATRTCARMLHTSPAGRRV
Q89806_9ALPH/1-91QALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKE

PF03554

GN_MUHVS/56-137FASIWMMVNAIVFICAFGVFMRHWCYKAFTSDTAK---
GN_EBVB9/20-101FASIWALLTLVLVIIASAIYLMYVCFNKFVNTLLT---
Q99CY8_BHV4/8-89FSSIWAILNVLIVLLATILYCLYTCFYKFVHDMVK---
Q9E7L5_HCMV/52-133FAAWWTMLNALILMGAFCIVLRHCCFQNFTATTTK---
GN_HHV7J/3-84FSSIWILVNTFILLCSFSLFLKYWCFKTLAKETVK---
GN_HHV6Z/1-82FSSIWLLINLFLLLCSFAIFLKYWCYKTFASETVK---
Q9WRP9_9GAMA/22-103FSSIWAVINSVLVAVATFLYLTYMCFFKFVETVAH---
GN_HCMVA/55-136FAAWWTMLNALILMGAFCIVLRHCCFQNFTATTTK---
Q9YTL3_ATHV3/8-89FSSIWAIVNGIIFFGASLLFLRHLCFVRFISHLTK---
GN_ALHV1/19-100FSSIWALMNVFVVLVSTVVFMTYLCFTKFVHTLIY---
P88941_HHV8/28-109FSSVWALINALLVVVATFFYLVYLCFFKFVDEVVH---
Q9DWC7_RCMVM/41-122FASIWMFLNAAVFIFAFCVFLKHWCFRAFTSDTAK---
P88990_MHV68/4-85VSSVLAIINGSIVTVSSGVFLIYACFSKFLTTMTS---
GN_EHV2/7-88FSTIWTLLNVLVMTIACVIYLIYMCFNKFVATMTN---
Q993G2_9GAMA/21-102VSSIWAMMSVTLVIIASTLYLMYVCFNKFVTTMLN---
GN_SHV21/9-90FSSVWAILNVIIFFCASLFYLRHLCIVKFISNLTK---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window