Sequence alignment for CL0147

PF03908

SEC20_HUMAN/133-224--QTSSTITESLMGIS------------------RMMAQQVQQSEEAMQSLVTSSR-TILDAN--EEFKSMSGTIQLGRK
Q9P887_CANAX/148-239--SQNKQITKSLQASR------------------QLLSAGILQSELNIDNIDQQTK-DLYKLN--EGFIQFNDLLNRSKK
SEC20_SCHPO/122-213--TSASQVTAAMRDIH------------------AQMVQAVDMSAENAMELSSSTN-LLETLQ--EKYFGVEDVLYTSKR
SEC20_YEAST/204-295--SKTKQLTNNLVRGN------------------QILQSGILQSDLNLDELRAQTN-SLTQID--DKYTQFETVFKKTAD
Q9LK13_ARATH/183-274--SDAESITESLRRSR------------------QLMVQEVERSTNTLVAFDESTG-VLKKAE--SEYKGHRSLLSRTRN
Q9VNI9_DROME/135-226--SQENDVTEKMLAIS------------------RHLSETTQKSAITLETLVASSQ-NVEATS--DELHHTAGSISMSGK

PF12352

GOS12_ARATH/167-232--VQVLRERASIHGSI------------------SHIDDVIGQAQATRAVLGSQRS-LFSDVQ--GKVKNLGDKFPVIRG
VTI1A_MOUSE/123-188--ERLERSSRRLEAGY------------------QIAVETEQIGQEMLENLSHDRE-KIQRAR--DRLRDADANLGKSSR
Q9W0N6_DROME/129-194--ERIERTGNRLTEGY------------------RVALETEQLGAQVLNDLHHQRE-TLQGAR--ARLRETNAELGRASR
GOS11_ARATH/133-198--QALIKEHMGINRNT------------------AQMDGVISQAQATLGTLVFQRS-TFGGIN--SKLSNVASRLPTVNT
VTI1_YEAST/125-190--AILQKSGDRLKDAS------------------RIANETEGIGSQIMMDLRSQRE-TLENAR--QTLFQADSYVDKSIK
O18230_CAEEL/133-198--QRLERSTRKVQDAH------------------RIAVETEQIGAEMLSNLASQRE-TIGRSR--DRLRQSNADLGRANK
GOSR1_DROME/143-208--EMYLKESGHLNSAS------------------HLVNDQINIAIETRDHLHAQRQ-AFKRLQ--TRFNDISNRFPLISS
GOSR2_CAEEL/121-186--DHELLLNDRLQSSH------------------THLDDLISQGSAVLENLKSQHL-NLRGVG--RKMHEIGQALGLSNS
BOS1_SCHPO/144-209--DGLLKEHDFLGRAE------------------SQVDEFLERGRMILGDLVEQGS-VLKATK--TKVLNAANTLGITRH
GOSR1_CRIGR/161-226--ELFLKEHDHLRNSD------------------RLIEETISIAMATKENMTSQRG-MLKSIH--SKMNTLANRFPAVNS
GOS1_SCHPO/95-160--FLEMQEANSLDNSI------------------RGTNELLERAYATREDFDYQNS-VLGNVT--NRINGAAMSIPFINQ
Q9Z2P7_MOUSE/136-201--ESLNRATQSIERSH------------------RIATETDQIGTEIIEELGEQRD-QLERTK--SRLVNTNENLSKSRK
VTI12_ARATH/129-194--ERLDQSSDRIRESR------------------RLMLETEEVGISIVQDLSQQRQ-TLLHAH--NKLHGVDDAIDKSKK
GOSR2_DROME/124-189--DYELQHHTQLGNAH------------------RGVDDMIASGSGILESLISQRM-TLGGAH--KRIQAIGSTLGLSNH
Q9FK98_ARATH/129-194--EGLVRTREMIKDSQ------------------RKLLETENIGISILENLQRQKE-SLQNSQ--AMLHEIDDTVKESRS
VTI1_SCHPO/122-187--NRLEQSSQRLLESQ------------------RIANETEGIGASILRDLHGQRN-QLEHSL--EMLGDTSGHLDRSLR
VTI11_ARATH/128-193--ERLGRTTDRVKDSR------------------RTMMETEEIGVSILQDLHGQRQ-SLLRAH--ETLHGVDDNIGKSKK
GOSR1_YEAST/136-201--EYIQNETRRIDQSN------------------NVVDRLISQAWETRSQFHSQSN-VLNTAN--NKVLQTLQRIPGVNQ
MEM11_ARATH/134-199--DEEAQAMSSVKNSK------------------RMLEESFSSGVAILSKYAEQRD-RLKSAQ--RKALDVLNTVGLSNS
Q21499_CAEEL/123-188--DEELNLNDKLKYSD------------------NMIDQMLAQGASVFEDLQKQKY-NLLSIR--KRFHFLTKSLGISDT

PF05008

VTI1A_HUMAN/12-90FAVLTAEITSKIARVP..RLP.P..D..EKKQMVANVEKQLEEAKELLEQMDLEVR.EI..PP..QSRGMYSNRMRSYKQ
B4FC18_MAIZE/12-90YCEASASLSRKCTAAS..AL..D.GE..RKKQKLSEIQSGVEEAESLIRKMDLEAR.SL.QP...SIKAGLLAKLREYKS
B2AYG5_PODAN/21-99YLLVRADLTQKLDQIN..ELS.G..E..PRKAALSAAERALEETDELVGQMQMEKQ.NV..PS..SQRTAINRRIRDYKS
Q9W0N6_DROME/11-90YATLIAEITAHIGRLQ.QQNN.N..S..ERHDLCSKIDSSLPEAQELLEQMGLEVR.EL..NP..GLRSSFNGKLQVAQA
C5DBU8_LACTC/12-93FKTTLEQAKTLLSVAP..SQP.V..S..QRNGTLKEVEQQQDELLDLVDQMEIEVN.NG..ALDNAARSSFKAKLREYKK
Q2UJN0_ASPOR/21-99LKLIQADLNQTLDQIA..ESS.G..E..QRKSTIRKAEQVLDEATELLDQMRMEKQ.NI..PS..AARSKVNARFRNYAT
C4JRN3_UNCRE/21-99LKLVQADLNQKLDQIA..EAT.G..E..ERKSSIRQAERALDEASELLDQMRIEKE.NI..PS..ATRSKVNARFRNFLS
Q55PK7_CRYNB/16-95LKQLFGSLKSKLDGEA..KSLTG..E..QRKAALKRVSEEIDEAEEIVAQMEVELP.SM..PT..SIRQTYQGRLAASKQ
B9S915_RICCO/12-91YCELSANLSRKCNSTS..LLP.D.AE..EKKEKISEIKSGLDECDVLIRKMDLEAR.SL.QP...SVKAMLLAKLREYKS
Q307Y3_SOLTU/12-90YCELSANLTKKCNSAT..IL..D.GE..QKKQKVSEIKAGLDDAEALIRKMDLEAR.SL.PP...NVKATLLAKLREYKS
Q0UKT7_PHANO/21-99LKLVQADLNQQLEEIK..EST.G..E..PRKAAISKAERALEEAEELIGQMRLEKS.NI..PA..NLKSKFNTRFRNFEQ
VTI11_ARATH/12-90YCELSASLSKKCSSAI..SL..D.GE..QKKQKLSEIKSGLENAEVLIRKMDLEAR.TL.PP...NLKSSLLVKLREFKS
Q24E32_TETTS/37-115FNKIVNQIQKMLANVQNLDQN.......KKDKTMIDIKYELNEADLQIKQMEIEVN.SL..PY..QTKQQLQQKIKRYRN
C1E4H4_MICSR/12-91FLEFTASIARNTSSLP..SLA.G..D..AKVQKIGETESDVAEAEALIRRMDLEAR.SQQNP...AAKNPMLNKLRDYKS
A6ZMQ9_YEAS7/12-93FKTTLEQAKASLAEAP..SQP.L..S..QRNTTLKHVEQQQDELFDLLDQMDVEVN.NS..IGDASERATYKAKLREWKK
Q755J1_ASHGO/12-92FQATLEQCQRLLRQAQ..GEP.V..A..QRNATLQTLEQHKDDLYDILDQMEVEVN.NM..VGDPARQVASRSALRDLRR
A2G6F9_TRIVA/10-88LDSHKDVIEQKIERLK..SA.....DPGSRNSLISEINQDLDNFRNEIKQLSNRLK.TA..PQ..SDKQFYSEDLSNFQN
B0WIR4_CULQU/11-89YAVLTAEITAQIGRLG..VSP.A..G..ERTKLISDIDRQLEESQELLEQIGLEIR.DV..PA..ANRSGYTSRLNCYQA
Q6DKB7_XENLA/12-90YAVLTAEITGRVGKIP..RLL.G..D..EKKQMILNVEKQLEEARELLEQMDLEVR.EI..PV..QSRAMYSNRMRSYKQ
A8NL72_COPC7/16-95FVHLLQGIREKLEGDA..RSGHG..E..QRKAALRKVEIELDEADDIVSQLEIELN.GI..PQ..SLKPPYLTRLKQAKS
A9U3W6_PHYPA/12-90YCELSANLSRKCTSVS..AL..H.GE..EKKHKLTELKSGLDEADSLIRRMDLEAR.SL.PP...TQKAALLAKLREYKS
O18230_CAEEL/18-98YSLQTAEITSKIGRVH..TLP.S..S..DRAGAVQEIRKSLEEVNDLLDQMELVVR.EL..ESNTTERTKYELRVRSYQS
B8LND1_PICSI/12-90YCELSANLSRKCTSAA..LL..N.GE..QKKQKLSELKTGLDEAEALIRKMDLEAR.SL.QP...SLKATFLAKLREYKS
VTI1B_BOVIN/18-97FRGLHEDLRGVPERLL..GMA.G.TE..EKKKLIRDFDEKQQEANETLAEMEEELR.YA..PL..SFRNPMMSKLRTYRK
Q235Y3_TETTS/24-98IYVKIDNLNAQYHAIF.........K..NIEEDLQNVKNSIKEAENCVKQMEFEIN.CL..PN..SIKKNYTTIVSKYRQ
Q8S9S2_ORYSJ/12-90YCEISASLARKCTAAS..AL..Q.GE..KLKQKASEIKSGIDGAEALIKKMDLEAR.NQ.QP...SVRAGLLAKLREYKS
Q9FK98_ARATH/12-90YSELSINLSKKCSLAF..SL..K.GG..EKKEKLSEITYDLENAEKLISKMDHAAS.NL.PP...NIKSILLEKLKESKS
B6KRP6_TOXGO/12-96FLNSYALLKSGCATLRTEDRS.A.....ERRRGIARCGKYLQQAESALHQFELETRMPPTDGFADVDEFSLKSKAANYRQ
A7TDM7_VANPO/12-93FKITFDQALSALSLAA..GQP.I..P..QRNASLKQIEQQQDELLDLVDQMEIEVN.NS..VSDVQERATFKSKLRDYKK
A0C5I0_PARTE/14-94CDEEVTVICKKLQQIL..TTI.D..IQEDKNFALKEAQSCIDSANENLKQMEVELQ.GY..AK..NIKDNLKQQFILQKR
C4Y5F8_CLAL4/12-90FQLAIQEARSNISAAS..AAP.A..D..QRQAALQNIERSTDEALEILEQMNIEVQ.SL..PS..NQRSSHNAKLRQYRS
C5FUM7_ARTOC/21-99LKLVQADLNQKLDQIT..ESS.G..E..ERKAAIRQAERALEEANELLDQMRMEKE.NI..PS..STRSKINARFRNYLT
A4RVZ0_OSTLU/12-92FCEFSSSIHRGVDGVK..TAA.D.AT..TRGRHAKAIEADVAECEALVRRMDLEAR.SVSDP...AVKTPMLNKLRDYKS
B0DSV4_LACBS/16-95FRHIIQSIRNKLEGEG..KNQLG..E..QRKAALRKVEIELDEADDIVSQLEIEIQ.GI..PQ..SIKSQYTSRLKQAKA
A0BIB1_PARTE/18-96YKAHMESVMHYLLKIS..NDR.K..D..DNNKSFSKVCDRLQQAEQCIKQMELEAS.TL..SV..SYKKELMETVKQYKR
Q1PW76_9BACT/22-100VDERTVEILAKIEEVR..KRQ.E..D..DFRYLVQKIDTDISSIRSEMGQLRNEIKGEI.G....SLRGEIKGETESLRG
A0E3A1_PARTE/12-87FEKYQQQVCSLIRQTQ..IN........RSDETLKEIASVFTDLQNCLQQMDIEST.SI..AV..SDRQELKNKVKRYKS
VTI12_ARATH/12-91YCELSTNLSRKCHSAS..VLS.N.GE..EKKGKIAEIKSGIDEADVLIRKMDLEAR.SL.QP...SAKAVCLSKLREYKS
B8CG98_THAPS/14-97FLSLTEQVTSKLRSLD..PST.SSGLPPTAEADIKMAHNLLLQADDLLKQMGLEAR.GVDDA...GVKRDLLGKVRVCKT
A2E5L8_TRIVA/11-89IDRIKKDISNAVSNLP..QYS.A..Q..ERPSKMQKIEARFGEFDAAINELDLQAL.....MFDVNDKNAAKKYLVEVRN
C3Z5P8_BRAFL/12-90YSNVTAEITNKIAKIV..KLS.G..G..EKRHMVTNVEKQMEEAKELLEQMDLEVR.DI..PS..KERQKYATRLKSYKT
Q23YX3_TETTS/11-89INDMLDNFEKEVKQLD..KK.....DAAQKKKAIQKNQTYLKSIEQMIQSYKLEVQ.AL..DR..NESAQYTESLKQINS
A6SSB2_BOTFB/21-99LKLVQADLNQKLDQIP..DLT.G..E..PRKAAISQAERALEEADELLDQMRLEKS.NI..PS..ANRTKVNQRFRNHES
Q6CVQ2_KLULA/12-99CQVAINQAKVLLANAK..NDA.GAVLKGGKSDILLQIQQYHDESLELVDQMEIELN.NTGNSLDSKTRASYKAKIRDYKR
Q4P2L8_USTMA/12-90LEQLKQGIRQKLDQAK..SQN.G..E..AKKSTLRRAEMELEEADEVISQMDIEVQ.GF..PQ..SVRSRFSVQIRGFKQ
Q6BS46_DEBHA/12-91LQLALQEAKSKLAQIS..SAD.G.KD..ERKQFLRAIETATDECLEVLDQMSIEVQ.NL..PS..NQRSTYNTKIRQYKS
VTI1A_DICDI/11-87FQHVCNSITRRIKQLP..NYG.G..E..KKKIAVREVENDIDEALKFISEMEKLAQ.NH......PQRIKLQTKTKQYHS
Q6FKL6_CANGA/11-92FKATLDQGKAALVKAS..AQS.L..P..ERNATLKQIEEQKDELYDLLDQMALEVN.NS..VSDMQQRANYKAKIRDWKT
B5M732_AMBAM/13-93FAALMEEIRRKLESAK..GRG.GIGE..SKKSLLREVQRKVDQASGVLQELEHEAR.AA..PN..PYRVHMNSKTRKYRS
C1MQ00_MICPC/12-91FLEYTASINRATASLP..SLD.G..A..AKSQKIAEVDAEVAEAEALVRRMDLEAR.SLRDP...TVKTPMLAKLRDYKS
VTI1_SCHPO/8-83YRLLRADIEEKLNDLS..KS........GENSVIQSCQRLLNEIDEVIGQMEIEIT.GI..PT..SERGLVNGRIRSYRS
Q57YW6_TRYB2/24-106ASRLQESLQRSGVSYQAPPAA.GPQ...SRSQQCHSLQQSLTRLRELITNMSYESN.EV.EPA..SAKEEVKRRLEDYRG
C3XZI6_BRAFL/13-92FRNLHDELRRKAQSRL..PNA.V.GE..ERKRIVREVMRGIEECTTLVQEMEEEVK.QA..PP..TYRPQMLSRLRNYRR
Q6CFZ4_YARLI/14-92FLLAQSEIEQKLESIS..TLE.R..D..ARTSAVKAVERTIGEAYEILDQLSVEIQ.NI..PS..SARAPLSANLRQYRQ
Q7RGW8_PLAYO/16-95YMKTVNYTEKIIKDNN......S.....DQNKLLNIYEKAVNSAESMFKRMQLEVETNTIISDQQNELNEIQTKITEYKY
B9RLV4_RICCO/12-90YCELSANLSRKCTSTS..VL..D.GE..LKKQKLSEIKTGLDEAETLIQKMDLEAR.SF.PP...NLKAVLLAKLREYKT
A9VB72_MONBE/13-91LQAEIDKLRRLQSQ.I..SNY.S.GE..QRRQAVQEAQSHLDECEDLLYDMSAEVQ.NA..PP..SLRQRMNAKVTDYKR
Q7QGG0_ANOGA/11-89YAVQTAEITAQIGRIA..HAS.G..A..ERNKLISDVDRQLEESQELLEQIGLEIR.DI..PQ..NSRAAYTSRLNCYQA
A9T6G0_PHYPA/12-89FCELCTHIKKRCKSVS..S...N.ET..EKKQKYDELKTGLDQAESLIRRMDLEAR.TL.IP...PLKIALLTKLREYKS
Q7S1W2_NEUCR/21-99YQLVQADLVQKLDQIS..ELT.G..E..PRKAALSTAERALEEAGELLDQMNMEKQ.NV..PS..SSRTAINKRLRDYRS
A5B0Y2_VITVI/12-90YCELSTNLSRKCTSAS..VL..D.GE..EKHQKISEIEAGLEEAVILIRKMDLEAR.SL.QA...GVKAMLLAKLREYKA
C5DT60_ZYGRC/12-93YRSTFDDARSRLQTAP..TQA.L..S..ERNLTLRQVEQQQEELVDLIDQMEIEVN.SA..IPNGQERANYKAKLRGYRK
A9SJ58_PHYPA/12-89YCELSTNLNKKCNSIS..S...N.EV..EKKQKFDDLTKGLDLAESLIKRMDLEAR.TL.PP...AQKATLLAKLREYKS
Q28GI4_XENTR/13-91YKELYTKLQEIQERLQ..SCY.G..E..EKKKLLREFSEKQKEANEMLSEMEYELK.SA..PP..TFRHQAAGQLRAYKR
A9UY36_MONBE/12-90FGDTLAEINSLVNEIK..DLD.G.DE...KKARVRTAEEKVDNAHELVEQLELDVL.DV..PI..SERKPIQHRIKAYND
B6K5P8_SCHJY/8-83FKLLQADIEEKLSDVQ..QN........GDSRAAESCKRALNEADEVLAQIELALT.NI..PT..AERGAAQSRARDYRQ
B8QHP6_9ASCO/12-92FQFIQSEIRDKLEALR..ENG.A..NAGNFKSEVSKAEDSIEEALEILERMSAEVQ.GI..PT..SERSQFNTKIRGHRA
Q499B4_DANRE/12-90FGTLTAEITNKIGRIP..KSA.G..E..EKTQLVLNVDKQLEEVRELMEQMDLEVR.EI..PI..QSRAMYNSRLKSYKQ
A7S502_NEMVE/13-92VKVLLEDVTQRVYHRI..PKL.S.GE..QRKAAVRDVEKKIENAFIIIDELDEEAS.AA..PG..AYRNSMMTRVRTIRR
A8HTE8_CHLRE/15-93YCNKSTDISRKITTAS..TL..G.AE..AKRKKLVEVDVDIKEADTIIKKMDNEAR.SV.AP...DRQKQLQNKVKEYKA
B3S7I7_TRIAD/11-89FSASVADISYKINRIP..NLN.G..D..EKKAVIHDCEHSLEDMKELIEQMDLEVR.DA..PS..TARSELAKKWNNYNT
B3SCN9_TRIAD/13-92LAFLFKEVDKTINITI..PKE.S.GE..QRKNTIRKTQKKLDEVKYLLNDLDAELQ.QA..PA..SYRNQMSSKARSLRR
A2FRJ4_TRIVA/15-94AEGLLDQIKSDMGRLD..GQP.L..D..KRRALDAEIERKISSLENLLNKMTADLR.SVTQQ...SSKSFYEGEIKNYRA
A8PVB8_MALGO/12-91FAQLRQSIENRLAVDF..SSM.S.AE..TRHSALRHADAEAEEAGELVSQMEIEVQ.SF..PS..AVRDRYVAELRALKH
A0CX93_PARTE/11-89LNAELDKLQKEIDSLS..KK.....EYNQKNAAIKKCQAQVKSISTLIESYELEIS.NL..DK..VQSAKYNDSLRSINQ
B0CY19_LACBS/16-97FQQFIEAIRVKLEGDA..KEERG..EQQQRSATLRQVEMELDEADEMVSQMDIEIQ.GI..PQ..SVRAQYHTRLRAAKA
A3LNU7_PICST/12-90FQLALSEAKSKLAQIS..AVE.G..E..SRKSYLRAIEGAIEEGQEVLDQMGIEVQ.NL..PT..NQRSSYNTKIRQYKS
B7FGM6_MEDTR/12-90YCELSSKLSKLCTAAA..AL..N.GE..QKKQNISDIKAGIDEAEALIRKMDLEAR.SL.QP...NIKGVLLAKLREYKS
C4R6G6_PICPG/12-90IQMTLAEAKRNLANIS..ASN...SV..DRTRQIRLVEENLDDSYDLLERLNLELQ.NV..ST..SDRTKYNVTLRDYQN
B4L0B4_DROMO/11-88YAALIAEITAHIGRLQ...QN.A..T..ERNELCTKIDGSLSEAQELLEQMGLEVR.EL..NP..LQRSNFNNKIQVAQA
B7P4P6_IXOSC/8-86YAALTAEITSKSGRIP..NLH.A..A..DKSAMVAEVERHLEEANELLEQMELEVR.SL..PA..PTRPKYQNRVKSYQS
Q4RH17_TETNG/13-91YRSLYDELKLMPDRAQ..RSY.G..E..ERKRLVRTFDERQGEAEEVLQGMEKELL.AA..PL..SYRNTMNTKLRMYRR
A2E8Q0_TRIVA/13-92CTELEKDIGEAISRIP..ET.....EQGQRRKLVREIEEKIKALIQDRDFMDCEIN.EM.QPG..EERDSYQEKLEYHNE
B9EXK3_ORYSJ/12-90YCEISASLARKCTAAS..AL..Q.GE..KLKQKASEIKSGIDGAEALIKKMDLEAR.NQ.QP...SVRAGPAGKTEGVQV
Q7SY45_DANRE/13-91YKSLYDEVKLMPERVQ..KSQ.G..E..ERKRIVRDFDERVSEAEEVLQGMEQELF.GA..PS..SFRTPMSTKIRLYRR
A7SUK0_NEMVE/12-90FGNLSAEITAKICKIP..NLH.G..E..AKRNTVADVERSFEEANELLEQMDLEAR.EI..TG..PEKSKLSNRLKTYKN
A4HD25_LEIBR/23-104SEALRQSCDRRAAGYKAPPAT.GPG...SRLQRGAHLTTVLAQLRELVNSMEYEAN.DL..PA..AHRQTAKERIVEYRT
B7GBR9_PHATC/15-85FQRLQAQIRRSL................EEEPPNQYTRNLLQQCDDLLQQMGIEAR.SVGDA...TMKRDLLHKVRTYKS
Q01B19_OSTTA/53-133FCAFSSAIRRGVDGAR..DAT.T.PS..ERRARASEIESAVAECEALIRRMDLEAR.SVGDA...SAKTTMLSKLRDYKS

PF03908

SEC20_HUMAN/133-224LITK-YNRRELTDKLLIFLALALFLATVLYIVKKRL
Q9P887_CANAX/148-239IVKF-IEKQDKADRQRIYLSMGFFILCCSWVVYRRI
SEC20_SCHPO/122-213IIKS-LKLSDRSDYFLVVSGFGFFIFVVVYLLFKRI
SEC20_YEAST/204-295LVKV-LENASHQEKRDVYLSLGFLLCCVSWVLWRRI
Q9LK13_ARATH/183-274LLST-MQRQDVIDRIILIVGFSLFVFAVVYVVSKRI
Q9VNI9_DROME/135-226LLKK-YGRRECTDKMLLFFAFSLFLACVFYIVQKRL

PF12352

GOS12_ARATH/167-232LLGS-IKRKR--------------------------
VTI1A_MOUSE/123-188ILTG-MLRRI--------------------------
Q9W0N6_DROME/129-194TLNT-MMLRA--------------------------
GOS11_ARATH/133-198ILAA-IKRKK--------------------------
VTI1_YEAST/125-190TLKT-MTRRL--------------------------
O18230_CAEEL/133-198TLSS-MIRRA--------------------------
GOSR1_DROME/143-208LIQR-INIKK--------------------------
GOSR2_CAEEL/121-186TLQV-IDRRV--------------------------
BOS1_SCHPO/144-209TLSL-INRRS--------------------------
GOSR1_CRIGR/161-226LIQR-INLRK--------------------------
GOS1_SCHPO/95-160ILRK-TSIRR--------------------------
Q9Z2P7_MOUSE/136-201ILRS-MSRKV--------------------------
VTI12_ARATH/129-194VLTA-MSRRM--------------------------
GOSR2_DROME/124-189TMKL-IERRL--------------------------
Q9FK98_ARATH/129-194IVRS-IKIKE--------------------------
VTI1_SCHPO/122-187TLKT-MARRL--------------------------
VTI11_ARATH/128-193ILTD-MTRRM--------------------------
GOSR1_YEAST/136-201LIMK-INTRR--------------------------
MEM11_ARATH/134-199VLRL-IERRN--------------------------
Q21499_CAEEL/123-188TIRL-IEKRV--------------------------

PF05008

VTI1A_HUMAN/12-90EMGK.LETDFKR------------------------
B4FC18_MAIZE/12-90DLNN.VKSELKR------------------------
B2AYG5_PODAN/21-99DVDG.YRRKLRT------------------------
Q9W0N6_DROME/11-90ELKR.LQAEYRL------------------------
C5DBU8_LACTC/12-93HVQSDVKSPLQQ------------------------
Q2UJN0_ASPOR/21-99DLDE.SKRKLKS------------------------
C4JRN3_UNCRE/21-99DIDE.VKRKLKS------------------------
Q55PK7_CRYNB/16-95SLDK.IRKTLKD------------------------
B9S915_RICCO/12-91DLNN.LKREFKR------------------------
Q307Y3_SOLTU/12-90DLNN.LKTEVKR------------------------
Q0UKT7_PHANO/21-99DLDT.TKRKLET------------------------
VTI11_ARATH/12-90DLNN.FKTEVKR------------------------
Q24E32_TETTS/37-115EWDS.LKKKQIK------------------------
C1E4H4_MICSR/12-91ELAR.LKRESQL------------------------
A6ZMQ9_YEAS7/12-93TIQSDIKRPLQS------------------------
Q755J1_ASHGO/12-92EAGM.VKQQLRE------------------------
A2G6F9_TRIVA/10-88AENK.FSQEIKK------------------------
B0WIR4_CULQU/11-89EWKR.LQQEFTN------------------------
Q6DKB7_XENLA/12-90ELGK.LDADFKR------------------------
A8NL72_COPC7/16-95DLNK.YKKMSRE------------------------
A9U3W6_PHYPA/12-90DLNN.LKRDVKK------------------------
O18230_CAEEL/18-98DKKQ.LDTELEK------------------------
B8LND1_PICSI/12-90DLNN.LKRDVKK------------------------
VTI1B_BOVIN/18-97DLAK.LHREVRS------------------------
Q235Y3_TETTS/24-98DYDD.VFKKYSQ------------------------
Q8S9S2_ORYSJ/12-90DLNN.LKGTLKR------------------------
Q9FK98_ARATH/12-90SLKR.LRNEIKR------------------------
B6KRP6_TOXGO/12-96ELKE.AAQEFRD------------------------
A7TDM7_VANPO/12-93RVQSELKEPLQK------------------------
A0C5I0_PARTE/14-94KLDE.MNKVYTQ------------------------
C4Y5F8_CLAL4/12-90EVDQ.SKRQLRE------------------------
C5FUM7_ARTOC/21-99DVDN.TKRKLRS------------------------
A4RVZ0_OSTLU/12-92ELAK.LKRDARE------------------------
B0DSV4_LACBS/16-95DLTK.YKKLSKD------------------------
A0BIB1_PARTE/18-96DMAK.VEKDFKQ------------------------
Q1PW76_9BACT/22-100EIGS.LRGEIKR------------------------
A0E3A1_PARTE/12-87ETEA.MKKQFRI------------------------
VTI12_ARATH/12-91DLNQ.LKKEFKR------------------------
B8CG98_THAPS/14-97RLAN.LRDDYEA------------------------
A2E5L8_TRIVA/11-89EYKK.LQNEYTD------------------------
C3Z5P8_BRAFL/12-90ELGK.LEKDFKK------------------------
Q23YX3_TETTS/11-89RYMR.LKNDFEY------------------------
A6SSB2_BOTFB/21-99DVDV.SKRKLKS------------------------
Q6CVQ2_KLULA/12-99QCQNEIKDPLKQ------------------------
Q4P2L8_USTMA/12-90DLQT.LTQQVRA------------------------
Q6BS46_DEBHA/12-91QVED.SKDRLKK------------------------
VTI1A_DICDI/11-87DIQK.YKREVQL------------------------
Q6FKL6_CANGA/11-92QVNQELKEPLQK------------------------
B5M732_AMBAM/13-93ELDD.INKTAAS------------------------
C1MQ00_MICPC/12-91ELQR.LKRESQV------------------------
VTI1_SCHPO/8-83TLEE.WRRHLKE------------------------
Q57YW6_TRYB2/24-106KLVA.LEKQLSR------------------------
C3XZI6_BRAFL/13-92DLDK.LQREMKQ------------------------
Q6CFZ4_YARLI/14-92SIQS.AKKQLAN------------------------
Q7RGW8_PLAYO/16-95KLKK.YKDEFLE------------------------
B9RLV4_RICCO/12-90DLNN.LKNESKR------------------------
A9VB72_MONBE/13-91QVAN.FKKTITA------------------------
Q7QGG0_ANOGA/11-89EWKR.LQQEFNN------------------------
A9T6G0_PHYPA/12-89DLNV.LKREAKN------------------------
Q7S1W2_NEUCR/21-99DVDK.YRRKLQT------------------------
A5B0Y2_VITVI/12-90DLNK.LKKEVKK------------------------
C5DT60_ZYGRC/12-93QVQNDLRQPLQQ------------------------
A9SJ58_PHYPA/12-89DLNV.LKREAKK------------------------
Q28GI4_XENTR/13-91DLVK.LQMEANY------------------------
A9UY36_MONBE/12-90ELTT.AEKNLVR------------------------
B6K5P8_SCHJY/8-83KLDG.WKTSLQN------------------------
B8QHP6_9ASCO/12-92EIDK.AKRELRK------------------------
Q499B4_DANRE/12-90EMEK.LEKDFKR------------------------
A7S502_NEMVE/13-92DFDK.LKKDLGT------------------------
A8HTE8_CHLRE/15-93DLAS.LKEQLQK------------------------
B3S7I7_TRIAD/11-89EYKD.LETNFRK------------------------
B3SCN9_TRIAD/13-92EYEQ.YKYKLND------------------------
A2FRJ4_TRIVA/15-94EHSK.VIEELRQ------------------------
A8PVB8_MALGO/12-91SLEK.LQQDIYR------------------------
A0CX93_PARTE/11-89RFQR.LKSELEF------------------------
B0CY19_LACBS/16-97DLAR.YKKLAAD------------------------
A3LNU7_PICST/12-90QIDD.SKSRLNQ------------------------
B7FGM6_MEDTR/12-90DLNN.NKSELKK------------------------
C4R6G6_PICPG/12-90TLTQ.LKEQLIQ------------------------
B4L0B4_DROMO/11-88ELKR.LQGEYKQ------------------------
B7P4P6_IXOSC/8-86ELIQ.LRKEFQR------------------------
Q4RH17_TETNG/13-91DLAK.VQRDMKS------------------------
A2E8Q0_TRIVA/13-92CIKQ.LQDQLVI------------------------
B9EXK3_ORYSJ/12-90SADQ.KSRLLRI------------------------
Q7SY45_DANRE/13-91DLAK.LQRDIRL------------------------
A7SUK0_NEMVE/12-90EMKK.FKDDLKK------------------------
A4HD25_LEIBR/23-104NLRT.VEEGLMR------------------------
B7GBR9_PHATC/15-85QYQS.LQAQSER------------------------
Q01B19_OSTTA/53-133ELAT.RKREARE------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window