Sequence alignment for CL0147

PF03908

SEC20_HUMAN/133-224--QTSSTITESLMGIS------------------RMMAQQVQQSEEAMQSLVTSSR-TILDAN-----EEFKSMSGTIQL
SEC20_SCHPO/122-213--TSASQVTAAMRDIH------------------AQMVQAVDMSAENAMELSSSTN-LLETLQ-----EKYFGVEDVLYT
SEC20_YEAST/204-295--SKTKQLTNNLVRGN------------------QILQSGILQSDLNLDELRAQTN-SLTQID-----DKYTQFETVFKK
Q9VNI9_DROME/135-226--SQENDVTEKMLAIS------------------RHLSETTQKSAITLETLVASSQ-NVEATS-----DELHHTAGSISM
D7L520_ARALL/143-234--SDAESITESLRRSR------------------QLMVQEVERSTNTLVAFDESTG-VLKKAE-----SEYKGHRSLLSR
Q5ACE5_CANAL/148-239--SQNKQITKSLQASR------------------QLLSAGILQSELNIDNIDQQTK-DLYKLN-----EGFIQFNDLLNR

PF12352

GOS12_ARATH/167-232--VQVLRERASIHGSI------------------SHIDDVIGQAQATRAVLGSQRS-LFSDVQ-----GKVKNLGDKFPV
VTI1A_MOUSE/123-188--ERLERSSRRLEAGY------------------QIAVETEQIGQEMLENLSHDRE-KIQRAR-----DRLRDADANLGK
Q9W0N6_DROME/129-194--ERIERTGNRLTEGY------------------RVALETEQLGAQVLNDLHHQRE-TLQGAR-----ARLRETNAELGR
GOS11_ARATH/133-198--QALIKEHMGINRNT------------------AQMDGVISQAQATLGTLVFQRS-TFGGIN-----SKLSNVASRLPT
VTI1_YEAST/125-190--AILQKSGDRLKDAS------------------RIANETEGIGSQIMMDLRSQRE-TLENAR-----QTLFQADSYVDK
O18230_CAEEL/133-198--QRLERSTRKVQDAH------------------RIAVETEQIGAEMLSNLASQRE-TIGRSR-----DRLRQSNADLGR
GOSR1_DROME/143-208--EMYLKESGHLNSAS------------------HLVNDQINIAIETRDHLHAQRQ-AFKRLQ-----TRFNDISNRFPL
GOSR2_CAEEL/121-186--DHELLLNDRLQSSH------------------THLDDLISQGSAVLENLKSQHL-NLRGVG-----RKMHEIGQALGL
BOS1_SCHPO/144-209--DGLLKEHDFLGRAE------------------SQVDEFLERGRMILGDLVEQGS-VLKATK-----TKVLNAANTLGI
GOS1_SCHPO/95-160--FLEMQEANSLDNSI------------------RGTNELLERAYATREDFDYQNS-VLGNVT-----NRINGAAMSIPF
VTI12_ARATH/129-194--ERLDQSSDRIRESR------------------RLMLETEEVGISIVQDLSQQRQ-TLLHAH-----NKLHGVDDAIDK
GOSR2_DROME/124-189--DYELQHHTQLGNAH------------------RGVDDMIASGSGILESLISQRM-TLGGAH-----KRIQAIGSTLGL
VTI1_SCHPO/122-187--NRLEQSSQRLLESQ------------------RIANETEGIGASILRDLHGQRN-QLEHSL-----EMLGDTSGHLDR
VTI11_ARATH/128-193--ERLGRTTDRVKDSR------------------RTMMETEEIGVSILQDLHGQRQ-SLLRAH-----ETLHGVDDNIGK
GOSR1_YEAST/136-201--EYIQNETRRIDQSN------------------NVVDRLISQAWETRSQFHSQSN-VLNTAN-----NKVLQTLQRIPG
MEM11_ARATH/134-199--DEEAQAMSSVKNSK------------------RMLEESFSSGVAILSKYAEQRD-RLKSAQ-----RKALDVLNTVGL
Q21499_CAEEL/123-188--DEELNLNDKLKYSD------------------NMIDQMLAQGASVFEDLQKQKY-NLLSIR-----KRFHFLTKSLGI
G1QU95_NOMLE/161-226--ELFLKEHDHLRNSD------------------RLIEETISIAMATKENMTSQRG-MLKSIH-----SKMNTLANRFPA
Q1PDQ2_ARATH/124-188--EGLVRTREMIKDSQ------------------RKLLETENIGISILENLQRQKE-SLQNSQ-----AMLHEIDDTVKE
Q91XH6_MOUSE/137-202--ESLNRATQSIERSH------------------RIATETDQIGTEIIEELGEQRD-QLERTK-----SRLVNTNENLSK

PF05008

VTI1A_HUMAN/12-90FAVLTAEITSKIARVP..RLP.P..D..EKKQMVANVEKQLEEAKELLEQMDLEVR.EI..PP.....QSRGMYSNRMRS
B4FC18_MAIZE/12-90YCEASASLSRKCTAAS..AL..D.GE..RKKQKLSEIQSGVEEAESLIRKMDLEAR.SL.QP......SIKAGLLAKLRE
B2AYG5_PODAN/21-99YLLVRADLTQKLDQIN..ELS.G..E..PRKAALSAAERALEETDELVGQMQMEKQ.NV..PS.....SQRTAINRRIRD
Q9W0N6_DROME/11-90YATLIAEITAHIGRLQ.QQNN.N..S..ERHDLCSKIDSSLPEAQELLEQMGLEVR.EL..NP.....GLRSSFNGKLQV
C5DBU8_LACTC/12-93FKTTLEQAKTLLSVAP..SQP.V..S..QRNGTLKEVEQQQDELLDLVDQMEIEVN.NG..ALD...NAARSSFKAKLRE
Q2UJN0_ASPOR/21-99LKLIQADLNQTLDQIA..ESS.G..E..QRKSTIRKAEQVLDEATELLDQMRMEKQ.NI..PS.....AARSKVNARFRN
C4JRN3_UNCRE/21-99LKLVQADLNQKLDQIA..EAT.G..E..ERKSSIRQAERALDEASELLDQMRIEKE.NI..PS.....ATRSKVNARFRN
B9S915_RICCO/12-91YCELSANLSRKCNSTS..LLP.D.AE..EKKEKISEIKSGLDECDVLIRKMDLEAR.SL.QP......SVKAMLLAKLRE
Q0UKT7_PHANO/21-99LKLVQADLNQQLEEIK..EST.G..E..PRKAAISKAERALEEAEELIGQMRLEKS.NI..PA.....NLKSKFNTRFRN
VTI11_ARATH/12-90YCELSASLSKKCSSAI..SL..D.GE..QKKQKLSEIKSGLENAEVLIRKMDLEAR.TL.PP......NLKSSLLVKLRE
C1E4H4_MICSR/12-91FLEFTASIARNTSSLP..SLA.G..D..AKVQKIGETESDVAEAEALIRRMDLEAR.SQQNP......AAKNPMLNKLRD
Q755J1_ASHGO/12-92FQATLEQCQRLLRQAQ..GEP.V..A..QRNATLQTLEQHKDDLYDILDQMEVEVN.NM..VGD...PARQVASRSALRD
A2G6F9_TRIVA/10-88LDSHKDVIEQKIERLK..SA.....DPGSRNSLISEINQDLDNFRNEIKQLSNRLK.TA..PQ.....SDKQFYSEDLSN
B0WIR4_CULQU/11-89YAVLTAEITAQIGRLG..VSP.A..G..ERTKLISDIDRQLEESQELLEQIGLEIR.DV..PA.....ANRSGYTSRLNC
A8NL72_COPC7/16-95FVHLLQGIREKLEGDA..RSGHG..E..QRKAALRKVEIELDEADDIVSQLEIELN.GI..PQ.....SLKPPYLTRLKQ
A9U3W6_PHYPA/12-90YCELSANLSRKCTSVS..AL..H.GE..EKKHKLTELKSGLDEADSLIRRMDLEAR.SL.PP......TQKAALLAKLRE
O18230_CAEEL/18-98YSLQTAEITSKIGRVH..TLP.S..S..DRAGAVQEIRKSLEEVNDLLDQMELVVR.EL..ESN...TTERTKYELRVRS
VTI1B_BOVIN/18-97FRGLHEDLRGVPERLL..GMA.G.TE..EKKKLIRDFDEKQQEANETLAEMEEELR.YA..PL.....SFRNPMMSKLRT
Q8S9S2_ORYSJ/12-90YCEISASLARKCTAAS..AL..Q.GE..KLKQKASEIKSGIDGAEALIKKMDLEAR.NQ.QP......SVRAGLLAKLRE
A7TDM7_VANPO/12-93FKITFDQALSALSLAA..GQP.I..P..QRNASLKQIEQQQDELLDLVDQMEIEVN.NS..VSD...VQERATFKSKLRD
A0C5I0_PARTE/14-94CDEEVTVICKKLQQIL..TTI.D..IQEDKNFALKEAQSCIDSANENLKQMEVELQ.GY..AK.....NIKDNLKQQFIL
C4Y5F8_CLAL4/12-90FQLAIQEARSNISAAS..AAP.A..D..QRQAALQNIERSTDEALEILEQMNIEVQ.SL..PS.....NQRSSHNAKLRQ
C5FUM7_ARTOC/21-99LKLVQADLNQKLDQIT..ESS.G..E..ERKAAIRQAERALEEANELLDQMRMEKE.NI..PS.....STRSKINARFRN
A4RVZ0_OSTLU/12-92FCEFSSSIHRGVDGVK..TAA.D.AT..TRGRHAKAIEADVAECEALVRRMDLEAR.SVSDP......AVKTPMLNKLRD
B0DSV4_LACBS/16-95FRHIIQSIRNKLEGEG..KNQLG..E..QRKAALRKVEIELDEADDIVSQLEIEIQ.GI..PQ.....SIKSQYTSRLKQ
A0BIB1_PARTE/18-96YKAHMESVMHYLLKIS..NDR.K..D..DNNKSFSKVCDRLQQAEQCIKQMELEAS.TL..SV.....SYKKELMETVKQ
A0E3A1_PARTE/12-87FEKYQQQVCSLIRQTQ..IN........RSDETLKEIASVFTDLQNCLQQMDIEST.SI..AV.....SDRQELKNKVKR
VTI12_ARATH/12-91YCELSTNLSRKCHSAS..VLS.N.GE..EKKGKIAEIKSGIDEADVLIRKMDLEAR.SL.QP......SAKAVCLSKLRE
B8CG98_THAPS/14-97FLSLTEQVTSKLRSLD..PST.SSGLPPTAEADIKMAHNLLLQADDLLKQMGLEAR.GVDDA......GVKRDLLGKVRV
A2E5L8_TRIVA/11-89IDRIKKDISNAVSNLP..QYS.A..Q..ERPSKMQKIEARFGEFDAAINELDLQAL.....MFD...VNDKNAAKKYLVE
C3Z5P8_BRAFL/12-90YSNVTAEITNKIAKIV..KLS.G..G..EKRHMVTNVEKQMEEAKELLEQMDLEVR.DI..PS.....KERQKYATRLKS
Q23YX3_TETTS/11-89INDMLDNFEKEVKQLD..KK.....DAAQKKKAIQKNQTYLKSIEQMIQSYKLEVQ.AL..DR.....NESAQYTESLKQ
Q6CVQ2_KLULA/12-99CQVAINQAKVLLANAK..NDA.GAVLKGGKSDILLQIQQYHDESLELVDQMEIELN.NTGNSLD...SKTRASYKAKIRD
Q4P2L8_USTMA/12-90LEQLKQGIRQKLDQAK..SQN.G..E..AKKSTLRRAEMELEEADEVISQMDIEVQ.GF..PQ.....SVRSRFSVQIRG
Q6BS46_DEBHA/12-91LQLALQEAKSKLAQIS..SAD.G.KD..ERKQFLRAIETATDECLEVLDQMSIEVQ.NL..PS.....NQRSTYNTKIRQ
VTI1A_DICDI/11-87FQHVCNSITRRIKQLP..NYG.G..E..KKKIAVREVENDIDEALKFISEMEKLAQ.NH.........PQRIKLQTKTKQ
Q6FKL6_CANGA/11-92FKATLDQGKAALVKAS..AQS.L..P..ERNATLKQIEEQKDELYDLLDQMALEVN.NS..VSD...MQQRANYKAKIRD
C1MQ00_MICPC/12-91FLEYTASINRATASLP..SLD.G..A..AKSQKIAEVDAEVAEAEALVRRMDLEAR.SLRDP......TVKTPMLAKLRD
VTI1_SCHPO/8-83YRLLRADIEEKLNDLS..KS........GENSVIQSCQRLLNEIDEVIGQMEIEIT.GI..PT.....SERGLVNGRIRS
Q57YW6_TRYB2/24-106ASRLQESLQRSGVSYQAPPAA.GPQ...SRSQQCHSLQQSLTRLRELITNMSYESN.EV.EPA.....SAKEEVKRRLED
C3XZI6_BRAFL/13-92FRNLHDELRRKAQSRL..PNA.V.GE..ERKRIVREVMRGIEECTTLVQEMEEEVK.QA..PP.....TYRPQMLSRLRN
Q6CFZ4_YARLI/14-92FLLAQSEIEQKLESIS..TLE.R..D..ARTSAVKAVERTIGEAYEILDQLSVEIQ.NI..PS.....SARAPLSANLRQ
Q7RGW8_PLAYO/16-95YMKTVNYTEKIIKDNN......S.....DQNKLLNIYEKAVNSAESMFKRMQLEVETNTIISDQ...QNELNEIQTKITE
B9RLV4_RICCO/12-90YCELSANLSRKCTSTS..VL..D.GE..LKKQKLSEIKTGLDEAETLIQKMDLEAR.SF.PP......NLKAVLLAKLRE
A9VB72_MONBE/13-91LQAEIDKLRRLQSQ.I..SNY.S.GE..QRRQAVQEAQSHLDECEDLLYDMSAEVQ.NA..PP.....SLRQRMNAKVTD
Q7QGG0_ANOGA/11-89YAVQTAEITAQIGRIA..HAS.G..A..ERNKLISDVDRQLEESQELLEQIGLEIR.DI..PQ.....NSRAAYTSRLNC
A9T6G0_PHYPA/12-89FCELCTHIKKRCKSVS..S...N.ET..EKKQKYDELKTGLDQAESLIRRMDLEAR.TL.IP......PLKIALLTKLRE
Q7S1W2_NEUCR/21-99YQLVQADLVQKLDQIS..ELT.G..E..PRKAALSTAERALEEAGELLDQMNMEKQ.NV..PS.....SSRTAINKRLRD
A5B0Y2_VITVI/12-90YCELSTNLSRKCTSAS..VL..D.GE..EKHQKISEIEAGLEEAVILIRKMDLEAR.SL.QA......GVKAMLLAKLRE
C5DT60_ZYGRC/12-93YRSTFDDARSRLQTAP..TQA.L..S..ERNLTLRQVEQQQEELVDLIDQMEIEVN.SA..IPN...GQERANYKAKLRG
A9SJ58_PHYPA/12-89YCELSTNLNKKCNSIS..S...N.EV..EKKQKFDDLTKGLDLAESLIKRMDLEAR.TL.PP......AQKATLLAKLRE
A9UY36_MONBE/12-90FGDTLAEINSLVNEIK..DLD.G.DE...KKARVRTAEEKVDNAHELVEQLELDVL.DV..PI.....SERKPIQHRIKA
B6K5P8_SCHJY/8-83FKLLQADIEEKLSDVQ..QN........GDSRAAESCKRALNEADEVLAQIELALT.NI..PT.....AERGAAQSRARD
A7S502_NEMVE/13-92VKVLLEDVTQRVYHRI..PKL.S.GE..QRKAAVRDVEKKIENAFIIIDELDEEAS.AA..PG.....AYRNSMMTRVRT
A8HTE8_CHLRE/15-93YCNKSTDISRKITTAS..TL..G.AE..AKRKKLVEVDVDIKEADTIIKKMDNEAR.SV.AP......DRQKQLQNKVKE
B3S7I7_TRIAD/11-89FSASVADISYKINRIP..NLN.G..D..EKKAVIHDCEHSLEDMKELIEQMDLEVR.DA..PS.....TARSELAKKWNN
B3SCN9_TRIAD/13-92LAFLFKEVDKTINITI..PKE.S.GE..QRKNTIRKTQKKLDEVKYLLNDLDAELQ.QA..PA.....SYRNQMSSKARS
A2FRJ4_TRIVA/15-94AEGLLDQIKSDMGRLD..GQP.L..D..KRRALDAEIERKISSLENLLNKMTADLR.SVTQQ......SSKSFYEGEIKN
A8PVB8_MALGO/12-91FAQLRQSIENRLAVDF..SSM.S.AE..TRHSALRHADAEAEEAGELVSQMEIEVQ.SF..PS.....AVRDRYVAELRA
A0CX93_PARTE/11-89LNAELDKLQKEIDSLS..KK.....EYNQKNAAIKKCQAQVKSISTLIESYELEIS.NL..DK.....VQSAKYNDSLRS
B0CY19_LACBS/16-97FQQFIEAIRVKLEGDA..KEERG..EQQQRSATLRQVEMELDEADEMVSQMDIEIQ.GI..PQ.....SVRAQYHTRLRA
A3LNU7_PICST/12-90FQLALSEAKSKLAQIS..AVE.G..E..SRKSYLRAIEGAIEEGQEVLDQMGIEVQ.NL..PT.....NQRSSYNTKIRQ
C4R6G6_PICPG/12-90IQMTLAEAKRNLANIS..ASN...SV..DRTRQIRLVEENLDDSYDLLERLNLELQ.NV..ST.....SDRTKYNVTLRD
B4L0B4_DROMO/11-88YAALIAEITAHIGRLQ...QN.A..T..ERNELCTKIDGSLSEAQELLEQMGLEVR.EL..NP.....LQRSNFNNKIQV
B7P4P6_IXOSC/8-86YAALTAEITSKSGRIP..NLH.A..A..DKSAMVAEVERHLEEANELLEQMELEVR.SL..PA.....PTRPKYQNRVKS
A2E8Q0_TRIVA/13-92CTELEKDIGEAISRIP..ET.....EQGQRRKLVREIEEKIKALIQDRDFMDCEIN.EM.QPG.....EERDSYQEKLEY
Q7SY45_DANRE/13-91YKSLYDEVKLMPERVQ..KSQ.G..E..ERKRIVRDFDERVSEAEEVLQGMEQELF.GA..PS.....SFRTPMSTKIRL
A7SUK0_NEMVE/12-90FGNLSAEITAKICKIP..NLH.G..E..AKRNTVADVERSFEEANELLEQMDLEAR.EI..TG.....PEKSKLSNRLKT
A4HD25_LEIBR/23-104SEALRQSCDRRAAGYKAPPAT.GPG...SRLQRGAHLTTVLAQLRELVNSMEYEAN.DL..PA.....AHRQTAKERIVE
Q01B19_OSTTA/53-133FCAFSSAIRRGVDGAR..DAT.T.PS..ERRARASEIESAVAECEALIRRMDLEAR.SVGDA......SAKTTMLSKLRD
E7NLP9_YEASO/12-92FKTTLEQAKASLAEAP..SQP.L..S..QRNTTLKHVEQQQDELFDLLDQMDVEVN.NSIGDA.....SERATYKAKLRE
H3DMU8_TETNG/18-96YRSLYDELKLMPDRAQ..RSY.G.AE..ERKRLVRTFDERQGEAEEVLQGMEKELL.AA..PL.....SYRNTMNTKLRM
M1BPY1_SOLTU/12-90YCELSANLTKKCNSAT..ILD.G..E..QKKQKVSEIKAGLDDAEALIRKMDLEAR.SL..PP.....NVKATLLAKLRE
Q0V9D5_XENTR/13-89YKELYTKLQKIQERLQ..SCY.G..E..EKKKLLREFSEKQKEANEMLSEMEYELK.SA..PP.....TFRHQAAGQLRA
Q1PDQ2_ARATH/12-90YSELSINLSKKCSLAF..SLK.G..G..EKKEKLSEITYDLENAEKLISKMDHAAS.NL..PP.....NIKSILLEKLKE
Q24E32_TETTS/12-87FNKIVNQIQKMLANVQ..NLD.Q..N..KKDKTMIDIKYELNEADLQIKQMEIEVN.SL..PY.....QTKQQLQQKIKR
Q5KDU9_CRYNJ/17-95.KQLFGSLKSKLDGEA.KSLT.G..E..QRKAALKRVSEEIDEAEEIVAQMEVELP.SM..PT.....SIRQTYQGRLAA
U3JA57_DANRE/12-90FGTLTAEITNKIGRIP..KLA.G..E..EKTQLVLNVDKQLEEVRELMEQMDLEVR.EI..PI.....QSRAMYNSRLKS
V4ZRC1_TOXGO/12-96FLNSYALLKSGCATLR..TED.R.SA..ERRRGIARCGKYLQQAESALHQFELETR.MP..PTDGFADVDEFSLKSKAAN

PF03908

SEC20_HUMAN/133-224GRKLITK-YNRRELTDKLLIFLALALFLATVLYIVKKRL
SEC20_SCHPO/122-213SKRIIKS-LKLSDRSDYFLVVSGFGFFIFVVVYLLFKRI
SEC20_YEAST/204-295TADLVKV-LENASHQEKRDVYLSLGFLLCCVSWVLWRRI
Q9VNI9_DROME/135-226SGKLLKK-YGRRECTDKMLLFFAFSLFLACVFYIVQKRL
D7L520_ARALL/143-234TRNLLST-MQRQDVIDRIILIVGFSLFVFAVVYVVSKRI
Q5ACE5_CANAL/148-239SKKIVKF-IEKQDKADRQRIYLSMGFFILCCSWVVYRRI

PF12352

GOS12_ARATH/167-232IRGLLGS-IKRKR--------------------------
VTI1A_MOUSE/123-188SSRILTG-MLRRI--------------------------
Q9W0N6_DROME/129-194ASRTLNT-MMLRA--------------------------
GOS11_ARATH/133-198VNTILAA-IKRKK--------------------------
VTI1_YEAST/125-190SIKTLKT-MTRRL--------------------------
O18230_CAEEL/133-198ANKTLSS-MIRRA--------------------------
GOSR1_DROME/143-208ISSLIQR-INIKK--------------------------
GOSR2_CAEEL/121-186SNSTLQV-IDRRV--------------------------
BOS1_SCHPO/144-209TRHTLSL-INRRS--------------------------
GOS1_SCHPO/95-160INQILRK-TSIRR--------------------------
VTI12_ARATH/129-194SKKVLTA-MSRRM--------------------------
GOSR2_DROME/124-189SNHTMKL-IERRL--------------------------
VTI1_SCHPO/122-187SLRTLKT-MARRL--------------------------
VTI11_ARATH/128-193SKKILTD-MTRRM--------------------------
GOSR1_YEAST/136-201VNQLIMK-INTRR--------------------------
MEM11_ARATH/134-199SNSVLRL-IERRN--------------------------
Q21499_CAEEL/123-188SDTTIRL-IEKRV--------------------------
G1QU95_NOMLE/161-226VNSLIQR-INLRK--------------------------
Q1PDQ2_ARATH/124-188SRSIVRS-IKIK.--------------------------
Q91XH6_MOUSE/137-202SRKILRS-MSRKV--------------------------

PF05008

VTI1A_HUMAN/12-90YKQEMGK.LETDFKR------------------------
B4FC18_MAIZE/12-90YKSDLNN.VKSELKR------------------------
B2AYG5_PODAN/21-99YKSDVDG.YRRKLRT------------------------
Q9W0N6_DROME/11-90AQAELKR.LQAEYRL------------------------
C5DBU8_LACTC/12-93YKKHVQSDVKSPLQQ------------------------
Q2UJN0_ASPOR/21-99YATDLDE.SKRKLKS------------------------
C4JRN3_UNCRE/21-99FLSDIDE.VKRKLKS------------------------
B9S915_RICCO/12-91YKSDLNN.LKREFKR------------------------
Q0UKT7_PHANO/21-99FEQDLDT.TKRKLET------------------------
VTI11_ARATH/12-90FKSDLNN.FKTEVKR------------------------
C1E4H4_MICSR/12-91YKSELAR.LKRESQL------------------------
Q755J1_ASHGO/12-92LRREAGM.VKQQLRE------------------------
A2G6F9_TRIVA/10-88FQNAENK.FSQEIKK------------------------
B0WIR4_CULQU/11-89YQAEWKR.LQQEFTN------------------------
A8NL72_COPC7/16-95AKSDLNK.YKKMSRE------------------------
A9U3W6_PHYPA/12-90YKSDLNN.LKRDVKK------------------------
O18230_CAEEL/18-98YQSDKKQ.LDTELEK------------------------
VTI1B_BOVIN/18-97YRKDLAK.LHREVRS------------------------
Q8S9S2_ORYSJ/12-90YKSDLNN.LKGTLKR------------------------
A7TDM7_VANPO/12-93YKKRVQSELKEPLQK------------------------
A0C5I0_PARTE/14-94QKRKLDE.MNKVYTQ------------------------
C4Y5F8_CLAL4/12-90YRSEVDQ.SKRQLRE------------------------
C5FUM7_ARTOC/21-99YLTDVDN.TKRKLRS------------------------
A4RVZ0_OSTLU/12-92YKSELAK.LKRDARE------------------------
B0DSV4_LACBS/16-95AKADLTK.YKKLSKD------------------------
A0BIB1_PARTE/18-96YKRDMAK.VEKDFKQ------------------------
A0E3A1_PARTE/12-87YKSETEA.MKKQFRI------------------------
VTI12_ARATH/12-91YKSDLNQ.LKKEFKR------------------------
B8CG98_THAPS/14-97CKTRLAN.LRDDYEA------------------------
A2E5L8_TRIVA/11-89VRNEYKK.LQNEYTD------------------------
C3Z5P8_BRAFL/12-90YKTELGK.LEKDFKK------------------------
Q23YX3_TETTS/11-89INSRYMR.LKNDFEY------------------------
Q6CVQ2_KLULA/12-99YKRQCQNEIKDPLKQ------------------------
Q4P2L8_USTMA/12-90FKQDLQT.LTQQVRA------------------------
Q6BS46_DEBHA/12-91YKSQVED.SKDRLKK------------------------
VTI1A_DICDI/11-87YHSDIQK.YKREVQL------------------------
Q6FKL6_CANGA/11-92WKTQVNQELKEPLQK------------------------
C1MQ00_MICPC/12-91YKSELQR.LKRESQV------------------------
VTI1_SCHPO/8-83YRSTLEE.WRRHLKE------------------------
Q57YW6_TRYB2/24-106YRGKLVA.LEKQLSR------------------------
C3XZI6_BRAFL/13-92YRRDLDK.LQREMKQ------------------------
Q6CFZ4_YARLI/14-92YRQSIQS.AKKQLAN------------------------
Q7RGW8_PLAYO/16-95YKYKLKK.YKDEFLE------------------------
B9RLV4_RICCO/12-90YKTDLNN.LKNESKR------------------------
A9VB72_MONBE/13-91YKRQVAN.FKKTITA------------------------
Q7QGG0_ANOGA/11-89YQAEWKR.LQQEFNN------------------------
A9T6G0_PHYPA/12-89YKSDLNV.LKREAKN------------------------
Q7S1W2_NEUCR/21-99YRSDVDK.YRRKLQT------------------------
A5B0Y2_VITVI/12-90YKADLNK.LKKEVKK------------------------
C5DT60_ZYGRC/12-93YRKQVQNDLRQPLQQ------------------------
A9SJ58_PHYPA/12-89YKSDLNV.LKREAKK------------------------
A9UY36_MONBE/12-90YNDELTT.AEKNLVR------------------------
B6K5P8_SCHJY/8-83YRQKLDG.WKTSLQN------------------------
A7S502_NEMVE/13-92IRRDFDK.LKKDLGT------------------------
A8HTE8_CHLRE/15-93YKADLAS.LKEQLQK------------------------
B3S7I7_TRIAD/11-89YNTEYKD.LETNFRK------------------------
B3SCN9_TRIAD/13-92LRREYEQ.YKYKLND------------------------
A2FRJ4_TRIVA/15-94YRAEHSK.VIEELRQ------------------------
A8PVB8_MALGO/12-91LKHSLEK.LQQDIYR------------------------
A0CX93_PARTE/11-89INQRFQR.LKSELEF------------------------
B0CY19_LACBS/16-97AKADLAR.YKKLAAD------------------------
A3LNU7_PICST/12-90YKSQIDD.SKSRLNQ------------------------
C4R6G6_PICPG/12-90YQNTLTQ.LKEQLIQ------------------------
B4L0B4_DROMO/11-88AQAELKR.LQGEYKQ------------------------
B7P4P6_IXOSC/8-86YQSELIQ.LRKEFQR------------------------
A2E8Q0_TRIVA/13-92HNECIKQ.LQDQLVI------------------------
Q7SY45_DANRE/13-91YRRDLAK.LQRDIRL------------------------
A7SUK0_NEMVE/12-90YKNEMKK.FKDDLKK------------------------
A4HD25_LEIBR/23-104YRTNLRT.VEEGLMR------------------------
Q01B19_OSTTA/53-133YKSELAT.RKREARE------------------------
E7NLP9_YEASO/12-92WKKTIQSDIKRPLQ.------------------------
H3DMU8_TETNG/18-96YRRDLAK.VQRDMK.------------------------
M1BPY1_SOLTU/12-90YKSDLNN.LKTEVKR------------------------
Q0V9D5_XENTR/13-89YKRDLVK.LQMEA..------------------------
Q1PDQ2_ARATH/12-90SKSSLKR.LRNEIKR------------------------
Q24E32_TETTS/12-87YRNEWDS.LKKK...------------------------
Q5KDU9_CRYNJ/17-95SKQSLDK.IRKTLKD------------------------
U3JA57_DANRE/12-90YKQEMEK.LEKDFKR------------------------
V4ZRC1_TOXGO/12-96YRQELKE.AAQEFRD------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window