Sequence alignment for CL0146

PF03554

GN_HCMVM/53-133--ATSTSSTTSAKPGSTTHDPNVMRPHAHND--------------------------------FYNAHCTSHMYELSLSS
GN_MUHVS/58-137--.VSVAASVPDTTVNKIVISDGSEAHNINE--------------------------------FYDVKCHSHFYGLSVSS
GN_EHV2/19-88--VSQVVCSQNST...........TPSKFPT--------------------------------FYSYDCNADTYAPQLTS
GN_HHV6Z/19-82--YILVFAAATEM.................D--------------------------------FYSSECHSHTYEIVLNS
GN_ALHV1/20-99--ITSCDSSSTPRAVTHPVLNATSNFNPTAG--------------------------------FYSFSCNADTYLLRLNS
GN_SHV21/20-90--SSLTEKSHTTS..........YTILHNNN--------------------------------FYSNSCSADTYVPSIKT
GN_GAHVM/18-92--AILIATSQATF......VDWGSSITSMGD--------------------------------FWESTCSAVGVSIAFSS
GN_HHV8P/29-109--ASSTERSSPSTAGLSARPSPGPTSVTTPG--------------------------------FYDVACSADSFSPSLSS
GN_EBVB9/33-100--SSPTNAAAASL............TEAQDQ--------------------------------FYSYTCNADTFSPSLTS

PF05702

Q9E207_9ALPH/1-87M.AS......NCSLELFMLLLLSVFTSAHTT...................HKLPEHRN.....FWHASCSARGVYIDGSA
Q9DH60_MEHV1/1-94M.GSVGVHHISPSWSVYVIWIVCVHVVLAVD...................GERSIAGA....DFWDSTCSAVGVSIAFSS
O56867_ILTV/1-117M.RLPWERSFMLLGAVVYLLHLALVFAQPGVTPGHGMEHGYYGLGAGNMLGAENSMYSANMEHFYHSACSSRGFSLVNGT
Q66598_9ALPH/1-99M.LS.ARL.VALAILTCLLVVFGLTRGASGDLEAK...............QRLDVAREEERRDFWHAACSGHGFPITTPS
G9CUG2_9ALPH/1-95M.GLMDIHNAVCSLVIGVAILIATSQATFVD...................WGSSITSMG...DFWESTCSAVGVSIAFSS
O89248_9ALPH/1-95M.GLSDIHHVVCKVLICVIASLVESRATSID...................SGRPIAVAG...NFWESTCSAVGVSIAFSS
Q9IF47_9ALPH/1-98M.VSSARLSLTLVAALCALVTPALSSIVFSE...................GSLPLLREESRTSFWSAACAARGVPVDQPT
K4P170_9ALPH/1-91MPRS......PLIVAVVAAALFAIVRGRDPL.....................LDAMRREGAMDFWSAGCYARGVPLSEPP

PF03554

GN_HCMVM/53-133FAAWWTMLNALILMGAFCIVLRHCCFQNFTATTTK---
GN_MUHVS/58-137FASIWMMVNAIVFICAFGVFMRHWCYKAFTSDTAK---
GN_EHV2/19-88FSTIWTLLNVLVMTIACVIYLIYMCFNKFVATMTN---
GN_HHV6Z/19-82FSSIWLLINLFLLLCSFAIFLKYWCYKTFASETVK---
GN_ALHV1/20-99FSSIWALMNVFVVLVSTVVFMTYLCFTKFVHTLI.---
GN_SHV21/20-90FSSVWAILNVIIFFCASLFYLRHLCIVKFISNLTK---
GN_GAHVM/18-92GFSVLFYMGLVAVISALLAGSYHACFRLFTADMFK---
GN_HHV8P/29-109FSSVWALINALLVVVATFFYLVYLCFFKFVDEVVH---
GN_EBVB9/33-100FASIWALLTLVLVIIASAIYLMYVCFNKFVNTLL.---

PF05702

Q9E207_9ALPH/1-87IATLFFYASLLGVCVALTALAYNACFRLFTRSVLRSTW
Q9DH60_MEHV1/1-94GFSVLFYLGLAAAISALLVGSYSACFRLFTADMFREEW
O56867_ILTV/1-117AASVFFFISLAVALIGLLAVLYNGCFNSFKSSVISSRW
Q66598_9ALPH/1-99TAAILFYVSLLAVGVAVACQAYRAFLRIVTLEML.RHL
G9CUG2_9ALPH/1-95GFSVLFYMGLVAVISALLAGSYHACFRLFTADMFKEEW
O89248_9ALPH/1-95GFSVLFYLGLVAVISALLAGSYHACFRLFTASMFDDGW
Q9IF47_9ALPH/1-98AAAVTFYICLLAVLVVALGYATRTCARMLHTSPAGRRV
K4P170_9ALPH/1-91QALVVFYVALTAVMVAVALYAYGLCFRLMGASGPNKKE

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window