Sequence alignment for CL0148

PF02093

F8S319_PIG/212-422QYWPFSSADLYNWKTNHPPFSEDPQRLTGLVESLMFSHQPTWDDCQQLLQT------------LFTTEERE-RILLEARK
M3X1Y6_FELCA/234-443QYWPFSASDLYNWKTHNPSFSQEPQALTSLIESILLTHQPTWDDCQQLLQV------------LLTTEERQ-RVLLEARK
M3XFF7_FELCA/213-416QYWPFSASDLYNWKLHNPPFSQDPVALTNLIESILVTHQPTWDDCQQLLQT------------LLTAEERQ-R.LLEARK
GAG_XMRV6/224-431QYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLGT------------LLTGEEKQ-RVLLEARK

PF00607

GAK10_HUMAN/312-526------IKMLKDMKEGVKQYGPNSPYMRTLLDSIAYGHRLIPYDWEILAKSSLSPSQFLQFKTWWIDGVQE-Q....VRR
GAG_HV1H2/149-363------PRTLNAWVKVVEE.KAFSPEVIPMFSALSEGA..TPQDLNTMLNT..VGGHQAA.MQMLKETINE-EAAEWDRV
GAG_MMTVC/290-495------LKTLKELQSAVRTMGPSAPYTLQVVDMVASQW..LTPSDWHQTAR..ATLSPGD.YVLWRTEYEE-K..SKETV
GAG_HTL1C/147-344------MKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQY..LCS.SLV.ASLHHQQLDS-L......I
GAG_HV2BE/151-365------PRTLNAWVKLVEE.KKFGAEVVPGFQALSEGC..TPYDINQMLNC..VGDHQAA.MQIIREIINE-EAADWDSQ
W5PXQ0_SHEEP/276-481------FKQLKELKIACSQYGPTAPFTIAMIENLGTQA..LPPNDWKQTAR..ACLSGGD.YLLWKSEFFE-QCARIADV

PF02023

I3NI39_HUMAN/37-126-------------------------------------------------------------PEASHLRFRR.F------R
C9JIC2_HUMAN/35-124-------------------------------------------------------------QEASRQLFRQ.F------C
G3R3C9_GORGO/38-127-------------------------------------------------------------TETCRQNFRN.F------P
F7CQI3_MONDO/39-128-------------------------------------------------------------SEVFRQHFRQ.L------C
F7C2C9_ORNAN/27-115-------------------------------------------------------------.DARHRPFEN.F------A
G1KZD9_ANOCA/101-189-------------------------------------------------------------IETQRQHFRQ.F------C
H0VL73_CAVPO/49-136-------------------------------------------------------------PEHACLCFRA.F------C
H9GV16_ANOCA/138-227-------------------------------------------------------------MERQRLNFRQ.F------C
H9G8P1_ANOCA/15-104-------------------------------------------------------------AEAQRRHFRM.L------R
F6UXF4_ORNAN/1-89-------------------------------------------------------------.EIFHRRFRQ.F------R
W5Q925_SHEEP/49-138-------------------------------------------------------------PEHSRQHFRG.F------R
G1KVW6_ANOCA/25-114-------------------------------------------------------------SESQRQHFRQ.F------D
G3VM18_SARHA/57-147-------------------------------------------------------------PEAWRQRFRL.F------G
F6T5P3_HORSE/44-133-------------------------------------------------------------PELSRQTFRR.F------C
F7F5Q8_MONDO/48-137-------------------------------------------------------------LEASRQRFRF.F------R
G3VZJ2_SARHA/42-131-------------------------------------------------------------PETFRQLFRL.F------C
G3UC70_LOXAF/35-118-------------------------------------------------------------PESSCRRFQS.F------Y
H0VNG3_CAVPO/40-126-------------------------------------------------------------PEGSRRQFRQ.L------R
H9GSG5_ANOCA/42-131-------------------------------------------------------------SDLHCQHFWR.I------H
H0XP10_OTOGA/40-129-------------------------------------------------------------QELCRLRFRQ.F------C
G1PWN2_MYOLU/59-145-------------------------------------------------------------PETCRQDFRR.F------R
ZN394_RAT/40-129-------------------------------------------------------------PETSRKQFRQ.L------R
I3N8X2_ICTTR/40-129-------------------------------------------------------------QEFCRLRFRQ.F------C
G1LE29_AILME/38-126-------------------------------------------------------------.EFQDSQHSL.F------Q
D3ZF35_RAT/41-130-------------------------------------------------------------PEAARLRFRC.F------R
F7C8L0_HORSE/32-121-------------------------------------------------------------PEISRQHFRN.F------H
F7BWC6_ORNAN/36-125-------------------------------------------------------------PESFRQRFRW.F------R
G3HPX2_CRIGR/38-127-------------------------------------------------------------QEPLSKQFRQ.L------R
G3WFW4_SARHA/48-137-------------------------------------------------------------QEIWRQRFRQ.L------C
T1HQU6_RHOPR/202-290-------------------------------------------------------------PEAYRQKFRG.F------T
I3MUC8_ICTTR/37-126-------------------------------------------------------------LKVSHQRFRH.F------Q
M3W6W2_FELCA/42-129-------------------------------------------------------------PEFFHQRFRN.F------L
R4GAL9_ANOCA/89-178-------------------------------------------------------------PEAHRQLFRQ.F------C
H3BUW4_HUMAN/14-103-------------------------------------------------------------SETFRQRFRR.F------H
F7BUI2_ORNAN/30-119-------------------------------------------------------------PESSRRRFRR.F------R
G3U9B4_LOXAF/34-122-------------------------------------------------------------AEAWHLCFRQ.F------K
W5P1J3_SHEEP/40-129-------------------------------------------------------------PEAARQRFRR.F------R
H9GQN3_ANOCA/39-128-------------------------------------------------------------TEPPCRRFRQ.F------L
G3VGJ9_SARHA/47-136-------------------------------------------------------------GEIFRKRFRH.F------C
M3YUS0_MUSPF/40-127-------------------------------------------------------------PEVAHQLFRC.F------Q
G3WVV5_SARHA/39-127-------------------------------------------------------------PEASRQNFRH.F------Q
G3MZ79_BOVIN/39-127-------------------------------------------------------------.RVSHQNFRY.F------Q
M3XQF3_MUSPF/46-135-------------------------------------------------------------QELCRQLFRQ.F------C
G1SPH0_RABIT/47-136-------------------------------------------------------------QELFRQLFRQ.L------R
R4G9E0_ANOCA/43-131-------------------------------------------------------------.DAQHQDCKP.F------S
H0W9S1_CAVPO/45-132-------------------------------------------------------------PESAHRLFRS.C------H
F7DUP4_HORSE/38-126-------------------------------------------------------------.KVSHEKFRH.F------Q
G1TCI0_RABIT/47-136-------------------------------------------------------------QELLCRQFRQ.L------R
H0WAL0_CAVPO/44-133-------------------------------------------------------------QEVFRQRFRQ.F------G
R4GBT3_ANOCA/134-222-------------------------------------------------------------REKSRQRFRR.F------C
G1PAE7_MYOLU/42-128-------------------------------------------------------------SEFSHQRFRN.F------L
G1KVY9_ANOCA/39-128-------------------------------------------------------------LEIQRQHFRV.L------V
F7GXN1_CALJA/157-246-------------------------------------------------------------PEAARQRFRQ.F------C
I1FKS6_AMPQE/169-256-------------------------------------------------------------EETYRRRFRL.D------G
W4XI34_STRPU/152-240-------------------------------------------------------------EEGYRTKFRY.V------K
H9GSL7_ANOCA/45-131-------------------------------------------------------------QERQRQNFRH.F------R
F6UYM9_CANLF/51-140-------------------------------------------------------------RELCRLRFRQ.F------C
I1FFW7_AMPQE/50-138-------------------------------------------------------------EETYRQRFRS.A------H
I3M4A7_ICTTR/44-133-------------------------------------------------------------REFFRRRFRQ.F------C
F6YR66_ORNAN/30-119-------------------------------------------------------------SETLRRRFRR.F------R
H9GUM9_ANOCA/2-89-------------------------------------------------------------..EQRQCFRR.F------C
R4G933_ANOCA/10-94-------------------------------------------------------------.....NAFGK.F------C
H9H9L0_MONDO/62-150-------------------------------------------------------------PEASRRRFRR.F------R
F7ASR7_MONDO/32-121-------------------------------------------------------------SEAFRQQFRQ.F------C
G3TIY7_LOXAF/26-115-------------------------------------------------------------CEVFRQRFRQ.F------Q
F6Y0L2_XENTR/70-156-------------------------------------------------------------PEVYRRKFRA.L------N
H9GAD1_ANOCA/1-89-------------------------------------------------------------.ETQRHSFRQ.F------R
G1PXN5_MYOLU/45-134-------------------------------------------------------------PESFRQHFRN.F------H
G3TBI6_LOXAF/35-121-------------------------------------------------------------LEAARLSFRQ.F------R
F6WAX4_ORNAN/41-129-------------------------------------------------------------VETFRQGFKQ.L------R
I3MGL2_ICTTR/48-137-------------------------------------------------------------PETFRQRFRQ.F------A
H0WSH9_OTOGA/159-248-------------------------------------------------------------PEAARQKFRQ.F------H
G1LLI4_AILME/74-163-------------------------------------------------------------PEAAHHHFRH.F------H
V8NJC1_OPHHA/264-353-------------------------------------------------------------IEAHRQRFRH.F------C
F6SSW6_ORNAN/43-130-------------------------------------------------------------..IFQQRFRQ.F------R
G1TSA0_RABIT/45-132-------------------------------------------------------------AESSCWHFRN.F------H
F6XAN0_ORNAN/49-138-------------------------------------------------------------PESFRQRFRR.F------R
F6W347_ORNAN/14-103-------------------------------------------------------------SETLRRRFRR.F------R
G1TS83_RABIT/90-179-------------------------------------------------------------PEAARLRFRH.F------R
G1MMS7_AILME/45-133-------------------------------------------------------------PESCRQHFRN.F------C
G3UAN3_LOXAF/20-109-------------------------------------------------------------PESSRRHFRS.F------Y
F6W9F0_MONDO/37-126-------------------------------------------------------------SEASRQHFRQ.F------Q
M3W412_FELCA/46-135-------------------------------------------------------------PEHSRRRFRG.F------R
H0VRS4_CAVPO/48-137-------------------------------------------------------------PETCRLQFRQ.F------G
G3WT79_SARHA/42-131-------------------------------------------------------------PEASCQRFWQ.F------R
F7GC31_MONDO/42-131-------------------------------------------------------------LETSHQNFRR.F------R
F6UNZ6_HORSE/48-137-------------------------------------------------------------PDTFRQRFRQ.F------G
H0VDV9_CAVPO/26-115-------------------------------------------------------------CEDSRLRFRQ.F------Q
I3N2G4_ICTTR/49-138-------------------------------------------------------------KEHCRQRFRA.F------C
G3U5G9_LOXAF/65-154-------------------------------------------------------------SESFRQQFRQ.F------R
G1KVJ6_ANOCA/17-104-------------------------------------------------------------QEANRLKFRT.N------A
G1KVF1_ANOCA/42-130-------------------------------------------------------------.GVSRRRFRQ.F------S
G3NE20_GASAC/93-183-------------------------------------------------------------PEAYRLRFRS.W------R
G3I2R2_CRIGR/52-140-------------------------------------------------------------SEVAHQKFRH.F------Q
M3X6Y2_FELCA/157-246-------------------------------------------------------------PEAARQRFRG.F------C
I1F9F1_AMPQE/170-256-------------------------------------------------------------EETYRQRFRS.T------K
ZN75C_HUMAN/47-134-------------------------------------------------------------..SACRHFRS.F------H
R4GBC4_ANOCA/51-139-------------------------------------------------------------.DLQSQRLRW.F------H
G1KX82_ANOCA/43-132-------------------------------------------------------------SDLQRQRFRC.F------R
W5QB12_SHEEP/45-134-------------------------------------------------------------PETFRCHFRQ.F------R
F6SMP8_ORNAN/6-94-------------------------------------------------------------AEGLRRRFRG.F------R
I3MZW9_ICTTR/49-138-------------------------------------------------------------QEVFRLRFRQ.F------S
V8NFE8_OPHHA/161-250-------------------------------------------------------------REKQRRDFRQ.F------C
I3L4W6_HUMAN/33-121-------------------------------------------------------------SEASRQRFRQ.F------C
H3BQ35_HUMAN/41-130-------------------------------------------------------------SETFRKCFRQ.F------C
H0WAW4_CAVPO/28-117-------------------------------------------------------------REIFRRHFRE.F------C
F6V0K5_CALJA/41-129-------------------------------------------------------------QEPLCKQFRQ.V------H
G3WJL4_SARHA/33-122-------------------------------------------------------------PEASRQNFRC.F------P
G1LV91_AILME/45-134-------------------------------------------------------------QEALWKQFRQ.L------R
F6WPG6_MONDO/42-131-------------------------------------------------------------LEISRQRFRQ.F------R
R4GBY9_ANOCA/37-124-------------------------------------------------------------.DTPHQCFKQ.L------S
F7CMF2_ORNAN/38-125-------------------------------------------------------------PETARQCFRG.F------P
G3WUB7_SARHA/49-138-------------------------------------------------------------PESYRQRFRS.F------Q
G3VG61_SARHA/35-124-------------------------------------------------------------YEVFRQRFRQ.L------C
K7DZ94_MONDO/30-119-------------------------------------------------------------QELSRQQFRQ.L------R
F7B272_XENTR/169-255-------------------------------------------------------------PEMHRKKFRG.I------H
B7PBT9_IXOSC/107-198-------------------------------------------------------------TEAFRQRFRG.D------T
H2QEF7_PANTR/48-137-------------------------------------------------------------PETFRQQFRQ.F------G
F7AGA9_XENTR/198-285-------------------------------------------------------------PEVYRKKFRT.V------Q
G5E651_BOVIN/45-133-------------------------------------------------------------PESARQHFRS.F------C
R4GAE0_ANOCA/42-131-------------------------------------------------------------LERLRRSFRQ.F------C
V8N700_OPHHA/304-393-------------------------------------------------------------MERQRQHFRQ.F------C
F7DJG4_MONDO/57-146-------------------------------------------------------------PAVSHQNLRW.F------Q
G5C295_HETGA/48-137-------------------------------------------------------------PETCRQRFRK.F------G
F7BJF5_ORNAN/43-131-------------------------------------------------------------DEIFQQRFRQ.F------R
NRIF1_MOUSE/154-243-------------------------------------------------------------TEASRQKFRH.F------Q
F7D2U8_ORNAN/46-134-------------------------------------------------------------.EFCQWNFWR.F------R
G1TNJ7_RABIT/46-135-------------------------------------------------------------PEKALKHLQG.F------R
F6UZ44_CANLF/53-142-------------------------------------------------------------TERSRRRFRS.F------R
G1TAR6_RABIT/48-137-------------------------------------------------------------PDTFRQQFRQ.F------G
L7N032_ANOCA/16-105-------------------------------------------------------------PDIQRHSFRH.F------H
M3X7M7_FELCA/47-136-------------------------------------------------------------QEPLCKQFRQ.L------R
R4GAC2_ANOCA/42-131-------------------------------------------------------------SDTQPHHFGQ.F------S
G3VST8_SARHA/49-138-------------------------------------------------------------WEMSRHRFRN.F------C
G3TW89_LOXAF/39-128-------------------------------------------------------------WEVCRLRFRQ.F------C
I3KYH8_ORENI/68-154-------------------------------------------------------------PETYKLKFHS.L------E
R4GD13_ANOCA/162-247-------------------------------------------------------------....CRLFRR.F------G
F6RYD6_ORNAN/53-142-------------------------------------------------------------AELSARRFRQ.F------R
H0UX96_CAVPO/48-137-------------------------------------------------------------QELFRLRFRQ.L------C
G3QSE2_GORGO/47-136-------------------------------------------------------------PEASRQRFRQ.F------Q
M3WU60_FELCA/44-133-------------------------------------------------------------PEAARLRFRR.F------C
F6YIP0_ORNAN/43-130-------------------------------------------------------------PETSRQRFRK.F------R
G3TCK1_LOXAF/49-138-------------------------------------------------------------RERSRQRFRG.F------R
M3VUC4_FELCA/48-137-------------------------------------------------------------QEASRQLFRH.F------C
H0XWT5_OTOGA/45-134-------------------------------------------------------------PESARRHFRS.F------N
G5BW12_HETGA/28-117-------------------------------------------------------------CEVSRMHFRQ.F------Q
G3WXR5_SARHA/42-131-------------------------------------------------------------SEIFRQRFRQ.F------H
R4GCL4_ANOCA/42-131-------------------------------------------------------------SDVRRQRFRG.V------C
G3UEV4_LOXAF/45-134-------------------------------------------------------------RESSRRDFRN.F------C
H9GH51_ANOCA/43-132-------------------------------------------------------------SETRRQRFRR.F------C
F6S3Z6_MONDO/43-132-------------------------------------------------------------SETLRKSFRQ.F------C
G3U4S2_LOXAF/38-127-------------------------------------------------------------PETARQLFRQ.F------R
D3ZV88_RAT/24-110-------------------------------------------------------------...PWHRFRH.F------H
G7P3S1_MACFA/45-134-------------------------------------------------------------QELYRQLFRQ.F------C
M3ZCB0_NOMLE/38-127-------------------------------------------------------------PESSRRLFRR.F------R
L7MZT4_ANOCA/1-86-------------------------------------------------------------....RQRFRQ.F------R
H9GV33_ANOCA/8-97-------------------------------------------------------------REEQRQCFRR.F------R
G1LHZ3_AILME/27-115-------------------------------------------------------------.ETFYQRFRH.F------Q
H2U7H2_TAKRU/66-153-------------------------------------------------------------PEAYRQKFRT.S------R
F6WQ39_XENTR/45-132-------------------------------------------------------------EETYRQRFRQ.L------K
G3TLL9_LOXAF/40-125-------------------------------------------------------------PETWHVNFRA.F------T
F7GAH0_ORNAN/86-175-------------------------------------------------------------PEVSHQRFRQ.F------R
G3VPU7_SARHA/40-129-------------------------------------------------------------QETFRQRFRQ.F------C
I3L473_HUMAN/41-130-------------------------------------------------------------SEACRQRFRQ.F------C
F7DRA3_ORNAN/39-127-------------------------------------------------------------AEICHQSFRQ.F------R
I3LR01_PIG/48-137-------------------------------------------------------------SETYRQRFRQ.F------D
H9GSX1_ANOCA/14-103-------------------------------------------------------------SDTQRQRFRQ.S------S
H9GSL2_ANOCA/38-127-------------------------------------------------------------REKQRQHFRH.F------R
G1PWN5_MYOLU/38-126-------------------------------------------------------------PETFRLRFRQ.F------R
H9GBZ5_ANOCA/14-103-------------------------------------------------------------VEMQRQRFRQ.F------R
G3T3H6_LOXAF/42-131-------------------------------------------------------------LEFSCLHFRN.F------V
F7G0P1_MONDO/42-131-------------------------------------------------------------SEIFRRRFRQ.F------C
F7DVV8_MONDO/1-89-------------------------------------------------------------.EAARQNFRW.Y------Q
H9GH43_ANOCA/38-124-------------------------------------------------------------AETQRQRFRQ.F------R
H0V5E8_CAVPO/42-128-------------------------------------------------------------...SSIQLNS.L------Q
C9JHD9_HUMAN/41-130-------------------------------------------------------------LEMFRQRFRQ.F------G
R4GD45_ANOCA/43-132-------------------------------------------------------------SEAQRRCFRD.F------H
G1NUW7_MYOLU/22-111-------------------------------------------------------------QELCRQLFRH.F------S
W4ZJX0_STRPU/154-245-------------------------------------------------------------EEGCRLKFRH.A------K
F8WEU5_HUMAN/38-127-------------------------------------------------------------WETSHLHFRQ.L------R
F6RNY0_ORNAN/26-115-------------------------------------------------------------PKLCRLLFQG.F------R
G3VFI6_SARHA/22-111-------------------------------------------------------------QELFRQLFRQ.L------R
M3XD21_FELCA/41-130-------------------------------------------------------------SEKSRQQFRR.F------R
E1BIL7_BOVIN/52-140-------------------------------------------------------------PEVFRQRFRH.F------C
M0R034_HUMAN/22-109-------------------------------------------------------------PETARLRFRG.F------C
G1L8Y8_AILME/37-126-------------------------------------------------------------REVFRQHFRK.L------C
F7HCM9_CALJA/29-118-------------------------------------------------------------LEFSRLRFRE.F------V
U3KLY8_RABIT/48-137-------------------------------------------------------------PEVFRQRFRQ.F------G
H9GQZ7_ANOCA/21-110-------------------------------------------------------------PEAQRQRFRE.F------C
F7HNX5_MACMU/34-123-------------------------------------------------------------TEAQRLRFRQ.F------Q
G3T2M0_LOXAF/44-133-------------------------------------------------------------SEASRQKFRQ.F------Q
F1Q4K9_CANLF/34-123-------------------------------------------------------------QELFHQRFQQ.F------C
G3VRM3_SARHA/42-131-------------------------------------------------------------LEIFRQRFRQ.F------A
M3XQ98_MUSPF/48-137-------------------------------------------------------------RELCRLRFRQ.F------C
F7CWS8_MACMU/50-139-------------------------------------------------------------CEIFRLHFRQ.L------C
W5Q908_SHEEP/40-130-------------------------------------------------------------RELCRLRFPPFF------C
F7EE73_MONDO/48-136-------------------------------------------------------------.AISHRNFRH.F------Q
R4G9I2_ANOCA/181-270-------------------------------------------------------------LEIKRQHFRH.F------C
G3VJ81_SARHA/45-134-------------------------------------------------------------METFNQRFRQ.F------Q
G3T0U2_LOXAF/108-196-------------------------------------------------------------PEAARQRFRQ.F------C
G5BSG8_HETGA/44-133-------------------------------------------------------------PECARLCFCA.F------R
H9GR70_ANOCA/38-127-------------------------------------------------------------REKQRQHFRR.F------C
I3MS02_ICTTR/44-133-------------------------------------------------------------PKSSCWHFRN.F------H
V8N853_OPHHA/232-321-------------------------------------------------------------RERQRQHFRQ.L------R
H2NPG6_PONAB/41-130-------------------------------------------------------------PETSCQSFWH.F------L
H9GJF9_ANOCA/5-94-------------------------------------------------------------SEAQRQDFRQ.S------C
H9GQ87_ANOCA/44-131-------------------------------------------------------------REKIRQHFRQ.F------C
H0XXX1_OTOGA/27-116-------------------------------------------------------------PEASRRRFRQ.L------R
G1KI12_ANOCA/155-244-------------------------------------------------------------LEMRRQRFRL.F------C
Q149X8_MOUSE/44-133-------------------------------------------------------------QEVFRQQFRQ.F------G
G1Q2R9_MYOLU/13-101-------------------------------------------------------------.KISHEKLRH.F------Q
ZSCA4_HUMAN/40-129-------------------------------------------------------------SEFSRMVLNS.F------Q
R4G9R4_ANOCA/42-131-------------------------------------------------------------SDLRSQQFRD.F------G
G3VQ12_SARHA/48-135-------------------------------------------------------------LEAAQENFRW.Y------Q
M3WTJ0_FELCA/57-144-------------------------------------------------------------PESAHQHFRS.F------Y
G3VJ10_SARHA/49-136-------------------------------------------------------------QEVFRQRFRQ.F------C
R4G9Q5_ANOCA/42-129-------------------------------------------------------------LDLYRQHFRQ.F------S
F6XAP1_ORNAN/37-126-------------------------------------------------------------PERFHERFRQ.F------C
H0WCZ6_CAVPO/44-133-------------------------------------------------------------SEVSRRKFRH.F------Q
L5M495_MYODS/26-115-------------------------------------------------------------SEVFHHRFRQ.F------H
ZSC12_MOUSE/42-130-------------------------------------------------------------RDVFRKYFRQ.F------C
D3YTV4_MOUSE/47-136-------------------------------------------------------------PDRSRQRFRA.F------R
G3T1H1_LOXAF/56-145-------------------------------------------------------------QEIFRQQFRQ.F------G
Q5VZN3_HUMAN/48-137-------------------------------------------------------------AESFRQRFRW.F------C
G1KYL1_ANOCA/24-110-------------------------------------------------------------MDVQRALFRE.Y------R
R4GDC0_ANOCA/42-131-------------------------------------------------------------SDLQRQRFRG.L------C
K7ERU5_HUMAN/46-135-------------------------------------------------------------QELFRQQFRK.F------C
F7CA80_HORSE/48-137-------------------------------------------------------------REIFRRRFRQ.L------C
G1SFD0_RABIT/152-241-------------------------------------------------------------PETAHQRFRQ.F------R
G1LLD5_AILME/49-138-------------------------------------------------------------LEFSRQHFRN.F------I
G3VRL4_SARHA/50-139-------------------------------------------------------------QEIFRLRFRQ.F------G
G1KZ70_ANOCA/2-90-------------------------------------------------------------.EMQRQHFRQ.F------C
R4GC39_ANOCA/169-256-------------------------------------------------------------IEVQRQHFRQ.F------R
F7F1F8_MONDO/44-133-------------------------------------------------------------HEACRQRFRH.F------C
G3VIH3_SARHA/43-132-------------------------------------------------------------PEIYHQCFRH.F------C
I3L7Q0_PIG/51-140-------------------------------------------------------------QELFRQCFRQ.F------R
G5CAU3_HETGA/39-126-------------------------------------------------------------..NSHQQFKH.F------Q
G1KI06_ANOCA/1-88-------------------------------------------------------------.ETCRQRFRN.F------C
H9GU03_ANOCA/63-152-------------------------------------------------------------PDVLHQRFVQ.F------E
I3N7T3_ICTTR/40-129-------------------------------------------------------------SEFSSSQLNS.L------P
G1LE31_AILME/40-129-------------------------------------------------------------YEFLRTQLSL.L------Q
G1P3T9_MYOLU/44-130-------------------------------------------------------------SEASRQKFRH.F------Q
F6XAK9_ORNAN/44-132-------------------------------------------------------------PETSRRFFRQ.F------R
I3KYJ5_ORENI/220-308-------------------------------------------------------------PETYRQRFRC.L------E
M3X1N7_FELCA/40-128-------------------------------------------------------------QELCRLRFRQ.F------S

PF02093

F8S319_PIG/212-422NV-PGADGRP-------TQLQNEIDMG---FPLTRPGWDYNTAEGRESLKIYRQALVAGLRGASRRPTNLAKVREVMQGP
M3X1Y6_FELCA/234-443NV-PGPGGLP-------TQLPNEIDEG---FPLTRPDWDYETAPGRESLRIYRQALLAGLKGAGKRPTNLAKVRTIIQGK
M3XFF7_FELCA/213-416QV-PGEDGRP-------TQLPNVVDEA---FPLTRPNWDFATPAGRE...LYRQLLLAGLRGAARRPTNLAQVKQVVQGK
GAG_XMRV6/224-431AV-RGNDGRP-------TQLPNEVNAA---FPLERPDWDYTTTEGRNHLVLYRQLLLAGLQNAGRSPTNLAKVKGITQGP

PF00607

GAK10_HUMAN/312-526NR-AANPPVN.......IDADQLLGIGQNWSTISQQALMQN.....EAIEQVRAICLRAWEKIQDPGSTCPSFNTVRQGS
GAG_HV1H2/149-363HP-VHAGPIAPGQMREPRGSD.IAGTTS..TLQEQIGWMTNN.PPIPVGEIYKRWIILGLNKIVRMYSPT.SILDIRQGP
GAG_MMTVC/290-495QK-TA.GKRKG.....KVSLDMLLGTGQ..FLSPSSQIKLS....KDVLKDVTTNAVLAWRAIPPPGVKKTVLAGLKQGN
GAG_HTL1C/147-344SE-AE..TRG.......ITGY.NPLAGP..LRVQANNPQQQ.....GLRREYQQLWLAAFAALPGSAKDP.SWASILQGL
GAG_HV2BE/151-365HP-IP.GPLPAGQLRDPRGSD.IAGTTS..TVDEQIQWMYRPQNPVPVGNIYRRWIQIGLQKCVRKYNPT.NILDIKQGP
W5PXQ0_SHEEP/276-481NR-QQ..GIQ.......TSYEMLIGEGP..YQATDTQLNFL....PGAYAQISNAARQAWKKLPSSSTKTEDLSKVRQGP

PF02023

I3NI39_HUMAN/37-126FQ.EAAGPR.------------------------------------EALSRLQELCHG-WLRPE..MRTKEQILELL---
C9JIC2_HUMAN/35-124YQ.ETPGPR.------------------------------------EALSRLRELCHQ-WLRPE..IHTKEQILELL---
G3R3C9_GORGO/38-127YP.DLAGPR.------------------------------------KALSQLRELCLK-WLRPE..IHSKEQILELL---
F7CQI3_MONDO/39-128YQ.ETSGPR.------------------------------------EALTRLRELCHQ-WLRPE..MHTKEQILEFL---
F7C2C9_ORNAN/27-115DQ.EASEPR.------------------------------------EILEHQLRLCHG-WSRAD..WLTKEQILERL---
G1KZD9_ANOCA/101-189CQ.EVEDPR.------------------------------------RVYSQVQELCCR-WLKPE..RHSKEQILELL---
H0VL73_CAVPO/49-136YL.DAAGPQ.------------------------------------DVLSRLR.LCQQ-WLCPE..THSKEQILELL---
H9GV16_ANOCA/138-227YL.EAEGPR.------------------------------------KVCSQLWYLCHR-WLKPE..RHAKEEILELL---
H9G8P1_ANOCA/15-104YQ.ETVGPR.------------------------------------EICRRLRECCHR-WLMPE..KRTKEQILELL---
F6UXF4_ORNAN/1-89YQ.EASGPR.------------------------------------EPLSRLRELCRR-WLRPK..KHTKEQILELL---
W5Q925_SHEEP/49-138YP.EAEGPR.------------------------------------EALSRLRELCRL-WLRPE..THSKEQMLELL---
G1KVW6_ANOCA/25-114YK.DAEGPW.------------------------------------EAYCQLRRFCHQ-WLKPE..AHTKEEILELV---
G3VM18_SARHA/57-147HRGEAAGPR.------------------------------------EALARLRELCRR-WLRPD..LHSKEQMLELL---
F6T5P3_HORSE/44-133YQ.EVSGPQ.------------------------------------EALSRLRQLCRQ-WLQPE..VHTKEQILELL---
F7F5Q8_MONDO/48-137YP.EGAAPY.------------------------------------EALSQLQALCLQ-WLRPE..IHTKEQILELL---
G3VZJ2_SARHA/42-131YQ.EVAGPR.------------------------------------EALSRLWELCCQ-WLRPE..MRTKEQILELL---
G3UC70_LOXAF/35-118YP.EAVESL.------------------------------------QAISLLLELCCQ-WLRPE..IHS..EILELL---
H0VNG3_CAVPO/40-126YH.EVAGPA.------------------------------------EALSRLGELCRR-WLRPE..LHSKEQILELV---
H9GSG5_ANOCA/42-131YE.EADGPR.------------------------------------ELCSRLYSLCRL-WLKPE..RHSKVEMLDLV---
H0XP10_OTOGA/40-129YQ.EASGPQ.------------------------------------EALAQLRELCHQ-WLRPE..MHTKEQILELL---
G1PWN2_MYOLU/59-145YQ.EAAGPE.------------------------------------EALNRLRELCRR-WLRPE..VHSKEQILELL---
ZN394_RAT/40-129YQ.EVAGPE.------------------------------------EALSRLWELCRR-WLRPE..LRSKEQIMELL---
I3N8X2_ICTTR/40-129YQ.EAPGPR.------------------------------------EALTQLRELCQQ-WLRPE..MHTKEQILELL---
G1LE29_AILME/38-126DG.NNSHAK.------------------------------------QELQRLYKSFYS-WLQPE..KHSKDEIIFQV---
D3ZF35_RAT/41-130YE.EAIGPQ.------------------------------------EALAQLRELCHQ-WLRPE..VHSKEQILELL---
F7C8L0_HORSE/32-121YD.EAAGPH.------------------------------------EAVSQLQELCSQ-WLRPE..IHSKEKILELL---
F7BWC6_ORNAN/36-125YQ.EAAGPR.------------------------------------EAHSRLRELCRR-WLRPE..LRTKEQILELL---
G3HPX2_CRIGR/38-127YE.ESTGPR.------------------------------------EVLRRLRELCRQ-WLQPE..TRSKEQILELL---
G3WFW4_SARHA/48-137YQ.ETPGPR.------------------------------------EALTRLRTLCCE-WLRPE..MHTKEEILELL---
T1HQU6_RHOPR/202-290KS.SEESFI.------------------------------------EFAREKEQLFDR-WCVSTGVERNFDKLKQLV---
I3MUC8_ICTTR/37-126YL.SVTGPH.------------------------------------QAVSQIQELCRQ-WLRPE..THTKEQIIEQL---
M3W6W2_FELCA/42-129YV.EFVGPR.------------------------------------KTLFKLRNLCLD-WLQPE..TRTKEEIIELL---
R4GAL9_ANOCA/89-178FQ.EGDGPR.------------------------------------RACHRLWELCQG-WLEPE..RRTKEQILELV---
H3BUW4_HUMAN/14-103YQ.EVAGPR.------------------------------------EAFSQLWELCCR-WLRPE..VRTKEQIVELL---
F7BUI2_ORNAN/30-119YR.EAAGPR.------------------------------------EALGRLRELCRR-WLRPE..RRTKEQILEQL---
G3U9B4_LOXAF/34-122YC.TVTGLQ.------------------------------------QALSQLWTLCHL-WLWPD..TCSKEQILELL---
W5P1J3_SHEEP/40-129YE.EAAGPG.------------------------------------EALARLWELCRQ-WLRPE..AHSKEQMLELL---
H9GQN3_ANOCA/39-128YR.EAEGPR.------------------------------------EACGRLWELCHR-WLKPE..RHSKEEILELV---
G3VGJ9_SARHA/47-136YE.ETPGPR.------------------------------------EALNQLRDLCQK-WLRPD..IHTKVQILELL---
M3YUS0_MUSPF/40-127YQ.EDMGPR.------------------------------------AALSRLRELCCR-WLRPE..LRTKEQILELL---
G3WVV5_SARHA/39-127YT.DVAGPR.------------------------------------KALSQLRELCLQ-WLRPE..IHNKHQILELL---
G3MZ79_BOVIN/39-127SL.SVTGPH.------------------------------------QAVSQIQELCWR-WLQPE..IHTKEQIMEQL---
M3XQF3_MUSPF/46-135YQ.DSAGPR.------------------------------------EALSRLRELCHQ-WLQPE..THSKEQILELL---
G1SPH0_RABIT/47-136YH.ESSGPL.------------------------------------ETLSRLRELCRW-WLRPD..VLSKAQMLELL---
R4G9E0_ANOCA/43-131SQ.EALRPR.------------------------------------ELCSQLHRLCCQ-WLKPE..RCTKAEMLDLV---
H0W9S1_CAVPO/45-132YP.EAPGLL.------------------------------------RSVRKLKDLCRQ-WLRPD..IHSTEEMLELL---
F7DUP4_HORSE/38-126YL.SMTGPH.------------------------------------QAVNQIQELCWQ-WLQPE..THTKEEMMEQL---
G1TCI0_RABIT/47-136YE.ETSGPR.------------------------------------EALSQLRELCRQ-WLQPE..THTKEQILELL---
H0WAL0_CAVPO/44-133YS.DSAGPR.------------------------------------EALRQLQELCCQ-WLRPE..AHTKEQILELL---
R4GBT3_ANOCA/134-222YQ.EAEGPR.------------------------------------GAYGHLQELCHR-WLKVE..KHTKEQILEDL---
G1PAE7_MYOLU/42-128YV.EVVGPQ.------------------------------------TTLLRLRNLCLD-WLQPE..IHSKEEIIDLL---
G1KVY9_ANOCA/39-128YQ.EAAGPR.------------------------------------NFWEQLRNLCRK-WLMPE..RHTKEQILDLV---
F7GXN1_CALJA/157-246YK.DMTGPQ.------------------------------------EALDQLRELCHQ-WLQPE..ARSKEQILELL---
I1FKS6_AMPQE/169-256RK.KEGSNR.------------------------------------ELAVRLMDWQVK-WLKE...CKKVKDVMELV---
W4XI34_STRPU/152-240LH.QGETYV.------------------------------------QYAHRIEKYLDR-WIDLSSYDDNVEGLKSLL---
H9GSL7_ANOCA/45-131YQ.EAEGPR.------------------------------------EACARLRGLCHR-WLEPE..SRTKEQIVELL---
F6UYM9_CANLF/51-140YQ.EVTGPR.------------------------------------EALAQLQELCHQ-WLRPE..THSKEEILELL---
I1FFW7_AMPQE/50-138IK.RTETPL.------------------------------------EMLTRITDLADK-WLVS...CTTRKEVIDCV---
I3M4A7_ICTTR/44-133YQ.ETTGPR.------------------------------------EALQRLQELCHQ-WLRPE..MHSKEQILELL---
F6YR66_ORNAN/30-119YE.EVAGPH.------------------------------------EAFSKLWELCCR-WLRPE..MRTKEQILELL---
H9GUM9_ANOCA/2-89YR.EAEGPK.------------------------------------GAYSQLQELCCQ-WLKPE..RHSKEQILELL---
R4G933_ANOCA/10-94YE.AVKGPR.------------------------------------EVCKQLWKLCHQ-WLKPE..RCSKDQILEVL---
H9H9L0_MONDO/62-150YQ.EASGPR.------------------------------------EALSRLRELCGL-WLRPE..VSPKEQILELL---
F7ASR7_MONDO/32-121YQ.EVGGPH.------------------------------------EAFSTLWELCCR-WLRPK..TNSKEQILEML---
G3TIY7_LOXAF/26-115YQ.EAAGPH.------------------------------------EAFNKLWELCCQ-WLKPK..MRSKEQILELL---
F6Y0L2_XENTR/70-156RE.PKDSYS.------------------------------------DVVGNLRTTFRQ-WIKGL.SINTLAELEDLM---
H9GAD1_ANOCA/1-89YQ.DAEGPQ.------------------------------------EVYRGLWRLSHQ-WLRPE..VHTKEQIMELL---
G1PXN5_MYOLU/45-134YQ.EAAGPR.------------------------------------VAVGQLQELCRQ-WLRPD..IHSKEEILDLL---
G3TBI6_LOXAF/35-121YQ.EATGPH.------------------------------------EALARLRELCHQ-WLRPE..VHSKEQMLELL---
F6WAX4_ORNAN/41-129YQ.EAGGPR.------------------------------------EALGRLRELCRR-WLRPD..RHTKEQILELL---
I3MGL2_ICTTR/48-137YE.DSPGPQ.------------------------------------EALSQLRELCHQ-WLRPE..EHTKEQILELL---
H0WSH9_OTOGA/159-248YE.NVVGPR.------------------------------------EALAHLRELCYQ-WLEPD..VHSKEQMLELL---
G1LLI4_AILME/74-163YE.EAVGPH.------------------------------------QALAQLRELCRQ-WLRPE..VHSKEQMLELL---
V8NJC1_OPHHA/264-353YQ.AADGPR.------------------------------------MACQQLQELCHC-WLRPE..GQSKEQILDLL---
F6SSW6_ORNAN/43-130YQ.EASGPR.------------------------------------EALGRLRELCHL-WLRPD..RRTKEQILDLL---
G1TSA0_RABIT/45-132YH.EATGPR.------------------------------------EAVSQLQELCRL-WLRPE..IHSKEQILELL---
F6XAN0_ORNAN/49-138YQ.EADGPR.------------------------------------KAHGQLWELCRR-WLRPE..VRTKEQILDLL---
F6W347_ORNAN/14-103YE.EVAGPH.------------------------------------EAFSKLWELCCC-WLRPE..MRTKEQILELL---
G1TS83_RABIT/90-179YE.EAVGPR.------------------------------------EALARLRELCRQ-WLQPE..THSKEQMLELL---
G1MMS7_AILME/45-133YH.EAAGPR.------------------------------------EIVGQLQELCRQ-WLRPE..LHSKEQILELL---
G3UAN3_LOXAF/20-109YP.EAVGPL.------------------------------------QAVSQLQELCRQ-WLKPE..IHSKEQILELL---
F6W9F0_MONDO/37-126YE.EFTQPH.------------------------------------EVLFQLRELCHL-WLKPE..KRTKEQILELL---
M3W412_FELCA/46-135YP.EAEGPR.------------------------------------EALSRLRELCRQ-WLSPD..IHTKEQILELL---
H0VRS4_CAVPO/48-137YS.DSSGPQ.------------------------------------GTLSQLRELCHH-WLRPE..VHTKEQILEML---
G3WT79_SARHA/42-131YQ.EAAGPR.------------------------------------EALNQLRELCRQ-WLRPE..KCTKEQILELL---
F7GC31_MONDO/42-131YQ.EASGPR.------------------------------------EALSRLRELCHQ-WLRPE..RRTKEQILDLL---
F6UNZ6_HORSE/48-137YQ.ESPGPR.------------------------------------EALSQLRQLCRQ-WLRPE..VHTKEQILELL---
H0VDV9_CAVPO/26-115YS.EAAQPK.------------------------------------ENYRRLWELCCQ-WLKPK..LNSIDQVLELL---
I3N2G4_ICTTR/49-138YP.ETAGPK.------------------------------------EVLSQLRELCRQ-WLRPE..MHSKEQILELL---
G3U5G9_LOXAF/65-154YQ.EVAGPI.------------------------------------EALRRLRELCRQ-WLRPE..MRTKEQILELL---
G1KVJ6_ANOCA/17-104FR.PGQAPE.------------------------------------EILLHLTDAAQQ-WLCPQ..EHSKEWIVDMV---
G1KVF1_ANOCA/42-130YP.EAMDPL.------------------------------------LVYVQLWKLCCQ-WLKPE..KHTKVEILELV---
G3NE20_GASAC/93-183KG.EKQTYT.------------------------------------EVARELYSHFNR-WCSAV.GVTTFEELSNLI---
G3I2R2_CRIGR/52-140YE.ESDDPQ.------------------------------------QAVSQLRELCHR-WLQPN..IHSKNWILELL---
M3X6Y2_FELCA/157-246FE.EVAGPR.------------------------------------EALARLRELCRQ-WLQPE..AHSKEQMLELL---
I1F9F1_AMPQE/170-256KK.EGQSYV.------------------------------------EVGIQLMDLFRK-WTASA..KDSVAELTELV---
ZN75C_HUMAN/47-134YH.EATEPL.------------------------------------EAINQLQKLCHQ-WLRPE..IHSKKHILEML---
R4GBC4_ANOCA/51-139FQ.EADGPR.------------------------------------ELCSQLHKLCSQ-WLKPE..KHTKAQMLDLV---
G1KX82_ANOCA/43-132YE.DLQGPR.------------------------------------EVCSYLHSLCCL-WLKPA..RRSKAEILDLV---
W5QB12_SHEEP/45-134YQ.EVAGPE.------------------------------------EALSRLRELCCR-WLRPE..VHSKEQILELL---
F6SMP8_ORNAN/6-94YR.EAARPR.------------------------------------EALSRLRELCHQ-WLRPE..ARSKEGILELL---
I3MZW9_ICTTR/49-138YS.DSSGPR.------------------------------------EAMSQLKELCSR-WLKPE..AHSKEQILELL---
V8NFE8_OPHHA/161-250YQ.ETEGPR.------------------------------------GVYRHLQELCWQ-WLKAE..RCSKEEILELL---
I3L4W6_HUMAN/33-121YQ.EVTGPH.------------------------------------EAFSKLWELCCQ-WLRPK..THSKEEILELL---
H3BQ35_HUMAN/41-130YE.DVTGPH.------------------------------------EAFSKLWELCCR-WLKPE..MRSKEQILELL---
H0WAW4_CAVPO/28-117YQ.ETPGPR.------------------------------------EALHRLRELCHQ-WLRPE..THSKEQILELL---
F6V0K5_CALJA/41-129YE.ETTGPR.------------------------------------EAPSRLRS.SVQ-WLQPE..TQTKEQIPELL---
G3WJL4_SARHA/33-122YP.EKAGPR.------------------------------------EAVNQLWELCLQ-WLRPE..LHSKEQILELL---
G1LV91_AILME/45-134YE.ETTGPR.------------------------------------EALSRLRELCRR-WLRPD..MHSKEQIVELL---
F6WPG6_MONDO/42-131YQ.EVSGPH.------------------------------------QAFSQLWELCCR-WLRPE..VRMKEQILELL---
R4GBY9_ANOCA/37-124YQ.ESLGPR.------------------------------------DVCSRLHHFCRQ-WLKPE..RYSKAEMLDLV---
F7CMF2_ORNAN/38-125YQ.EAAGPR.------------------------------------ETLCCLRELCRR-WLRPE..RRTKEQILELL---
G3WUB7_SARHA/49-138YQ.ESAGPQ.------------------------------------ETLSQLRELCLQ-WLQPE..IHTKEQILELL---
G3VG61_SARHA/35-124YH.ETSGPQ.------------------------------------EALSQLRDLCGR-WLRPD..MNTKMQILELL---
K7DZ94_MONDO/30-119YT.ETAGPT.------------------------------------EALIRLQELCQC-WLRPD..VCTKEEILQRL---
F7B272_XENTR/169-255RG.ANDSYS.------------------------------------DVVGRLRTTFHQ-WIQGR.SVSTFAELGDLM---
B7PBT9_IXOSC/107-198KK.TEQSFT.------------------------------------EFAYSLRSNLVE-WLKSAEVYGDHDRIVECI---
H2QEF7_PANTR/48-137YQ.DSPGPH.------------------------------------EALSRLRELCHL-WLRPE..VHTKEQILELL---
F7AGA9_XENTR/198-285RG.PTDSYS.------------------------------------DVVSSLRTTFKS-WLRGL.SVTTFDCLEDLM---
G5E651_BOVIN/45-133YH.DTPGPY.------------------------------------EAVSHLQELCSQ-WLRPE..IHSKEQILELL---
R4GAE0_ANOCA/42-131YE.ETEGPR.------------------------------------KVCSQLHHLCSQ-WLKPE..QHTKAEMLDLV---
V8N700_OPHHA/304-393CQ.EVGDPR.------------------------------------RIHSQLQELCLQ-WLRPE..KHTKEQILELL---
F7DJG4_MONDO/57-146RP.EVASPQE------------------------------------EELNQIRELCMQ-WMDPE..TRAKEDVLDML---
G5C295_HETGA/48-137YL.DSTGPR.------------------------------------EALSQLQELCHR-WLRPE..VHTKEQMLELL---
F7BJF5_ORNAN/43-131Y..EASGPR.------------------------------------QALGRLRELCRL-WLRPD..RRTKEQILDLL---
NRIF1_MOUSE/154-243YE.ESAGPQ.------------------------------------KAMSQLRKLCHQ-WLQPN..TRSKKQILELL---
F7D2U8_ORNAN/46-134YQ.DASGPQ.------------------------------------EALSQLRKLCHQ-WLKPE..KHTKEQILEML---
G1TNJ7_RABIT/46-135FD.EVPGAF.------------------------------------EAASRFQELCHQ-WLQPE..IHSKEQIMELL---
F6UZ44_CANLF/53-142YP.EAQGPR.------------------------------------EALTRLRELCRR-WLRPE..SRSKEQILELL---
G1TAR6_RABIT/48-137YQ.DSPGPR.------------------------------------EALSRLRELCCQ-WLRPE..VHSKEQILELL---
L7N032_ANOCA/16-105YE.EAQGPR.------------------------------------EVCSRLHSLCRL-WLKPE..EHTKAEMLDLV---
M3X7M7_FELCA/47-136YE.ETTGPR.------------------------------------EALRRLRELCRQ-WLRPE..THSKEQILELL---
R4GAC2_ANOCA/42-131CE.EVEWPR.------------------------------------EICSQLHHLCRQ-WLKPE..KHTKNQMLDLV---
G3VST8_SARHA/49-138YQ.DTPGPR.------------------------------------EALSQLRELCCL-WLRPE..RCTKEQILEML---
G3TW89_LOXAF/39-128YH.EASGPR.------------------------------------EVLAQLRELCRR-WLKPE..THTKEQILELL---
I3KYH8_ORENI/68-154VK.PDENPK.------------------------------------ELYARLKELYEK-WVKPK..GKTVHEVGEIL---
R4GD13_ANOCA/162-247YQ.ETDGPR.------------------------------------EACRHLRKLCHQ-WLKPE..SHTKEQIVELV---
F6RYD6_ORNAN/53-142YR.EASGPR.------------------------------------QALGRLRELCRL-WLRPD..RRTKEQILELL---
H0UX96_CAVPO/48-137YQ.ETLGPR.------------------------------------EAMIQLRALCHQ-WLRPD..LNSKEQIMELL---
G3QSE2_GORGO/47-136YR.DAAGPH.------------------------------------EAFSQLWALCCR-WLRPE..IHLKEQILELL---
M3WU60_FELCA/44-133YE.EASNPH.------------------------------------EALAQLRELCHQ-WLQPE..AHSKEQMLELL---
F6YIP0_ORNAN/43-130FQ.EAAGPH.------------------------------------QALSRLRELCQQ-WLRPE..VHTKEQILELL---
G3TCK1_LOXAF/49-138YP.EAAGPR.------------------------------------EVLGRLRELCWQ-WLQPE..MHSKEQILELL---
M3VUC4_FELCA/48-137YQ.ESPGPR.------------------------------------EALRRLRELCRQ-WLRPE..THSKEQILELL---
H0XWT5_OTOGA/45-134YH.EAPGPL.------------------------------------EAVSQLQKLCHQ-WLRPE..IHSKEQILELL---
G5BW12_HETGA/28-117YS.EAAGPW.------------------------------------ENFHRLWELCCQ-WLKPK..VRSIEQVLELL---
G3WXR5_SARHA/42-131YR.EADGPH.------------------------------------EAFRQLWELCCQ-WLRPE..TRTKEQILELL---
R4GCL4_ANOCA/42-131YR.QAEGPR.------------------------------------EVCSQLCDLCYE-WLKPE..KHTKAQILDLL---
G3UEV4_LOXAF/45-134YH.EAAGPI.------------------------------------EAVSQLKELCYR-WLRPE..IHSKEQILELL---
H9GH51_ANOCA/43-132FQ.EAEGPR.------------------------------------QACGNLRKLCRQ-WLKPE..IHTKDHILELL---
F6S3Z6_MONDO/43-132YE.DVSGPH.------------------------------------EAFNRLWELCRQ-WLKPE..VRSKEQILELL---
G3U4S2_LOXAF/38-127YQ.VMSGPQ.------------------------------------ETLKQLRKLCFQ-WLQPE..VHTKEQILELL---
D3ZV88_RAT/24-110LG.DAAGPR.------------------------------------EALGLLRALCRD-WLQPE..VHTKEQMLELL---
G7P3S1_MACFA/45-134YQ.DSPGPR.------------------------------------EALSQLRELCCQ-WLKPE..IHTKEQILELL---
M3ZCB0_NOMLE/38-127YQ.EAAGPR.------------------------------------EALQRLWDLCRG-WLRPE..RHTKEQILELL---
L7MZT4_ANOCA/1-86YQ.EAEGPR.------------------------------------EVCGRLHVLCRQ-WLKPE..RHTKKHILDLV---
H9GV33_ANOCA/8-97YR.EAKGPR.------------------------------------EAYGQLQELCCR-WLKAE..RHSKEQILELL---
G1LHZ3_AILME/27-115YH.EASGPR.------------------------------------EALSQLRVLCCE-WLRPE..LHTKEQILELL---
H2U7H2_TAKRU/66-153KQ.DDKTYV.------------------------------------EFVRELTTLFNR-WRIAS.GVETFPQLCELL---
F6WQ39_XENTR/45-132YS.AADSPR.------------------------------------EVFTHLTDLYKK-WMKPE..LKTHQQITETI---
G3TLL9_LOXAF/40-125CS.EEADCI.------------------------------------GDLKRLCELCHL-WLRPD..LHTKEQILDKL---
F7GAH0_ORNAN/86-175YQ.DSAGPH.------------------------------------EALGRLRELCRQ-WLRPD..RHTKEQILELL---
G3VPU7_SARHA/40-129YQ.KTTKPQ.------------------------------------EALSQLWVLCSQ-WLRPE..VHTKEEMMELL---
I3L473_HUMAN/41-130YG.DVHGPH.------------------------------------EAFSQLWELCCR-WLRPE..LRTKEQILELL---
F7DRA3_ORNAN/39-127YQ.EMSGPR.------------------------------------EALSQLWELCRR-WLRPE..KHTKKQILELL---
I3LR01_PIG/48-137YQ.ESPGPR.------------------------------------EALSRLRELCCQ-WLRPE..VHSKEQILELL---
H9GSX1_ANOCA/14-103YQ.EGEGPR.------------------------------------GVCSRLHDLCRQ-WLKPE..QHTKAEVLDLV---
H9GSL2_ANOCA/38-127YQ.EAEGPR.------------------------------------GVYGRLQELCRR-WLKVE..RHSKEQILELL---
G1PWN5_MYOLU/38-126YQ.EATGPQ.------------------------------------EALRKLQELCRQ-WLRPE..LHTKEQILELL---
H9GBZ5_ANOCA/14-103YQ.DSEGPR.------------------------------------EACWRLRELCRR-WLKPE..SRTKEQILELL---
G3T3H6_LOXAF/42-131YQ.EATGPH.------------------------------------KALAQLHELCRE-WLWPK..THTKEQMLELL---
F7G0P1_MONDO/42-131YQ.ETPGPR.------------------------------------EALRRLRELCLQ-WLRPE..VHTKEQILDLL---
F7DVV8_MONDO/1-89YP.EVAGPQ.------------------------------------EALIQLRELCSQ-WLRPE..IHTKEQILELL---
H9GH43_ANOCA/38-124YQ.EAEGPR.------------------------------------EVCSWLRELCHR-WLEPE..NRTKEQILELL---
H0V5E8_CAVPO/42-128YS.DNSEAR.------------------------------------KELQRLYEFFHS-WLQPE..NHSKDQIIAQL---
C9JHD9_HUMAN/41-130YH.DTPGPR.------------------------------------EALSQLRVLCCE-WLRPE..IHTKEQILELL---
R4GD45_ANOCA/43-132YW.EAKGPR.------------------------------------EVCGRLHSLCRR-WLKPE..QSTKAQILDLV---
G1NUW7_MYOLU/22-111YR.DAPGPR.------------------------------------QALHRLRELCGL-WLQPD..THSKEQMLELL---
W4ZJX0_STRPU/154-245IQ.SGETYI.------------------------------------QFASRIEKYFDR-WLELSPYDSSIDGMKSLT---
F8WEU5_HUMAN/38-127YH.ETSGPQ.------------------------------------EALSRLRELCRR-WLRPE..ARTKAQILELL---
F6RNY0_ORNAN/26-115YE.EAAGPR.------------------------------------AALGRLRELCGR-WLRPE..RRTKEQIVELL---
G3VFI6_SARHA/22-111YQ.DTSGPQ.------------------------------------EALVRLQELSRW-WLRPD..IHTKEEILERL---
M3XD21_FELCA/41-130YQ.EVAGPE.------------------------------------EALSRLRELCRR-WLRPE..MHTKEQILELL---
E1BIL7_BOVIN/52-140YQ.NTFGPR.------------------------------------EALSRLKELCHQ-WLRPE..IHTKEQILELL---
M0R034_HUMAN/22-109YQ.EVAGPR.------------------------------------EALARLRELCCQ-WLQPE..AHSKEQMLEML---
G1L8Y8_AILME/37-126YQ.DAPGPR.------------------------------------EALSQLWELCRQ-WLRPE..CHTKEQILDLL---
F7HCM9_CALJA/29-118YQ.EAAGPH.------------------------------------QTLARLHELCRQ-WLMPE..ARSKEQMLELL---
U3KLY8_RABIT/48-137YQ.DSPGPR.------------------------------------EAVSQLRELCRL-WLRPE..THTKEQILELV---
H9GQZ7_ANOCA/21-110YK.DAQSPR.------------------------------------ELRNQLHHLCQQ-WLEPE..KNTKAQVLDLV---
F7HNX5_MACMU/34-123YH.VAGGPH.------------------------------------LALGQLWTLCRQ-WLRPE..ARSKEQMLELL---
G3T2M0_LOXAF/44-133YL.EAAGPY.------------------------------------ESLSQLWKLCIQ-WLRPE..IHTKNQILELL---
F1Q4K9_CANLF/34-123YK.ETPGPR.------------------------------------EALSQLWMFCCK-WLRPE..IHTKEQMLDLL---
G3VRM3_SARHA/42-131YH.LTPGPR.------------------------------------EALCRLRELCHQ-WLKPE..MHTKEQILELL---
M3XQ98_MUSPF/48-137YQ.ETPGPR.------------------------------------EALSRLRELCRR-WLRPE..THSKEQIVELL---
F7CWS8_MACMU/50-139YH.EMSGPQ.------------------------------------EALSRLRELCHW-WLMPE..VHTKEQILELL---
W5Q908_SHEEP/40-130YQ.EVPGPR.------------------------------------EALAQLRELCHQ-WLSPE..THSKERILELL---
F7EE73_MONDO/48-136YS.EADGPQ.------------------------------------KTLHHLRELCHQ-WLRPD..IHTKEQILEML---
R4G9I2_ANOCA/181-270YQ.EIEGPR.------------------------------------AVLNELQKLCRQ-WLVPE..GHTKEQIVDLV---
G3VJ81_SARHA/45-134YY.EAAGPR.------------------------------------EALSQLRVLCCE-WLRPE..MHTKEQILELL---
G3T0U2_LOXAF/108-196YQ.VAMGPQ.------------------------------------QALAQLRELCYQ-WLRPE..ARSKEQMLELL---
G5BSG8_HETGA/44-133YP.EAAGPQ.------------------------------------EALGRLRELCHQ-WLQPK..THSKEQILELL---
H9GR70_ANOCA/38-127YR.EVEGPR.------------------------------------GAYSQLWELCRG-WLRVE..RHSKEQILELL---
I3MS02_ICTTR/44-133YP.KRAGPR.------------------------------------EAVIQLQELCRL-WLRPE..IHSKEEILELL---
V8N853_OPHHA/232-321YR.DTEGPR.------------------------------------GVCGQLRALGCR-WLKVE..RRTKDEILELL---
H2NPG6_PONAB/41-130YQ.EASGPR.------------------------------------EALLQLRKLCCQ-WLRPE..KCAKEQILELL---
H9GJF9_ANOCA/5-94YE.DTETPR.------------------------------------EICNRLHSLCRR-WLKPE..QHTKAQILDLV---
H9GQ87_ANOCA/44-131YR.ESEGPR.------------------------------------GAYIRLQELCSQ-WLKFK..HHSKEQILELL---
H0XXX1_OTOGA/27-116YQ.EVAGPE.------------------------------------EALSRLRELCGQ-WLRPE..VHSKEQILELL---
G1KI12_ANOCA/155-244YE.EAEGPR.------------------------------------EVCNKLWELCHQ-WLRPE..THTKEQILEFL---
Q149X8_MOUSE/44-133YS.DFTGPR.------------------------------------EALNRLQKLCQQ-WLRPE..EHSKEQILELL---
G1Q2R9_MYOLU/13-101SL.SATGPQ.------------------------------------QALSQIRERCCE-WLQPE..THTKEQMMELL---
ZSCA4_HUMAN/40-129DS.NNSYAR.------------------------------------QELQRLYRIFHS-WLQPE..KHSKDEIISLL---
R4G9R4_ANOCA/42-131YR.ETLGPR.------------------------------------EVCSQLHLLCRQ-WLRPE..RHTKAEMLDLV---
G3VQ12_SARHA/48-135YP.KVAGPQ.------------------------------------EPLIQFPELFFQ-WLKPK..IHTKEQILELL---
M3WTJ0_FELCA/57-144YH.EAPGPH.------------------------------------EAVSQLQELCHQ-WLRPE..IHSKEQILELL---
G3VJ10_SARHA/49-136YR.ETLGPR.------------------------------------EALIQLRALCHQ-WLRPD..LHTKEQILELL---
R4G9Q5_ANOCA/42-129YQ.ESQGPQ.------------------------------------EACSQLHSLCRQ-WLKPE..HCTKSQILDLV---
F6XAP1_ORNAN/37-126YQ.EVAGPR.------------------------------------EALSRLRELCRL-WLRPE..MHTKEQILELL---
H0WCZ6_CAVPO/44-133YF.EASGPH.------------------------------------EALNQLWKLCHQ-WLRPE..IHTKEQILELV---
L5M495_MYODS/26-115YK.EGVRPT.------------------------------------DVFNKLLELCSE-WLKPK..MHSKKQMVKLL---
ZSC12_MOUSE/42-130YQ.ETSGPR.------------------------------------EALSRLRELCRQ-WLRPD..LNSKEQILELL---
D3YTV4_MOUSE/47-136YP.EAAGPR.------------------------------------QALSRLRELCRQ-WLRPD..MHSKEQILELL---
G3T1H1_LOXAF/56-145YS.DSSGPR.------------------------------------EALSRLRELCHQ-WLRPE..THSKEQILELL---
Q5VZN3_HUMAN/48-137YS.EVAGPR.------------------------------------KALSQLWELCNQ-WLRPD..IHTKEQILELL---
G1KYL1_ANOCA/24-110YQ.EAEGPR.------------------------------------EACSRLWYLCHR-WLKPE..RHTKEQILELV---
R4GDC0_ANOCA/42-131YK.EVEGPR.------------------------------------RVCSQLHALCCQ-WLQPE..TQSKAEMLDVV---
K7ERU5_HUMAN/46-135YQ.ETPGPR.------------------------------------EALSRLQELCYQ-WLMPE..LHTKEQILELL---
F7CA80_HORSE/48-137YQ.ETPGPR.------------------------------------EALTRLRELCHQ-WLRPH..VSTKEQILELL---
G1SFD0_RABIT/152-241YE.EASGPQ.------------------------------------EALARLRELCHQ-WLQPE..AHSKEQILELL---
G1LLD5_AILME/49-138YQ.EADGPH.------------------------------------QALAQLYELCRQ-WLQPE..VHSKEQMLELL---
G3VRL4_SARHA/50-139YY.DTPGPR.------------------------------------EALSKLWELCHQ-WLRPE..IHTKEQILELL---
G1KZ70_ANOCA/2-90CP.EVEDPR.------------------------------------RVYTQLQELCCR-WLKPE..RRSKEQILELL---
R4GC39_ANOCA/169-256YP.NAIGPR.------------------------------------EVCSRLRELCHY-WLEPE..NRSKEQILELL---
F7F1F8_MONDO/44-133YQ.EAAGPK.------------------------------------EALSRLRELCCQ-WLRPE..THTKKQILELL---
G3VIH3_SARHA/43-132YQ.QAAGPR.------------------------------------QAFIQLQELCHR-WLRPE..IHSKEQILELL---
I3L7Q0_PIG/51-140YQ.EAPGPR.------------------------------------EALSRLQELCQK-WLQPE..IHSKEQILELL---
G5CAU3_HETGA/39-126YL.SLTGPH.------------------------------------QAVSQIQVLCRR-WLQPE..THTKEQIIERL---
G1KI06_ANOCA/1-88YL.EAEGPR.------------------------------------EVCSHLWFLCSQ-WLKPE..RHNKEQILELL---
H9GU03_ANOCA/63-152YQ.EALGPR.------------------------------------EVCSRLYALCHQ-WLKQE..EHATAQFVDLV---
I3N7T3_ICTTR/40-129DN.GNSNAR.------------------------------------KELQRLHGIFHS-WLQPE..KHSKDEIISRL---
G1LE31_AILME/40-129NS.NNSCAR.------------------------------------QELQNLYKLFHS-WLQPE..KHSKDEIISCL---
G1P3T9_MYOLU/44-130YL.GVSGPR.------------------------------------EALSQLWELCLQ-WLRPE..VHTKKQILELL---
F6XAK9_ORNAN/44-132YR.EALGPR.------------------------------------GALSRLRELCRQ-WLRPE..VRTKEQILELL---
I3KYJ5_ORENI/220-308VF..DESPK.------------------------------------ELYARLKELYEK-WIQPK..NRTIKEVGEII---
M3X1N7_FELCA/40-128YR.DVTGPR.------------------------------------QALAQLHELCRQ-WLRPE..THSKEQILELL---

PF02093

F8S319_PIG/212-422NEPPSVFLERLMEAFRRFTPFDPTSEAQKASVALAFIGQSALDIRKKLQRLEG---LQEAEL-RDLVKEAEKVYYKRET-
M3X1Y6_FELCA/234-443EESPAAFMERLLEGFRMYTPFNPEAPEHKATVAMSFIDQAASDIKGKLQRLDG---IQTYGL-QELVREAE.VYNKRET-
M3XFF7_FELCA/213-416EETPAAFLERLKEAYRMYTPYDPEDPGQAASVILSFIYQSSPDIRNKLQRLEG---LQGFTL-SDLLKEAEKIYNK...-
GAG_XMRV6/224-431NESPSAFLERLKEAYRRYTPYDPEDPGQETNVSMSFIWQSAPDIGRKLERLED---LKSKTL-GDLVREAEKIFNK...-

PF00607

GAK10_HUMAN/312-526KEPYPDFVARLQDVAQKSIA----DEKAGKVIVELMAYENANPECQSAIKPLKGKVPAGSDVISEYVKACDGIGGAMHKA
GAG_HV1H2/149-363KEPFRDYVDRFYKTLRAEQA----SQEVKNWMTETLLVQNANPDCKTILKALG....PAATL.EEMMTACQGVGGPGHKA
GAG_MMTVC/290-495EESYETFISRLEEAVYRVMP----RGEGSDILIKQLAWENANSLCQDLIRPMR....KTGTM.QDYIRACLDASPAVVQG
GAG_HTL1C/147-344EEPYHAFVERLNIALDNGLP----EGTPKDPILRSLAYSNANKECQKLLQARG...HTNSPL.GDMLRACQ.AWTPKDKT
GAG_HV2BE/151-365KEPFQSYVDRFYKSLRAEQT----DPAVKNWMTQTLLIQNANPDCKLVLKGLG....MNPTL.EEMLTACQGVGGPGQKA
W5PXQ0_SHEEP/276-481DEPYQDFVARLLDTIGKIMS----DEKAGMVLAKQLAFENANAACQAALRPYR....KKGDL.SDFIRICADIGPSYMQG

PF02023

I3NI39_HUMAN/37-126------VLEQFLTILPQEIQ--------------SRVQELHPESGEEAVTLV-----------EDMQRELGRL-------
C9JIC2_HUMAN/35-124------VLEQFLTILPEELQ--------------AWVREHHPESGEEAVAVV-----------EDLEQELSEP-------
G3R3C9_GORGO/38-127------VLEQFLTILPGEVR--------------TWVKSQYPESSEEAVTLV-----------EDLTQILEEE-------
F7CQI3_MONDO/39-128------VLEQFLTILPKDLQ--------------TWVQDHHPENGEEAVTVL-----------EDLEREIDEP-------
F7C2C9_ORNAN/27-115------VMDRFLALLPWETQ--------------ARVRQTRLGSVEEAVTLL-----------EDLRPEPRRR-------
G1KZD9_ANOCA/101-189------VLEQFLASLPPDLQ--------------GWIRVGGPDSCSQAVALV-----------EDFMMCQQE.-------
H0VL73_CAVPO/49-136------VLEQFLAVLPAELQ--------------AWVRAQRPQSGGEAAALL-----------EFVQGPLEE.-------
H9GV16_ANOCA/138-227------ILEQFLAILPPEML--------------SWVKENDPESCAEAVALA-----------EDFLQRQQED-------
H9G8P1_ANOCA/15-104------ILEQFLTILPQEMQ--------------SWVRSHCPQTCSQAVALA-----------EEFLRDQQQQ-------
F6UXF4_ORNAN/1-89------VLEQFLTVLPGEIQ--------------TWVRLHKPESGEEALTLV-----------EDLQGALDGP-------
W5Q925_SHEEP/49-138------VLEQFLTILPTDLQ--------------SWVREQHPESGEEVVALL-----------EYLERQPDGP-------
G1KVW6_ANOCA/25-114------ILEQFLSILPREML--------------SWIRERDSESCFHAVALA-----------EHFLLQQHQA-------
G3VM18_SARHA/57-147------VLEQFLSLLPGQVQ--------------ARVRERRPQRGEEVLGLL-----------ERLDHGLEEN-------
F6T5P3_HORSE/44-133------VLEQFLNILPPEIQ--------------ARVRHRCPMSSKEMVTLV-----------EDFHRAAKRP-------
F7F5Q8_MONDO/48-137------VLEQFLTILPGEIR--------------TWVKSHNPEKSEEVVAMV-----------EDLAQMLEEE-------
G3VZJ2_SARHA/42-131------VLEQFLTVLPGEIQ--------------TWVREQQPESGEEAVVLV-----------EGLQKEPRKQ-------
G3UC70_LOXAF/35-118------VL....TILPRELQ--------------SQMQKHHPQSIEAAVALV-----------QHFHRESGQR-------
H0VNG3_CAVPO/40-126------VLEQFLSILPGELQ--------------AWVRRHCPESREKASALT-----------RALLAAL...-------
H9GSG5_ANOCA/42-131------LLEQFLAVLPADME--------------RWVRECGAETSSQAVALA-----------EGFLLSREQE-------
H0XP10_OTOGA/40-129------VLEQFLTILPRDLQ--------------ARVQRYPLESGEEVVTVL-----------ENLETRSGNR-------
G1PWN2_MYOLU/59-145------VLEQFLTALPPELR--------------DRVRRRDPASADQAAATV-----------RALRRTR...-------
ZN394_RAT/40-129------VLEQFLTILPRELQ--------------AYVRDHCPESGEEAAALA-----------RTLQRALDGA-------
I3N8X2_ICTTR/40-129------VLEQFLTILPKELQ--------------AWMQTYSLQSGEEAVTML-----------ENLTSGHGDT-------
G1LE29_AILME/38-126------VLEQFMINRHCSGR--------------STLKKKWESSGRNLEKFM-----------ESLSESSLKP-------
D3ZF35_RAT/41-130------VLEQFLGALPSEIQ--------------ARVQEQWPGSPEEAAALV-----------DRLRWELDGP-------
F7C8L0_HORSE/32-121------VLEQFLTILPRDIQ--------------TGVKKHHLQGIEEAVALV-----------EHLQKESGQT-------
F7BWC6_ORNAN/36-125------VLEQFLTVLPREIQ--------------TQVRERRPESGEEAVALV-----------EGLQRETRRP-------
G3HPX2_CRIGR/38-127------VLEQFLTILPRDLL--------------VQVLEHHPETGEDLVGIL-----------EDLQRDRGEA-------
G3WFW4_SARHA/48-137------VLEQFLSILPEELQ--------------IWLQERHPESGEEVVMLL-----------EDLERELDEP-------
T1HQU6_RHOPR/202-290------LMEEFKSCVSKQIR--------------LFLEEKQVVDLETAAKLA-----------EEYVLTH...-------
I3MUC8_ICTTR/37-126------VLEQFLNTLPKEVQ--------------VWVRSQQPKSSREAGALV-----------AHLIQACGEK-------
M3W6W2_FELCA/42-129------VLEQYLTILPEKIK--------------PWVRAKKPENCEKLVTLL-----------ENYKEMYE..-------
R4GAL9_ANOCA/89-178------VLEQFLAVLPWRIR--------------HRVQEGGPENCAQAVALA-----------EGFLLEPTEE-------
H3BUW4_HUMAN/14-103------VLEQFLTVLPGEIQ--------------NWVQEQCPENGEEAVTLV-----------EDLEREPGRP-------
F7BUI2_ORNAN/30-119------VLEQFLTVLPEDIR--------------ARVWDRRPESAEEAVALV-----------EDLKRHPSGR-------
G3U9B4_LOXAF/34-122------VLEQFLSSLTCKMR--------------SWVQSQGPQTCREATSLV-----------EDLMQMFQQ.-------
W5P1J3_SHEEP/40-129------VLEQFLGVLPLEIQ--------------ARVRGQQPGSPEEAAALV-----------EGFRREPGGP-------
H9GQN3_ANOCA/39-128------ILEQFLAVLPQGME--------------SWVRECHPHTCAQAVALA-----------EDFLLRHPED-------
G3VGJ9_SARHA/47-136------VLEQFLTILPKELQ--------------VWLQEHHPKSGEQAVTML-----------EDLEQELDEP-------
M3YUS0_MUSPF/40-127------VLEQFLSALPAHLL--------------ARLQGQQLRDGEEVVLLL-----------EGVQRESS..-------
G3WVV5_SARHA/39-127------VLEQFLTILPREIR--------------AWVKSQHPDSSEEVVSLV-----------ENLAHVHQG.-------
G3MZ79_BOVIN/39-127------VLEQFLNILPEKVQ--------------IWVRSKQPKSSKEAGDLV-----------ADLIQVCEEE-------
M3XQF3_MUSPF/46-135------VLEQFLTILPEELQ--------------TWVQEHGPENGEEVVTLL-----------EDLERGADEA-------
G1SPH0_RABIT/47-136------VLEQFLSILPGELR--------------TWVQLHRPESGEEAVALL-----------EELQRDLDET-------
R4G9E0_ANOCA/43-131------VLEQFLAILPTEME--------------CWVRECGAETTSQAVALA-----------EGFLLSQKEN-------
H0W9S1_CAVPO/45-132------TVEQFLAMLPKAVR--------------VWVHGHHPQNIRQAVFLV-----------ETLKRATS..-------
F7DUP4_HORSE/38-126------VLEQFLNTLPEEVQ--------------TWVRSKQPKNSKEAGTLV-----------ANLIQAYEEK-------
G1TCI0_RABIT/47-136------VLEQFLSILPKELQ--------------ARVQEHQPENGEDMVIVL-----------EDLQLERGEA-------
H0WAL0_CAVPO/44-133------VLEQFLAILPQELQ--------------ACMQRHRPENGEEAVTLL-----------EELEREFDGP-------
R4GBT3_ANOCA/134-222------ILEQFLAVLPLEIQ--------------SWVKDQGPRSCPQAVDLA-----------EEFLLRRRE.-------
G1PAE7_MYOLU/42-128------VLEQYLNILPERVR--------------LWVQARRPQTCEKLVDLL-----------EMYHEVY...-------
G1KVY9_ANOCA/39-128------TLEQFLAALPPNMQ--------------KWLRGRCPQTCSQAVTLL-----------EEFLLNHRGP-------
F7GXN1_CALJA/157-246------VLEQFLGALPVKLR--------------TWVESQHPENCQEVVAMV-----------EGVTWMSEEE-------
I1FKS6_AMPQE/169-256------EIEQFLNLLPTEKR--------------LWVAERKPKSCIQAGELA-----------DEYEQAIRK.-------
W4XI34_STRPU/152-240------IQEQIFNTSSKECL--------------MFVKERHPGKHTEVLTLA-----------DQYHDAH...-------
H9GSL7_ANOCA/45-131------VLEQFLTILPEEMQ--------------DWVQEYRPKTCIQAVTLA-----------EHFLLKQ...-------
F6UYM9_CANLF/51-140------VLEQFLTILPKELQ--------------ARVQACHLESRKDVVTML-----------ENLQKDTGDP-------
I1FFW7_AMPQE/50-138------ILEQFVNVLPEEAR--------------TCVKEHKPSSSKEAGQLA-----------EDFRQARKDK-------
I3M4A7_ICTTR/44-133------VLEQFLTILPDDLQ--------------AWVREHRPMNGDEAVAVL-----------EDLERELDEP-------
F6YR66_ORNAN/30-119------VLEQFLTILPGDLR--------------IWVQDQRPKSGEEAVGLV-----------EDLQREPGRP-------
H9GUM9_ANOCA/2-89------VLEQFLAILPPEIE--------------AWVKECGLETCSQAVALA-----------EDFLQKQRES-------
R4G933_ANOCA/10-94------ILEQFLTVLPREMQ--------------NWVMEQSPENCSQAVGMA-----------EDFLQRLEEP-------
H9H9L0_MONDO/62-150------VLEQFLSILPVEIR--------------TWVREQAPQSAEEVVGLV-----------EGLQRNPAR.-------
F7ASR7_MONDO/32-121------VLEQFLTILPGEIQ--------------VQVREHRPENGEEAVALV-----------EDLQKETERP-------
G3TIY7_LOXAF/26-115------VLEQFLTILPSEIE--------------TWVREHCPENRERVVALI-----------EDLQRELEIP-------
F6Y0L2_XENTR/70-156------VKDQFLHICPAEVR--------------QFVVDREPKTAAKAAEIA-----------DTYAAS....-------
H9GAD1_ANOCA/1-89------VVEQFLNILPEEIQ--------------TLVRECQPENGKEAVALA-----------ERFQLHFESK-------
G1PXN5_MYOLU/45-134------VLEQFLNILPRDTQ--------------TQIKKHHLQSIEEAMALV-----------DHLQSESGQT-------
G3TBI6_LOXAF/35-121------VLEQFLGVLPLEIQ--------------AWVREQLPGSPEEAVALV-----------EELQHDP...-------
F6WAX4_ORNAN/41-129------VLEQFLTVLPADIQ--------------AWVRERRPESGEEAVALV-----------EGLQREPER.-------
I3MGL2_ICTTR/48-137------VLEQFLAILPKELQ--------------AWVHLHPPENGEEAVTLL-----------EDVEKEVHQQ-------
H0WSH9_OTOGA/159-248------VLEQFLGALPGKLR--------------TWVESQHPKDYEEVAALV-----------EDATWISEEE-------
G1LLI4_AILME/74-163------VLEQFLCALPPEIQ--------------AHVEGQRPGNPEEAAALV-----------EGLRQEPGGP-------
V8NJC1_OPHHA/264-353------ILEQFLVILPQEMQ--------------DWIRERGPETCDRAVALA-----------EEYLQEQQET-------
F6SSW6_ORNAN/43-130------VLEQFLLVLPEEIQ--------------AWVRLHRPESGEEAVAVV-----------EEMQGEQNEP-------
G1TSA0_RABIT/45-132------VLEQFLTILPVEMQ--------------SEMQQQRPQSIEEAVALL-----------EHLQRESG..-------
F6XAN0_ORNAN/49-138------VLEQFLTVLPGDIQ--------------SQVREQCPRSGEEAVAMV-----------EDLRKQPGTP-------
F6W347_ORNAN/14-103------VLEQFLTVLPGKIQ--------------TWVKDRHLESGEEAVALV-----------QGLEGKPGKP-------
G1TS83_RABIT/90-179------VLEQFLGTLPPEIQ--------------AWVGAQCPTSGEEAAVLV-----------EDLTQVLEKR-------
G1MMS7_AILME/45-133------VLEQFVTILPRDTQ--------------SRIRKDHLQSIEEAVALV-----------EHLQRESGP.-------
G3UAN3_LOXAF/20-109------VLEQFLAILPRELQ--------------TQIQKHHPQSIEEAVALV-----------QQFQGKSDQR-------
F6W9F0_MONDO/37-126------VLEQFLSILPEKLQ--------------TWVWDQRPKNSEEAVTLV-----------ETWQKEPKIP-------
M3W412_FELCA/46-135------VLEQFLTILPAELQ--------------AWVRGQHPESGDEVVVLL-----------EHLQRQLEAP-------
H0VRS4_CAVPO/48-137------VLEQFLAILPQELQ--------------ACVKKHQPENGEEAVTLL-----------EELEREADQP-------
G3WT79_SARHA/42-131------VLEQFLTVLPREIQ--------------SWVREQHPESGEEAVALV-----------ENLQREPGRS-------
F7GC31_MONDO/42-131------VLEQFLTVLPGELQ--------------SWVRGQRPESGEEAVTLV-----------EGLQKQPRRP-------
F6UNZ6_HORSE/48-137------VLEQFLAILPEELQ--------------AWLRDHRPEDGEEAVTML-----------EDLEKELDGP-------
H0VDV9_CAVPO/26-115------VLEQFLTVLPTEIE--------------SRVRTYGPENKEKLFALL-----------ERIQRERETS-------
I3N2G4_ICTTR/49-138------VLEQFLTILPRELQ--------------NWVRKQHPESGEEVVVLL-----------EYLEKHLDEP-------
G3U5G9_LOXAF/65-154------VLEQFLNILPEETQ--------------ARVREHSPENWQEAAAAV-----------QAFQRALDGT-------
G1KVJ6_ANOCA/17-104------VLEEFLDVLPVDMR--------------MWVRAREPSSSKEAAQLA-----------EAYFRECQ..-------
G1KVF1_ANOCA/42-130------ILEQFIAILPQEIQ--------------DRMKEHSPETCAQAVVLV-----------KEFLRTQHER-------
G3NE20_GASAC/93-183------VLEQFRNILPERVA--------------THIFEHKMKTAAEAAVVA-----------DDFALTHNQA-------
G3I2R2_CRIGR/52-140------VLEQFLSALPEKLR--------------VWVESHHPEDCQAAVALV-----------ENVTSVSKE.-------
M3X6Y2_FELCA/157-246------VLEQFLGALPRKLQ--------------RWVQSQHPEDCQEAVALV-----------EDVTWISEEE-------
I1F9F1_AMPQE/170-256------VLEQLLNTMPTELQ--------------VWIREKKLKTVEEAATQA-----------DDYLLAR...-------
ZN75C_HUMAN/47-134------VLEHFLTILPKGTQ--------------NWVQKHHPQLAKQALVLV-----------ERLQREPGGT-------
R4GBC4_ANOCA/51-139------LLEQFLAVLPPEME--------------SWVRECGPETSSQAVALA-----------EGFLLSQTEE-------
G1KX82_ANOCA/43-132------ILEQFLAILPSEME--------------RWVRECGAETSSQAVALA-----------EGFLLSQEDE-------
W5QB12_SHEEP/45-134------VLEQFLTILPQELQ--------------AWVRKHCPQSGEEAAAVV-----------QSLQRQPAGT-------
F6SMP8_ORNAN/6-94------VLEQFLTILPGEVG--------------AWVREQRPQSGDEVVVLL-----------EDLQRDPRR.-------
I3MZW9_ICTTR/49-138------VLEQFLAILPEELQ--------------AWMREQGPDNGEEAVTLL-----------EELEKELNES-------
V8NFE8_OPHHA/161-250------VLEQFLTILPPGMQ--------------SWVRAHGPETCTEAVLLA-----------EEFLSKWSSV-------
I3L4W6_HUMAN/33-121------VLEQFLTILPEEIQ--------------TWVREQHPENGEEAVALV-----------EDVQRAPGQ.-------
H3BQ35_HUMAN/41-130------VIEQFLTILPEKIQ--------------AWAQKQCPQSGEEAVALV-----------VHLEKETGRL-------
H0WAW4_CAVPO/28-117------VLEQFLAILPAELQ--------------AWVHAQHPESGDEVVTVL-----------EDLERELDEP-------
F6V0K5_CALJA/41-129------VLERFLTILPEELQ--------------ARVQGHHPDSGEDVVVVL-----------EDLQLDLGET-------
G3WJL4_SARHA/33-122------VLEQFLTILPSEIR--------------IWVKSQCPENIEEVVTLV-----------EDLTQILEEE-------
G1LV91_AILME/45-134------VLEQFLTILPEELR--------------ARLREQQPESGEQAVAVL-----------EGLERELGEA-------
F6WPG6_MONDO/42-131------VLEQFLNILPREIQ--------------SWVREHHPESGEEAVALV-----------EDWQINPRKP-------
R4GBY9_ANOCA/37-124------ILEQLLTILPPEME--------------CWVRECGAETSSQAVALA-----------EGFLLNRAE.-------
F7CMF2_ORNAN/38-125------VLEQFLTVLPREIQ--------------AWVREWRPESGEDAVTLV-----------EGLHRVLS..-------
G3WUB7_SARHA/49-138------LLEQFMNILPEKTK--------------TKVQKHSPTTIKEAVTLV-----------EDLQSTLIRK-------
G3VG61_SARHA/35-124------VLEQFITILPREIR--------------MWVQLHHPESGEEAVAMV-----------KDFQRHLDGP-------
K7DZ94_MONDO/30-119------VLEQLLTILPGDIR--------------TWVQLHHPVSGEEVVALV-----------KDIESHLDGW-------
F7B272_XENTR/169-255------ILDQFLCICPVEVQ--------------QFVLDREPKTVVQAAQLA-----------DAYTAN....-------
B7PBT9_IXOSC/107-198------GLEQLCKCMPETVR--------------FWVQDKVPETTQKAAELA-----------EEYLSRRGSQ-------
H2QEF7_PANTR/48-137------VLEQFLAILPKELQ--------------AWVQKHHPENGEETVTML-----------EDVERELDGP-------
F7AGA9_XENTR/198-285------IKDQFLHTCPVEVR--------------QFIMDREPKRADQAAEIA-----------DTYAANR...-------
G5E651_BOVIN/45-133------VLEQFLDVLPSHIQ--------------NWVQKYHPQNVKEAVALV-----------DRFHRECGG.-------
R4GAE0_ANOCA/42-131------VLEQFLAILPAEME--------------RWVRECGAQTSCQAVALA-----------EGFLLSEAEE-------
V8N700_OPHHA/304-393------ILEQFLASLPSDLQ--------------SWIRAGGAATCSQAVALV-----------EEFLRSQQEV-------
F7DJG4_MONDO/57-146------VLDQYVIILPREVM--------------TWVKSQPSEHSEEVEILL-----------EDLSQMFED.-------
G5C295_HETGA/48-137------VLEQFLAILPEELQ--------------AWVQRHRPENGEEAVTLL-----------EELEREVDQP-------
F7BJF5_ORNAN/43-131------VLEQFLAVLPADTG--------------ARVRTRRPESGEEAATLV-----------ENLQRELGGP-------
NRIF1_MOUSE/154-243------VLEQFLNALPEKFR--------------VWVESQHPEDCKAVVALL-----------ENMTSVSKDD-------
F7D2U8_ORNAN/46-134------VLEQFLTILPGEIQ--------------TWVRIHQPQSGEEAVTLV-----------EDLQSDLDGP-------
G1TNJ7_RABIT/46-135------VLERFLTNLPQKTQ--------------DWLQKHHLQNLKQAVTLA-----------QYFHREPAET-------
F6UZ44_CANLF/53-142------VLEQFLTILPEELR--------------GWVREQHPESGDEAVVLL-----------EYLQRQLDER-------
G1TAR6_RABIT/48-137------VLQQFLAILPEELQ--------------AWVRAHQPANGEEAVTVL-----------EDVQREFGRQ-------
L7N032_ANOCA/16-105------LLEQFLAVLPAEME--------------RWVRECGAETSSQAVALA-----------EGFLLSQEEE-------
M3X7M7_FELCA/47-136------VLEQFLTILPAELQ--------------ARVREHHPESGDEVVVVL-----------EDLQPELGDA-------
R4GAC2_ANOCA/42-131------VLEQFLTLLPSKMS--------------SWVRECGAETCSQAVALA-----------EGFLLSKEAE-------
G3VST8_SARHA/49-138------VLEQFLSILPEELQ--------------SWVLNHHPETGEEAVSLL-----------EDLEKEFDES-------
G3TW89_LOXAF/39-128------VLEQFLAILPKELQ--------------VCAQVYHLESGEEVVTAL-----------ENLEAEHGDM-------
I3KYH8_ORENI/68-154------ILEQYLRMLSPELQ--------------IWIKERNPNSAAAAAELA-----------DVFVAAR...-------
R4GD13_ANOCA/162-247------ILEQFLAVLPSEMK--------------SWVRECSPQTCTQAVILA-----------EDFLLRQQEN-------
F6RYD6_ORNAN/53-142------VLDQFLAILPADTG--------------ARVRIRRPRSGDQAVEMV-----------EGLQRETDGR-------
H0UX96_CAVPO/48-137------VLEQFLTILPKDLQ--------------ALIKDHQLENGEEVVTLL-----------EDLERQIDVL-------
G3QSE2_GORGO/47-136------VLEQFLTILPREVQ--------------TWVQARHPESGEEAVALV-----------EDWHRETRTA-------
M3WU60_FELCA/44-133------VLEQFLGALPPKIQ--------------SWVGAQFPKSGEEAAMLV-----------EGLTRSLDKT-------
F6YIP0_ORNAN/43-130------VLEQFLTILPGDIQ--------------PKMVELRQESSKEAVTLE-----------EELRSQLE..-------
G3TCK1_LOXAF/49-138------VLEQFLTILPGALQ--------------SWVQEQHPESGEEVVVLL-----------EYLERQLDEP-------
M3VUC4_FELCA/48-137------VLEQFLTVLPAELQ--------------AWVRGQHPESGDEVVTAL-----------EGLEREFSEP-------
H0XWT5_OTOGA/45-134------VLEQFLTTLPKETQ--------------HWVQKHHPQDIKQAVILV-----------ECLQRKPAGT-------
G5BW12_HETGA/28-117------VLEQFLTILPTEIE--------------SRVSAYGPESREKLFALI-----------EHLQRERETT-------
G3WXR5_SARHA/42-131------VLEQFLTVLPGGIQ--------------GWVRDRCPMSGEEAVAMV-----------ENLQKHPRNP-------
R4GCL4_ANOCA/42-131------ILEQFLAVLPVEIK--------------NWVKQFGPETSSQAVSLA-----------ESFLLDQAED-------
G3UEV4_LOXAF/45-134------VIEQFLTILPRETQ--------------TQMQKHHPQSIKEAVALI-----------EYLQREPESG-------
H9GH51_ANOCA/43-132------ILEQFLTILPDEMQ--------------SWVWECRPETCAQAVALA-----------EEFARKQQES-------
F6S3Z6_MONDO/43-132------VLEQFLAILPKEIQ--------------AWAWKQCPESGEEAVALI-----------ADLEGEPGRL-------
G3U4S2_LOXAF/38-127------MLEQFLTILPGEIQ--------------TWVRKQCPGSGEEAVTLV-----------ESLKGDPRRL-------
D3ZV88_RAT/24-110------VLEQFLSALPADTQ--------------AWVCSRRPQSGEEAVALL-----------EELWGPATSP-------
G7P3S1_MACFA/45-134------VLEQFLTILPGDLQ--------------AWVHEHYPESGEEAVTIV-----------EDLERGTDKA-------
M3ZCB0_NOMLE/38-127------VLEQFLAILPREIQ--------------SWVRAQEPESGEQAVAAV-----------EALEREPGRP-------
L7MZT4_ANOCA/1-86------ILEQFLAILPQEME--------------SWVRESGAETSSQAVALA-----------EGFLLSQAEE-------
H9GV33_ANOCA/8-97------IMEQFLAILPPEIT--------------AWIKECSPETCSQAVALA-----------EDFLQKQCEQ-------
G1LHZ3_AILME/27-115------VLEQFLTILPEEFQ--------------TWVREHHPESGEEAVAVV-----------ENIQRELEER-------
H2U7H2_TAKRU/66-153------LLEQFKFTLPERIA--------------TFLAEHKVKSASEAAVLA-----------DEYALTH...-------
F6WQ39_XENTR/45-132------VMEQFIKILPEDIS--------------SWVQKHRPNKAEKAISLA-----------EDYLLAKK..-------
G3TLL9_LOXAF/40-125------VLEQFMISMPLDLQ--------------VLVKESGVENCKD....L-----------EEMQRNNKRP-------
F7GAH0_ORNAN/86-175------VLEQFLTVLPADIQ--------------TWVREQNPESGEEAVTLV-----------EDLEREPKKL-------
G3VPU7_SARHA/40-129------VLEQFLTILPQELQ--------------ASVKKRLPQNRAEVITLL-----------EELEQQSNKP-------
I3L473_HUMAN/41-130------VLEQFLTVLPGEIQ--------------GWVREQHPGSGEEAVALV-----------EDLQKQPVKA-------
F7DRA3_ORNAN/39-127------VLEQFLTVLPGEIQ--------------AWVRIHRPEMDSRAVWAV-----------EGAQFTDRR.-------
I3LR01_PIG/48-137------VLEQFLAMLPAELQ--------------TWFQENRPGSGEEAVVML-----------EELEKEHDGA-------
H9GSX1_ANOCA/14-103------TLEQFLSILPPEMG--------------SWVRECGAETCSQAVALA-----------EGFLLSRAED-------
H9GSL2_ANOCA/38-127------VLEQFLMVLPPEIQ--------------NWVRERGPETCAQAVALA-----------EDFLWMQRES-------
G1PWN5_MYOLU/38-126------VLEQFLTILPREFY--------------AWIREHGPESGKALVAMV-----------EDFTERALE.-------
H9GBZ5_ANOCA/14-103------ILEQFLTILPQEIQ--------------SWVWERGPETCAQAVALV-----------EGYQMGRREA-------
G3T3H6_LOXAF/42-131------VLEQFLGVLPEKVQ--------------PWVVAQCPESCKEAASLV-----------EDLTRILGEP-------
F7G0P1_MONDO/42-131------VLEQFLNILPEELQ--------------TWVWDHRPVNGEEAVTVL-----------EDLERELDDS-------
F7DVV8_MONDO/1-89------VLEQFLTILPEDIR--------------IWVKAQHPTNSKEVVNLV-----------EDLTQTLEER-------
H9GH43_ANOCA/38-124------ILEQFLTVLPEEIQ--------------NRVRERGPETCAQAVALA-----------EGFLLRQ...-------
H0V5E8_CAVPO/42-128------AMEQFMLSGRCRDK--------------SILKKKWESSGKNLEKLL-----------EDLTDDCMKP-------
C9JHD9_HUMAN/41-130------VLEQFLTILPQELQ--------------AWVQEHCPESAEEAVTLL-----------EDLERELDEP-------
R4GD45_ANOCA/43-132------ILEQFLAVLPAEME--------------SWVKECEPETSSQAVALA-----------EGFLLSRAEE-------
G1NUW7_MYOLU/22-111------VLEQLLSILPAELQ--------------ALEQGHHPETGAQAVAVL-----------EELERELDEP-------
W4ZJX0_STRPU/154-245------LQEQVLDTGNRELL--------------MFIKERQPSSLQNLLILA-----------DQYRDAHSDP-------
F8WEU5_HUMAN/38-127------VLEQFLSILPGEIR--------------TWVQLHHPGSGEEAVALV-----------EELQKDLDGP-------
F6RNY0_ORNAN/26-115------VLERFLSGLTAHLQ--------------AWVRDRRPHSGDEAVALL-----------EAAQPESGRP-------
G3VFI6_SARHA/22-111------VLEQFLTILPGDLR--------------TWVLLHHPENGKEAVALV-----------KDLESHFSDQ-------
M3XD21_FELCA/41-130------VLEQFLSILPQELQ--------------AWVRKHCPQSGEKAAAVV-----------RAFQRALDGA-------
E1BIL7_BOVIN/52-140------VLEQFLSILPRELQ--------------AWLQEYRPDSGEEAVTLL-----------EDLELDLSG.-------
M0R034_HUMAN/22-109------VLEQFLGTLPPEIQ--------------AWVRGQRPGSPEEAAALV-----------EGLQHDPG..-------
G1L8Y8_AILME/37-126------VLEQFLSILPRDLQ--------------AWVQAHHPKTGEEAVTVL-----------EDLERELDEP-------
F7HCM9_CALJA/29-118------VLEQFLGILPDKVR--------------PWVVAQYPESCKKAASLV-----------EGLADVLDEP-------
U3KLY8_RABIT/48-137------VLEQFVAILPKELQ--------------TWVREHHPENGEEAVAVL-----------EDLESELDDP-------
H9GQZ7_ANOCA/21-110------VLEQFLTILPPEME--------------SWVRECGAETSSQAVAIA-----------EGFLLSQMEE-------
F7HNX5_MACMU/34-123------VLEQFLGALPSKMR--------------TWVQSQGPRSCREAASLV-----------EDLTQMCQQE-------
G3T2M0_LOXAF/44-133------VLEQFLTILPEEVR--------------TWVKLQHPKSSEEVVTHL-----------EDVIEMLKDE-------
F1Q4K9_CANLF/34-123------VLEQFLTILPKELQ--------------AWVWEQHPESGEEAVAVL-----------EDLEKELDEP-------
G3VRM3_SARHA/42-131------VLEQFLTILPEELR--------------TWVQERQPRNGEEAVTVL-----------EDLEKELDEP-------
M3XQ98_MUSPF/48-137------VLEQFLTILPEELQ--------------AWVREQQPESGEQAVAAL-----------EDLERELDEP-------
F7CWS8_MACMU/50-139------VLEQFLSILPGELR--------------TWVQLHHPESGEEAVAVV-----------EDFQRHLSGP-------
W5Q908_SHEEP/40-130------VLEQFLTILPEELQ--------------ARVQACSLESGEDALIAL-----------ESLERDAGDS-------
F7EE73_MONDO/48-136------VLEQFWAILPGEIR--------------TWVKSHHPKNGEEVVNLI-----------EDLTQMLKEE-------
R4G9I2_ANOCA/181-270------ILEQFLTILPLEMQ--------------IWVCENGPATCAQALSLA-----------ESFLLRLQEA-------
G3VJ81_SARHA/45-134------VLEQFLAILPGQLQ--------------AWVREHHPESGEEAVILL-----------EELQRDFDEQ-------
G3T0U2_LOXAF/108-196------VLEQFLGALPRKLR--------------TWVESQHPADCQEAAALV-----------EVVTWISTE.-------
G5BSG8_HETGA/44-133------VLEQFLAVLPEELQ--------------AWLRTQHPGSGEEAAALL-----------EFLEEQLEEL-------
H9GR70_ANOCA/38-127------VLEQLLTILPREMQ--------------RWVREHGPETCAQAVALA-----------EEFQLRQQED-------
I3MS02_ICTTR/44-133------VLEQFLTILPREMQ--------------AWMQKHHPQSVEEAVDLV-----------EHLQRESGQR-------
V8N853_OPHHA/232-321------ILEQFLSILPVEMQ--------------IWVRKRKPGSCTQAVALA-----------EDFLSKQKEA-------
H2NPG6_PONAB/41-130------VLEQFPTVIPQEIQ--------------IWVRQQHPESEEEAVALV-----------EDLQKEPGRQ-------
H9GJF9_ANOCA/5-94------VLEQFLAVLPADIE--------------NWVRECGAETCSQAVALA-----------EGFLLSRAEE-------
H9GQ87_ANOCA/44-131------ILEQLLTILPPQIQ--------------NWVRERGPETCSQAVALA-----------EDFLSKKE..-------
H0XXX1_OTOGA/27-116------VLEQFLTILPEELQ--------------SWVREHCPESGEEAIAAV-----------RALQRALDGT-------
G1KI12_ANOCA/155-244------ILEQFLAVLPPEMQ--------------SWVREQSPDTCTRAVTLA-----------ERFLQDSEEP-------
Q149X8_MOUSE/44-133------VLEQFMTILPMELK--------------AWVQEHRPRSGEEAVTLL-----------EELEREFDEP-------
G1Q2R9_MYOLU/13-101------VLEQFLSTLPQEVQ--------------TWVRSRRPRNSKEAGILV-----------ANLLQACEEE-------
ZSCA4_HUMAN/40-129------VLEQFMIGGHCNDK--------------ASVKEKWKSSGKNLERFI-----------EDLTDDSINP-------
R4G9R4_ANOCA/42-131------VFEQFLALLPPEMS--------------SWVRECGAETSSQAVALA-----------EGFLLSQAEK-------
G3VQ12_SARHA/48-135------VLEQFLTNLPGDIK--------------IWEKSQHPTNSKEEVSLV-----------EELIQTEE..-------
M3WTJ0_FELCA/57-144------VLEQFLTILPRSTQ--------------SWVQKYHPQSIKEAVALV-----------ERFQRERG..-------
G3VJ10_SARHA/49-136------VLEQFLSILPGELQ--------------TLVQEHHLESGEEVVTVL-----------EDLERHIN..-------
R4G9Q5_ANOCA/42-129------VLEQFLSILPSEMG--------------SWVRECGAESSSQAVSLA-----------EYFLLSRA..-------
F6XAP1_ORNAN/37-126------VLEQFLTVLPREIQ--------------NWVRERHPESGEEAVAMV-----------EDLQRDPRRL-------
H0WCZ6_CAVPO/44-133------VLEQFLAILPEELR--------------TWVNLHHLKNSKDVVTFI-----------EDVTEMLKNK-------
L5M495_MYODS/26-115------TLEQYLTIMPQELE--------------TWVTEQCPESTERILSLL-----------EEIQMKPETI-------
ZSC12_MOUSE/42-130------VLEQFLTILPGELQ--------------AWVQEQNPESVEEVVTVL-----------EDLERELDE.-------
D3YTV4_MOUSE/47-136------VLEQFLTILPGELQ--------------AWVREQHPDSGEEVVALL-----------EYLDRQLDDT-------
G3T1H1_LOXAF/56-145------VLEQFLAILPEELK--------------AWVRDHRPESGEEAVTML-----------EELEKELDEP-------
Q5VZN3_HUMAN/48-137------VFEQFLTILPGEIR--------------IWVKSQHPESSEEVVTLI-----------EDLTQMLEEK-------
G1KYL1_ANOCA/24-110------ILEQFLAILPSEIQ--------------SWVKRGCPRTCDRAVALA-----------EDFLLRR...-------
R4GDC0_ANOCA/42-131------VLEQFLAILPAEME--------------RWVRECGAESSSQAVALA-----------EGFLLSQAEE-------
K7ERU5_HUMAN/46-135------VLEQFLSILPEELQ--------------IWVQQHNPESGEEAVTLL-----------EDLEREFDDP-------
F7CA80_HORSE/48-137------VLEQFLSILPKELQ--------------GWVREHCPESGEEAVTLL-----------EDLERELDEP-------
G1SFD0_RABIT/152-241------VLEQFLGALPGKLR--------------TWVELQHPKDCQEVVALL-----------GDVTWRANEE-------
G1LLD5_AILME/49-138------VLEQFLSVLPDKVR--------------PWVVAQHPESCKKAASLV-----------KDLTKALEEP-------
G3VRL4_SARHA/50-139------VLEQFLTILPEDLQ--------------SWVRDQHPESGEEVVTVL-----------EDLERELLDP-------
G1KZ70_ANOCA/2-90------ILEQFLAVLPFEIQ--------------NWIREGGPETCAQAVVLV-----------EDFLTSQREA-------
R4GC39_ANOCA/169-256------VLEQFLVILPREIQ--------------SQVQARGPETCAQAVALA-----------EDFLLRQP..-------
F7F1F8_MONDO/44-133------VLEQFLIVLPGDIQ--------------AWVRGKHPKNGDEVVTLM-----------EDLQREPSKA-------
G3VIH3_SARHA/43-132------VLEQFLTILPGDIQ--------------ARVREQHPESGEEAVTLV-----------EELQKEHERC-------
I3L7Q0_PIG/51-140------VLEQFLTILPEGLR--------------AQVLGYHPRSGEEVVTML-----------ENLETELGDK-------
G5CAU3_HETGA/39-126------VLEQFLSTLPEEIQ--------------KWVRSKQPENSSEAGMLV-----------ANLIQACEDP-------
G1KI06_ANOCA/1-88------ILEQFLAILPPEIQ--------------GSVKERAPETCAQAVSLA-----------EEFLMRQEE.-------
H9GU03_ANOCA/63-152------VLEQFLAILPPEME--------------DWLRDCRPETPCQAVALA-----------EGFLMSQAEK-------
I3N7T3_ICTTR/40-129------VLEQFMINGNCRDR--------------SILKEKWESSGRNLEKLM-----------EDLTDDCMEP-------
G1LE31_AILME/40-129------VLEQFMINGHCSDR--------------SMLKEKWNASGRNLEKFM-----------EDLTDESMKP-------
G1P3T9_MYOLU/44-130------VLEQFLTILPEEVR--------------TWVNLHHPKNSKEVVTLI-----------EDVIEDK...-------
F6XAK9_ORNAN/44-132------VLEQFLTILPGDIQ--------------AWVQEQHPKSGEEAVTLV-----------ENLQREPGR.-------
I3KYJ5_ORENI/220-308------VLEQFLRMLCPELQ--------------VWIKEHNPKSAAEAATLA-----------DVFVAARSKS-------
M3X1N7_FELCA/40-128------VLEQFLTVLPAELQ--------------AWVREHHPESGDEVVTAL-----------EDLEKDTGQ.-------

PF02093

F8S319_PIG/212-422---
M3X1Y6_FELCA/234-443---
M3XFF7_FELCA/213-416---
GAG_XMRV6/224-431---

PF00607

GAK10_HUMAN/312-526MLM
GAG_HV1H2/149-363RVL
GAG_MMTVC/290-495MA.
GAG_HTL1C/147-344KVL
GAG_HV2BE/151-365RLM
W5PXQ0_SHEEP/276-481IAM

PF02023

I3NI39_HUMAN/37-126---
C9JIC2_HUMAN/35-124---
G3R3C9_GORGO/38-127---
F7CQI3_MONDO/39-128---
F7C2C9_ORNAN/27-115---
G1KZD9_ANOCA/101-189---
H0VL73_CAVPO/49-136---
H9GV16_ANOCA/138-227---
H9G8P1_ANOCA/15-104---
F6UXF4_ORNAN/1-89---
W5Q925_SHEEP/49-138---
G1KVW6_ANOCA/25-114---
G3VM18_SARHA/57-147---
F6T5P3_HORSE/44-133---
F7F5Q8_MONDO/48-137---
G3VZJ2_SARHA/42-131---
G3UC70_LOXAF/35-118---
H0VNG3_CAVPO/40-126---
H9GSG5_ANOCA/42-131---
H0XP10_OTOGA/40-129---
G1PWN2_MYOLU/59-145---
ZN394_RAT/40-129---
I3N8X2_ICTTR/40-129---
G1LE29_AILME/38-126---
D3ZF35_RAT/41-130---
F7C8L0_HORSE/32-121---
F7BWC6_ORNAN/36-125---
G3HPX2_CRIGR/38-127---
G3WFW4_SARHA/48-137---
T1HQU6_RHOPR/202-290---
I3MUC8_ICTTR/37-126---
M3W6W2_FELCA/42-129---
R4GAL9_ANOCA/89-178---
H3BUW4_HUMAN/14-103---
F7BUI2_ORNAN/30-119---
G3U9B4_LOXAF/34-122---
W5P1J3_SHEEP/40-129---
H9GQN3_ANOCA/39-128---
G3VGJ9_SARHA/47-136---
M3YUS0_MUSPF/40-127---
G3WVV5_SARHA/39-127---
G3MZ79_BOVIN/39-127---
M3XQF3_MUSPF/46-135---
G1SPH0_RABIT/47-136---
R4G9E0_ANOCA/43-131---
H0W9S1_CAVPO/45-132---
F7DUP4_HORSE/38-126---
G1TCI0_RABIT/47-136---
H0WAL0_CAVPO/44-133---
R4GBT3_ANOCA/134-222---
G1PAE7_MYOLU/42-128---
G1KVY9_ANOCA/39-128---
F7GXN1_CALJA/157-246---
I1FKS6_AMPQE/169-256---
W4XI34_STRPU/152-240---
H9GSL7_ANOCA/45-131---
F6UYM9_CANLF/51-140---
I1FFW7_AMPQE/50-138---
I3M4A7_ICTTR/44-133---
F6YR66_ORNAN/30-119---
H9GUM9_ANOCA/2-89---
R4G933_ANOCA/10-94---
H9H9L0_MONDO/62-150---
F7ASR7_MONDO/32-121---
G3TIY7_LOXAF/26-115---
F6Y0L2_XENTR/70-156---
H9GAD1_ANOCA/1-89---
G1PXN5_MYOLU/45-134---
G3TBI6_LOXAF/35-121---
F6WAX4_ORNAN/41-129---
I3MGL2_ICTTR/48-137---
H0WSH9_OTOGA/159-248---
G1LLI4_AILME/74-163---
V8NJC1_OPHHA/264-353---
F6SSW6_ORNAN/43-130---
G1TSA0_RABIT/45-132---
F6XAN0_ORNAN/49-138---
F6W347_ORNAN/14-103---
G1TS83_RABIT/90-179---
G1MMS7_AILME/45-133---
G3UAN3_LOXAF/20-109---
F6W9F0_MONDO/37-126---
M3W412_FELCA/46-135---
H0VRS4_CAVPO/48-137---
G3WT79_SARHA/42-131---
F7GC31_MONDO/42-131---
F6UNZ6_HORSE/48-137---
H0VDV9_CAVPO/26-115---
I3N2G4_ICTTR/49-138---
G3U5G9_LOXAF/65-154---
G1KVJ6_ANOCA/17-104---
G1KVF1_ANOCA/42-130---
G3NE20_GASAC/93-183---
G3I2R2_CRIGR/52-140---
M3X6Y2_FELCA/157-246---
I1F9F1_AMPQE/170-256---
ZN75C_HUMAN/47-134---
R4GBC4_ANOCA/51-139---
G1KX82_ANOCA/43-132---
W5QB12_SHEEP/45-134---
F6SMP8_ORNAN/6-94---
I3MZW9_ICTTR/49-138---
V8NFE8_OPHHA/161-250---
I3L4W6_HUMAN/33-121---
H3BQ35_HUMAN/41-130---
H0WAW4_CAVPO/28-117---
F6V0K5_CALJA/41-129---
G3WJL4_SARHA/33-122---
G1LV91_AILME/45-134---
F6WPG6_MONDO/42-131---
R4GBY9_ANOCA/37-124---
F7CMF2_ORNAN/38-125---
G3WUB7_SARHA/49-138---
G3VG61_SARHA/35-124---
K7DZ94_MONDO/30-119---
F7B272_XENTR/169-255---
B7PBT9_IXOSC/107-198---
H2QEF7_PANTR/48-137---
F7AGA9_XENTR/198-285---
G5E651_BOVIN/45-133---
R4GAE0_ANOCA/42-131---
V8N700_OPHHA/304-393---
F7DJG4_MONDO/57-146---
G5C295_HETGA/48-137---
F7BJF5_ORNAN/43-131---
NRIF1_MOUSE/154-243---
F7D2U8_ORNAN/46-134---
G1TNJ7_RABIT/46-135---
F6UZ44_CANLF/53-142---
G1TAR6_RABIT/48-137---
L7N032_ANOCA/16-105---
M3X7M7_FELCA/47-136---
R4GAC2_ANOCA/42-131---
G3VST8_SARHA/49-138---
G3TW89_LOXAF/39-128---
I3KYH8_ORENI/68-154---
R4GD13_ANOCA/162-247---
F6RYD6_ORNAN/53-142---
H0UX96_CAVPO/48-137---
G3QSE2_GORGO/47-136---
M3WU60_FELCA/44-133---
F6YIP0_ORNAN/43-130---
G3TCK1_LOXAF/49-138---
M3VUC4_FELCA/48-137---
H0XWT5_OTOGA/45-134---
G5BW12_HETGA/28-117---
G3WXR5_SARHA/42-131---
R4GCL4_ANOCA/42-131---
G3UEV4_LOXAF/45-134---
H9GH51_ANOCA/43-132---
F6S3Z6_MONDO/43-132---
G3U4S2_LOXAF/38-127---
D3ZV88_RAT/24-110---
G7P3S1_MACFA/45-134---
M3ZCB0_NOMLE/38-127---
L7MZT4_ANOCA/1-86---
H9GV33_ANOCA/8-97---
G1LHZ3_AILME/27-115---
H2U7H2_TAKRU/66-153---
F6WQ39_XENTR/45-132---
G3TLL9_LOXAF/40-125---
F7GAH0_ORNAN/86-175---
G3VPU7_SARHA/40-129---
I3L473_HUMAN/41-130---
F7DRA3_ORNAN/39-127---
I3LR01_PIG/48-137---
H9GSX1_ANOCA/14-103---
H9GSL2_ANOCA/38-127---
G1PWN5_MYOLU/38-126---
H9GBZ5_ANOCA/14-103---
G3T3H6_LOXAF/42-131---
F7G0P1_MONDO/42-131---
F7DVV8_MONDO/1-89---
H9GH43_ANOCA/38-124---
H0V5E8_CAVPO/42-128---
C9JHD9_HUMAN/41-130---
R4GD45_ANOCA/43-132---
G1NUW7_MYOLU/22-111---
W4ZJX0_STRPU/154-245---
F8WEU5_HUMAN/38-127---
F6RNY0_ORNAN/26-115---
G3VFI6_SARHA/22-111---
M3XD21_FELCA/41-130---
E1BIL7_BOVIN/52-140---
M0R034_HUMAN/22-109---
G1L8Y8_AILME/37-126---
F7HCM9_CALJA/29-118---
U3KLY8_RABIT/48-137---
H9GQZ7_ANOCA/21-110---
F7HNX5_MACMU/34-123---
G3T2M0_LOXAF/44-133---
F1Q4K9_CANLF/34-123---
G3VRM3_SARHA/42-131---
M3XQ98_MUSPF/48-137---
F7CWS8_MACMU/50-139---
W5Q908_SHEEP/40-130---
F7EE73_MONDO/48-136---
R4G9I2_ANOCA/181-270---
G3VJ81_SARHA/45-134---
G3T0U2_LOXAF/108-196---
G5BSG8_HETGA/44-133---
H9GR70_ANOCA/38-127---
I3MS02_ICTTR/44-133---
V8N853_OPHHA/232-321---
H2NPG6_PONAB/41-130---
H9GJF9_ANOCA/5-94---
H9GQ87_ANOCA/44-131---
H0XXX1_OTOGA/27-116---
G1KI12_ANOCA/155-244---
Q149X8_MOUSE/44-133---
G1Q2R9_MYOLU/13-101---
ZSCA4_HUMAN/40-129---
R4G9R4_ANOCA/42-131---
G3VQ12_SARHA/48-135---
M3WTJ0_FELCA/57-144---
G3VJ10_SARHA/49-136---
R4G9Q5_ANOCA/42-129---
F6XAP1_ORNAN/37-126---
H0WCZ6_CAVPO/44-133---
L5M495_MYODS/26-115---
ZSC12_MOUSE/42-130---
D3YTV4_MOUSE/47-136---
G3T1H1_LOXAF/56-145---
Q5VZN3_HUMAN/48-137---
G1KYL1_ANOCA/24-110---
R4GDC0_ANOCA/42-131---
K7ERU5_HUMAN/46-135---
F7CA80_HORSE/48-137---
G1SFD0_RABIT/152-241---
G1LLD5_AILME/49-138---
G3VRL4_SARHA/50-139---
G1KZ70_ANOCA/2-90---
R4GC39_ANOCA/169-256---
F7F1F8_MONDO/44-133---
G3VIH3_SARHA/43-132---
I3L7Q0_PIG/51-140---
G5CAU3_HETGA/39-126---
G1KI06_ANOCA/1-88---
H9GU03_ANOCA/63-152---
I3N7T3_ICTTR/40-129---
G1LE31_AILME/40-129---
G1P3T9_MYOLU/44-130---
F6XAK9_ORNAN/44-132---
I3KYJ5_ORENI/220-308---
M3X1N7_FELCA/40-128---

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window