Sequence alignment for CL0148

PF02093

F8S319_PIG/212-422QYWPFSSADLYNWKTNHPPFSEDPQRLTGLVESLMFSHQPTWDDCQQLLQT------------LFTTEERERILLEARKN
M3X1Y6_FELCA/234-443QYWPFSASDLYNWKTHNPSFSQEPQALTSLIESILLTHQPTWDDCQQLLQV------------LLTTEERQRVLLEARKN
M3XFF7_FELCA/213-416QYWPFSASDLYNWKLHNPPFSQDPVALTNLIESILVTHQPTWDDCQQLLQT------------LLTAEERQR.LLEARKQ
GAG_XMRV6/224-431QYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGT------------LLTGEEKQRVLLEARKA

PF00607

GAK10_HUMAN/312-526------IKMLKDMKEGVKQYGPNSPYMRTLLDSIAYGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQEQ....VRRN
GAG_HV1H2/149-363------PRTLNAWVKVVEE.KAFSPEVIPMFSALSEGA..TPQDLNTMLNT..VGGHQAA.MQMLKETINEEAAEWDRVH
GAG_MMTVC/290-495------LKTLKELQSAVRTMGPSAPYTLQVVDMVASQW..LTPSDWHQTAR..ATLSPGD.YVLWRTEYEEK..SKETVQ
GAG_HTL1C/147-344------MKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQY..LCS.SLV.ASLHHQQLDSL......IS
GAG_HV2BE/151-365------PRTLNAWVKLVEE.KKFGAEVVPGFQALSEGC..TPYDINQMLNC..VGDHQAA.MQIIREIINEEAADWDSQH
W5PXQ0_SHEEP/276-481------FKQLKELKIACSQYGPTAPFTIAMIENLGTQA..LPPNDWKQTAR..ACLSGGD.YLLWKSEFFEQCARIADVN

PF02093

F8S319_PIG/212-422VPGADGRP-------TQLQNEIDMG---FPLTRPGWDYNTAEGRESLKIYRQALVAGLRGASRRPTNLAKVREVMQGPNE
M3X1Y6_FELCA/234-443VPGPGGLP-------TQLPNEIDEG---FPLTRPDWDYETAPGRESLRIYRQALLAGLKGAGKRPTNLAKVRTIIQGKEE
M3XFF7_FELCA/213-416VPGEDGRP-------TQLPNVVDEA---FPLTRPNWDFATPAGRE...LYRQLLLAGLRGAARRPTNLAQVKQVVQGKEE
GAG_XMRV6/224-431VRGNDGRP-------TQLPNEVNAA---FPLERPDWDYTTTEGRNHLVLYRQLLLAGLQNAGRSPTNLAKVKGITQGPNE

PF00607

GAK10_HUMAN/312-526RAANPPVN.......IDADQLLGIGQNWSTISQQALMQN.....EAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQGSKE
GAG_HV1H2/149-363PVHAGPIAPGQMREPRGSD.IAGTTS..TLQEQIGWMTNN.PPIPVGEIYKRWIILGLNKIVRMYSPT.SILDIRQGPKE
GAG_MMTVC/290-495KTA.GKRKG.....KVSLDMLLGTGQ..FLSPSSQIKLS....KDVLKDVTTNAVLAWRAIPPPGVKKTVLAGLKQGNEE
GAG_HTL1C/147-344EAE..TRG.......ITGY.NPLAGP..LRVQANNPQQQ.....GLRREYQQLWLAAFAALPGSAKDP.SWASILQGLEE
GAG_HV2BE/151-365PIP.GPLPAGQLRDPRGSD.IAGTTS..TVDEQIQWMYRPQNPVPVGNIYRRWIQIGLQKCVRKYNPT.NILDIKQGPKE
W5PXQ0_SHEEP/276-481RQQ..GIQ.......TSYEMLIGEGP..YQATDTQLNFL....PGAYAQISNAARQAWKKLPSSSTKTEDLSKVRQGPDE

PF02093

F8S319_PIG/212-422PPSVFLERLMEAFRRFTPFDPTSEAQKASVALAFIGQSALDIRKKLQRLEG---LQEAEL-RDLVKEAEKVYYKRET---
M3X1Y6_FELCA/234-443SPAAFMERLLEGFRMYTPFNPEAPEHKATVAMSFIDQAASDIKGKLQRLDG---IQTYGL-QELVREAE.VYNKRET---
M3XFF7_FELCA/213-416TPAAFLERLKEAYRMYTPYDPEDPGQAASVILSFIYQSSPDIRNKLQRLEG---LQGFTL-SDLLKEAEKIYNK...---
GAG_XMRV6/224-431SPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIWQSAPDIGRKLERLED---LKSKTL-GDLVREAEKIFNK...---

PF00607

GAK10_HUMAN/312-526PYPDFVARLQDVAQKSIA----DEKAGKVIVELMAYENANPECQSAIKPLKGKVPAGSDVISEYVKACDGIGGAMHKAML
GAG_HV1H2/149-363PFRDYVDRFYKTLRAEQA----SQEVKNWMTETLLVQNANPDCKTILKALG....PAATL.EEMMTACQGVGGPGHKARV
GAG_MMTVC/290-495SYETFISRLEEAVYRVMP----RGEGSDILIKQLAWENANSLCQDLIRPMR....KTGTM.QDYIRACLDASPAVVQGMA
GAG_HTL1C/147-344PYHAFVERLNIALDNGLP----EGTPKDPILRSLAYSNANKECQKLLQARG...HTNSPL.GDMLRACQ.AWTPKDKTKV
GAG_HV2BE/151-365PFQSYVDRFYKSLRAEQT----DPAVKNWMTQTLLIQNANPDCKLVLKGLG....MNPTL.EEMLTACQGVGGPGQKARL
W5PXQ0_SHEEP/276-481PYQDFVARLLDTIGKIMS----DEKAGMVLAKQLAFENANAACQAALRPYR....KKGDL.SDFIRICADIGPSYMQGIA

PF02093

F8S319_PIG/212-422-
M3X1Y6_FELCA/234-443-
M3XFF7_FELCA/213-416-
GAG_XMRV6/224-431-

PF00607

GAK10_HUMAN/312-526M
GAG_HV1H2/149-363L
GAG_MMTVC/290-495.
GAG_HTL1C/147-344L
GAG_HV2BE/151-365M
W5PXQ0_SHEEP/276-481M

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window