Sequence alignment for CL0149

PF00198

Q7PG41_ANOGA/236-467-----KQAETVVPLKGVAKAMVRSMT-DAL..KIPH--------------------------------------------
A4H464_LEIBR/234-468-----EPGDTILPIIGVRRGMVKAMT-QAA..SIPT--------------------------------------------
Q8IJJ4_PLAF7/416-640-----YGDPKTVDMTNIQKSIKNNMM-LTL..TVPV--------------------------------------------
B0K8I7_THEP3/156-382-----LEKVERMPMDNIRKTISQRMK-KSWS.EIPH--------------------------------------------
A9B180_HERA2/216-442-----NSVYTEEPLSRLRQTAAKRMV-ESQQ.QVPP--------------------------------------------
B9LC79_CHLSY/227-461-----QSGYRKLPLTGMRRTIARRLQ-RSAQ.EAPH--------------------------------------------
B8GAA3_CHLAD/150-362-----NGSVQMAPMSTEAVATLSQVV-TSD..RVPL--------------------------------------------
Q7MB23_PHOLL/166-382-----ENITTTEPIEVSKQAEIRILS-DAQN.GSLP--------------------------------------------
A5G2C9_ACICJ/193-425-----TAPHDAIPHSSMRKVIAKRLQ-AAKQ.TIPH--------------------------------------------
A7K5W2_VIBSE/398-631-----FGETEVQPLSRIKKISGANLH-RNWV.MIPH--------------------------------------------
A6QGW5_STAAE/188-420-----TKPVIREKMSRRKKTAAKKLL-EVSN.NTAM--------------------------------------------
Q8IEA6_PLAF7/189-419-----ERTERRVRMLPIRKRIAERLK-ESQN.TCAL--------------------------------------------
Q6C806_YARLI/226-463-----TAGSRLVPLTPTQMGMFKTMT-NSL..SIPH--------------------------------------------
A6Q9K5_SULNB/241-441-----LPE....PIDMPHKAMIAIVN-AAQ..KRPV--------------------------------------------
A4CCC7_9GAMM/276-508-----SNATRVEPIRGIKAAMAKQMM-ASVT.TIPH--------------------------------------------
A4IKZ7_GEOTN/204-435-----QEKVRRVPLTGIRKAITQAMV-RSTR.TIPQ--------------------------------------------
A5IXN4_MYCAP/10-243-----PLEEKEAPISGIRKAIAKNLK-EVLE.SSAY--------------------------------------------
Q05SD7_9SYNE/221-446-----GAPGDTVAFNTLQAAVNRNME-ASL..AVPC--------------------------------------------
Q2B858_9BACI/159-388-----AAHDSAISYSGRRKMTAEKMV-QSLS.LIPH--------------------------------------------
ODP2_MYCPN/169-401-----PSGEETIAITTMRKAIAEAMV-KSHE.NIPA--------------------------------------------
A6DTS5_9BACT/215-442-----SESLTDIPMTQMRQAIANRMV-QASA.GVPV--------------------------------------------
Q67RX4_SYMTH/33-262-----FPPVVTLPLSHIRRVSMLNLE-QAQR.TTAP--------------------------------------------
A0QDC1_MYCA1/158-386-----NGAEVR.PVQGVQARMADKMT-LSHK.EIPA--------------------------------------------
A3RZM1_RALSL/164-375-----LGPPEV..LRGVRRAMAQNMA-RAQS.EVAA--------------------------------------------
Q018W7_OSTTA/269-503-----FPDFEDVSVTAIKRVTAQRLT-ESKQ.QVPH--------------------------------------------
A0JUQ7_ARTS2/229-460-----GERETRTPIKGVRKLTAAAMV-SSAF.TAPH--------------------------------------------
Q9CJD7_LACLA/298-530-----GAGDRREAMNPTRKVVSKVMT-AQHT.HIPP--------------------------------------------
A0LSF1_ACIC1/217-449-----QPDVEEIPLNTIRKITARRLT-ESMQ.QAPH--------------------------------------------
Q253H7_CHLFF/159-388-----NANENRIPMSPLRRAIASSLS-KSSD.EVPH--------------------------------------------
KGD_MYCS2/97-344-----AKGDESQILRGAAAAVVKNMN-ASL..EVPT--------------------------------------------
A5GAC3_GEOUR/194-419-----VSAGAIQPLSRMRAAIARTVS-DAWQ.SIPH--------------------------------------------
Q55ZP3_CRYNB/357-619-----EQETTRVEFGRTRKVMFKALS-EQA..KIPH--------------------------------------------
Q1NYU2_9FLAO/144-371-----TISSNEVNHSNIRKIISKRLI-NSKI.ESPH--------------------------------------------
A2QTN3_ASPNC/236-469-----VQEETAVKLTPIQSQMFKNMT-NSL..SIPQ--------------------------------------------
Q59298_9CLOT/219-443-----KYTEKIVPMTQIRKIISARMH-ESWI.TSPT--------------------------------------------
Q9M724_ARATH/249-480-----NFEDKTVPLRGFSRAMVKTMT-MAT..SVPH--------------------------------------------
A0CLV5_PARTE/180-390-----ESTSTVIKMSDFQKGMQKSMT-EAN..SIPH--------------------------------------------
A4FGQ0_SACEN/225-452-----PEDSTRIPLRGLRRAVADKLT-RSRR.EIPE--------------------------------------------
Q6MPR6_BDEBA/309-540-----GAAEERVPMIGIRKKIAENMQ-RSKH.VIPH--------------------------------------------
A1SQ65_NOCSJ/201-427-----KVEPVDVPHSRLRRAVANRLA-ESKQ.TAPH--------------------------------------------
Q6AFG4_LEIXX/233-470-----PLRGTTQPMSRLRKVVAERAV-VSMQ.STAQ--------------------------------------------
A6U1Y7_STAA2/191-418-----NSENSTIPVNGVRKAIAQNMV-NSVT.EIPH--------------------------------------------
A5GEF2_GEOUR/180-403-----PPDYQA....GMRRAIAAAMS-RSNR.EIPH--------------------------------------------
A5V538_SPHWW/170-392-----APRGR.....DLRALIAARVT-RSKA.EIPH--------------------------------------------
Q03DD0_PEDPA/195-427-----VKAG.RVPLSPVRKVIAKTLT-NQVQ.TIPH--------------------------------------------
Q0RVL0_RHOSR/192-421-----PNHEQGKPLSAMRRTIADRMQ-QSLQ.TTAQ--------------------------------------------
Q5P9L2_ANAMM/204-433-----AAGGDVVEVSSMRRVIADRLL-ESKL.TVPH--------------------------------------------
Q5UWH1_HALMA/304-539-----ARPESRKPYKGIRQTIGAAMT-SSKY.TAPH--------------------------------------------
Q1Q664_9BACT/170-401-----AERETLIPLHPKRKITAERMA-LSRQ.TAAL--------------------------------------------
Q6MTX8_MYCMS/197-428-----PLSWDEVPMNGVRKATVKAMT-KSHT.EIAA--------------------------------------------
Q820B9_TROW8/211-440-----EEATTRVPVKGLRRQTAQNVT-LSAF.SVPH--------------------------------------------
A7NKS9_ROSCS/223-453-----APLAAVVPLSNMRKTIARRML-QSWQ.QFPH--------------------------------------------
A6U0R3_STAA2/197-428-----DFPETTEKIPAMRRAIAKAMV-NSKH.TAPH--------------------------------------------
ODO2_BUCAI/188-418-----NKVTNRVKMTRLRQRIAERLL-DSKN.NTAM--------------------------------------------
Q2NJY8_AYWBP/185-416-----SQETEVVKISRLRKAIAQKMV-LSKG.KIPE--------------------------------------------
A4XEQ9_NOVAD/253-480-----ANQPQVQPFDKVRKVVARRLT-EAKQ.TIPH--------------------------------------------
Q5SLR1_THET8/217-449-----EHLEERVPLRGIRRTIAQGLW-QSHL.YTVR--------------------------------------------
Q5DM38_NYCOV/252-485-----MPEFTDIELTNYKRVTAERLT-EAKQ.TVPH--------------------------------------------
Q5F3G9_CHICK/271-501-----PGTFTEIPASNIRRVIAKRLT-ESKT.TIPH--------------------------------------------
A4F1Y4_STRVG/208-431-----GHDFTDRPVSRRQKELNRALR-SGTGDVVPA--------------------------------------------
A4ICH2_LEIIN/226-463-----NPNFIDIPVTTMRSVIAKRLH-QSKNLEIPH--------------------------------------------
Q9KG97_BACHD/180-411-----SSAEKRIPLKGIRKAIAEKMI-KSVA.TIPH--------------------------------------------
A0LLM2_SYNFM/206-441-----HGAIERVPLRSVRRATAKHLA-RAWA.EIPH--------------------------------------------
Q04KE8_STRP2/115-347-----YGKIERIPMTPMRKVIAQRMV-ESYL.TAPT--------------------------------------------
A7HBV2_ANADF/220-451-----GAADERVPLRGVRKRIAENMA-RSKR.TAAH--------------------------------------------
Q1IIF0_KORVE/320-555-----GTPGAIEPMSVMRKKIADHMV-MSKR.TSAH--------------------------------------------
A5JBE6_BURML/251-482-----RHDEEAVPVIGLRRKIAQRMQ-DAKR.RIPH--------------------------------------------
A5G5K2_GEOUR/156-387-----FGPVERLPLRGVRRTIARNLI-ASQR.NTAS--------------------------------------------
Q4XMM8_PLACH/203-444-----MDIMEEVQVKGIKLSMCKSMN-DSL..SIPL--------------------------------------------
Q8RD59_THETN/185-414-----IPSYRVIPFTGMRKIIAEKMQ-KSIN.TAPH--------------------------------------------
Q8CTW0_STAES/196-425-----SAIGE..GLNPMRQRIAQNMR-QSLN.STAQ--------------------------------------------
A4XHV3_CALS8/229-459-----ETEYEEAPLSNIRKTIAKAMY-LSLT.TTAQ--------------------------------------------
A6TMP1_ALKMQ/205-437-----SDKEERIKLSMLRKTIGKRMT-ESFY.TAPH--------------------------------------------
Q04RI4_LEPBJ/240-470-----KRQDRKLEITGMRKTIASRLA-HSTS.TIPH--------------------------------------------
A7SJI4_NEMVE/174-396-----PGTFTDVPNTEMRREIAKRLL-KSKT.TIPH--------------------------------------------
A1ZHD0_9BACT/218-453-----SGAHDVIEMDRMRKMIAQRMV-DSKR.ISPH--------------------------------------------
Q4DDM3_TRYCC/200-436-----EGDVVVSLLTGIRHVMVSTMT-EAG..KIPS--------------------------------------------
A7BC27_9ACTO/216-447-----PGASASAPLKGVRKVVAKRMM-ESLT.STAQ--------------------------------------------
O84249_CHLTR/201-428-----PGSYIEEPLSPVREVISKRLQ-AAKT.FIPH--------------------------------------------
Q6KH63_MYCMO/220-452-----ANELKREKVTPIRKAIAKAMK-NSWS.NVAY--------------------------------------------
Q5DAR0_SCHJA/35-267-----GAAFTDVALSNMRKVIAQRLS-ELKL.CIPH--------------------------------------------
Q87IG1_VIBPA/172-383-----PGTEV...LKGARRTMVSTMA-ESHQ.NVAA--------------------------------------------
Q6A613_PROAC/233-468-----DGHTRKVPVRGVRKVTAKAVK-DSLD.TKAL--------------------------------------------
Q2PY29_9BACT/192-418-----SSGYLDTPVSQMRKVIASRLG-ESKF.SAPH--------------------------------------------
ODP2_SCHPO/252-483-----PGDYEDLPLSNMRKIIASRLA-ESKN.MNPH--------------------------------------------
O45279_CAEEL/97-322-----LRHHQDIPLSNIRATIAKRLT-ASKQ.QIPH--------------------------------------------
Q97CK2_THEVO/179-398-----PGREEILEMHGLRRIIFDKMT-KAKQ.IMPH--------------------------------------------
A0NRH8_9RHOB/70-301-----YGPVTEEPVSRFAQVAAQNMA-AAHR.LIPA--------------------------------------------
Q3A0D1_PELCD/165-395-----ERLSHREPLSPLRQTVARRLL-AARQ.QTAM--------------------------------------------
Q1IX53_DEIGD/361-594-----WGPVRREDMSGIRKATVRSMT-QSWT.TIPM--------------------------------------------
Q7WED2_BORBR/182-409-----AAGEQRIEASALVQSMARRMT-QAK..QVPH--------------------------------------------
Q3J9C7_NITOC/185-392-----PGAGR..PMDSMEKAIAHNME-YSL..SMPL--------------------------------------------
Q0W153_UNCMA/195-425-----AGLEERIPLRGIRRTISDNLM-RSLQ.HTAQ--------------------------------------------
Q7UU97_RHOBA/235-467-----YGPIRVERMSKIRKTISAQMH-LSWS.TVPR--------------------------------------------
Q81CI7_BACCR/169-399-----QEESNVIPVTGMRKAIANRMH-ASLQ.NSAQ--------------------------------------------
ODP2_BUCBP/176-410-----CDDFKSIELTRTQIRSSKNLL-KSWL.TIPH--------------------------------------------
ODP2_YEAST/248-482-----TASYEDVPISTMRSIIGERLL-QSTQ.GIPS--------------------------------------------
Q8RBW8_THETN/173-398-----NLTARRVPLTPTQRLVGSRML-QSLR.ETAQ--------------------------------------------
Q4P9L5_USTMA/1242-1493-----AGTTEIVDLTPVQRAMFKAMT-ATL..STPH--------------------------------------------
A8FC90_BACP2/211-441-----ASPVKTQKLAGMRKVIADRMS-QSAF.TAPH--------------------------------------------

PF00302

CAT3_ECOLX/1-205-----MNYTKFDVKNWVRREHFEFYR-HRLP---CG--------------------------------------------
CAT_PROMI/6-209-----VGILVVDLSQWGRKEHFEAFQ-SFAQ---CT--------------------------------------------
CAT2_CLOPF/1-202-----MVFEKIDKNSWNRKEYFDHYF-ASVP---CT--------------------------------------------
CAT_CLOBU/1-206-----MNFNLIDINHWSRKPYFEHYL-NNVK---CT--------------------------------------------
CAT1_STAAU/1-205-----MNFNKIDLDNWKRKEIFNHYL-N.QQ---TT--------------------------------------------
CAT_SALTI/6-209-----TGYTTVDISQWHRKEHFEAFQ-SVAQ---CT--------------------------------------------
CAT_STRAC/6-211-----PTPAPIDLDTWPRRQHFDHYR-RRVP---CT--------------------------------------------
CAT2_ECOLX/1-205-----MNFTRIDLNTWNRREHFALYR-QQIK---CG--------------------------------------------
CAT2_STAAU/1-205-----MTFNIIKLENWDRKEYFEHYF-N.QQ---TT--------------------------------------------
CAT_BACPU/1-203-----.MFKQID.ENYLRKEHFHHYM-TLTR---CS--------------------------------------------
CAT1_CLOPF/1-206-----MKFNLIDIEDWNRKPYFEHYL-NAVR---CT--------------------------------------------
CAT_CAMCO/1-202-----MQFTKIDINNWTRKEYFDHYF-GNTP---CT--------------------------------------------

PF07247

Q6CJX7_KLULA/18-514------------RAGYVEE------V-LLME-HRQK------------------------------------------L-
Q6XBS9_SACPS/47-542------------RMGSVED------L-YAAL-NRQK------------------------------------------L-
Q6BRP8_DEBHA/9-477------------KLGFLEK------Y-YVCR-NVEW------------------------------------------Y-
Q6FVS8_CANGA/40-557------------RMGHLEN------Y-FAIM-QRQK------------------------------------------L-
Q5ANM4_CANAL/12-486------------PLSVSEN------F-FRCR-TASG------------------------------------------N-
YA33_SCHPO/9-444------------EAGRLEI------Y-SVKR-NVLN------------------------------------------M-
Q5AEJ2_CANAL/10-465------------KPEFNER------Y-YICR-TIEN------------------------------------------Y-
Q6XBT1_SACPS/23-529------------RMGHLEN------Y-FAVL-SRQK------------------------------------------M-
Q6FND8_CANGA/4-456------------HLGGIEQ------Y-FYQR-SSLN------------------------------------------L-

PF00668

PKSJ_BACSU/690-989-------QATFQPLSEVQKG---LWT-LQKM-SPEK------------------------------------------S.
SRFAA_BACSU/3121-3425-------VEGEVILTPIQR.---.WF-FEKN-FTNK------------------------------------------H.
SRFAA_BACSU/2097-2386-------KQDTYPVSSPQKR---MYV-LQQL-EDAQ------------------------------------------T.
SRFAA_BACSU/1058-1346-------KQEHYPLSLAQQR---TYI-VSQF-EDAG------------------------------------------V.
SRFAA_BACSU/2-303-------EITFYPLTDAQKR---IWY-TEKF-YPHT------------------------------------------S.
SRFAB_BACSU/3117-3421-------VEGEVILTPIQR.---.WF-FEKN-FTNK------------------------------------------H.
PPSA_BACSU/2089-2400-------AEGEAELTPIQR.---.RF-FGQV-HAFH------------------------------------------Y.
ACVS_EMENI/3105-3393-------VLGDAPLLPIQT.---.WF-LSKS-LQHP------------------------------------------S.
SRFAB_BACSU/6-306-------IQKVYALTPMQEG---MLY-HAML-DPHS------------------------------------------S.
SRFAC_BACSU/9-309-------VQDMYYLSPMQEG---MLF-HAIL-NPGQ------------------------------------------S.
ACVS_EMENI/944-1252-------NANVYLANSLQQG---FVY-QFLK-NMGR------------------------------------------S.
SRFAB_BACSU/1054-1340-------YQQHYPVSPAQRR---MYI-LNQL-GQAN------------------------------------------T.
SRFAB_BACSU/2093-2382-------KQDMYPLSSAQKR---MYV-LNQL-DRQT------------------------------------------I.
PPSA_BACSU/1048-1338-------KQETYPVSSAQKR---IYV-LQQL-EDGG------------------------------------------T.
ACVS_EMENI/2018-2321-------NRRKIAVSPAQER---LLF-IHEL-EGGG------------------------------------------N.
PPSA_BACSU/2-300-------SEHTYSLTHAQRR---VWF-TELL-EPDT------------------------------------------S.
GRSB_BREBE/9-310-------VQDMYRLSPMQEG---MLF-HALL-DKDK------------------------------------------N.
GRSB_BREBE/1058-1347-------EQEYYPVSSVQKR---MFI-LNEF-DRSG------------------------------------------T.
GRSB_BREBE/2093-2382-------PQDYYPVSSAQKR---MYI-LYEF-EGAG------------------------------------------I.
GRSB_BREBE/3138-3427-------GQDYYPVSSAQKR---MFI-VNQF-DGVG------------------------------------------I.
HTS1_COCCA/4782-5060-------DNSTLPCTEYQQ.---.MF-LAGT-EAFT------------------------------------------G.
GRSA_BREBE/620-923-------VEGEIGLTPIQH.---.WF-FEQQ-FTNM------------------------------------------H.
TYCA_BREPA/610-913-------IAGNVPLTPIQK.---.WF-FGKN-FTNT------------------------------------------G.
PPSB_BACSU/2088-2393-------VEGEITWTPIQQ.---.WF-FSQS-LESH------------------------------------------..
ACVS_CEPAC/3050-3340-------VEGDAPLLPIQD.---.WF-LSKP-LDNP------------------------------------------A.
ACVS1_PENCH/3082-3370-------VIGEAPLLPIQD.---.WF-LSKA-LQHP------------------------------------------M.
ACVS_NOCLA/2998-3282-------LTGECPMLPIQE.---.WF-FAKP-LADR------------------------------------------H.
HTS1_COCCA/854-1158-------PGQRIPVSPIQK.---.LF-FQTA-EASK------------------------------------------SW
PPSB_BACSU/7-310-------IQDIYPLSHMQEG---MLF-HSLM-D.FS------------------------------------------S.
PPSC_BACSU/7-306-------IQDIYPLSFMQEG---MLF-HSLY-D.EQ------------------------------------------S.
ACVS_CEPAC/893-1203-------VSDSYVASSLQQG---FVY-HSLK-N.EL------------------------------------------S.
ACVS1_PENCH/916-1226-------TDNIYLANSLQQG---FVY-HYLK-SMEQ------------------------------------------S.
ACVS_NOCLA/876-1186-------EPVRVLANGLQQG---LLY-HHLK-TAGG------------------------------------------D.
HTS1_COCCA/1337-1660-------LEGVYPGSPMQDA---LFL-SQSK-SQDG------------------------------------------AY
HTS1_COCCA/2530-2808-------IEDVFPCTPMQEA---LVA-LSLI-PGAQ------------------------------------------A.
PPSB_BACSU/1052-1342-------QRDVYPLSFSQKR---LYA-LHQL-ADDS------------------------------------------T.
ACVS_CEPAC/1969-2278-------ASLDIPLSPAQER---LMF-IHEF-GHSG------------------------------------------ED
ACVS1_PENCH/1992-2295-------DTQMIPVSRAQER---LLF-IHEF-ENGS------------------------------------------N.
ACVS_NOCLA/1948-2242-------AVEHPPVSLAQER---LLF-IDDF-EGGT------------------------------------------A.
ENTF_ECOLI/1-301-------MSQHLPLVAAQPG---IWM-AEKL-SELP------------------------------------------S.
HMWP2_YERE8/111-410-------ESTPFPLTPVQH.---AYL-TGRM-PGQT------------------------------------------L.
HMWP2_YERE8/1492-1782-------RYQPFALTDVQQ.---AYL-VGRQ-PGFT------------------------------------------L.

PF03007

Q9RIU8_STRCO/6-253-------------LAPLDLA---FWN-IESA-EHPM------------------------------------------H-
TGS3_MYCTU/5-271-------------LSASDAS---FYQ-LENT-ATPM------------------------------------------Y-
Y3154_MYCBO/4-256-------------LTTLDAG---FLK-AEDV-DR..------------------------------------------H-
Y3115_MYCBO/4-273-------------INPIDLS---FLL-LERA-NRPN------------------------------------------H-
Y1760_MYCTU/38-298-------------LSGLDAF---FLY-METP-SQPL------------------------------------------N-
Y919_MYCBO/32-296-------------MAAADAL---FLW-AETP-TRPL------------------------------------------H-
Q9X7A8_MYCLE/4-282-------------SVEGIGP---FDE-LGAL-DYLL------------------------------------------H-
Y1425_MYCTU/4-264-------------LSSVDAA---FWS-AETA-GWHM------------------------------------------H-
Y3371_MYCTU/4-237-------------LTALDAG---FLK-SRDP-ER..------------------------------------------H-
Y3480_MYCTU/8-298-------------LGPQDMF---FLY-SESS-TTMM------------------------------------------H-
Y3761_MYCBO/4-262-------------MMPNDSM---FLF-IESR-EHPM------------------------------------------H-
Y2484_MYCTU/4-282-------------SGESPRL---SDE-LGPV-DYLM------------------------------------------H-
Y3087_MYCTU/4-268-------------LNGVDAL---MLY-LDGG-SAYN------------------------------------------H-
Y221_MYCTU/4-263-------------LSGWDAV---LLY-SETP-NVHM------------------------------------------H-
Y3740_MYCTU/1-257-------------MSPIDAL---FLS-AESR-EHPL------------------------------------------H-
Y2306_MYCBO/4-256-------------LSPLDQM---FAR-MEAP-RTPM------------------------------------------H-

PF02458

O64549_ARATH/128-561FHVTTTRKQVITAALPLQDH...WLP-LSNL-D..L------------------------------------------LL
O04201_ARATH/6-476KSVTIISRNRVFPDQKSTLV...DLK-LSVS-DLPM------------------------------------------LS
Q43583_TOBAC/11-441FTVRRQKPELIAPAKPTPRE...TKF-LSDI-DD.Q------------------------------------------EG
O23392_ARATH/6-435MKVETISKEIIKPSSPTPNN.LQTLQ-LSIY-D..H------------------------------------------IL
O64988_CLABR/1-429MNVTMHSKKLLKPSIPTPNH.LQKLN-LSLL-D..Q------------------------------------------IQ
O23393_ARATH/3-424AKLEVTGKEVIKPASPSPRD...RLQ-LSIL-D..L------------------------------------------YC
HCBT2_DIACA/1-446MSIQIKQSTMVRPAEETPNK...SLW-LSKI-DM.I------------------------------------------LR
O80816_ARATH/16-448LKVTIKESTLIFPSEETSERK..SMF-LSNV-DQ.I------------------------------------------LN
O64470_ARATH/2-450APITFRKSYTIVPAEPTWSG...RFP-LAEW-D..Q------------------------------------------VG
DAT_CATRO/8-434VETETLSKTLIKPSSPTPQS.LSRYN-LSYN-DQNI------------------------------------------YQ
O80467_ARATH/11-450LMVEKMLTEMVKPSKHIPQQ...TLN-LSTL-DN.D------------------------------------------PY

PF00755

CACP_MOUSE/34-616-------ALPRLPVPPLQQSLDYYLK.ALQP-IVSE.EEWAHTKQLVDEFQTSG.GVGERLQKGLERRAKKM......EN
Q20278_CAEEL/11-599-------SLPSLPLPELEETIGKYLK.SLVP-IVPK.DELETITTLANDFAS.S.QNGQILQRFLKEKTISS......KN
CLAT_RAT/22-612-------DLPKLPVPPLQQTLATYLQ.CMQH-LVPE.EQFRKSQAIVKRFGAPG.GLGETLQEKLLERQEKT......AN
CACM_YEAST/3-644-------NLKRLPIPPLQDTLNRYLA.RVEP-LQDE.RQNRRTRRTVL..SAENLDALNTLHERLLEYDARLAESNPESS
Q23066_CAEEL/147-743-------LLPSLPVPALKDTISEYLD.SMKH-ILSE.QEYEIVAKQAHEFLE...NEGKKLQRYTWIYSLFT......DN
CPT1B_HUMAN/172-763-------SLPKLPVPRVSATIQRYLE.SVRP-LLDD.EEYYRMELLAKEFQD...KTAPRLQKYLVLKSWWA......SN
CLAT_CAEEL/19-623-------ALPKPPVPSLEATLDRYLEYAAVV-AVGQKASLATTHDAAHKFVR....QATPLQEQLLEIAEKS......PN
OCTC_RAT/19-605-------SLPPLPVPSLEESLKKYLE.SVKP-FANE.DEYKKTEEIVQKFQD...GVGKTLHQKLLERAKGK......RN
OCTC_BOVIN/19-605-------SLPSLPVPSLEESLKKYLE.SVKP-FANE.EEYKNTEAIVWKFQN...GIGEKLQQKLLQRAKGR......RN
Q17499_CAEEL/21-602-------DLPKLPAPQPIKTLKHFLD.FAQA-LQSK.KEFQETKQIVNDFVV...KDLPKLQELLQKRADAL......PN
O44619_CAEEL/140-733-------LLPNLPLPALQDTVDRYVD.SMKH-LMSE.EDYDQLLEMSRKFVS...NEGRSIQRYAWFLHKFT......DN
CLAT_DROME/87-717-------TLPKVPVPALDETMADYIR.ALEP-ITTP.AQLERTKELIRQFSAPQ.GIGARLHQYLLDKREAE......DN
CACP_COLLI/35-617-------ALPHLPVPPLQQTLDRYLL.ALQP-IISE.EELNHTQELVAEFRKPG.GVGERLQKGLERRAKKT......DN
CPT2_HUMAN/48-649-------SLPRLPIPKLEDTIRRYLS.AQKP-LLND.GQFRKTEQFCK..SFEN.GIGKELHEQLVALD...KQ.NKHTS
CACP_YEAST/73-658-------DLPSLPVPELKSTLDKYLQ.TIRP-FCNDVETFERQQLLCKDFSEHM.GP..ILQDRLKEYANDK......RN
CACP_CANTR/41-613-------QLPKLPVPTLEETASKYLK.TVEP-FLNQ.EQLESTKAKVAEFVRPG.GAGEALQARLNNFAADK......DN
CPT1A_HUMAN/170-763-------SLPRLPVPAVKDTVNRYLQ.SVRP-LMKE.EDFKRMTALAQDFAV...GLGPRLQWYLKLKSWWA......TN

PF00198

Q7PG41_ANOGA/236-467----FAYC...DEVD-------------------------------------------------VTRLVAVRA.E.....
A4H464_LEIBR/234-468----FTFS...EEYE-------------------------------------------------LTRLMAARE.S.....
Q8IJJ4_PLAF7/416-640----FRVT...HLIK-------------------------------------------------TNELLKLYE.K.....
B0K8I7_THEP3/156-382----VTED...IKVD-------------------------------------------------VTELVNLRE.N.....
A9B180_HERA2/216-442----FFVT...STIE-------------------------------------------------MDAIQALLP.K.....
B9LC79_CHLSY/227-461----IQLE...VRVD-------------------------------------------------VTEVEALRA.K.....
B8GAA3_CHLAD/150-362----AGAT...IAVN-------------------------------------------------LQPLLQRCA.T.....
Q7MB23_PHOLL/166-382----SSIT...VQFN-------------------------------------------------SINLREKLRND.....
A5G2C9_ACICJ/193-425----FYLS...MDVE-------------------------------------------------LDALLKLRA.E.....
A7K5W2_VIBSE/398-631----VTQW...DNAD-------------------------------------------------ITALEAFRK.E.....
A6QGW5_STAAE/188-420----LTTF...NEVD-------------------------------------------------MTNVMELRK.R.....
Q8IEA6_PLAF7/189-419----LTTF...NECD-------------------------------------------------MSKAMLLRS.E.....
Q6C806_YARLI/226-463----FLYT...DEVC-------------------------------------------------LDKLMELRA.S.....
A6Q9K5_SULNB/241-441----YHMT...DRID-------------------------------------------------ATLLNHYVS.K.....
A4CCC7_9GAMM/276-508----FTFS...DEID-------------------------------------------------LTQIIDLRL.Q.....
A4IKZ7_GEOTN/204-435----VTHF...SEAN-------------------------------------------------ATRLVQHRQ.R.....
A5IXN4_MYCAP/10-243----CSLV...LKAD-------------------------------------------------VTNLWNLRA.K.....
Q05SD7_9SYNE/221-446----FRVG...YTIT-------------------------------------------------TDKLDAFYK.Q.....
Q2B858_9BACI/159-388----CTHF...EDVD-------------------------------------------------VTELSVFRE.E.....
ODP2_MYCPN/169-401----TILT...FYVN-------------------------------------------------ATKLKQYRE.S.....
A6DTS5_9BACT/215-442----IYLT...TKIE-------------------------------------------------MDRLMDLRA.Q.....
Q67RX4_SYMTH/33-262----VTVV...AEVD-------------------------------------------------ATGLISVRE.S.....
A0QDC1_MYCA1/158-386----ATVS...VQVD-------------------------------------------------CTALVRLSE.R.....
A3RZM1_RALSL/164-375----ATVI...DDAD-------------------------------------------------IHAWPP..........
Q018W7_OSTTA/269-503----FYLT...VDVR-------------------------------------------------LDNMISIRQ.T.....
A0JUQ7_ARTS2/229-460----ATEF...LTID-------------------------------------------------VTPTMELLS.R.....
Q9CJD7_LACLA/298-530----VTNF...DQVE-------------------------------------------------VSKLVKHRA.V.....
A0LSF1_ACIC1/217-449----FYLT...RTLN-------------------------------------------------AEPLIDVRA.R.....
Q253H7_CHLFF/159-388----ASLI...VDID-------------------------------------------------VTDLMNLIS.......
KGD_MYCS2/97-344----ATSV...RAIP-------------------------------------------------AKLMIDNRV.V.....
A5GAC3_GEOUR/194-419----FTVT...VAID-------------------------------------------------MGEAENVYR.E.....
Q55ZP3_CRYNB/357-619----FGYS...HTLD-------------------------------------------------LTALIPYLKSKPFSPS
Q1NYU2_9FLAO/144-371----YSLF...IEVI-------------------------------------------------MDNLIKLRD.S.....
A2QTN3_ASPNC/236-469----FLYA...DELN-------------------------------------------------VNNVMAIRK.R.....
Q59298_9CLOT/219-443----VTYD...IKVD-------------------------------------------------MTSLKRFKD.A.....
Q9M724_ARATH/249-480----FHFV...EEIN-------------------------------------------------CDSLVELKQ.F.....
A0CLV5_PARTE/180-390----LYLK...EEVD-------------------------------------------------LTELAQMRE.Q.....
A4FGQ0_SACEN/225-452----ATVW...VDVD-------------------------------------------------ATGLLEARA.A.....
Q6MPR6_BDEBA/309-540----FTIM...DEAK-------------------------------------------------VDAMVALRE.S.....
A1SQ65_NOCSJ/201-427----FYLR...ATVR-------------------------------------------------ADRLVDLRA.E.....
Q6AFG4_LEIXX/233-470----LTSV...VEVD-------------------------------------------------VTKVAALRD.R.....
A6U1Y7_STAA2/191-418----AWMM...IEVD-------------------------------------------------ATNLVNTRN.H.....
A5GEF2_GEOUR/180-403----YYLE...MEID-------------------------------------------------MECALAWLE.G.....
A5V538_SPHWW/170-392----FYLS...ADAR-------------------------------------------------FDALAALRR.E.....
Q03DD0_PEDPA/195-427----VTIM...DEVE-------------------------------------------------VSKLMDLRN.Q.....
Q0RVL0_RHOSR/192-421----LTDV...REVE-------------------------------------------------VSALVELRN.R.....
Q5P9L2_ANAMM/204-433----FYLA...VDCM-------------------------------------------------VGELLKLRV.E.....
Q5UWH1_HALMA/304-539----VTHQ...DEVD-------------------------------------------------VTALVDARS.T.....
Q1Q664_9BACT/170-401----VTTV...FEVD-------------------------------------------------MTPVTKYRE.L.....
Q6MTX8_MYCMS/197-428----FTGM...KNTD-------------------------------------------------ITETHKMRT.E.....
Q820B9_TROW8/211-440----VSVF...VDVD-------------------------------------------------VTRTIELVD.R.....
A7NKS9_ROSCS/223-453----IFVS...IEVD-------------------------------------------------MGAALALRA.Q.....
A6U0R3_STAA2/197-428----VTLM...DEID-------------------------------------------------VQALWDHRK.K.....
ODO2_BUCAI/188-418----LTTF...HEVN-------------------------------------------------MKPIILLRK.K.....
Q2NJY8_AYWBP/185-416----TTIM...DEVN-------------------------------------------------ITALVTLRK.Q.....
A4XEQ9_NOVAD/253-480----FYLR...VSAS-------------------------------------------------VDALMDLRK.T.....
Q5SLR1_THET8/217-449----TLNV...DEAD-------------------------------------------------LTELVRLRE.R.....
Q5DM38_NYCOV/252-485----FYVS...VECE-------------------------------------------------VDKLLTLRS.Q.....
Q5F3G9_CHICK/271-501----AYAA...ADCD-------------------------------------------------IDAILKLRS.E.....
A4F1Y4_STRVG/208-431----VVATEVREELL-------------------------------------------------ASALRARRA.A.....
A4ICH2_LEIIN/226-463----YYLF...DDCR-------------------------------------------------VDNMLALIK.Q.....
Q9KG97_BACHD/180-411----VTHV...DEIE-------------------------------------------------MDALKELRE.Q.....
A0LLM2_SYNFM/206-441----VSHQ...DVAD-------------------------------------------------ITELDAFRR.K.....
Q04KE8_STRP2/115-347----FTLN...YEVD-------------------------------------------------MTEMLALRKKV.....
A7HBV2_ANADF/220-451----FTFV...EQCD-------------------------------------------------VTELARVKE.R.....
Q1IIF0_KORVE/320-555----VHGV...FEVD-------------------------------------------------FTKIVKLRE.K.....
A5JBE6_BURML/251-482----FSYV...EEID-------------------------------------------------VTELEALRA.E.....
A5G5K2_GEOUR/156-387----VTCT...EEAD-------------------------------------------------ITDLWDLRE.......
Q4XMM8_PLACH/203-444----FHLN...EVYN-------------------------------------------------VEKVVKIRK.E.....
Q8RD59_THETN/185-414----FYVT...MEVK-------------------------------------------------MREILKLRE.T.....
Q8CTW0_STAES/196-425----LTLH...RKVD-------------------------------------------------ADRLLDFKD.R.....
A4XHV3_CALS8/229-459----LTLH...TSFD-------------------------------------------------ASNILEFRK.R.....
A6TMP1_ALKMQ/205-437----ALCI...DEVD-------------------------------------------------VTDLVAYRE.E.....
Q04RI4_LEPBJ/240-470----FYLT...TELN-------------------------------------------------AGPIDDLRN.S.....
A7SJI4_NEMVE/174-396----VYAS...TDCV-------------------------------------------------MDNLLQLKS.H.....
A1ZHD0_9BACT/218-453----VTTF...VEAD-------------------------------------------------VTNIVMWRN.K.....
Q4DDM3_TRYCC/200-436----FTAC...DEIE-------------------------------------------------LTSLLKFRE.E.....
A7BC27_9ACTO/216-447----LTLN...TTAN-------------------------------------------------AAGILAMRK.K.....
O84249_CHLTR/201-428----FYVR...QRIY-------------------------------------------------ASPLLALLK.E.....
Q6KH63_MYCMO/220-452----TNLV...NEIN-------------------------------------------------VGSLVSLRE.K.....
Q5DAR0_SCHJA/35-267----GYVR...ATTC-------------------------------------------------IDRLNNLRK.E.....
Q87IG1_VIBPA/172-383----VTIT...EEAL-------------------------------------------------LEDWLP..........
Q6A613_PROAC/233-468----VTAF...LTCD-------------------------------------------------VTPTMELVN.R.....
Q2PY29_9BACT/192-418----FYVS...MSID-------------------------------------------------MGAAMASRS.L.....
ODP2_SCHPO/252-483----YYVT...VSVN-------------------------------------------------MEKIIRLRA.A.....
O45279_CAEEL/97-322----EYQG...VDVR-------------------------------------------------IDDILALRQ.K.....
Q97CK2_THEVO/179-398----FTVV...EKVD-------------------------------------------------VTGMISIIE.S.....
A0NRH8_9RHOB/70-301----VTHH...DRAE-------------------------------------------------MTAIEALRK.Q.....
Q3A0D1_PELCD/165-395----ATTI...NEAD-------------------------------------------------LSRIMELRS.Q.....
Q1IX53_DEIGD/361-594----VTHF...DKAD-------------------------------------------------VTRMEEVRK.A.....
Q7WED2_BORBR/182-409----FYLS...AEAE-------------------------------------------------VSALLALRQ.R.....
Q3J9C7_NITOC/185-392----FRAT...VHVD-------------------------------------------------PSRLVAAAKKQ.....
Q0W153_UNCMA/195-425----VTVF...DDAD-------------------------------------------------VTKLSELRE.Q.....
Q7UU97_RHOBA/235-467----VTNF...DDAD-------------------------------------------------ITDLERLRQ.S.....
Q81CI7_BACCR/169-399----LTLT...MKVD-------------------------------------------------VTDLVALHK.E.....
ODP2_BUCBP/176-410----VTQF...DESD-------------------------------------------------ITELENFRQ.K.....
ODP2_YEAST/248-482----YIVS...SKIS-------------------------------------------------ISKLLKLRQ.S.....
Q8RBW8_THETN/173-398----YTLG...REVD-------------------------------------------------ISALIKVRM.E.....
Q4P9L5_USTMA/1242-1493----FAYS...DEID-------------------------------------------------VTDLDQVRVLL.....
A8FC90_BACP2/211-441----VTLT...SEID-------------------------------------------------MTKAKEVRQ.Q.....

PF00302

CAT3_ECOLX/1-205----FSLT---SKID-------------------------------------------------ITTLKKSLDDS-----
CAT_PROMI/6-209----FSQT---VQLD-------------------------------------------------ITSLLKTVKQN-----
CAT2_CLOPF/1-202----YSMT---VKVD-------------------------------------------------IT....QIKEK-----
CAT_CLOBU/1-206----YSMT---ANIE-------------------------------------------------ITDLLYEIKLK-----
CAT1_STAAU/1-205----FSIT---TEID-------------------------------------------------ISVLYRNIKQE-----
CAT_SALTI/6-209----YNQT---VQLD-------------------------------------------------ITAFLKTVKKN-----
CAT_STRAC/6-211----YAMT---VEVD-------------------------------------------------VTAFAAALRRS-----
CAT2_ECOLX/1-205----FSLT---TKLD-------------------------------------------------ITALRTALAET-----
CAT2_STAAU/1-205----YSIT---KEID-------------------------------------------------ITLFKDMIKKK-----
CAT_BACPU/1-203----YSLV---INLD-------------------------------------------------ITKLHAILKEK-----
CAT1_CLOPF/1-206----YSMT---ANIE-------------------------------------------------ITGLLREIKLK-----
CAT_CAMCO/1-202----YSMT---VKLD-------------------------------------------------IS....KLKKD-----

PF07247

Q6CJX7_KLULA/18-514----YSNFVVHGELK-S--AA------SE--------LQ..LAHA-------------------LRALFLRYP-I-----
Q6XBS9_SACPS/47-542----YRNFSTYSELN-D--YC------TK--------DQ..LALA-------------------LRNICLKNP-T-----
Q6BRP8_DEBHA/9-477----KEDICVTAQYN-Q--HI------DE--------VL..LSNA-------------------LRSLILKNT-V-----
Q6FVS8_CANGA/40-557----YTNFNMYGELN-K--EV------TR--------EQ..LAVA-------------------IRQILLRHP-I-----
Q5ANM4_CANAL/12-486----YRNFVVTATYN-Q--SL------KK--------KLYVLVKA-------------------LRKTILEYP-I-----
YA33_SCHPO/9-444----FSIVIVSATYS-I--SL------DS--------TV..LYPA-------------------VYHAIVNQP-M-----
Q5AEJ2_CANAL/10-465----STNFSIIVQYN-R--QI------SH--------NL..LSNA-------------------LYSLIKKNS-W-----
Q6XBT1_SACPS/23-529----YSNFTVYAELN-K--GV------NK--------RQ..LMLV-------------------LKLLLQKYS-T-----
Q6FND8_CANGA/4-456----HSCFSVGVELN-S--LP------NR--------SD..FICA-------------------LRRVVNSHF-Q-----

PF00668

PKSJ_BACSU/690-989....AYHVPLCFKFS-S..GL------HH--------ET--FQQA-------------------FGLVLNQHP-I-----
SRFAA_BACSU/3121-3425....HWNQSVMLHAK-K..GF------DP--------ER--VEKT-------------------LQALIEHHD-A-----
SRFAA_BACSU/2097-2386....SYNMPAVLRLT-G..EL------DV--------ER--LNSV-------------------MQQLMQRHE-A-----
SRFAA_BACSU/1058-1346....GYNMPAAAILE-G..PL------DI--------QK--LERA-------------------FQGLIRRHE-S-----
SRFAA_BACSU/2-303....ISNLAGIGKLV-SADAI------DY--------VL--VEQA-------------------IQEFIRRND-A-----
SRFAB_BACSU/3117-3421....HWNQSVMLHAK-K..GF------DP--------ER--VEKT-------------------LQALIEHHD-A-----
PPSA_BACSU/2089-2400....HYNQSVMLFSE-K..GF------NA--------NA--LHLA-------------------LRKITEHHD-A-----
ACVS_EMENI/3105-3393....HWNHTFYLRTP-...EL------DV--------TT--LSTA-------------------VAELQLYHD-A-----
SRFAB_BACSU/6-306....SYFTQLELGIH-G..AF------DL--------EI--FEKS-------------------VNELIRSYD-I-----
SRFAC_BACSU/9-309....FYLEQITMKVK-G..SL------NI--------KC--LEES-------------------MNVIMDRYD-V-----
ACVS_EMENI/944-1252...EAYVMQSVLRYD-V..NI------NP--------DL--FKKA-------------------WKQVQHMLP-T-----
SRFAB_BACSU/1054-1340....SYNVPAVLLLE-G..EV------DK--------DR--LENA-------------------IQQLINRHE-I-----
SRFAB_BACSU/2093-2382....SYNMPSVLLME-G..EL------DI--------SR--LRDS-------------------LNQLVNRHE-S-----
PPSA_BACSU/1048-1338....GYNMPAVLELE-G..KL------NP--------ER--MERA-------------------FKELIKRHE-S-----
ACVS_EMENI/2018-2321....AYNIDAAFELP-P..YI------DQ--------SR--VEEA-------------------LYTILSRHE-A-----
PPSA_BACSU/2-300....ICNLTACVKFK-G..NI------EL--------DT--LEGA-------------------LNHSISRND-A-----
GRSB_BREBE/9-310....AHLVQMSIAIE-G..IV------DV--------EL--LSES-------------------LNILIDRYD-V-----
GRSB_BREBE/1058-1347....AYNLPGVMFLD-G..KL------NY--------RQ--LEAA-------------------VKKLVERHE-A-----
GRSB_BREBE/2093-2382....TYNVPNVMFIE-G..KL------DY--------QR--FEYA-------------------IKSLINRHE-A-----
GRSB_BREBE/3138-3427....SYNMPSIMLIE-G..KL------ER--------TR--LESA-------------------FKRLIERHE-S-----
HTS1_COCCA/4782-5060....AHSAQFIFRLP-E..KI------DL--------DR--LQAA-------------------FDHCADWYP-N-----
GRSA_BREBE/620-923....HWNQSYMLYRP-N..GF------DK--------EI--LLRV-------------------FNKIVEHHD-A-----
TYCA_BREPA/610-913....HWNQSSVLYRP-E..GF------DP--------KV--IQSV-------------------MDKIIEHHD-A-----
PPSB_BACSU/2088-2393....HFNQSVMIYRA-E..RF------DE--------AA--LRKV-------------------LKSLVTHHD-A-----
ACVS_CEPAC/3050-3340....YWNHCFTIRTG-...AL------SV--------EG--LRGA-------------------LKLLQERHD-V-----
ACVS1_PENCH/3082-3370....YWNHTFYVRTP-...EL------DV--------DS--LSAA-------------------VRDLQQYHD-V-----
ACVS_NOCLA/2998-3282....RWNHNFAIRTP-...PL------DP--------GE--LRTA-------------------LDRLVEHHD-A-----
HTS1_COCCA/854-1158...NHYHQSFLFRID-Q..PI------KP--------QT--IEDA-------------------ISLVMQRHP-M-----
PPSB_BACSU/7-310...KAYIEQTSFTIT-G..NL------CV--------DS--FQKS-------------------LNLLVSRYD-I-----
PPSC_BACSU/7-306...RAYFEQASFTIH-G..QL------DL--------ER--FQKS-------------------MDAVFDRYD-I-----
ACVS_CEPAC/893-1203...EAYTMQSMIHYG-V..PL------KR--------DI--YQAA-------------------WQRVQGEHP-A-----
ACVS1_PENCH/916-1226...DAYVMQSVLRYN-T..TL------SP--------DL--FQRA-------------------WKHAQQSFP-A-----
ACVS_NOCLA/876-1186...DAYVVQSVHRYH-A..PI------RP--------EL--MKDA-------------------WQAARQTYP-A-----
HTS1_COCCA/1337-1660EVDFTWRVATSLQNS-Q.PAV------DI--------GC--LVEA-------------------WKDTVALHA-A-----
HTS1_COCCA/2530-2808....SYALHAAFELR-P..GL------DR--------NR--FRSA-------------------WESTVKAQP-I-----
PPSB_BACSU/1052-1342....GYNMPAVLELR-G..NL------NR--------QR--LRSV-------------------LTELVNRHE-A-----
ACVS_CEPAC/1969-2278..TGAYNVPLQLQLH-H..DV------CL--------ES--LEKA-------------------LRDVVSRHE-A-----
ACVS1_PENCH/1992-2295....AYNIDAAFELP-G..SV------DA--------SL--LEQA-------------------LRGNLARHE-A-----
ACVS_NOCLA/1948-2242....AYNIPFVLRLP-...AH------TR--------AA--LPGA-------------------LGTLVRRHP-A-----
ENTF_ECOLI/1-301....AWSVAHYVELT-G..EV------DS--------PL--LARA-------------------VVAGLAQAD-T-----
HMWP2_YERE8/111-410...GGVGCHLYQEFE-G.HCL------TA--------SQ--LEQA-------------------ITTLLQRHP-M-----
HMWP2_YERE8/1492-1782...GGVGSHFFVEFE-I.ADL------DL--------TR--LETV-------------------WNRLIARHD-M-----

PF03007

Q9RIU8_STRCO/6-253----LGALGVFEADS-PTAGALAADLLAA--------RA--PAVP-------------------GLRMRIRDT-W-----
TGS3_MYCTU/5-271----VGLLLILRRPR-AGLSY.......E--------AL--LETV-------------------.EQRLPQIP-R-----
Y3154_MYCBO/4-256----VSLAIGALAVI-EGPAP......DQ--------EA--FLSS-------------------LAQRLRPCT-R-----
Y3115_MYCBO/4-273----MAAYTIFEKP.-KGQKSS.....FG--------PR--LFDA-------------------YRHSQAAKP-F-----
Y1760_MYCTU/38-298----VCCVLELDTST-MPGGY......TY--------GR--FHAA-------------------LEKYVKAAP-E-----
Y919_MYCBO/32-296----VGALAVLSQPD-NGTGR......YL--------RK--VFSA-------------------AVARQQVAP-W-----
Q9X7A8_MYCLE/4-282----RGEANPRTRAG-IMAVELLDTTPDW--------NR--FRSR-------------------IEDVSQRVL-R-----
Y1425_MYCTU/4-264----VGALAICDPSD-APEYS.......F--------QR--LREL-------------------IIERLPEIP-Q-----
Y3371_MYCTU/4-237----PGLAIGAVAVV-NGAAP......SY--------DQ--LKTV-------------------LTERIKSIP-R-----
Y3480_MYCTU/8-298----VGALMPFTPP.-SGAPPD.....LL--------RQ--LVDE-------------------SKASEVVEP-W-----
Y3761_MYCBO/4-262----VGGLSLFEPP.-QGAGPE.....FV--------RE--FTER-------------------LVANDEFQP-M-----
Y2484_MYCTU/4-282----RGEANPRTRSG-IMALELLDGTPDW--------DR--FRTR-------------------FENASRRVL-R-----
Y3087_MYCTU/4-268----TLKISVLDPST-DPDGWS......W--------PK--ARQM-------------------FEERAHLLP-V-----
Y221_MYCTU/4-263----TLKVAVIELDS-DRQEFG......V--------DA--FREV-------------------IAGRLHKLE-P-----
Y3740_MYCTU/1-257----VGALQLFEPP.-AGAGRG.....FV--------RE--TYQA-------------------MLQCREIAP-L-----
Y2306_MYCBO/4-256----IGAFAVFDLP.-KGAPRR.....FI--------RD--LYEA-------------------ISQLAFLPF-P-----

PF02458

O64549_ARATH/128-561PPLNVH.VCFCYKKP-LHFTN------TV........AYETLKTA-------------------LAETLVSYY-A-----
O04201_ARATH/6-476CHYIQK.GCLFTCPN-LPLPA------L..........ISHLKHS-------------------LSITLTHFP-P-----
Q43583_TOBAC/11-441LRFQIP.VIQFYHKD-SSMGR------KD........PVKVIKKA-------------------IAETLVFYY-P-----
O23392_ARATH/6-435PPVYTV.AFLFYTKN-DLISQ------EH........TSHKLKTS-------------------LSETLTKFY-P-----
O64988_CLABR/1-429IPFYVG.LIFHYETL-SDNSD------IT.........LSKLESS-------------------LSETLTLYY-H-----
O23393_ARATH/3-424PGIYVS.TIFFYDLI-TESSE------VF.........SENLKLS-------------------LSETLSRFY-P-----
HCBT2_DIACA/1-446TPYSHTGAVLIYKQP-DNNED------NIHPSSSMYFDANILIEA-------------------LSKALVPYY-P-----
O80816_ARATH/16-448FDVQTV...HFFRPN-KEFPP------EM........VSEKLRKA-------------------LVKLMDAYE-F-----
O64470_ARATH/2-450TITHIP.TLYFYDKP-SESFQ------GN........VVEILKTS-------------------LSRVLVHFY-P-----
DAT_CATRO/8-434TCVSVG...FFYENP-DGIEI------ST........IREQLQNS-------------------LSKTLVSYY-P-----
O80467_ARATH/11-450NEVIYK.ACYVFKAK-NVADD------DNR.......PEALLREA-------------------LSDLLGYYY-P-----

PF00755

CACP_MOUSE/34-616WLSEWWLKTAYLQFR.QPVVI------YSSPG..VILPKQDFVDL.........QGQLRFAAKLIEGVLDFKS-M-----
Q20278_CAEEL/11-599WLEDWWYDAYLTNRD.SLLTQ------NMG....AVVPKFSVNDS..........SQIESASHIIHHLMSYWS-L-----
CLAT_RAT/22-612WVSEYWLNDMYLNNR.LALPV------NSSPA..VIFARQHFQDT.........NDQLRFAACLISGVLSYKT-L-----
CACM_YEAST/3-644YIEQFWYDAYLLYDATVVLNV------NPYFQLQDDPTIKDTPETAAQGPYGAHTVQVRRAARLTTSILKFIR-Q-----
Q23066_CAEEL/147-743YVTSFWQKYAYLHGR.YPLMI------NSS....VAHCDLLRDKE.........ATRAHRAARVTWIEVMSHL-A-----
CPT1B_HUMAN/172-763YVSDWWEEYIYLRGR.SPLMV------NSNY...YVMDLVLIKNT.........DVQAARLGNIIHAMIMYRR-K-----
CLAT_CAEEL/19-623WATKFWLPEMYMRVR.MPTPV------NSNPG..YIFPKVKFETK.........EDHIKYTALLTRGLLEYKN-L-----
OCTC_RAT/19-605WLEEWWLNVAYLDVR.IPSQL------NVNFVGPSPHFEHYWPAR.........EGTQLERGSILLWHNLNYW-Q-----
OCTC_BOVIN/19-605WLEEWWLNVAYLDVR.IPSQL------NVNFGGPASHIEHYWPPK.........EGTQLERGSISLWHNLNYW-Q-----
Q17499_CAEEL/21-602WLTPWWLNIAYLAAR.TPLPV------VTSPG..VMFPKFDYNTE.........EGQLEYAAKISQAAVHFYL-R-----
O44619_CAEEL/140-733YVTSLWEQYIYMAGR.YPLLI------NSS....VAQCTMYGESD.........LIQAYQVARLIYIETIANL-A-----
CLAT_DROME/87-717WAYYYWLNEMYMDIR.IPLPI------NSNPG..MVFPPRRFKTV.........HDVAHFAARLLDGILSHRE-M-----
CACP_COLLI/35-617WLSDWWLKTAYLEYR.LPVVV------HSSPG..VVLPKQDFQDR.........QGQLRFAAKLIEGILDFKT-M-----
CPT2_HUMAN/48-649YISGPWFDMYLSARDSVVLNF------NPFMAFNPDPK....SE.........YNDQLTRATNMTVSAIRFLK-T-----
CACP_YEAST/73-658WMAKFWDEQSYLQYNDPIVPY------VSYFYSHMPLPNHLSKID.........NDPLIKATAIISTVVKFIE-A-----
CACP_CANTR/41-613WLAEFWDDYAYMSYRDPVVPY------VSYFFSHKDVKN...IIG.........QDQLLKATLIAYYTIEFQE-K-----
CPT1A_HUMAN/170-763YVSDWWEEYIYLRGR.GPLMV------NSNY...YAMDLLYILPT.........HIQAARAGNAIHAILLYRR-K-----

PF00198

Q7PG41_ANOGA/236-467.............LKEEAA----------ARGV...--------------------------------------------
A4H464_LEIBR/234-468.............LKDAVK----------ERSKG..--------------------------------------------
Q8IJJ4_PLAF7/416-640.............VKQ...----------.......--------------------------------------------
B0K8I7_THEP3/156-382.............LNHISD----------N......--------------------------------------------
A9B180_HERA2/216-442.............LREAHG----------G......--------------------------------------------
B9LC79_CHLSY/227-461.............ANRHHL----------DEQP...--------------------------------------------
B8GAA3_CHLAD/150-362.............QTAEFV----------TRGL...--------------------------------------------
Q7MB23_PHOLL/166-382.............TNS...----------.......--------------------------------------------
A5G2C9_ACICJ/193-425.............LNAQSP----------KEGPG..--------------------------------------------
A7K5W2_VIBSE/398-631.............QNAIEA----------KKDTG..--------------------------------------------
A6QGW5_STAAE/188-420.............KKEQFM----------KDHDG..--------------------------------------------
Q8IEA6_PLAF7/189-419.............LNDIFQ----------.KKYS..--------------------------------------------
Q6C806_YARLI/226-463.............VNSLLA----------KSPSNG.--------------------------------------------
A6Q9K5_SULNB/241-441...................----------.......--------------------------------------------
A4CCC7_9GAMM/276-508.............LKQQYQ----------DQGV...--------------------------------------------
A4IKZ7_GEOTN/204-435.............IKPLA.----------.EQQG..--------------------------------------------
A5IXN4_MYCAP/10-243.............VKDKVF----------.AEHN..--------------------------------------------
Q05SD7_9SYNE/221-446.............VKPK..----------.......--------------------------------------------
Q2B858_9BACI/159-388.............LKKQEK----------.......--------------------------------------------
ODP2_MYCPN/169-401.............VNGLAL----------.SKYN..--------------------------------------------
A6DTS5_9BACT/215-442.............INSMEG----------V......--------------------------------------------
Q67RX4_SYMTH/33-262.............LKPLAE----------.RHLG..--------------------------------------------
A0QDC1_MYCA1/158-386.............LGPAEQ----------.......--------------------------------------------
A3RZM1_RALSL/164-375...................----------.......--------------------------------------------
Q018W7_OSTTA/269-503.............LNKQLA----------DDKAAE.--------------------------------------------
A0JUQ7_ARTS2/229-460.............LKASRT----------FEGF...--------------------------------------------
Q9CJD7_LACLA/298-530.............FKEIAA----------KQDI...--------------------------------------------
A0LSF1_ACIC1/217-449.............LNAALS----------SADPD..--------------------------------------------
Q253H7_CHLFF/159-388.............EEKDRF----------FATHG..--------------------------------------------
KGD_MYCS2/97-344.............INNHLK----------RTRG...--------------------------------------------
A5GAC3_GEOUR/194-419.............LKGAGA----------.......--------------------------------------------
Q55ZP3_CRYNB/357-619KPSYTASDIPSSLIHEDEA----------IPEVGK.--------------------------------------------
Q1NYU2_9FLAO/144-371.............INEKKY----------LD.....--------------------------------------------
A2QTN3_ASPNC/236-469.............LANDPK----------DPK....--------------------------------------------
Q59298_9CLOT/219-443.............LKDVC.----------.......--------------------------------------------
Q9M724_ARATH/249-480.............FKENNT----------DSTI...--------------------------------------------
A0CLV5_PARTE/180-390.............LKKEK.----------.......--------------------------------------------
A4FGQ0_SACEN/225-452.............LNARSP----------EQ.....--------------------------------------------
Q6MPR6_BDEBA/309-540.............LKEHA.----------.EKNG..--------------------------------------------
A1SQ65_NOCSJ/201-427.............LNEGAE----------T......--------------------------------------------
Q6AFG4_LEIXX/233-470.............VKSDFL----------.AKTG..--------------------------------------------
A6U1Y7_STAA2/191-418.............YKNSFK----------.NKEG..--------------------------------------------
A5GEF2_GEOUR/180-403.............ENLKRS----------IKD....--------------------------------------------
A5V538_SPHWW/170-392.............VNADPS----------SPG....--------------------------------------------
Q03DD0_PEDPA/195-427.............FKEQAK----------QKGY...--------------------------------------------
Q0RVL0_RHOSR/192-421.............LAAKA.----------.ERIG..--------------------------------------------
Q5P9L2_ANAMM/204-433.............INDSCA----------DRGT...--------------------------------------------
Q5UWH1_HALMA/304-539.............LRREA.----------.EAQD..--------------------------------------------
Q1Q664_9BACT/170-401.............NREA.M----------.KREG..--------------------------------------------
Q6MTX8_MYCMS/197-428.............LKDHA.----------.AASG..--------------------------------------------
Q820B9_TROW8/211-440.............LKRDPL----------YEQV...--------------------------------------------
A7NKS9_ROSCS/223-453.............ANAGRA----------KEE....--------------------------------------------
A6U0R3_STAA2/197-428.............FKEIA.----------.AEQG..--------------------------------------------
ODO2_BUCAI/188-418.............YGEDFE----------.KKHN..--------------------------------------------
Q2NJY8_AYWBP/185-416.............AKDQA.----------.QSQG..--------------------------------------------
A4XEQ9_NOVAD/253-480.............ANLVLG----------T......--------------------------------------------
Q5SLR1_THET8/217-449.............LKPQA.----------.EAQG..--------------------------------------------
Q5DM38_NYCOV/252-485.............LNKIAS----------T......--------------------------------------------
Q5F3G9_CHICK/271-501.............LAKDDI----------.......--------------------------------------------
A4F1Y4_STRVG/208-431.............GDGQS.----------.......--------------------------------------------
A4ICH2_LEIIN/226-463.............LNAKGN----------GEY....--------------------------------------------
Q9KG97_BACHD/180-411.............LKHYS.----------.EQKG..--------------------------------------------
A0LLM2_SYNFM/206-441.............HKAEI.----------.REAG..--------------------------------------------
Q04KE8_STRP2/115-347.............LEPIME----------ATGK...--------------------------------------------
A7HBV2_ANADF/220-451.............MAVAA.----------.KEEG..--------------------------------------------
Q1IIF0_KORVE/320-555.............NKNSFQ----------.EKTG..--------------------------------------------
A5JBE6_BURML/251-482.............LNRKYG----------DTRG...--------------------------------------------
A5G5K2_GEOUR/156-387..............REQEA----------LEARG..--------------------------------------------
Q4XMM8_PLACH/203-444.............LKNKIA----------ESDSG..--------------------------------------------
Q8RD59_THETN/185-414.............LNSKLK----------EDEA...--------------------------------------------
Q8CTW0_STAES/196-425.............LATELK----------QADQD..--------------------------------------------
A4XHV3_CALS8/229-459.............VKENRE----------KLGL...--------------------------------------------
A6TMP1_ALKMQ/205-437.............MKNHFV----------.EEKE..--------------------------------------------
Q04RI4_LEPBJ/240-470.............INRDLG----------LSGQ...--------------------------------------------
A7SJI4_NEMVE/174-396.............LKERGL----------.......--------------------------------------------
A1ZHD0_9BACT/218-453.............VKKEFQ----------.QKHG..--------------------------------------------
Q4DDM3_TRYCC/200-436.............LRRNLT----------PRSPGD.--------------------------------------------
A7BC27_9ACTO/216-447.............VKNADE----------ALGL...--------------------------------------------
O84249_CHLTR/201-428.............LQEQNI----------.......--------------------------------------------
Q6KH63_MYCMO/220-452.............IKDSVQ----------.DLTG..--------------------------------------------
Q5DAR0_SCHJA/35-267.............LKVNLG----------M......--------------------------------------------
Q87IG1_VIBPA/172-383...................----------.......--------------------------------------------
Q6A613_PROAC/233-468.............LRADRR----------FKGL...--------------------------------------------
Q2PY29_9BACT/192-418.............LNAEST----------V......--------------------------------------------
ODP2_SCHPO/252-483.............LNAMAD----------GRY....--------------------------------------------
O45279_CAEEL/97-322.............LKKSGT----------.......--------------------------------------------
Q97CK2_THEVO/179-398.............AKSSGK----------.......--------------------------------------------
A0NRH8_9RHOB/70-301.............LRTEA.----------.GERG..--------------------------------------------
Q3A0D1_PELCD/165-395.............YGERFM----------.ERNG..--------------------------------------------
Q1IX53_DEIGD/361-594.............FAPRV.----------.EKAG..--------------------------------------------
Q7WED2_BORBR/182-409.............LNAQAD----------AP.....--------------------------------------------
Q3J9C7_NITOC/185-392...................----------.......--------------------------------------------
Q0W153_UNCMA/195-425.............VNGA..----------.RKDG..--------------------------------------------
Q7UU97_RHOBA/235-467.............SKDDY.----------.AAQG..--------------------------------------------
Q81CI7_BACCR/169-399.............IAKVVQ----------KRYD...--------------------------------------------
ODP2_BUCBP/176-410.............YNSDLK----------DKSK...--------------------------------------------
ODP2_YEAST/248-482.............LNATAN----------DKY....--------------------------------------------
Q8RBW8_THETN/173-398.............LKQKGS----------.......--------------------------------------------
Q4P9L5_USTMA/1242-1493.............SKSIPE----------RYTQAGD--------------------------------------------
A8FC90_BACP2/211-441.............LLPAIE----------KETG...--------------------------------------------

PF00302

CAT3_ECOLX/1-205--------------------------------------------------------------------------------
CAT_PROMI/6-209--------------------------------------------------------------------------------
CAT2_CLOPF/1-202--------------------------------------------------------------------------------
CAT_CLOBU/1-206--------------------------------------------------------------------------------
CAT1_STAAU/1-205--------------------------------------------------------------------------------
CAT_SALTI/6-209--------------------------------------------------------------------------------
CAT_STRAC/6-211--------------------------------------------------------------------------------
CAT2_ECOLX/1-205--------------------------------------------------------------------------------
CAT2_STAAU/1-205--------------------------------------------------------------------------------
CAT_BACPU/1-203--------------------------------------------------------------------------------
CAT1_CLOPF/1-206--------------------------------------------------------------------------------
CAT_CAMCO/1-202--------------------------------------------------------------------------------

PF07247

Q6CJX7_KLULA/18-514-------------LATTII----------PEYWNEK--------------------ETYYTSEAF--YNKPGLAED----
Q6XBS9_SACPS/47-542-------------LLHIVL----------PARWPDH--------------------KKYYLSSEY--YSQPRPKHD----
Q6BRP8_DEBHA/9-477-------------FALNVY----------RDGDPQY--------------------DAKMNGDNF--TVRP.....----
Q6FVS8_CANGA/40-557-------------MMQAII----------PKKFPEH--------------------EEYYTSDDY--YNTPFPEND----
Q5ANM4_CANAL/12-486-------------LATTVK----------FDK....--------------------....TVNAF--AYVP.....----
YA33_SCHPO/9-444-------------LGARIH----------.......--------------------......NCH--SKIP.....----
Q5AEJ2_CANAL/10-465-------------FVQNFF----------QI.DQRN--------------------PATANGHNF--EVR......----
Q6XBT1_SACPS/23-529-------------LAHTII----------PKHYPHH--------------------EAYYSSEEY--LSKPFPQHD----
Q6FND8_CANGA/4-456-------------LYCNAY----------K......--------------------....SNNEV--VVNP.....----

PF00668

PKSJ_BACSU/690-989-------------LKHVIQ----------EKDG...--------------------.VPFLKNEP--ALSI---------
SRFAA_BACSU/3121-3425-------------LRMVYR----------EGQED..--------------------VIQYNRGLE--AASA---------
SRFAA_BACSU/2097-2386-------------LRTTFE----------IKDG...--------------------.ETVQRIWE--EAEC---------
SRFAA_BACSU/1058-1346-------------LRTSFV----------LENS...--------------------.TPRQKIHD--SVDF---------
SRFAA_BACSU/2-303-------------MRLRLR----------LDEN...--------------------GEPVQYISE--YRPV---------
SRFAB_BACSU/3117-3421-------------LRMVYR----------EENGD..--------------------IVQVYKPIG--ESKV---------
PPSA_BACSU/2089-2400-------------IRMIFQ----------RDQNG.H--------------------VIQFNRGIN--HKDH---------
ACVS_EMENI/3105-3393-------------FRMRLR----------QIDGR..--------------------TVQCFADDI--SP.V---------
SRFAB_BACSU/6-306-------------LRTVFV----------HQQL...--------------------QKPRQVVLA--ERKT---------
SRFAC_BACSU/9-309-------------FRTVFI----------HEKV...--------------------KRPVQVVLK--KRQF---------
ACVS_EMENI/944-1252-------------LRLRFQ----------WGQ....--------------------.DVLQVIDE--DQPL---------
SRFAB_BACSU/1054-1340-------------LRTSFD----------MIDG...--------------------.EVVQTVHK--NISF---------
SRFAB_BACSU/2093-2382-------------LRTSFM----------EANG...--------------------.EPVQRIIE--KAEV---------
PPSA_BACSU/1048-1338-------------LRTSFE----------QDAG...--------------------GDPVQRIHD--EVPF---------
ACVS_EMENI/2018-2321-------------LRTFLL----------RDQAT..--------------------GTFYQKILT--TDEA---------
PPSA_BACSU/2-300-------------IRFQLL----------EGEE...--------------------LEPRLHLTE--YKYY---------
GRSB_BREBE/9-310-------------FRTTFL----------HEK.I..--------------------KQPLQVVLK--ERPV---------
GRSB_BREBE/1058-1347-------------LRTSFH----------SING...--------------------.EPVQRVHQ--NVEL---------
GRSB_BREBE/2093-2382-------------LRTSF.----------YSLN...--------------------GEPVQRVHQ--NVEL---------
GRSB_BREBE/3138-3427-------------LRTSFE----------IING...--------------------.KPVQKIHE--EADF---------
HTS1_COCCA/4782-5060-------------LRTQIH----------KDAD...--------------------TGRLLHDIS--PIGV---------
GRSA_BREBE/620-923-------------LRMIYK----------HHNGK..--------------------IVQINRGLE--GT..---------
TYCA_BREPA/610-913-------------LRMVYQ----------HENGN..--------------------VVQHNRGLG--GQ..---------
PPSB_BACSU/2088-2393-------------LRIVC.----------RHEDG.R--------------------QVQINRGID--LSDE---------
ACVS_CEPAC/3050-3340-------------LRLRLQ----------RRDEG.R--------------------HVQTFARDC--AQ..---------
ACVS1_PENCH/3082-3370-------------FRMRL.----------KREEV.G--------------------FVQSFAEDF--SP..---------
ACVS_NOCLA/2998-3282-------------FRLRFP----------ESGG...--------------------..EVYAEDA--AP..---------
HTS1_COCCA/854-1158-------------LQARFE----------RTEEG.D--------------------WYQYIPIDV--ERRA---------
PPSB_BACSU/7-310-------------FRTIFI----------KEVPD.L--------------------TGPQQVVL.--SNRE---------
PPSC_BACSU/7-306-------------FRTAFI----------YKN.V..--------------------AKPRQVVL.--KQRH---------
ACVS_CEPAC/893-1203-------------LRLRFT----------WEA....--------------------.EVMQIVD.--PKSE---------
ACVS1_PENCH/916-1226-------------LRLRFS----------WEK....--------------------.EVFQLLD.--QDPP---------
ACVS_NOCLA/876-1186-------------LRLRFD----------WAE....--------------------.EPVQIVDN--DDKP---------
HTS1_COCCA/1337-1660-------------LRTVIL----------ESSLPAT--------------------GILHQVVLR--SHDP---------
HTS1_COCCA/2530-2808-------------LRSRII----------SGSN...--------------------..GSSVVVT--SATD---------
PPSB_BACSU/1052-1342-------------LRTVFV----------LDRD...--------------------.EPVQIIYP--EMAF---------
ACVS_CEPAC/1969-2278-------------LRTLIT----------RTQKS..--------------------SVHCQKILD--AEEA---------
ACVS1_PENCH/1992-2295-------------LRTLLV----------KDHAT..--------------------GIYLQKVLS--PDEA---------
ACVS_NOCLA/1948-2242-------------LRTLLK----------TDDQ...--------------------GVRRQYPIP--ADDV---------
ENTF_ECOLI/1-301-------------LRMRFT----------EDNG...--------------------.EVWQWVDD--ALTF---------
HMWP2_YERE8/111-410-------------LHIAFR----------PDGQQ.V--------------------WLPQPYWNG--VTVH---------
HMWP2_YERE8/1492-1782-------------LRAVVL----------DGQ....--------------------....QQVLE--QTPP---------

PF03007

Q9RIU8_STRCO/6-253-------------QPPMAL----------RRPFAFG--------------------GATREPDPR--FDPL---------
TGS3_MYCTU/5-271-------------YRQKVQ----------EVKLGLA--------------------RPVWIDDRD--FDIT---------
Y3154_MYCBO/4-256-------------FGQRLR----------LRPFDLG--------------------APKWVDDPD--FDLG---------
Y3115_MYCBO/4-273-------------NHK...----------LKWLGTD--------------------VAAWETVE.--PDMG---------
Y1760_MYCTU/38-298-------------FRMKLA----------DTELNLD--------------------HPVWVDDDN--FQIR---------
Y919_MYCBO/32-296-------------WRRRPH----------RSLTSLG--------------------QWSWRTETE--VDLD---------
Q9X7A8_MYCLE/4-282-------------LRQKVV----------VPTLPTA--------------------APRWVVDPD--FELD---------
Y1425_MYCTU/4-264-------------LRWRVT----------GAPLGLD--------------------RPWFVEDEE--LDID---------
Y3371_MYCTU/4-237-------------CTQ..V----------L......--------------------ATEWIDYPG--FDLT---------
Y3480_MYCTU/8-298-------------SLRLSH----------PELLYHP--------------------TQSWVVDDN--FDLD---------
Y3761_MYCBO/4-262-------------FRKHPA----------TIGGGIA--------------------RVAWAYDDD--IDID---------
Y2484_MYCTU/4-282-------------LRQKVV----------VPTLPTA--------------------APRWVVDPD--FNLD---------
Y3087_MYCTU/4-268-------------FRLRYL----------PTPLGLH--------------------HPIWVEDPE--FDLD---------
Y221_MYCTU/4-263-------------LGYQLV----------DVPLKFH--------------------HPMWREHCQ--VDLN---------
Y3740_MYCTU/1-257-------------FRKRPT----------SLHGALI--------------------NLGWSTDAD--VDLG---------
Y2306_MYCBO/4-256-------------FDS...----------VIAGGAS--------------------MAYWRQVQ.--PDPS---------

PF02458

O64549_ARATH/128-561-------------FAGELV----------TNP.TGE--------------------PEILCNNRG..VDFV---------
O04201_ARATH/6-476-------------LAGRLS----------TSS.SGH--------------------VFLTCNDAG..ADFV---------
Q43583_TOBAC/11-441-------------FAGRL.----------REGNGRK--------------------LMVDCTGEG..IMFV---------
O23392_ARATH/6-435-------------LAGRI.----------.....TG--------------------VTVDCTDEG..AIFV---------
O64988_CLABR/1-429-------------VAGRY.----------..N.GTD--------------------CVIECNDQG..IGYV---------
O23393_ARATH/3-424-------------LAGRI.----------.....EG--------------------LSISCNDEG..AVFT---------
HCBT2_DIACA/1-446-------------MAGRL.----------.KINGDR--------------------YEIDCNAEG..ALFV---------
O80816_ARATH/16-448-------------LAGRLR----------VDPSSGR--------------------LDVDCNGAG..AGFV---------
O64470_ARATH/2-450-------------MAGRL.----------RWLPRGR--------------------FELNCNAEG..VEFI---------
DAT_CATRO/8-434-------------FAGKV.----------..V..KN--------------------DYIHCNDDG..IEFV---------
O80467_ARATH/11-450-------------LSGSLK----------RQESDRK--------------------LQLSCGGDGGGVPFT---------

PF00755

CACP_MOUSE/34-616-------------IDNETL..........PVEFLGG.....................QPLCMNQY--YQILSSCRV...P
Q20278_CAEEL/11-599-------------IRQEKI..........EVTKSRG.....................NSWDMNQD--YNLFNACRV...P
CLAT_RAT/22-612-------------LDSHSL..........PTDWAKGQ.................LSGQPLCMKQY--YRLFSSYRL...P
CACM_YEAST/3-644-------------IRHGTL..........RTDTVRG....................KTPLSMDQY--ERLFGSSRIPPGP
Q23066_CAEEL/147-743-------------IDRQQY..........K...ALG....................DGLVCTRHY--KNMYAVTRE...P
CPT1B_HUMAN/172-763-------------LDREEI..........KPVMALG....................IVPMCSYQM--ERMFNTTRI...P
CLAT_CAEEL/19-623-------------IDTKQV..........CREKSTGA..................QKLQMCMEQY--DRVLSCYRE...P
OCTC_RAT/19-605-------------LLRREK..........LPVHKSG....................NTPLDMNQF--RMLFSTCKV...P
OCTC_BOVIN/19-605-------------LLRKEK..........LAVEKVG....................NTPLDMNQF--RMLFSTCKI...P
Q17499_CAEEL/21-602-------------AKNNQL..........KPDMAGK.....................SPLDMSQY--QFLFGTTRV...P
O44619_CAEEL/140-733-------------LDRQKY..........M...AIG....................EGLMSTRHY--RNIYNGCRI...P
CLAT_DROME/87-717-------------LDSGEL..........PLERAASR.................EKNQPLCMAQY--YRLLGSCRR...P
CACP_COLLI/35-617-------------IDNETL..........PVEY...M..................GGKPLCMNQY--YQILSSCRI...P
CPT2_HUMAN/48-649-------------LRAGLLEPEVFHLNPAKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQY--FRLFNSTRL...P
CACP_YEAST/73-658-------------IKDESL..........PVEIIKG.....................MPFCMNSF--SLMFNTSRL...P
CACP_CANTR/41-613-------------VLDESL..........DPEVIKG.....................NPFCMNAF--KYMFNNSRV...P
CPT1A_HUMAN/170-763-------------LDREEI..........KPIRLLG...................STIPLCSAQW--ERMFNTSRI...P

PF00198

Q7PG41_ANOGA/236-467-----------------------------------------------....KLTYMPFFLKAASNALLQH-PILNSSF..
A4H464_LEIBR/234-468-----------------------------------------------..KAKLSFMPFFLKAASIALQQH-PDINAHC..
Q8IJJ4_PLAF7/416-640-----------------------------------------------....KISMSVIINKCVSSVLLNH-PLIYSTY.I
B0K8I7_THEP3/156-382-----------------------------------------------....KFTYTDLIAKACVIAIKKN-PVVNWSI..
A9B180_HERA2/216-442-----------------------------------------------....KLSVTELLLKACAIALKKF-PALNSTF..
B9LC79_CHLSY/227-461-----------------------------------------------....KVSLTAIFVKSAAWALKRH-PYLNAWL..
B8GAA3_CHLAD/150-362-----------------------------------------------....QATPLSALVAAAAALFPLH-PFLNAAW..
Q7MB23_PHOLL/166-382-----------------------------------------------....SGQIFPYLLWILGITLQDW-PQLRSYY..
A5G2C9_ACICJ/193-425-----------------------------------------------..AFKLSVNDLIIKAVAVALRRV-PAANASF..
A7K5W2_VIBSE/398-631-----------------------------------------------...MKITPLVFIMKAVAKALEAF-PAFNSSL..
A6QGW5_STAAE/188-420-----------------------------------------------...TKLGFMSFFTKASVAALKKY-PEVNAEI..
Q8IEA6_PLAF7/189-419-----------------------------------------------...CKLGFVSLFMYASTLALKKM-PNVNAYI..
Q6C806_YARLI/226-463-----------------------------------------------..VSKISYMPFFIKALSLALKDY-PMVNAKV..
A6Q9K5_SULNB/241-441-----------------------------------------------....DLTITVWLLKLFAEAMMRQ-KYFRLTL..
A4CCC7_9GAMM/276-508-----------------------------------------------....KLTMMPFFVKALSLAITEF-PVLNSQV..
A4IKZ7_GEOTN/204-435-----------------------------------------------...MKLTYLVYVIKALAAVLKKY-PMLNASL..
A5IXN4_MYCAP/10-243-----------------------------------------------...VKLTFLSWIVKASAIALSEY-PSFAARW..
Q05SD7_9SYNE/221-446-----------------------------------------------....GVTMTALLAKAVAVTLARH-PQVNAAT..
Q2B858_9BACI/159-388-----------------------------------------------....QVTMTAFYIKALSMALKRF-PVFNSRL..
ODP2_MYCPN/169-401-----------------------------------------------...MKISFFAFFVKAIVNALKKF-PVFNGRY..
A6DTS5_9BACT/215-442-----------------------------------------------....RISINDFIVKACGLSLAKF-PAMNGAF..
Q67RX4_SYMTH/33-262-----------------------------------------------...IRLTYLPFFAAATVRALKAW-PIMNAML..
A0QDC1_MYCA1/158-386-----------------------------------------------....RITPFVLTLRLLVIALRRN-EIMNSTW..
A3RZM1_RALSL/164-375-----------------------------------------------....GTDVTIRLIRALVAGCRAE-PGLNAWF..
Q018W7_OSTTA/269-503-----------------------------------------------..GAKISVNDFIVKASAKALLAV-PEVNSSW..
A0JUQ7_ARTS2/229-460-----------------------------------------------....KLTPLTLVAKALLIALRRQ-PSLNSRW..
Q9CJD7_LACLA/298-530-----------------------------------------------....KLTYLAYVAKALATTAHKF-PDINASV..
A0LSF1_ACIC1/217-449-----------------------------------------------..TAKISLNDLIVKVAAAALRKH-PEVNVSY..
Q253H7_CHLFF/159-388-----------------------------------------------...VKLTITSFIIQCLAKALEQF-PLLNGSL..
KGD_MYCS2/97-344-----------------------------------------------...GKISFTHLLGYAIVQAVKKF-PNMNRHF..
A5GAC3_GEOUR/194-419-----------------------------------------------....MVSLNDVIIKAAAMVLQKF-PLANASF..
Q55ZP3_CRYNB/357-619-----------------------------------------------..NAKPTLLTFLIKTILLALEEH-PIMRSRV..
Q1NYU2_9FLAO/144-371-----------------------------------------------....KISFNDLIVKASALAIKEN-PKINSSW..
A2QTN3_ASPNC/236-469-----------------------------------------------....KISLLSFVIKAMSLALNDY-PLLNAKI..
Q59298_9CLOT/219-443-----------------------------------------------....KVTYTDLIVKIVSKVLLQF-PLLNCSI..
Q9M724_ARATH/249-480-----------------------------------------------....KHTFLPTLIKSLSMALTKY-PFVNSCF..
A0CLV5_PARTE/180-390-----------------------------------------------....NITFMTLLIKSFSLALAKY-PILNSTY..
A4FGQ0_SACEN/225-452-----------------------------------------------....PVSVLALVSRFAVLGLRRF-PELNSRV..
Q6MPR6_BDEBA/309-540-----------------------------------------------...TKITYLPIIMKALIATIREF-PMFNASI..
A1SQ65_NOCSJ/201-427-----------------------------------------------....RVSLNDLVVKAVAAAHARV-PEMNVVW..
Q6AFG4_LEIXX/233-470-----------------------------------------------...VKLSFLPFFALAAAEALKTY-PVINATV..
A6U1Y7_STAA2/191-418-----------------------------------------------...YNLTFFAFFVKAVADALKAY-PLLNSSW..
A5GEF2_GEOUR/180-403-----------------------------------------------....RLLPAVLLLKAVARALADV-PELNGYWLD
A5V538_SPHWW/170-392-----------------------------------------------....KLSVTAFLGAAVGRALALH-PEANGVWRG
Q03DD0_PEDPA/195-427-----------------------------------------------....KLTYMPFIAKALAGAAHKY-PELSAMV..
Q0RVL0_RHOSR/192-421-----------------------------------------------...FKVSFTDLFLKATALALREV-PELNVTV..
Q5P9L2_ANAMM/204-433-----------------------------------------------....KITVNDFVLKAVALAMREF-PEINSSW..
Q5UWH1_HALMA/304-539-----------------------------------------------...IRLTYMPFVMKACAAALQEN-PQVNVSL..
Q1Q664_9BACT/170-401-----------------------------------------------...IHLTYLPFIAFAVVQALKEH-VALNSSW..
Q6MTX8_MYCMS/197-428-----------------------------------------------...IKLTYLAFIIKAVAKSLRDM-PNINVRG..
Q820B9_TROW8/211-440-----------------------------------------------....RISPLLILSRAVTWAVKRS-PIVNSTW..
A7NKS9_ROSCS/223-453-----------------------------------------------....QFSVNDMVVKACAGALLAF-PNLNASY..
A6U0R3_STAA2/197-428-----------------------------------------------...TKLTFLPYVVKALVSALKKY-PALNTSF..
ODO2_BUCAI/188-418-----------------------------------------------...VRIGFMSFFVKAVIQALKNF-PEINAYI..
Q2NJY8_AYWBP/185-416-----------------------------------------------...IKLTFMAFIMKAVAIALQEF-PVFNASY..
A4XEQ9_NOVAD/253-480-----------------------------------------------....KASINDYLVKAVALALVRH-PDVNVQV..
Q5SLR1_THET8/217-449-----------------------------------------------...VKLTYLPFIVKAVVRALKKF-PMLNTSL..
Q5DM38_NYCOV/252-485-----------------------------------------------....KISINDMLIKACSLACLKV-PVTNSSW..
Q5F3G9_CHICK/271-501-----------------------------------------------....KVSVNDFIIKAAAVTLKQM-PDVNATW..
A4F1Y4_STRVG/208-431-----------------------------------------------....FTTAFQVFAHLAARVAADF-PFLRSRR..
A4ICH2_LEIIN/226-463-----------------------------------------------....KITVNDYIVKAVARANILV-PEVNSSW..
Q9KG97_BACHD/180-411-----------------------------------------------...IKLTFLPFFIKAIVSALKEF-EYFNASI..
A0LLM2_SYNFM/206-441-----------------------------------------------...GALNMIVFVLKAAVAALKAF-PGFNASI..
Q04KE8_STRP2/115-347-----------------------------------------------....KTTVTDLLSLAVVKTLMKH-PYINASLTE
A7HBV2_ANADF/220-451-----------------------------------------------...VKLTFLPFVVKAVVAALRKH-PKLNATM..
Q1IIF0_KORVE/320-555-----------------------------------------------...LKLTYTPFYARAVAHALRAW-PIINASV..
A5JBE6_BURML/251-482-----------------------------------------------....RLTVLPLLARAMVIALREF-PQINARY..
A5G5K2_GEOUR/156-387-----------------------------------------------...THLTFLPFFIKAAQHALRDH-PFLNASI..
Q4XMM8_PLACH/203-444-----------------------------------------------..INNITISSILIKLISNTLKEF-PILNSKF..
Q8RD59_THETN/185-414-----------------------------------------------....KISLNTLLMKAAGIAIKDY-PIFNSYV..
Q8CTW0_STAES/196-425-----------------------------------------------...VKLTVTTLLAKAVVLALKEY-GAMNARY..
A4XHV3_CALS8/229-459-----------------------------------------------...EDITINDIILFAVSRVLPKH-KALNAHF..
A6TMP1_ALKMQ/205-437-----------------------------------------------...IKITYLPFMIKAVMLALKDY-PRFNAQL..
Q04RI4_LEPBJ/240-470-----------------------------------------------...GKVSVNDLILKACSYTLLQV-PEVNSSW..
A7SJI4_NEMVE/174-396-----------------------------------------------....TVSVNDLLVKVAAVCLRKV-PEMNAVW..
A1ZHD0_9BACT/218-453-----------------------------------------------...EKITFTPIFIEAIAKTLGDF-PLVNSSI..
Q4DDM3_TRYCC/200-436-----------------------------------------------.ATPKLSLLPLFIKAASLALLQH-PQINSHV..
A7BC27_9ACTO/216-447-----------------------------------------------...NKITLNDLVCFAVSRTLLKY-PVFNAHL..
O84249_CHLTR/201-428-----------------------------------------------....KLSINDCIVRACALALKEF-PEINSGF..
Q6KH63_MYCMO/220-452-----------------------------------------------...VKVTFLPFIIKAITLALKEF-PVLMAKY..
Q5DAR0_SCHJA/35-267-----------------------------------------------....NFSINDFIIKACALALRLF-PDFNSIY..
Q87IG1_VIBPA/172-383-----------------------------------------------....NEDISIRLVQAIVYACQQE-PALNAWF..
Q6A613_PROAC/233-468-----------------------------------------------....RVSPLTVWCKAVCLAMGRT-PIINAAW..
Q2PY29_9BACT/192-418-----------------------------------------------....KISFNDMVVKAVAKSLKKH-PAVNSSW..
ODP2_SCHPO/252-483-----------------------------------------------....KLSVNDLVIKATTAALRQV-PEVNAAW..
O45279_CAEEL/97-322-----------------------------------------------....AVSLNDFIIKAAALALRSV-PTVNVRW..
Q97CK2_THEVO/179-398-----------------------------------------------....KVTITGYIARIVPIVLKQY-PYLNAIY..
A0NRH8_9RHOB/70-301-----------------------------------------------...VKLTALAFHAKALSKALREF-PKFNASL..
Q3A0D1_PELCD/165-395-----------------------------------------------...IKLGLMSFFVKACVEALREF-PVINARL..
Q1IX53_DEIGD/361-594-----------------------------------------------...GKLTMTHILMKVVANALRKF-PKFGASL..
Q7WED2_BORBR/182-409-----------------------------------------------....RLTLNHFVIAAVARALAAM-PHQNRIWND
Q3J9C7_NITOC/185-392-----------------------------------------------....GSSVTVALAKATALAIEEH-PKINSVY..
Q0W153_UNCMA/195-425-----------------------------------------------...VKVSYLAFTVKAVSAALRNH-PVLNASI..
Q7UU97_RHOBA/235-467-----------------------------------------------...LKLTTMPFLVKAVATALRHH-PSLNAVI..
Q81CI7_BACCR/169-399-----------------------------------------------...NKLTITDFVSRAAVLALGEH-KEMNSAY..
ODP2_BUCBP/176-410-----------------------------------------------....KLTILIFVIKAVSKALEMF-PKFNGRL..
ODP2_YEAST/248-482-----------------------------------------------....KLSINDLLVKAITVAAKRV-PDANAYWLP
Q8RBW8_THETN/173-398-----------------------------------------------....PANITDLIHKAVVQAILEN-PVMQAVI..
Q4P9L5_USTMA/1242-1493-----------------------------------------------ASFTKLTLLPLLVKAMSLALHEH-PMFRSTL..
A8FC90_BACP2/211-441-----------------------------------------------...YRLSFTEIIIHAVSHVLTRH-PQINMTF..

PF00302

CAT3_ECOLX/1-205---------------------------------------------------AYKFYPVMIYLIAQAVNQF-DELRMAI--
CAT_PROMI/6-209---------------------------------------------------GYKFYPTFIYIISLLVNKH-AEFRMAM--
CAT2_CLOPF/1-202---------------------------------------------------GMKLYPAMLYYIAMIVNRH-SEFRTAI--
CAT_CLOBU/1-206---------------------------------------------------NIKFYPTLIYMIATVVNNH-KEFRICF--
CAT1_STAAU/1-205---------------------------------------------------GYKFYPAFIFLVTRVINSN-TAFRTGY--
CAT_SALTI/6-209---------------------------------------------------KHKFYPAFIHILARLMNAH-PEFRMAM--
CAT_STRAC/6-211---------------------------------------------------PRKSYLAQVWALATVVNRH-EEFRMCL--
CAT2_ECOLX/1-205---------------------------------------------------GYKFYPLMIYLISRAVNQF-PEFRMAL--
CAT2_STAAU/1-205---------------------------------------------------GYEIYPSLIYAIMEVVNKN-KVFRTGI--
CAT_BACPU/1-203---------------------------------------------------KLKVYPVQIYLLARAVQKI-PEFRMDQ--
CAT1_CLOPF/1-206---------------------------------------------------GLKLYPTLIYIITTVVNRH-KEFRTCF--
CAT_CAMCO/1-202---------------------------------------------------GKKLYPTLLYGVTTIINRH-EEFRTAL--

PF07247

Q6CJX7_KLULA/18-514------YVSVV.DQLKLED-VIMNKQPE.HSKFYNEILNQWEHDGFKYGDDLSVVVSQ--YTFSCWDPTK-PHFRLVLLP
Q6XBS9_SACPS/47-542------YISVL.PELKLDG-VILNEQPE.HNALMKQILEEFANSNGSYTAKIFKLTTA--LTIPYTGPTS-PTWRLICLP
Q6BRP8_DEBHA/9-477------....V.EKIAFSD-VV.................SFKDIDESFGVVELNALSE--EVSPVNDTR.-PLWRLKVYK
Q6FVS8_CANGA/40-557------FLRVITSKIKLSD-IIINEQSEDYGEIIDMILSEYKKNGYKFDAYMQELIGN--IVIPIGNPNK-PNWRLLCLP
Q5ANM4_CANAL/12-486------....L.KTINLSD-ILFFEGDE...........KWLTNG.VINENYMKYCNE--TQFKLYEEN.-VLFKLILVG
YA33_SCHPO/9-444------IVKKL.KTIDLDK-VV.................KYAD.DQKVDSFCNNALQN--FKLCYDDETL-PLWMVYVLN
Q5AEJ2_CANAL/10-465------....ILEHVKFND-VV.................KFHQID.KFDEIIMESLND--HIFSMNNATL-PLWKINVFE
Q6XBT1_SACPS/23-529------FIKVI.SHLEFDD-LIMNNQPE.YREVMEKISEQFKKDDFKVTNRLIELISP--VIIPVGNPKR-PNWRLICLP
Q6FND8_CANGA/4-456------....IGEPIKFDD-VV.................DYMDWDTYGEEEINSVFRK--YNFEYGVDK.-PLWKVIVVP

PF00668

PKSJ_BACSU/690-989------------EIKTENI-SS-----------------LKE......SDIPAFLRKK..VKEPYVKENS.PLVRVMSFS
SRFAA_BACSU/3121-3425------------QLEVIQI-EG-----------------QAA....DYEDRIEREAER..LQSSIDLQEG.GLLKAGLFQ
SRFAA_BACSU/2097-2386------------EIAYFEA-P.-----------------.........EEETERIVSE..FIKPFKIDQL.PLFRIGLIK
SRFAA_BACSU/1058-1346------------NIEMIER-G.-----------------.........GRSDEAIMAS..FVRTFDLAKA.PLFRIGLLG
SRFAA_BACSU/2-303------------DIKHTDT-TE-----------------DPN....AIEFISQWSREE..TKKPLPLYDC.DLFRFSLFT
SRFAB_BACSU/3117-3421------------SFEIVDL-YG-----------------SDE...EMLRSQIKLLANK..LQSSLDLRNG.PLLKAEQYR
PPSA_BACSU/2089-2400------------ELFGLYI-SD-----------------WTKASLERAHLDEKLAAEETVIQSKMNVEKG.PLLQAGLFK
ACVS_EMENI/3105-3393------------QLRVLNV-KD-----------------VDG......SAAIDQQLQK..YQSDFDLEKG.PICAAAYLH
SRFAB_BACSU/6-306------------KVHYEDI-SH-----------------ADEN..RQKEHIERYKQDV..QRQGFNLAKD.ILFKVAVFR
SRFAC_BACSU/9-309------------HIEEIDL-TH-----------------LTGS..EQTAKINEYKEQD..KIRGFDLTRD.IPMRAAIFK
ACVS_EMENI/944-1252------------NWWFLHL-AD-----------------DSAL..PEEQKLLELQRRD..LAEPYDLAAG.SLFRIYLIE
SRFAB_BACSU/1054-1340------------QLEAAKG-R.-----------------.........EEDAEEIIKA..FVQPFELNRA.PLVRSKLVQ
SRFAB_BACSU/2093-2382------------DLHVFEA-K.-----------------.........EDEADQKIKE..FIRPFDLNDA.PLIRAALLR
PPSA_BACSU/1048-1338------------TLQTTVL-G.-----------------.........ERTEQEAAAA..FIKPFDLSQA.PLFRAQIVK
ACVS_EMENI/2018-2321------------KCMLIIE-KS-----------------AVS....TIDQIDSIVGRL..SQHIFRLDSE.LPWLAHIVT
PPSA_BACSU/2-300------------PLRIIDF-SN-----------------..V....EMIEIEQWIQDQ..ASIPFKLFNS.PLFQFYLLR
GRSB_BREBE/9-310------------QLQFKDI-SS-----------------LDEE..KREQAIEQYKYQD..GETVFDLTRD.PLMRVAIFQ
GRSB_BREBE/1058-1347------------QIAYSES-T.-----------------.........EDQVERIIAE..FMQPFALEVA.PLLRVGLVK
GRSB_BREBE/2093-2382------------QIAYSEA-K.-----------------.........EDEIEQIVES..FVQPFDLEIA.PALRVGLVK
GRSB_BREBE/3138-3427------------NMSYQVA-S.-----------------.........NEQVEKMIDE..FIQPFDLSVA.PLLRVELLK
HTS1_COCCA/4782-5060------------KVPWSCH-YS-----------------.........DDLNTVLSHD....KKFPPGLDGPLHRVTIMR
GRSA_BREBE/620-923------------.LFDFYT-FD-----------------LTAN..DNEQQVICEESAR..LQNSINLEVG.PLVKIALFH
TYCA_BREPA/610-913------------.LYDFFS-YN-----------------LTAQ..PDVQQAIEAETQR..LHSSMNLQEG.PLVKVALFQ
PPSB_BACSU/2088-2393------------ELYALEL-FD-----------------.VKDSLTEARNTIEEAASR..MQEHIRLETG.PLLHAGLFR
ACVS_CEPAC/3050-3340------------..PRLTV-LD-----------------RRS...FEDAEDVQEALCE..IQSHFDLENG.PLYTVAYIH
ACVS1_PENCH/3082-3370------------..AQLRV-LN-----------------VKD...VDGSAAVNEILDG..WQSGFNLENG.PIGSIGYLH
ACVS_NOCLA/2998-3282------------..ITLHE-LD-----------------VRG....LADADLRQRLVD..WQRTFDLANG.PTACAAYLH
HTS1_COCCA/854-1158------------SVEVIGS-LS-----------------.........TDDREAAMLR..ARQSIDLTEG.PLIRCQLFN
PPSB_BACSU/7-310------------LTVYRED-IS-----------------RLAD.QEQQTLIDAFMTKD..REKGFDLQKD.PLMRLALFD
PPSC_BACSU/7-306------------CPIHIED-IS-----------------HLNE.RDKEHCTEAFKEQD..KSKGFDLQTD.VLMRISILK
ACVS_CEPAC/893-1203------------LDWRVVD-WT-----------------DVSSREKQLVALEQLQTED..LAKVYHLDKG.PLMRLYLIL
ACVS1_PENCH/916-1226------------LDWRFLY-FT-----------------DVAAGAVEDRKLEDLRRQD..LTERFKLDVG.RLFRVYLIK
ACVS_NOCLA/876-1186------------FDWRFVD-LS-----------------ATADDAEQEARVRELQERD..RTEPYDLAGG.RLFRVYLIK
HTS1_COCCA/1337-1660------------DIVILDV-RD-----------------VT.....AAITILDSYPPP..TEEGIALIKR.PPHRLLICT
HTS1_COCCA/2530-2808------------SIPQLDV-S.-----------------...........GLDTFLEQ...QLQVGFAPGAPLFRLAFVY
PPSB_BACSU/1052-1342------------DLKELEM-ES-----------------.........EQMLESAIET..FIKPFYLSSG.PLFRACVIT
ACVS_CEPAC/1969-2278------------QKLFSVD-VL-----------------RLT...S.ETEMQGRMAES..TAHAFKLDEE.LPIHVRLYQ
ACVS1_PENCH/1992-2295------------QGMFSVN-VD-----------------TAK...Q.VERLDQEIASL..SQHVFRLDDE.LPWEARILK
ACVS_NOCLA/1948-2242------------RLEVPST-TV-----------------DSR......AELDEVLTER..AGYVFRLHEE.LPIRAEAFD
ENTF_ECOLI/1-301------------ELPEIID-LR-----------------TN....IDPHGTAQALMQA.DLQQDLRVDSGKPLVFHQLIQ
HMWP2_YERE8/111-410------------DLRHNDA-ES-----------------R........QAYLDALRQR.LSHRLLRVEIG.ETFDFQLTL
HMWP2_YERE8/1492-1782------------WVIPTHT-LH-----------------TP.......EEALRVREKL..AHQVLNPEVW.PVFDLQVGY

PF03007

Q9RIU8_STRCO/6-253------------DHVR...-LH-------------------------APAT..DFHARAGRLMERPLERGRPPWEAHVLP
TGS3_MYCTU/5-271------------YHVRRSA-LP-------------------------SPGSDEQLHELIARLAARPLDKSRPLWEMYLVE
Y3154_MYCBO/4-256------------RHVWRIA-LP-------------------------RPGNEDQLFELIADLMARRLDRGRPLWEVWVIE
Y3115_MYCBO/4-273------------YHIRHLA-LP-------------------------APGSMQQFHETVSFLNTGLLDRGHPMWECYIID
Y1760_MYCTU/38-298------------HHLRRVA-MP-------------------------APGGRRELAEICGYIAGLPLDRDRPLWEMWVIE
Y919_MYCBO/32-296------------YHVRLSA-LP-------------------------PRAGTAELWALVSELHAGMLDRSRPLWQVDLIE
Q9X7A8_MYCLE/4-282------------FHVRRVR-VP-------------------------DPGTLREVFDLAEVIQQSPMDVSRPLWTATLVE
Y1425_MYCTU/4-264------------FHIRRIG-VP-------------------------APGGRRELEELVGRLMSYKLDRSRPLWELWVIE
Y3371_MYCTU/4-237------------QHVRRVA-LP-------------------------RPGDEAELFRAIALALERPLDPDRPLWECWIIE
Y3480_MYCTU/8-298------------YHVRRSA-LA-------------------------SPGDERELGIPVSRLHSHALDLRRPPWEVHFIE
Y3761_MYCBO/4-262------------YHVRRSA-LP-------------------------SPGRVRDLLELTSRLHTSLLDRHRPLWELHVVE
Y2484_MYCTU/4-282------------FHVRRVR-VS-------------------------GPATLREVLDLAEVILQSPLDISRPLWTATLVE
Y3087_MYCTU/4-268------------AHVRRVV-CP-------------------------APGGMAEFCALVEQIYAHPLDRDRPLWQTWVVE
Y221_MYCTU/4-263------------YHIRPWR-LR-------------------------APGGRRELDEAVGEIASTPLNRDHPLWEMYFVE
Y3740_MYCTU/1-257------------YHARRSA-LP-------------------------APGRVRELLELTSRLHSNLLDRHRPLWETHVIE
Y2306_MYCBO/4-256------------YHVRLSA-LP-------------------------YPGTGRDLGALVERLHSTPLDMAKPLWELHLIE

PF02458

O64549_ARATH/128-561------------EAGADVE.LR-----------------ELNLYD..PDESIAKLVP...IKKHG.......VIAIQVTQ
O04201_ARATH/6-476------------FAQAKSIHVS-----------------DVIAGIDVPDVVKEFFTYDRAVSYEGHN...RPILAVQVTE
Q43583_TOBAC/11-441------------EADADVT.LE-----------------QFGDELQPPFPCLEELLYDVPDSAGVLN...CPLLLIQVTR
O23392_ARATH/6-435------------DARVNNCPLT-----------------EFLKCP..DFDALQQLLPLDVVDNPYVAAATWPLLLVKATY
O64988_CLABR/1-429------------ETAFDVE.LH-----------------QFLLGE..ESNNLDLLVGLSGFLSETET...PPLAAIQLNM
O23393_ARATH/3-424------------EARTDLL.LP-----------------DFLRNL..NTDSLSGFLPTLAAGESPAA...WPLLSVKVTF
HCBT2_DIACA/1-446------------EAESSHV.LE-----------------DFGDFR.PNDELHRVMVPTCDYSKGISS...FPLLMVQLTR
O80816_ARATH/16-448------------TAASDYT.LE-----------------ELGDLVYPNPAFAQLVTSQLQSLPKDDQ....PLFVFQITS
O64470_ARATH/2-450------------EAESEGK.LS-----------------DFKDFS..PTPEFENLMPQVNYKNPIET...IPLFLAQVTK
DAT_CATRO/8-434------------EVRIRCR.MN-----------------DILKYELRSYARDLVLPKRVTVGSED......TTAIVQLSH
O80467_ARATH/11-450------------VATANVE.LS-----------------SLKNLENIDSDTALNFLPVLHVDIDG.....YRPFALQVTK

PF00755

CACP_MOUSE/34-616GPK...QDSVVNFLKSKRP-P...THITVVHNYQFFELDVYHS..DGTPLTSDQIFVQLEKIWNSSLQSNK..EPVGILT
Q20278_CAEEL/11-599ALP...KDRIKRYFRTEAE-GKCPSHVIILCNGHVWKLETTCE..NSKFLNIFEIQNALKRIKESSR..TSVECSIVQLT
CLAT_RAT/22-612GHT...QDTLVAQKSSIMP-E..PEHVIVACCNQFFVLDVVI...NFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLT
CACM_YEAST/3-644GEP...SCHLQTDATSH..-.....HVVAMYRGQFYWFDVLDTRNEPIFATPEQLEWNLYSIIMDAESAGSGSAPFGVFT
Q23066_CAEEL/147-743GKK...IDQLILHGIQK..-.....HIVVVLRGKYYKIHVVDD..KNNIYTVEQLTKIFHEMISRDEKEEGVIGKIAALT
CPT1B_HUMAN/172-763GKD...TDVLQHLSDSR..-.....HVAVYHKGRFFKLWLYEG...ARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALT
CLAT_CAEEL/19-623GVG...EDTQIRKQKTNDG-N...EHVLVMCRNQTFLLHSRIN...GALVSYADVEYQLAQIEEISKINQNNTANIGASG
OCTC_RAT/19-605GIT...RDSIMNYFKTESE-GHCPTHIAVLCRGRAFVFDVLHD...GCLITPPELLRQLTYIYQKCWN.EPVGPSIAALT
OCTC_BOVIN/19-605GIT...RDSIINYFRTESE-GHSPSHLAVLCRGRVFVFDVMHE...GYLMTAPEIQRQLTYIQKKCHS.EPDGPGVAALT
Q17499_CAEEL/21-602KVG...VDEIRYGCDYKEK-L...QHILVIRNGHLFRVQVLDS..NEQPLSIFAITQQLAKVVSESQTPNP..HPVGIVS
O44619_CAEEL/140-733GKQ...YDSFQWNKPAK..-.....HVILVHDCTWYKVDICDS..NGQLYTVDQLAKIVAEVMGRDDKSKGYLRNIASLT
CLAT_DROME/87-717GVK...QDSQFLPSRERLN-DE.DRHVVVICRNQMYCVVLQAS..DRGKLSESEIASQILYVLSDAPCLPAKPVPVGLLT
CACP_COLLI/35-617GPK...RDSIVNYAKGKKQ-S...RHITVVHNFQFFELDVYNS..DGSPLTTDQLFIQLEKIWNTSLQTNK..EPVGILT
CPT2_HUMAN/48-649KPSR.D..ELFTDDKAR..-.....HLLVLRKGNFYIFDVLD..QDGNIVSPSEIQAHLKYILSDS..SPAPEFPLAYLT
CACP_YEAST/73-658GKPEDNQDTNIFYSVYENN-.....FVTIAYKGKFYKLMTHDG..NDKPLSENEIWRQLYSVVFQGSQSDPKLGGIGSLT
CACP_CANTR/41-613AE...GSDITQHYNGEENQ-.....FFVVIYKNNFYKVPTHK...NGQRLTKGEIYSYLQEIKNDAT...PKGLGLGALT
CPT1A_HUMAN/170-763GEE...TDTIQHMRDSK..-.....HIVVYHRGRYFKVWLYH...DGRLLKPREMEQQMQRILDNTSEPQPGEARLAALT

PF00198

Q7PG41_ANOGA/236-467D-..EPS...ESVIYKRY---HNISVAMQTP.....QG..LVVPNVKSVEQ-----------------------------
A4H464_LEIBR/234-468P-..ADC...SALVRKAA---HNIGFAMDTP.....NG..LIVPVVLHVER-----------------------------
Q8IJJ4_PLAF7/416-640D-..KDN...GKILYNKD---VNIGNALGLP.....DS..LLTPVLKKVDK-----------------------------
B0K8I7_THEP3/156-382E-..GEY.....IIKNSS---INLGIAVALD.....NG..LIVPVVKEADK-----------------------------
A9B180_HERA2/216-442A-..GDK.....LLVHKD---VHISVAVATD.....AG..LLAPVVRNCDS-----------------------------
B9LC79_CHLSY/227-461Q-SIGHE...EQIVLVDE---INIGIAVALE.....QG..LIVPVIRKANE-----------------------------
B8GAA3_CHLAD/150-362A-..ETA.....IMLRHR---YHTAVCLS.......DG..RWV.LIRDAGD-----------------------------
Q7MB23_PHOLL/166-382E-..KQR.....IHRYST---VNIGVAIDMN.....HG..LRVPVIRQINQ-----------------------------
A5G2C9_ACICJ/193-425T-..EEA.....MIRYHD---VDISVAVAIP.....DG..LITPIIRKADQ-----------------------------
A7K5W2_VIBSE/398-631S-..EDG...ESLILKKY---VNVGIAVDTP.....NG..LVVPVFKDVNK-----------------------------
A6QGW5_STAAE/188-420D-..GDD.....MITKQY---YDIGVAVSTD.....DG..LLVPFVRDCDK-----------------------------
Q8IEA6_PLAF7/189-419E-..NDE.....IVYKNY---IDISVAVATP.....NG..LTVPVIRNCQN-----------------------------
Q6C806_YARLI/226-463D-LSGDK...PAVLMRDY---HNISIAMDTP.....NG..LLVPTIKNVQD-----------------------------
A6Q9K5_SULNB/241-441.-..TDD....HMQLWPN---ASISVAMA.......HGEYLYMPVFKTVNT-----------------------------
A4CCC7_9GAMM/276-508N-..DEC...TELTYFTD---HNIGMAVDSK.....IG..LLVPNIKQCQQ-----------------------------
A4IKZ7_GEOTN/204-435D-..EEQ...EEIVIHES---IHIGFAVDTD.....RG..LLVPVIRDADQ-----------------------------
A5IXN4_MYCAP/10-243D-..GVE...GKVYYPGT---LNIGIAVDTP.....FG..LFVPVIRGVEN-----------------------------
Q05SD7_9SYNE/221-446.-..TAA....GMAYPAD---VNVAVAVAME.....DG.GLITPVLRQADR-----------------------------
Q2B858_9BACI/159-388D-..EKA...GLIHLLPE---HHIGVAVNAE.....DG..LIVPVIGNAEE-----------------------------
ODP2_MYCPN/169-401D-..KER...NLIVLNKD---VNVGIAVDTP.....DG..LIVPNIKQAQT-----------------------------
A6DTS5_9BACT/215-442Q-..GDK.....IVQFND---VDISVAVSIP.....DG..LITPIVRSADS-----------------------------
Q67RX4_SYMTH/33-262T-..PQG.....FVIPRY---INLGIATAVP.....GG..VLLPVVPGAER-----------------------------
A0QDC1_MYCA1/158-386.-..VDTPQGPQVRIEHR---VHLGVAVATE.....RG..LLVPVIADAHT-----------------------------
A3RZM1_RALSL/164-375D-..GHA...GRRHVLEK---IDLGIAVDLP.....DG..LFVPVLRDVAH-----------------------------
Q018W7_OSTTA/269-503L-..GDK.....IRRYKK---ADISVAVQTE.....RG..LMVPIVRSACC-----------------------------
A0JUQ7_ARTS2/229-460D-..EAN...QEIVQYNY---VNLGIAAATP.....RG..LTVPNIKDAHS-----------------------------
Q9CJD7_LACLA/298-530D-..YEK...QEIVYHEH---VNLGIAVNAP.....TG..LYVPVIHEAET-----------------------------
A0LSF1_ACIC1/217-449A-..GEK.....LLQHKH---IHIGVAVAIP.....DG..LIVPVIRDADT-----------------------------
Q253H7_CHLFF/159-388D-..GDT.....IVVKKS---INVGVAVNLN....KEG..VVVPVIRNCQD-----------------------------
KGD_MYCS2/97-344.-..AVVDGKPTAITPAH---TNLGLAIDLQGKDGNRS..LVVAAIKRCET-----------------------------
A5GAC3_GEOUR/194-419A-..ADG.....IVLHDE---VNIGFAVSLD.....DG..LLVPVIKGCGG-----------------------------
Q55ZP3_CRYNB/357-619.-..KHG........TDG---TEKWLEVNPK.....YG..LLTPSLPPLNP-----------------------------
Q1NYU2_9FLAO/144-371T-..EKS.....ILYHNN---INIGIAVALE.....DG..LIVPVINQVNE-----------------------------
A2QTN3_ASPNC/236-469D-..TTDPAKPQLIMRAK---HNIGVAMDTP.....QG..LLVPNIKDVGN-----------------------------
Q59298_9CLOT/219-443N-..GNE.....LITRNY---VNMGVAVAID.....GG..LVVPVVKYANE-----------------------------
Q9M724_ARATH/249-480N-..AES...LEIILKGS---HNIGVAMATE.....HG..LVVPNIKNVQS-----------------------------
A0CLV5_PARTE/180-390D-..PTKQ..FEYTQHLS---HNVSVALDSP.....KG..LVVSKYQEY..-----------------------------
A4FGQ0_SACEN/225-452E-..QDE.....IVLLDR---IHLGFAAQTD.....RG..LVVPVVRDAQS-----------------------------
Q6MPR6_BDEBA/309-540D-..DAA...GEIVYKKY---FNLGFAADTP.....NG..LVVPVIKNADQ-----------------------------
A1SQ65_NOCSJ/201-427T-..PDA.....VRSFSS---VDVAVAVATD.....RG..LVTPVLRDVTS-----------------------------
Q6AFG4_LEIXX/233-470D-..GDN.....IVYPNQ---ENMSIAVDTE.....RG..LLTPVVRNASE-----------------------------
A6U1Y7_STAA2/191-418Q-..GNE.....IVLHKD---INISIAVADE.....NK..LYVPVIKHADE-----------------------------
A5GEF2_GEOUR/180-403D-..RHQ.......VSEA---IHIGFAISMR.....QG.GLITPAIHNVDM-----------------------------
A5V538_SPHWW/170-392D-.........RVEPLDA---IAIGIAVEAP.....GG..VMAPVVPLGG.-----------------------------
Q03DD0_PEDPA/195-427D-..IEK...QEIVYYED---TNVSFAVDTD.....NG..LFVPNVKNVKS-----------------------------
Q0RVL0_RHOSR/192-421Q-..ADR.....IIEHDH---VHLGMAVSVP.....DG..LIVPVVRDADQ-----------------------------
Q5P9L2_ANAMM/204-433E-..GDR.....IRYHRD---INISFAVSID.....GG..LITPVVENVDA-----------------------------
Q5UWH1_HALMA/304-539D-..EAN...EEIVEKQY---YNIGVATATD.....DG..LLVPVVENVDA-----------------------------
Q1Q664_9BACT/170-401T-..DNG.....ILQKNY---INLGIAVALE.....DG..LVVPVIKDADK-----------------------------
Q6MTX8_MYCMS/197-428D-..FAN...NKIQFMHN---INIGIAVDTP.....NG..LMVPVIKGVDH-----------------------------
Q820B9_TROW8/211-440.-..SEQ....EILLHKS---VNLGIAVATD.....RG..LVVPNIKNAQC-----------------------------
A7NKS9_ROSCS/223-453S-..DEG.....IIRHPM---VNIAIAVALE.....SG..LMAPVVTNCQD-----------------------------
A6U0R3_STAA2/197-428N-..EEA...GEIVHKHY---WNIGIAADTD.....RG..LLVPVVKHADR-----------------------------
ODO2_BUCAI/188-418D-..QTD.....IVFYKN---FDISIAISTP.....RG..LITPVIRNADT-----------------------------
Q2NJY8_AYWBP/185-416D-..DVK...EEVTYKKF---INLGVAVDTK.....DG..LIVPNIKDANK-----------------------------
A4XEQ9_NOVAD/253-480H-..GDS.....VHSFPH---ADVAIAVASP.....KG..LVTPIVRQADR-----------------------------
Q5SLR1_THET8/217-449D-..EER...QEIVYKRY---YHIGLAVATE.....RG..LIVPVVRDADR-----------------------------
Q5DM38_NYCOV/252-485M-..GDF.....VRRYKD---VDMSVAVQTP.....NG..LITPIVPRANL-----------------------------
Q5F3G9_CHICK/271-501D-..GEG.....CRQLQS---IDISIAVATD.....RG..LITPIIKDVPA-----------------------------
A4F1Y4_STRVG/208-431L-..GED....HLRVFDH---VDLGIACAGE.....DG.DLTIGVVRGSDL-----------------------------
A4ICH2_LEIIN/226-463Q-..GDF.....IRQYAT---VDVSVAVATP.....TG..LITPIIRNAQA-----------------------------
Q9KG97_BACHD/180-411D-..EET...NEIVLKKD---YHIGIATDTE.....KG..LIVPVIQNADQ-----------------------------
A0LLM2_SYNFM/206-441D-..PER...EEIVFKRY---YNIGVAVDTD.....RG..LIVPVIRDVDR-----------------------------
Q04KE8_STRP2/115-347D-..GKT.....IITHNY---VNLAMAVGMD.....NG..LMTPVVYNAEK-----------------------------
A7HBV2_ANADF/220-451D-..DER...GELVLHRR---YDVGIASATD.....AG..LVVPVVRGADR-----------------------------
Q1IIF0_KORVE/320-555E-..GEN.....IHYKKD---INLGIAVALD.....WG..LIVPVVKQADG-----------------------------
A5JBE6_BURML/251-482D-..DEA...GVVTRHGA---VHLGIATQSK.....AG..LMVPVVRHAEA-----------------------------
A5G5K2_GEOUR/156-387D-..AEA...ETIILKKH---YHFGIAVETP.....DG..LMVPVIRDVDK-----------------------------
Q4XMM8_PLACH/203-444N-..AKT...NTYVVYNN---HNICIAMDTP.....HG..LLVPNIKNVEK-----------------------------
Q8RD59_THETN/185-414.-..EEG....QIILRNE---INIGLAVALD.....EG..LIVPVIREVDK-----------------------------
Q8CTW0_STAES/196-425.-..EQG....ELTEYED---VHLGIATSLD.....EG..LMVPVINHADT-----------------------------
A4XHV3_CALS8/229-459L-..DDK.....MRYFKN---VHLGFAVDTE.....RG..LMVPTIFNSNK-----------------------------
A6TMP1_ALKMQ/205-437D-..EEN...QMLILKKY---YNIGIAVDTP.....EG..LTVPVIKDVDQ-----------------------------
Q04RI4_LEPBJ/240-470R-..EDH.....ILEHGR---VDIGVAVSIE.....GG..LITPYIRNAEE-----------------------------
A7SJI4_NEMVE/174-396N-..GKE.....IEYLKD---IDLAVDVATD.....VG..IITPVIRNAAY-----------------------------
A1ZHD0_9BACT/218-453E-..GEN.....IIVKKD---INIGMATALP.....SG.NLIVPVIKNADQ-----------------------------
Q4DDM3_TRYCC/200-436S-..QKC...ETFIIRKA---HNIGFAVHSP.....KG..LIVPVIRNVEQ-----------------------------
A7BC27_9ACTO/216-447.-..EDG....VLTEFEQ---VHLGFACDTP.....RG..LLVPVIRSAQA-----------------------------
O84249_CHLTR/201-428N-SVDNK.....IIRFST---IDISIAVAIP.....DG..VIAPIVRCADR-----------------------------
Q6KH63_MYCMO/220-452D-..EQA...SELVYSGT---LNIGIAVDTE.....AG..LMVPVIKNADK-----------------------------
Q5DAR0_SCHJA/35-267D-..AQA...ESPVYLRS---VDISMAVATS.....SG..LITPILKSADT-----------------------------
Q87IG1_VIBPA/172-383D-..AET...MTRCVHPT---VNLGVAVDSR.....HG..LYVPVLRHADE-----------------------------
Q6A613_PROAC/233-468D-..DAA...DQIVFRDH---INLGIAAATP.....RG..LMVPVVRDAQD-----------------------------
Q2PY29_9BACT/192-418L-..GDV.....IRTNYD---VHVGIAVAVE.....DG..LLVPVVRHADA-----------------------------
ODP2_SCHPO/252-483M-..GDF.....IRQYKN---VDISMAVATP.....SG..LITPVIRNTHA-----------------------------
O45279_CAEEL/97-322T-..PEG......IGLGS---VDISVAVATP.....TG..LITPIVENSDI-----------------------------
Q97CK2_THEVO/179-398D-..EAN...RRYLIKKY---YNIGIAVDTP.....DG..LNVFVVKDADR-----------------------------
A0NRH8_9RHOB/70-301S-..SDG...KTLFLKDY---VHLGVAVDTA.....HG..LMVPVIRDVDR-----------------------------
Q3A0D1_PELCD/165-395E-..EEA.....IVYQHF---YDIGIAVATD.....QG..LVAPVLLNADR-----------------------------
Q1IX53_DEIGD/361-594D-..LEH...QQVIYKDY---VNLGVAVDTP.....QG..LLVPVLKDADR-----------------------------
Q7WED2_BORBR/182-409D-.........HIVQFQG---IDVGVAVSTE.....RG..LMAPVLHGLDH-----------------------------
Q3J9C7_NITOC/185-392Q-..HED....RILEREQ---IDVGLAVAT......EGMGLVVPVLRDTSH-----------------------------
Q0W153_UNCMA/195-425D-..DEK...GEIVLKKY---YNIGLAIDTP.....RG..LMVAPVKDADR-----------------------------
Q7UU97_RHOBA/235-467D-..SEN...QQVIYKDY---VNIGIAVDTD.....NG..LVVPVMHNADQ-----------------------------
Q81CI7_BACCR/169-399I-..DDA.....IHQFEH---VHLGMAVALE.....KG..LIVPAIRFANN-----------------------------
ODP2_BUCBP/176-410.-..INKDNRIAIVLNEH---INIGIVVDTD.....DG..LLVPVINRVNK-----------------------------
ODP2_YEAST/248-482N-..ENV.....IRKFKN---VDVSVAVATP.....TG..LLTPIVKNCEA-----------------------------
Q8RBW8_THETN/173-398D-..GDD.....MVVPAE---VHLGFAVA.......RGDELLVPVIKNAHR-----------------------------
Q4P9L5_USTMA/1242-1493N-..SDQ....KLVRRSS---HDVSIALTSK.....VG..LLTPCITDVQA-----------------------------
A8FC90_BACP2/211-441E-..QNE.....LHFHED---VHIGLAVAVK.....DG..LMVPVISHANQ-----------------------------

PF00302

CAT3_ECOLX/1-205----KDD---.ELIVWDS---VDPQFTVFHQETETFSA--LSCPYSSDIDQ-----------------------------
CAT_PROMI/6-209----KDG---.ELVIWDS---VNPGYNIFHEQTETFSS--LWSYYHKDINR-----------------------------
CAT2_CLOPF/1-202----NQD---GELGIYDE---MIPSYTIFHNDTETFSS--LWTECKSDFKS-----------------------------
CAT_CLOBU/1-206----DHK---GSLGYWDS---MNPSYTIFHKENETFSS--IWTEYNKSFLR-----------------------------
CAT1_STAAU/1-205----NSD---GELGYWDK---LEPLYTIFDGVSKTFSG--IWTPVKNDFKE-----------------------------
CAT_SALTI/6-209----KDG---.ELVIWDS---VHPCYTVFHEQTETFSS--LWSEYHDDFRQ-----------------------------
CAT_STRAC/6-211----NSS---GDPAVWPV---VHPAFTVFNPERETFAC--LWAPYDPDFGT-----------------------------
CAT2_ECOLX/1-205----KDN---.ELIYWDQ---SDPVFTVFHKETETFSA--LSCRYFPDLSE-----------------------------
CAT2_STAAU/1-205----NSE---NKLGYWDK---LNPLYTVFNKQTEKFTN--IWTESDNNFTS-----------------------------
CAT_BACPU/1-203----VND---.ELGYWEI---LHPSYTILNKETKTFSS--IWTPFDENFAQ-----------------------------
CAT1_CLOPF/1-206----DQK---GKLGYWDS---MNPSYTVFHKDNETFSS--IWTEYDENFPR-----------------------------
CAT_CAMCO/1-202----DEN---GQVGVFSE---MLPCYTVFHKETETFSS--IWTEFTADYTE-----------------------------

PF07247

Q6CJX7_KLULA/18-514S-ADDKKGARGFKDILYI---TNHVTSDGTS-----GA--NLLEDLSIELG----------------KF-----------
Q6XBS9_SACPS/47-542E-EDDTN..KWKKFI.FV---SNHCMCDGRS-----SI--HFFQDLRDELN----------------NI-----------
Q6BRP8_DEBHA/9-477S-SSSK.....KQYVTFH---CDHTFFDGLS-----AA--QFHKDLIVEFG----------------IY-----------
Q6FVS8_CANGA/40-557S-AEGGG.AQWKKFV.YI---SNHCCSDAIS-----AV--NLFQDIAENVS----------------LI-----------
Q5ANM4_CANAL/12-486D-F..........HLSAI---FEHTIGDGLV-----AN--YFHEVLLKNLA----------------EC-----------
YA33_SCHPO/9-444D-.........KSELVFI---YDHSLFDGGS-----GP--LFHKYVLEGLQ----------------MS-----------
Q5AEJ2_CANAL/10-465E-MRPNG....NQFISVS---FDHSNYDGLS-----GV--QFQKDLAKELL----------------TA-----------
Q6XBT1_SACPS/23-529G-KDTDGFETWKNFV.YV---TNHCGSDGVS-----GS--NFFKDLALLFC----------------KI-----------
Q6FND8_CANGA/4-456K-A........NKMI.FA---TDHLFFDGIA-----TV--LFWTELLKSLE----------------EL-----------

PF00668

PKSJ_BACSU/690-989R-SEQ.-----EHFLLVV...IHHLIFDGVS-----SV--TFIRSLFDTYQ----------------LL-----------
SRFAA_BACSU/3121-3425A-ED..-----GDHLLLA...IHHLVVDGVS-----WR--ILLEDFAAVYT----------------QL-----------
SRFAA_BACSU/2097-2386H-SDT.-----EHVLLFD...MHHIISDGAS-----VG--VLIEELSKLYD----------------GE-----------
SRFAA_BACSU/1058-1346L-EEN.-----RHMLLFD...MHHLISDGVS-----IG--IMLEELARIYK----------------GE-----------
SRFAA_BACSU/2-303I-KEN.-----EVWFYAN...VHHVISDGIS-----MN--ILGNAIMHIYL----------------EL-----------
SRFAB_BACSU/3117-3421T-EA..-----GDHLLIA...VHHLVVDGVS-----WR--ILLEDFASGYM----------------QA-----------
PPSA_BACSU/2089-2400T-AE..-----GDHLLIA...LHHLVIDGVS-----WR--ILLEDLAAAYQ----------------QA-----------
ACVS_EMENI/3105-3393G-YEDR-----SARVWFS...VHHIIIDIVS-----WQ--ILARDLQILYE----------------GG-----------
SRFAB_BACSU/6-306L-AAD.-----QLYLVWS...NHHIMMDGWS-----MG--VLMKSLFQNYE----------------AL-----------
SRFAC_BACSU/9-309K-AEE.-----SFEWVWS...YHHIILDGWC-----FG--IVVQDLFKVYN----------------AL-----------
ACVS_EMENI/944-1252H-SST.-----RFSCLFS...CHHAILDGWS-----LP--LLFRKTHGTYL----------------HL-----------
SRFAB_BACSU/1054-1340L-EEK.-----RHLLLID...MHHIITDGSS-----TG--ILIGDLAKIYQ----------------GA-----------
SRFAB_BACSU/2093-2382I-EAK.-----KHLLLLD...MHHIIADGVS-----RG--IFVKELALLYK----------------GE-----------
PPSA_BACSU/1048-1338I-SDE.-----RHLLLVD...MHHIISDGVS-----VN--ILIREFGELYN----------------NR-----------
ACVS_EMENI/2018-2321H-KTG.-----NLYLTLS...FHHTCFDAWS-----LK--IFERELRVFCA----------------SN-----------
PPSA_BACSU/2-300I-DSH.-----EVWLFAK...FHHIIMDGIS-----LN--VMGNQIIDLYQ----------------KM-----------
GRSB_BREBE/9-310T-GKV.-----NYQMIWS...FHHILMDGWC-----FN--IIFNDLFNIYL----------------SL-----------
GRSB_BREBE/1058-1347L-EAE.-----RHLFIMD...MHHIISDGVS-----MQ--IMIQEIADLYK----------------EK-----------
GRSB_BREBE/2093-2382L-ASD.-----RHLFLMD...MHHIISDGVS-----MQ--IITKEIADLYK----------------GK-----------
GRSB_BREBE/3138-3427L-EED.-----RHVLIFD...MHHIISDGIS-----SN--ILMKELGELYQ----------------GN-----------
HTS1_COCCA/4782-5060H-RDPT-----ESMLVWT...LNHAAYDAWS-----LR--MMLEHITEAYA----------------NP-----------
GRSA_BREBE/620-923T-QN..-----GDHLFMA...IHHLVVDGIS-----WR--ILFEDLATAYE----------------QA-----------
TYCA_BREPA/610-913T-LH..-----GDHLFLA...IHHLVVDGIS-----WR--ILFEDLATGYA----------------QA-----------
PPSB_BACSU/2088-2393T-EN..-----GDHLFLT...IHHLVVDAVS-----WR--ILFEDFSTAYK----------------QA-----------
ACVS_CEPAC/3050-3340G-YEDG-----SARVWFA...CHHVMVDTVS-----WN--IILQDLQALYH----------------GD-----------
ACVS1_PENCH/3082-3370G-YEDR-----SARVWFS...VHHMAIDTVS-----WQ--ILVRDLQTLYR----------------NG-----------
ACVS_NOCLA/2998-3282G-FDDG-----TARVWFA...LHHLVVDTVS-----WH--ILAQDLEILYN----------------GG-----------
HTS1_COCCA/854-1158N-NVDE-----ASRLFFV..VIHHAVVDLVS-----WR--IIMEELEAHLA----------------TD-----------
PPSB_BACSU/7-310R-GDS.-----QYTCVWT...HHHIIMDGWC-----LG--IILKEFFSMYD----------------SL-----------
PPSC_BACSU/7-306W-APD.-----HYVCIWS...HHHILMDGWC-----LG--IVIKDFLHIYQ----------------AL-----------
ACVS_CEPAC/893-1203L-PDS.-----KYSCLFS...CHHAILDGWS-----LP--LLFNNVHQAYL----------------DL-----------
ACVS1_PENCH/916-1226H-SEN.-----RFTCLFS...CHHAILDGWS-----LP--LLFEKVHETYL----------------QL-----------
ACVS_NOCLA/876-1186Q-RED.-----LFSLIFS...CHHIILDGWS-----LP--VLHDEVHRNYL----------------AL-----------
HTS1_COCCA/1337-1660T-IEG.-----SVLIKFQ...VNHLVFDGMS-----TD--KIIQDLSKAYT----------------CR-----------
HTS1_COCCA/2530-2808S-KADD-----CDYFVIS...AHHAIYDGWS-----LN--LIWSQVLALYT----------------NG-----------
PPSB_BACSU/1052-1342M-GNN.-----RGFLLLD...MHHIIADGVS-----MS--TLVQEFTDLYC----------------GK-----------
ACVS_CEPAC/1969-2278V-VRD.-----GRTLSFASIVCHHLAFDAWS-----WD--VFQRDLDAFYA----------------VH-----------
ACVS1_PENCH/1992-2295L-ESG.-----GLYLILA...FHHTCFDAWS-----LK--VFEQELRALYA----------------AL-----------
ACVS_NOCLA/1948-2242H-GD..-----EIYLSVV...VHHSCFDGWS-----WD--IFRRELAALLD----------------GV-----------
ENTF_ECOLI/1-301V-ADN.-----RWYWYQR...YHHLLVDGFS-----FP--AITRQIANIYC----------------TW-----------
HMWP2_YERE8/111-410L-PDN.-----RHRLHVN...IDLLIMDASS-----FT--LFFDELNALLA----------------GE-----------
HMWP2_YERE8/1492-1782V-DG.M-----PARLWLC...LDNLLLDGLS-----MQ--ILLAELEHGYR----------------YP-----------

PF03007

Q9RIU8_STRCO/6-253G.ADGG-----SFAVLFK---FHHALADGLR-----AL--TLAAGVLD--------------------------------
TGS3_MYCTU/5-271G.LEKN-----RIALYTK---SHQALINGVT-----AL--AIGHVIAD--------------------------------
Y3154_MYCBO/4-256G.LADS-----KWAILTK---LHHCMADGIA-----AT--HLLAGLSD--------------------------------
Y3115_MYCBO/4-273G.IERG-----RIAILLK---VHHALIDGEG-----GL--RAMRNFLS--------------------------------
Y1760_MYCTU/38-298GGARSD-----TVAVMLK---VHHAVVDGVA-----GA--NLLSHLCS--------------------------------
Y919_MYCBO/32-296G.LPGG-----RCAVYVK---VHHALADGVS-----VM--RLLQRIVT--------------------------------
Q9X7A8_MYCLE/4-282G.LAAG-----RAAMLLQ---ISHAITDGVG-----SV--EMFAEMYD--------------------------------
Y1425_MYCTU/4-264G.VEGG-----RIATLTK---MHHAIVDGVS-----GA--GLGEILLD--------------------------------
Y3371_MYCTU/4-237G.LNGN-----RWAILIK---IHHCMAGAMS-----AA--HLLARLCD--------------------------------
Y3480_MYCTU/8-298G.LEGG-----RFAIYIK---MHHSLIDGYT-----GQ--KMLARSLS--------------------------------
Y3761_MYCBO/4-262G.LNDG-----RFAMYTK---MHHALIDGVS-----AM--KLAQRTLS--------------------------------
Y2484_MYCTU/4-282G.MADG-----RAAMLLH---VSHAVTDGVG-----GV--EMFAQIYD--------------------------------
Y3087_MYCTU/4-268G.LDGG-----RVALVTL---LHHAYSDGVG-----VL--DMLAAFYN--------------------------------
Y221_MYCTU/4-263G.LANH-----RIAVVAK---IHHALADGVA-----SA--NMMARGMD--------------------------------
Y3740_MYCTU/1-257G.LRDG-----RFAIYSK---MHHALVDGVS-----GL--TLMRQPMT--------------------------------
Y2306_MYCBO/4-256G.LTGR-----QFAMYFK---AHHCAVDGLG-----GV--NLIKSWLT--------------------------------

PF02458

O64549_ARATH/128-561L-KCG.-----SIVVGCT---FDHRVADAYS-----MN--MFLLSWAEISR----------------SD..VPISCVPSF
O04201_ARATH/6-476L-NDG.-----.VFIGCS---VNHAVTDGTS-----LW--NFINTFAEVSR----------------GA..KNVTRQPDF
Q43583_TOBAC/11-441L-RCG.-----GFIFALR---LNHTMSDAPG-----LV--QFMTAVGEMAR----------------GG..SAPSILPVW
O23392_ARATH/6-435F-GCG.-----GMAIGIC---ITHKIADAAS-----IS--TFIRSWAATAR----------------GENDAAAMESPVF
O64988_CLABR/1-429F-KCG.-----GLVIGAQ---FNHIIGDMFT-----MS--TFMNSWAKACR----------------VG..IKEVAHPTF
O23393_ARATH/3-424F-GSGS-----GVAVSVS---VSHKICDIAS-----LV--TFVKDWATTTA----------------KG...KSNSTIEF
HCBT2_DIACA/1-446F-RCG.-----GVSIGFA---QHHHACDGMS-----HF--EFNNSWARIAK----------------G...LLPALEPVH
O80816_ARATH/16-448F-KCG.-----GFAMGIS---TNHTTFDGLS-----FK--TFLENLASLLH----------------EK...PLSTPPCN
O64470_ARATH/2-450F-KCG.-----GISLSVN---VSHAIVDGQS-----AL--HLISEWGRLAR----------------GE..PLETVPFLD
DAT_CATRO/8-434F-DCG.-----GLAVAFG---ISHKVADGGT-----IA--SFMKDWAASAC----------------YLSSSHHVPTPLL
O80467_ARATH/11-450F-ECG.-----GFILGMA---MSHAMCDGYG-----EG--HIMCALTDLAG----------------GK..KKPMVTPIW

PF00755

CACP_MOUSE/34-616S-NHRNTWAKAYNNLIKDKV..NRESVNSIQ-----KS--IFTVCLDKQVP................RVSDDVYRNHVA.
Q20278_CAEEL/11-599S-LGRDNWAQIRESMIQNSN.RNVELFHDVD-----SA--VFCLTLSDDFV................ENESEV.......
CLAT_RAT/22-612S-DGRSEWAKARTVLLKDST..NRDSLDMIE-----RC--ICLVCLDGP..................GTGELS.DTHRA.
CACM_YEAST/3-644T-ESRRVWSNIRDYLFHADDCTNWRNLKLID-----SA--LFVVCLDDVAF................AADQQDELTRSM.
Q23066_CAEEL/147-743H-DTRDSWHRNRQKYFLGNV.KNAQILKEIE-----CA--VFFFTLDEN.D................DYGYDEKK.PEV.
CPT1B_HUMAN/172-763A-GGRVEWAQARQAFFSSGK..NKAALEAIE-----RA--AFFVALDEESY................SYDPED...EAS.
CLAT_CAEEL/19-623V-GPRDNAALFWQDMLTVEQ..NSKSYEWVK-----SA--LFVVCLDMEDPIDYG.......KNDTMSISEKEKEFVARG
OCTC_RAT/19-605S-EERTRWAKAREYLIGLDP.ENLTLLEKIQ-----SS--LFVYSIEDTSP................HATPEN...FSQ.
OCTC_BOVIN/19-605T-EERTRWAKAREYLISLNP.ENLTILEKIQ-----SS--LLVFCLDDDSP................HVTPED...YSQ.
Q17499_CAEEL/21-602S-DSRDKWANVYSSLKKDNN..NAKSLEAVE-----KS--LFVVCLDKASE................PPVGYTEKDEQS.
O44619_CAEEL/140-733T-DRRTEWCSNRQKFFLENK.HNQKLLQQIE-----TA--QFVMSVDGD.L................NWGVET...TEQ.
CLAT_DROME/87-717A-EPRSTWARDREMLQEDER..NQRNLELIE-----TA--QVVLCLDEPLAGNFNARGFTGATPTVHRAGDRDE..TNMA
CACP_COLLI/35-617T-NHRNSWAKAYNNLLKDKT..NKESVRTIE-----KS--ICTICLDAPMP................RVSDDIYKSPVA.
CPT2_HUMAN/48-649S-ENRDIWAELRQKLMSSG...NEESLRKVD-----SA--VFCLCLDDF..................PIKDLVHLSHNM.
CACP_YEAST/73-658S-LPRDQWREVHLELMKD.P.ISQDSLETIH-----KS--SFMLCLDLDQS................PVTLEEKS.....
CACP_CANTR/41-613S-LNRDEWLSAYNNLLKS.P.INEASLGSIF-----AS--SFVIALDSN.N................PVTIEEKS.....
CPT1A_HUMAN/170-763A-GDRVPWARCRQAYFGRGK..NKQSLDAVE-----KA--AFFVTLDET..................EEGYRSEDPDTS.

PF00198

Q7PG41_ANOGA/236-467------------------------------------------------------------------------KSI-----
A4H464_LEIBR/234-468------------------------------------------------------------------------KSI-----
Q8IJJ4_PLAF7/416-640------------------------------------------------------------------------KDI-----
B0K8I7_THEP3/156-382------------------------------------------------------------------------KSL-----
A9B180_HERA2/216-442------------------------------------------------------------------------LSL-----
B9LC79_CHLSY/227-461------------------------------------------------------------------------KGI-----
B8GAA3_CHLAD/150-362------------------------------------------------------------------------LTE-----
Q7MB23_PHOLL/166-382------------------------------------------------------------------------LAL-----
A5G2C9_ACICJ/193-425------------------------------------------------------------------------KGL-----
A7K5W2_VIBSE/398-631------------------------------------------------------------------------KGI-----
A6QGW5_STAAE/188-420------------------------------------------------------------------------KNF-----
Q8IEA6_PLAF7/189-419------------------------------------------------------------------------KNL-----
Q6C806_YARLI/226-463------------------------------------------------------------------------KTI-----
A6Q9K5_SULNB/241-441------------------------------------------------------------------------KNP-----
A4CCC7_9GAMM/276-508------------------------------------------------------------------------KSI-----
A4IKZ7_GEOTN/204-435------------------------------------------------------------------------KSL-----
A5IXN4_MYCAP/10-243------------------------------------------------------------------------LSI-----
Q05SD7_9SYNE/221-446------------------------------------------------------------------------TDL-----
Q2B858_9BACI/159-388------------------------------------------------------------------------KTI-----
ODP2_MYCPN/169-401------------------------------------------------------------------------KSV-----
A6DTS5_9BACT/215-442------------------------------------------------------------------------KGL-----
Q67RX4_SYMTH/33-262------------------------------------------------------------------------MGF-----
A0QDC1_MYCA1/158-386------------------------------------------------------------------------KTT-----
A3RZM1_RALSL/164-375------------------------------------------------------------------------RDA-----
Q018W7_OSTTA/269-503------------------------------------------------------------------------LGL-----
A0JUQ7_ARTS2/229-460------------------------------------------------------------------------MSL-----
Q9CJD7_LACLA/298-530------------------------------------------------------------------------KSI-----
A0LSF1_ACIC1/217-449------------------------------------------------------------------------LGI-----
Q253H7_CHLFF/159-388------------------------------------------------------------------------RGL-----
KGD_MYCS2/97-344------------------------------------------------------------------------MRF-----
A5GAC3_GEOUR/194-419------------------------------------------------------------------------LSL-----
Q55ZP3_CRYNB/357-619------------------------------------------------------------------------STP-----
Q1NYU2_9FLAO/144-371------------------------------------------------------------------------KSL-----
A2QTN3_ASPNC/236-469------------------------------------------------------------------------LSI-----
Q59298_9CLOT/219-443------------------------------------------------------------------------KGL-----
Q9M724_ARATH/249-480------------------------------------------------------------------------LSL-----
A0CLV5_PARTE/180-390------------------------------------------------------------------------...-----
A4FGQ0_SACEN/225-452------------------------------------------------------------------------MST-----
Q6MPR6_BDEBA/309-540------------------------------------------------------------------------KSI-----
A1SQ65_NOCSJ/201-427------------------------------------------------------------------------LTV-----
Q6AFG4_LEIXX/233-470------------------------------------------------------------------------LDL-----
A6U1Y7_STAA2/191-418------------------------------------------------------------------------KSI-----
A5GEF2_GEOUR/180-403------------------------------------------------------------------------LSH-----
A5V538_SPHWW/170-392------------------------------------------------------------------------.GI-----
Q03DD0_PEDPA/195-427------------------------------------------------------------------------KSI-----
Q0RVL0_RHOSR/192-421------------------------------------------------------------------------LSL-----
Q5P9L2_ANAMM/204-433------------------------------------------------------------------------KSL-----
Q5UWH1_HALMA/304-539------------------------------------------------------------------------KGL-----
Q1Q664_9BACT/170-401------------------------------------------------------------------------KDM-----
Q6MTX8_MYCMS/197-428------------------------------------------------------------------------LSV-----
Q820B9_TROW8/211-440------------------------------------------------------------------------LSM-----
A7NKS9_ROSCS/223-453------------------------------------------------------------------------RSL-----
A6U0R3_STAA2/197-428------------------------------------------------------------------------KSI-----
ODO2_BUCAI/188-418------------------------------------------------------------------------MTM-----
Q2NJY8_AYWBP/185-416------------------------------------------------------------------------LTL-----
A4XEQ9_NOVAD/253-480------------------------------------------------------------------------MHI-----
Q5SLR1_THET8/217-449------------------------------------------------------------------------KSV-----
Q5DM38_NYCOV/252-485------------------------------------------------------------------------KGF-----
Q5F3G9_CHICK/271-501------------------------------------------------------------------------KGI-----
A4F1Y4_STRVG/208-431------------------------------------------------------------------------LDA-----
A4ICH2_LEIIN/226-463------------------------------------------------------------------------KGL-----
Q9KG97_BACHD/180-411------------------------------------------------------------------------KSL-----
A0LLM2_SYNFM/206-441------------------------------------------------------------------------KSV-----
Q04KE8_STRP2/115-347------------------------------------------------------------------------MSL-----
A7HBV2_ANADF/220-451------------------------------------------------------------------------RSL-----
Q1IIF0_KORVE/320-555------------------------------------------------------------------------LSF-----
A5JBE6_BURML/251-482------------------------------------------------------------------------RDP-----
A5G5K2_GEOUR/156-387------------------------------------------------------------------------KSI-----
Q4XMM8_PLACH/203-444------------------------------------------------------------------------KNI-----
Q8RD59_THETN/185-414------------------------------------------------------------------------KGL-----
Q8CTW0_STAES/196-425------------------------------------------------------------------------KSI-----
A4XHV3_CALS8/229-459------------------------------------------------------------------------KSL-----
A6TMP1_ALKMQ/205-437------------------------------------------------------------------------KGL-----
Q04RI4_LEPBJ/240-470------------------------------------------------------------------------KSV-----
A7SJI4_NEMVE/174-396------------------------------------------------------------------------LDL-----
A1ZHD0_9BACT/218-453------------------------------------------------------------------------MNL-----
Q4DDM3_TRYCC/200-436------------------------------------------------------------------------KGT-----
A7BC27_9ACTO/216-447------------------------------------------------------------------------LGL-----
O84249_CHLTR/201-428------------------------------------------------------------------------KNI-----
Q6KH63_MYCMO/220-452------------------------------------------------------------------------LNI-----
Q5DAR0_SCHJA/35-267------------------------------------------------------------------------LTV-----
Q87IG1_VIBPA/172-383------------------------------------------------------------------------YEP-----
Q6A613_PROAC/233-468------------------------------------------------------------------------MAM-----
Q2PY29_9BACT/192-418------------------------------------------------------------------------KSL-----
ODP2_SCHPO/252-483------------------------------------------------------------------------LGL-----
O45279_CAEEL/97-322------------------------------------------------------------------------LGV-----
Q97CK2_THEVO/179-398------------------------------------------------------------------------KSM-----
A0NRH8_9RHOB/70-301------------------------------------------------------------------------KGL-----
Q3A0D1_PELCD/165-395------------------------------------------------------------------------LNF-----
Q1IX53_DEIGD/361-594------------------------------------------------------------------------KSI-----
Q7WED2_BORBR/182-409------------------------------------------------------------------------ASL-----
Q3J9C7_NITOC/185-392------------------------------------------------------------------------RDI-----
Q0W153_UNCMA/195-425------------------------------------------------------------------------KSI-----
Q7UU97_RHOBA/235-467------------------------------------------------------------------------MGI-----
Q81CI7_BACCR/169-399------------------------------------------------------------------------LSL-----
ODP2_BUCBP/176-410------------------------------------------------------------------------KNI-----
ODP2_YEAST/248-482------------------------------------------------------------------------KGL-----
Q8RBW8_THETN/173-398------------------------------------------------------------------------LNL-----
Q4P9L5_USTMA/1242-1493------------------------------------------------------------------------KSI-----
A8FC90_BACP2/211-441------------------------------------------------------------------------KGL-----

PF00302

CAT3_ECOLX/1-205------------------------------------------------------------------------F-------
CAT_PROMI/6-209------------------------------------------------------------------------F-------
CAT2_CLOPF/1-202------------------------------------------------------------------------F-------
CAT_CLOBU/1-206------------------------------------------------------------------------F-------
CAT1_STAAU/1-205------------------------------------------------------------------------F-------
CAT_SALTI/6-209------------------------------------------------------------------------F-------
CAT_STRAC/6-211------------------------------------------------------------------------F-------
CAT2_ECOLX/1-205------------------------------------------------------------------------F-------
CAT2_STAAU/1-205------------------------------------------------------------------------F-------
CAT_BACPU/1-203------------------------------------------------------------------------F-------
CAT1_CLOPF/1-206------------------------------------------------------------------------F-------
CAT_CAMCO/1-202------------------------------------------------------------------------F-------

PF07247

Q6CJX7_KLULA/18-514SGTN------------------L...............QQLEYLLHY.....GRDYEQLP-----------.KLP-----
Q6XBS9_SACPS/47-542KTLP------------------K................KLDYIFEY.....EKDYQLLR-----------.KLP-----
Q6BRP8_DEBHA/9-477SGDA------------------A..............LKFQETLFDY.....TEDKS...-----------.KLP-----
Q6FVS8_CANGA/40-557EQNS------------------W............AVPYADDVIVDY.....EQDVADIA-----------.KLP-----
Q5ANM4_CANAL/12-486ESIE------------------DAAFETQFGPLVFENIKAEDEIFNF.....SKDKLYIK-----------NSLP-----
YA33_SCHPO/9-444KTNF------------------S.............................SSTVPVSE-----------LPLP-----
Q5AEJ2_CANAL/10-465KDDL------------------F.................YDVLFDY.....QRDFG...-----------.NLP-----
Q6XBT1_SACPS/23-529EEKG------------------F.........DYDEEFIEDQVIIDY.....DRDYTEIS-----------.KLP-----
Q6FND8_CANGA/4-456KQDN------------------D..............LDVDEIIYRPGGSTDSIDQCHPY-----------EKLP-----

PF00668

PKSJ_BACSU/690-989LKG.------------------Q-----------------------------QPEKAVSP............AIY-----
SRFAA_BACSU/3121-3425EQG.------------------N-----------------------------EPVLPQKT............HSF-----
SRFAA_BACSU/2097-2386T...------------------.-----------------------------...LEPLR............IQY-----
SRFAA_BACSU/1058-1346Q...------------------.-----------------------------...LPDLR............LQY-----
SRFAA_BACSU/2-303AS..------------------G-----------------------------SETKEGIS............HSF-----
SRFAB_BACSU/3117-3421EKE.------------------E-----------------------------SLVFPQKT............NSF-----
PPSA_BACSU/2089-2400LEK.------------------K-----------------------------EIQLPPKT............DSY-----
ACVS_EMENI/3105-3393T...------------------.-----------------------------...LGRKS............SSV-----
SRFAB_BACSU/6-306R...------------------.-----------------------------.AGRTPAN............GQG-----
SRFAC_BACSU/9-309R...------------------.-----------------------------.EQKPYSL............PPV-----
ACVS_EMENI/944-1252L...------------------.-----------------------------..HGHSLR............TLE-----
SRFAB_BACSU/1054-1340D...------------------.-----------------------------...LELPQ............IHY-----
SRFAB_BACSU/2093-2382Q...------------------.-----------------------------...LPEPT............LHY-----
PPSA_BACSU/1048-1338N...------------------.-----------------------------...LPALR............IQY-----
ACVS_EMENI/2018-2321EKGG------------------N-----------------------------MPILPMPQ............VQY-----
PPSA_BACSU/2-300KK..------------------.-----------------------------KDPLPDQP...........EPSY-----
GRSB_BREBE/9-310K...------------------.-----------------------------.EKKPLQL............EAV-----
GRSB_BREBE/1058-1347E...------------------.-----------------------------...LPTLG............IQY-----
GRSB_BREBE/2093-2382E...------------------.-----------------------------...LAELH............IQY-----
GRSB_BREBE/3138-3427A...------------------.-----------------------------...LPELR............IQY-----
HTS1_COCCA/4782-5060D...------------------.-----------------------------YEPSYSLG...............-----
GRSA_BREBE/620-923MHQ.------------------Q-----------------------------TIALPEKT............DSF-----
TYCA_BREPA/610-913LAG.------------------Q-----------------------------AISLPEKT............DSF-----
PPSB_BACSU/2088-2393VSG.------------------E-----------------------------SIKLPQKT............DSY-----
ACVS_CEPAC/3050-3340....------------------.-----------------------------..SLGPKS............SSV-----
ACVS1_PENCH/3082-3370....------------------.-----------------------------..SLGSKG............SSF-----
ACVS_NOCLA/2998-3282D...------------------.-----------------------------...LGAKT............GSY-----
HTS1_COCCA/854-1158S...------------------.-----------------------------...TPDRG............EAY-----
PPSB_BACSU/7-310K...------------------.-----------------------------.NNSPVQL............GST-----
PPSC_BACSU/7-306G...------------------.-----------------------------.KGQLPDL............PPV-----
ACVS_CEPAC/893-1203V...------------------.-----------------------------.EGTASPV............EQD-----
ACVS1_PENCH/916-1226L...------------------.-----------------------------.HGDNLTS............SMD-----
ACVS_NOCLA/876-1186R...------------------.-----------------------------.AGQPIES............DVD-----
HTS1_COCCA/1337-1660H...------------------.-----------------------------SNKLPDHSESKLHDGTYGNRPTK-----
HTS1_COCCA/2530-2808....------------------.-----------------------------..ELPPPG............PSF-----
PPSB_BACSU/1052-1342E...------------------.-----------------------------...LPALN............LHY-----
ACVS_CEPAC/1969-2278TKHK------------------A-----------------------------AANLPTLR............VQY-----
ACVS1_PENCH/1992-2295QKTK------------------S-----------------------------AANLPALK............AQY-----
ACVS_NOCLA/1948-2242P...------------------.-----------------------------EADLGALR............GTY-----
ENTF_ECOLI/1-301LR..------------------.-----------------------------GEPTPASP...........FTPF-----
HMWP2_YERE8/111-410S...------------------.-----------------------------.LSAIDTR............YDF-----
HMWP2_YERE8/1492-1782Q...------------------.-----------------------------.QLLPPLP............VTF-----

PF03007

Q9RIU8_STRCO/6-253------------------------------------------------------------------------PMD-----
TGS3_MYCTU/5-271------------------------------------------------------------------------RTR-----
Y3154_MYCBO/4-256------------------------------------------------------------------------ESM-----
Y3115_MYCBO/4-273------------------------------------------------------------------------DSP-----
Y1760_MYCTU/38-298------------------------------------------------------------------------LQP-----
Y919_MYCBO/32-296------------------------------------------------------------------------ADP-----
Q9X7A8_MYCLE/4-282------------------------------------------------------------------------LER-----
Y1425_MYCTU/4-264------------------------------------------------------------------------ITP-----
Y3371_MYCTU/4-237------------------------------------------------------------------------DAD-----
Y3480_MYCTU/8-298------------------------------------------------------------------------TDP-----
Y3761_MYCBO/4-262------------------------------------------------------------------------ADP-----
Y2484_MYCTU/4-282------------------------------------------------------------------------LER-----
Y3087_MYCTU/4-268------------------------------------------------------------------------DTP-----
Y221_MYCTU/4-263------------------------------------------------------------------------LLP-----
Y3740_MYCTU/1-257------------------------------------------------------------------------TDP-----
Y2306_MYCBO/4-256------------------------------------------------------------------------TDP-----

PF02458

O64549_ARATH/128-561RRSL------------------LNPR.........RPLVMDPSIDQIYMPVTSLPPPQETTNPENLLASRIYY..-----
O04201_ARATH/6-476TRES------------------VLISPAVLKVPQGGPKVTFDENAPLRERIFSFSRESIQELKAVVNKKKWLTVD-----
Q43583_TOBAC/11-441CREL------------------LNAR........NPPQV...TCTHHEYDEVRDTKGTIIPLDDMVHKSFFFG..-----
O23392_ARATH/6-435AGAN------------------FYPPA.......NEAFK..............LPADEQAGKRSSITKRFVFE..-----
O64988_CLABR/1-429GLAP------------------LMPS........AKVLN..............IPPPPSFEGVKFVSKRFVFN..-----
O23393_ARATH/3-424AETT------------------IYPP.........PPSH...MYEQFP.....STDSDSNITSKYVLKRFVFE..-----
HCBT2_DIACA/1-446DRYL------------------HLRLR.......NPPQI...KYTHSQFEP.FVPSLPNELLDGKTNKSQTLF..-----
O80816_ARATH/16-448DRTL------------------LKAR........DPPSV...AFPHHELVK..FQDCETTTVFEATSEHLDFKIF-----
O64470_ARATH/2-450RKIL------------------WAGEP.......LPPFVSPPKFDHKEFDQPPFLIGETDNVEERKKKTIVVML.-----
DAT_CATRO/8-434VSDS------------------IFPR.........QDN...............IICEQFPTSKNCVEKTFIFP..-----
O80467_ARATH/11-450ERER------------------LVGKP.......EDDQP...PFVPGD..D..TAASPYLPTDDWVTEKITIR..-----

PF00755

CACP_MOUSE/34-616GQML.........HGGGSK...FNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGPPIVALVDH...VMEYTKKP.....
Q20278_CAEEL/11-599.VRL.........MKYSIF...GSPLNAYCDKNLNIIVLRDGKTCLQAEHGNVDAISLFAPCDFAADQFQLNRKL.....
CLAT_RAT/22-612LQLL.........HGGGCS...LNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMMTSNK......
CACM_YEAST/3-644LCGTSTINLDPHQHQPPLNVQTGTCLNRWYDK.LQLIVTKNGKAGINFEHTGVDGHTVLRLATDIYTDSILSFARGVTKN
Q23066_CAEEL/147-743LSNF.........LANCLS...GDGTNRWVDKSLNYICSKNARCGGTTEHSIADGAEFDHIMENFVYVDLEVLKYK....
CPT1B_HUMAN/172-763LSLY.........GKALLH...GNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPIIGHLWEFVLGTDSFHLGY.....
CLAT_CAEEL/19-623YSTL.........TGHGSS...KFGLNRWYDATIQLVVSSSGVNGLCIEHSTAEGIVIINMAETAIRYAQKYFKS.....
OCTC_RAT/19-605VFEM.........L..LG....GDPAVRWGDKSYNLISFANGIFGCSCDHAPYDAMLMVNIAH..Y.VDEKLLET.....
OCTC_BOVIN/19-605VSAK.........I..LN....GDPTVRWGDKSYNLIAFSNGVFGSNCDHAPFDAMVLVKVCY..Y.VDENILEN.....
Q17499_CAEEL/21-602RQAL.........HGGGSK...VNSSNRWFDKTIQFVIGTNGYTGMTYEHTPAEGPPVGALMDF...ICDQFDAN.....
O44619_CAEEL/140-733LSKY.........MKDMLA...GSGSNRWVDKTMNYAVDASGRAGATGEHSPCDGAELDHLCENVLNVDKQVLVSP....
CLAT_DROME/87-717HEMI.........HGGGSE...YNSGNRWFDKTMQLIICTDGTWGLCYEHSCSEGIAVVQLLEKIYKKIEEHPDE.....
CACP_COLLI/35-617AQML.........HGGGSR...WNSGNRWFDKTLQFIIAEDGSCGLVYEHAPAEGPPIVALLDH...IVEYTKKP.....
CPT2_HUMAN/48-649LHG....................DGTNRWFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPA......
CACP_YEAST/73-658..............RNCWH...GDGINRFYDKSLQFLVTGNGSSGFLAEHSKMDGTPTLFLNNY...VCQQLNKLD....
CACP_CANTR/41-613..............KNCWH...GDGQNRFFDKPLEFFVSANGNSGFLGEHSRMDATPTVQLNNT...IYKQILETN....
CPT1A_HUMAN/170-763MDSY.........AKSLLH...GRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGY.....

PF00198

Q7PG41_ANOGA/236-467-----------------------------LQIAQDLNALQERGAKGA.LTPN----------------------------
A4H464_LEIBR/234-468-----------------------------LDIAIDMQTLIERGKNNK.LTTQ----------------------------
Q8IJJ4_PLAF7/416-640-----------------------------YTLANEWKILVEKGKNGL.LSSN----------------------------
B0K8I7_THEP3/156-382-----------------------------LELSKNIKELSERARNNK.LTPD----------------------------
A9B180_HERA2/216-442-----------------------------GAISNQMRDVIGRTRDGK.AGLD----------------------------
B9LC79_CHLSY/227-461-----------------------------LQIAREIDDLSQRARTDK.LRPD----------------------------
B8GAA3_CHLAD/150-362-----------------------------RGIARMLART.........DTTN----------------------------
Q7MB23_PHOLL/166-382-----------------------------PNVEAAVADYVCRYHENK.LSLE----------------------------
A5G2C9_ACICJ/193-425-----------------------------AAISNEMKDLAARAKAGK.LKPD----------------------------
A7K5W2_VIBSE/398-631-----------------------------YELSEELMAVSKKARAGK.LTAA----------------------------
A6QGW5_STAAE/188-420-----------------------------AEIEAEIANLAVKAREKK.LGLD----------------------------
Q8IEA6_PLAF7/189-419-----------------------------PQLELALSDLATKARSNK.LSID----------------------------
Q6C806_YARLI/226-463-----------------------------VEIAADLQRLQELGMAGK.LSRD----------------------------
A6Q9K5_SULNB/241-441-----------------------------AAIAEELHQFKTKISQKK.LTKE----------------------------
A4CCC7_9GAMM/276-508-----------------------------IDIAQEISRLTDSAREGR.VAPD----------------------------
A4IKZ7_GEOTN/204-435-----------------------------FQIAKEIEELSAKARTGA.IQAA----------------------------
A5IXN4_MYCAP/10-243-----------------------------IDIQKEIVRLSTLARDKK.LKMS----------------------------
Q05SD7_9SYNE/221-446-----------------------------YEMSRQWADLVKRSRSKQ.LQPE----------------------------
Q2B858_9BACI/159-388-----------------------------AEIAEDLQNLTRKALDGR.LLAK----------------------------
ODP2_MYCPN/169-401-----------------------------VDIAKDIVDLANRARSKQ.IKLP----------------------------
A6DTS5_9BACT/215-442-----------------------------ASISKDVKSLVGKARSNS.LSPE----------------------------
Q67RX4_SYMTH/33-262-----------------------------WDLARAIHLQTQKARAGL.LSPH----------------------------
A0QDC1_MYCA1/158-386-----------------------------RELASRAAELISGARAGS.LTPG----------------------------
A3RZM1_RALSL/164-375-----------------------------ADLRAGLDRMRADIKARK.IPPE----------------------------
Q018W7_OSTTA/269-503-----------------------------KTISSEVKALASRAREGS.LTPQ----------------------------
A0JUQ7_ARTS2/229-460-----------------------------TELSTALTALTETARAGK.TSPA----------------------------
Q9CJD7_LACLA/298-530-----------------------------LEIAKEIAELATATREGT.LKPQ----------------------------
A0LSF1_ACIC1/217-449-----------------------------REISQRTRDLATRARQGK.LKPD----------------------------
Q253H7_CHLFF/159-388-----------------------------VSIAKSLADLSVRARANK.LDPS----------------------------
KGD_MYCS2/97-344-----------------------------GQFIAAYEDIVRRARDGK.LTAE----------------------------
A5GAC3_GEOUR/194-419-----------------------------MEIAARSRELIERARGGT.IAEA----------------------------
Q55ZP3_CRYNB/357-619-----------------------------IPI...LTNHLTHLRQTA.HRPS----------------------------
Q1NYU2_9FLAO/144-371-----------------------------RQISFEIKEKVIKAKEKK.IQSN----------------------------
A2QTN3_ASPNC/236-469-----------------------------LDIAAEILRLNALAKERK.LTPA----------------------------
Q59298_9CLOT/219-443-----------------------------KEISTEVKDLAKKAKSNQ.LKPE----------------------------
Q9M724_ARATH/249-480-----------------------------LEITKELSRLQHLAANNK.LNPE----------------------------
A0CLV5_PARTE/180-390-----------------------------.....ELNRLRTLGEKGQ.L...----------------------------
A4FGQ0_SACEN/225-452-----------------------------RELSDAMRTHTIAGREGS.LAPS----------------------------
Q6MPR6_BDEBA/309-540-----------------------------LEISKEILDLSKRARDGK.LKPD----------------------------
A1SQ65_NOCSJ/201-427-----------------------------TAVAAKVQDLAARAREGR.LKQD----------------------------
Q6AFG4_LEIXX/233-470-----------------------------AGLAKEISDLAERTRDNR.LKPD----------------------------
A6U1Y7_STAA2/191-418-----------------------------KGIAREINTLATKARNKQ.LTTE----------------------------
A5GEF2_GEOUR/180-403-----------------------------DELMGAMRDLITRTRAGR.LRSS----------------------------
A5V538_SPHWW/170-392-----------------------------HDFASALDAAIERARQGR.LGAA----------------------------
Q03DD0_PEDPA/195-427-----------------------------MEVAQEIDDMAIRGRAGD.LKPN----------------------------
Q0RVL0_RHOSR/192-421-----------------------------RAIHQRSEEAALAARERK.VTAA----------------------------
Q5P9L2_ANAMM/204-433-----------------------------SEISDITKSLATRAKERK.LQPH----------------------------
Q5UWH1_HALMA/304-539-----------------------------LEVASETNEKTQKARERS.LSPE----------------------------
Q1Q664_9BACT/170-401-----------------------------FQLAREIQEIAVNARSKK.LKPD----------------------------
Q6MTX8_MYCMS/197-428-----------------------------FEIAIKINELANKAKDGK.LTRA----------------------------
Q820B9_TROW8/211-440-----------------------------LDLAKAIESLVDDARSSR.IRPE----------------------------
A7NKS9_ROSCS/223-453-----------------------------GSIARETKRVVVLAREGK.ITPD----------------------------
A6U0R3_STAA2/197-428-----------------------------FQISDEINELAVKARDGK.LTAD----------------------------
ODO2_BUCAI/188-418-----------------------------AEIEKKIKDFSIKGLQNK.INIK----------------------------
Q2NJY8_AYWBP/185-416-----------------------------LEMAQQLQQVAKSTTERK.VELN----------------------------
A4XEQ9_NOVAD/253-480-----------------------------AQIAATTRALIDKAQAGR.LGYE----------------------------
Q5SLR1_THET8/217-449-----------------------------LELAQEIAELSQKAREGR.LAPE----------------------------
Q5DM38_NYCOV/252-485-----------------------------EQIAKITKELIAKAKDGT.LKPE----------------------------
Q5F3G9_CHICK/271-501-----------------------------QEIAASAKALAKKARDGK.LLPE----------------------------
A4F1Y4_STRVG/208-431-----------------------------DRFDERYADAVERALGGE.SQAD----------------------------
A4ICH2_LEIIN/226-463-----------------------------VEISKETKALAKKARDGT.LQPS----------------------------
Q9KG97_BACHD/180-411-----------------------------LELAGEITQLSTQARKGT.LNVQ----------------------------
A0LLM2_SYNFM/206-441-----------------------------RELAVELLDVAERTRRGK.AERE----------------------------
Q04KE8_STRP2/115-347-----------------------------SELVVAFKDVIGRTLDGK.LAPS----------------------------
A7HBV2_ANADF/220-451-----------------------------VELAREIERLAQDAKAGR.ARPE----------------------------
Q1IIF0_KORVE/320-555-----------------------------VGLQRAITDLGERARAKK.LKPE----------------------------
A5JBE6_BURML/251-482-----------------------------WSIAAEVARLADAARAGR.AERD----------------------------
A5G5K2_GEOUR/156-387-----------------------------IALAEEIQALGKKAHERT.IALT----------------------------
Q4XMM8_PLACH/203-444-----------------------------IDIQKELLNLRNKAMEMK.LSKD----------------------------
Q8RD59_THETN/185-414-----------------------------KEIAREEKALIQKAREGK.LTPD----------------------------
Q8CTW0_STAES/196-425-----------------------------GTLAHEIKSSAEAVREGN.TGAV----------------------------
A4XHV3_CALS8/229-459-----------------------------NQISKEAKELIQLCRKGT.INPD----------------------------
A6TMP1_ALKMQ/205-437-----------------------------MSLMEESVRLSQSAKDKS.LKLN----------------------------
Q04RI4_LEPBJ/240-470-----------------------------LEISREIKELASRARDRK.LKPG----------------------------
A7SJI4_NEMVE/174-396-----------------------------SQISLVAHDIATRARDNK.LHEH----------------------------
A1ZHD0_9BACT/218-453-----------------------------LGLAKRVNDLANRARNNK.LNPD----------------------------
Q4DDM3_TRYCC/200-436-----------------------------MDIVQEVNELVELGRKNR.IPPE----------------------------
A7BC27_9ACTO/216-447-----------------------------KAFSDEAKRLAGGAIDGS.LSPD----------------------------
O84249_CHLTR/201-428-----------------------------GMISAEIKGLATKAKQQS.LAEE----------------------------
Q6KH63_MYCMO/220-452-----------------------------IEIAKEITRLAVAARDKK.IKAD----------------------------
Q5DAR0_SCHJA/35-267-----------------------------SDISKLSRQLIRKARDGI.IQPP----------------------------
Q87IG1_VIBPA/172-383-----------------------------QDVRRWLDQTVKGIRDRK.ISRE----------------------------
Q6A613_PROAC/233-468-----------------------------LELATEITRIVAIAKEDK.LQPP----------------------------
Q2PY29_9BACT/192-418-----------------------------SDISTEVKSFAQRARDKQ.LQPQ----------------------------
ODP2_SCHPO/252-483-----------------------------AEISTLAKDYGQRARNNK.LKPE----------------------------
O45279_CAEEL/97-322-----------------------------LAISSKVKELSGLARESK.LKPQ----------------------------
Q97CK2_THEVO/179-398-----------------------------YEITAEITDKAERARNNQ.LKID----------------------------
A0NRH8_9RHOB/70-301-----------------------------WQIAAEIADLASRALERK.VRPD----------------------------
Q3A0D1_PELCD/165-395-----------------------------ADIEKQIAELAEKARKHR.LALA----------------------------
Q1IX53_DEIGD/361-594-----------------------------TEIVLELSELAAKARDRK.LSPS----------------------------
Q7WED2_BORBR/182-409-----------------------------DDIAAQSGALLGRVRAGK.ATRE----------------------------
Q3J9C7_NITOC/185-392-----------------------------ADLSAAWIDLVERARIKR.LKPE----------------------------
Q0W153_UNCMA/195-425-----------------------------VQISREIKELVELAESGK.IGVE----------------------------
Q7UU97_RHOBA/235-467-----------------------------PDTARNIAEMAGKVRGGK.FGVN----------------------------
Q81CI7_BACCR/169-399-----------------------------VELSKEIKNVAQKARAGS.LSSD----------------------------
ODP2_BUCBP/176-410-----------------------------SSISNDLRIISERARSRK.LNFS----------------------------
ODP2_YEAST/248-482-----------------------------SQISNEIKELVKRARINK.LAPE----------------------------
Q8RBW8_THETN/173-398-----------------------------NEMAVERRRLTDAVLQGI.IKPE----------------------------
Q4P9L5_USTMA/1242-1493-----------------------------YDVSAFITRLQTVAGSSKGLAPA----------------------------
A8FC90_BACP2/211-441-----------------------------KQLTKEAKEIGRNARDQK.LLPD----------------------------

PF00302

CAT3_ECOLX/1-205-------------------------------MVNYLSVMERYKSDTK-LFPQ----------------------------
CAT_PROMI/6-209-------------------------------LKTYSEDIAQYGDDLA-YFPK----------------------------
CAT2_CLOPF/1-202-------------------------------LADYESDTQRYGNNHR-MEGK----------------------------
CAT_CLOBU/1-206-------------------------------YSDYLDDIKNYGNIMK-FTPK----------------------------
CAT1_STAAU/1-205-------------------------------YDLYLSDVEKYNGSGK-LFPK----------------------------
CAT_SALTI/6-209-------------------------------LHIYSQDVACYGENLA-YFPK----------------------------
CAT_STRAC/6-211-------------------------------HDTAAPLLAEHSRATD-FFPQ----------------------------
CAT2_ECOLX/1-205-------------------------------MAGYNAVTAEYQHDTR-LFPQ----------------------------
CAT2_STAAU/1-205-------------------------------YNNYKNDLLEYKDKEE-MFPK----------------------------
CAT_BACPU/1-203-------------------------------YKSCVADIETFSKSSN-LFPK----------------------------
CAT1_CLOPF/1-206-------------------------------YYNYLEDIRNYSDVLN-FMPK----------------------------
CAT_CAMCO/1-202-------------------------------LQNYQKDIDAFGERMG-MSAK----------------------------

PF07247

Q6CJX7_KLULA/18-514-----------------------------DPIEEKVSYGVNPS-FIA-...S----------------------------
Q6XBS9_SACPS/47-542-----------------------------EPIENMIDF..RPP-YLF-IPKS----------------------------
Q6BRP8_DEBHA/9-477-----------------------------.DILDSPDK..IVD-LYN-PGIL----------------------------
Q6FVS8_CANGA/40-557-----------------------------APITERVEY..RPP-LSK-LPKI----------------------------
Q5ANM4_CANAL/12-486-----------------------------PPIDPFLED..IDL-DYS-FGDP----------------------------
YA33_SCHPO/9-444-----------------------------KNLEKLIDV..HPS-WFC-LMKA----------------------------
Q5AEJ2_CANAL/10-465-----------------------------AKILPAVDN..LTD-LFD-LGVL----------------------------
Q6XBT1_SACPS/23-529-----------------------------KPITDRIDY..KPA-LTS-LPKF----------------------------
Q6FND8_CANGA/4-456-----------------------------IPFSWKVKRPIVKA-LFT-IAPG----------------------------

PF00668

PKSJ_BACSU/690-989-----------------------------HDFAAWEKNMLAGK-DGV-KHRT----------------------------
SRFAA_BACSU/3121-3425-----------------------------AEYAERLQDFANSK-AFL-KEKE----------------------------
SRFAA_BACSU/2097-2386-----------------------------KDYAVWQQQFIQSE-LYK-KQEE----------------------------
SRFAA_BACSU/1058-1346-----------------------------KDYAVWQSRQAAEG-.YK-KDQA----------------------------
SRFAA_BACSU/2-303-----------------------------IDHVLSEQEYAQSK-RFE-KDKA----------------------------
SRFAB_BACSU/3117-3421-----------------------------KDWAEELAAFSQSA-HLL-QQAE----------------------------
PPSA_BACSU/2089-2400-----------------------------LSYADGLTQIAESK-QLL-SEKT----------------------------
ACVS_EMENI/3105-3393-----------------------------RQWAEALQSYQGS.-..A-SERA----------------------------
SRFAB_BACSU/6-306-----------------------------KPYSDYIKWLGKQD-.NE-EAES----------------------------
SRFAC_BACSU/9-309-----------------------------KPYKDYIKWLEKQD-.KQ-ASLR----------------------------
ACVS_EMENI/944-1252-----------------------------DPYRQSQQYLQDH.-.RE-DHLR----------------------------
SRFAB_BACSU/1054-1340-----------------------------KDYAVWHKEQTNY.-..Q-KDEE----------------------------
SRFAB_BACSU/2093-2382-----------------------------KDFAVWQNEAEQKE-RMK-EHEA----------------------------
PPSA_BACSU/1048-1338-----------------------------KDYAVWREGFKTGD-AYK-TQEA----------------------------
ACVS_EMENI/2018-2321-----------------------------KEYAEHHRRRLGKN-QIQ-KLSD----------------------------
PPSA_BACSU/2-300-----------------------------LSYIEKESQYLQSP-RFA-KDRL----------------------------
GRSB_BREBE/9-310-----------------------------QPYKQFIKWLEKQD-.KQ-EALR----------------------------
GRSB_BREBE/1058-1347-----------------------------KDFTVWHNRLLQSD-VIE-KQEA----------------------------
GRSB_BREBE/2093-2382-----------------------------KDFAVWQNEWFQSA-ALE-KQKT----------------------------
GRSB_BREBE/3138-3427-----------------------------KDFAVWQNEWFQSE-AFK-KQEE----------------------------
HTS1_COCCA/4782-5060-----------------------------..WTAFVLHTENT.-.KE-ASRS----------------------------
GRSA_BREBE/620-923-----------------------------KDWSIELEKYANSE-LFL-EEAE----------------------------
TYCA_BREPA/610-913-----------------------------QSWSQWLQEYANEA-DLL-SEIP----------------------------
PPSB_BACSU/2088-2393-----------------------------LTYSQRIADYSISR-QVQ-REAA----------------------------
ACVS_CEPAC/3050-3340-----------------------------QQWSLAVSDYKMP.-..L-SERA----------------------------
ACVS1_PENCH/3082-3370-----------------------------RQWAEAIQNYKAS.-..D-SERN----------------------------
ACVS_NOCLA/2998-3282-----------------------------RQWAQAVRDYTPA.-..E-GERE----------------------------
HTS1_COCCA/854-1158-----------------------------QESVPFLAWCQVQA-EAV-KDIP----------------------------
PPSB_BACSU/7-310-----------------------------VPYSRYIEWLGEQD-.QE-ETAA----------------------------
PPSC_BACSU/7-306-----------------------------QPYGTYIKWLMQQD-.RE-EAAE----------------------------
ACVS_CEPAC/893-1203-----------------------------ATYLLGQQYLQSH.-.RD-DHLD----------------------------
ACVS1_PENCH/916-1226-----------------------------DPYTRTQRYLHAH.-.RE-DHLD----------------------------
ACVS_NOCLA/876-1186-----------------------------NAYVAAQRYWEAH.-.RN-DHAA----------------------------
HTS1_COCCA/1337-1660-----------------------------PPLAEFIRYIRDPQ-RKQ-DSIN----------------------------
HTS1_COCCA/2530-2808-----------------------------KHFARNLNLVQSK.-..L-DSED----------------------------
PPSB_BACSU/1052-1342-----------------------------KDFAVWQQEKHPKE-LYK-KQEA----------------------------
ACVS_CEPAC/1969-2278-----------------------------KEYAIEHRRALRAE-QHR-VLAD----------------------------
ACVS1_PENCH/1992-2295-----------------------------KEYALYHRRQLSGD-RMR-NLSD----------------------------
ACVS_NOCLA/1948-2242-----------------------------GEFAVWQRQYLTGK-RLA-ALTE----------------------------
ENTF_ECOLI/1-301-----------------------------ADVVEEYQQYRESE-AWQ-RDAA----------------------------
HMWP2_YERE8/111-410-----------------------------RSYLLHQQKINQP.-LRD-DARA----------------------------
HMWP2_YERE8/1492-1782-----------------------------RDYLQQPSLQSPN.-..P-DSLA----------------------------

PF03007

Q9RIU8_STRCO/6-253-----------------------------LPAPRPRPEQ.PPR-G..-...L----------------------------
TGS3_MYCTU/5-271-----------------------------RPPAFPEDIWVPER-DPG-TTRL----------------------------
Y3154_MYCBO/4-256-----------------------------SDSFASNIHTTMQS-Q..-..SA----------------------------
Y3115_MYCBO/4-273-----------------------------DDTTLAGPWMSAQG-ADR-PRRT----------------------------
Y1760_MYCTU/38-298-----------------------------DAPAPQPVRGTGGG-N..-..VL----------------------------
Y919_MYCBO/32-296-----------------------------HQRQMPTLWEVPAQ-ASV-AKHT----------------------------
Q9X7A8_MYCLE/4-282-----------------------------DPPSRPRSPQPIPQ-DLS-..RN----------------------------
Y1425_MYCTU/4-264-----------------------------EPRPPQQETVGFVG-FQI-P.GL----------------------------
Y3371_MYCTU/4-237-----------------------------GSAFANNVDIKQIP-P..-..YG----------------------------
Y3480_MYCTU/8-298-----------------------------HDTTHPLFFNIPTP-GRS-PADT----------------------------
Y3761_MYCBO/4-262-----------------------------DDAEVRAIWNLPPR-P..-..RT----------------------------
Y2484_MYCTU/4-282-----------------------------DPPPRSTPPQPIPE-DLS-..PN----------------------------
Y3087_MYCTU/4-268-----------------------------DEAPVVAPPWEPPP-LP.-..ST----------------------------
Y221_MYCTU/4-263-----------------------------GPEVGRYVPD.PAP-T..-..KR----------------------------
Y3740_MYCTU/1-257-----------------------------IEGKLRTAWS.PAT-Q..-..HT----------------------------
Y2306_MYCBO/4-256-----------------------------EAPPGSGKPE.PFG-D..-..DY----------------------------

PF02458

O64549_ARATH/128-561-----------------------------.IKANALQELQTLA-SSS-KNGK.....................R.....T
O04201_ARATH/6-476-----------------------------NGEIDGVELLGKQS-NDK-LNGKENGILTEMLESLFGRNDAVSKPVAVEIS
Q43583_TOBAC/11-441-----------------------------PSEVSALRRFVPHH-LRK-..C............................S
O23392_ARATH/6-435-----------------------------...ASKVEDLRTKA-ASE-ETVD.....................QP....T
O64988_CLABR/1-429-----------------------------ENAITRLRKEATEE-DGD-GDDD.....................QKKKRPS
O23393_ARATH/3-424-----------------------------...PSKIAELKHKA-ASE-SVPV.....................P.....T
HCBT2_DIACA/1-446-----------------------------KLSREQINTLKQKL-DLS-SNTT.....................TRL...S
O80816_ARATH/16-448-----------------------------KLSSEQIKKLKERA-SET-SNGN.....................VR...VT
O64470_ARATH/2-450-----------------------------PLSTSQLQKLRSKA-NGS-KHSD.....................PAKG.FT
DAT_CATRO/8-434-----------------------------...PEAIEKLKSKA-VEF-GIEK.....................P.....T
O80467_ARATH/11-450-----------------------------ADSIRRLKEATLKE-YDF-SNET.....................I.....T

PF00755

CACP_MOUSE/34-616................ELVRSPMV....PLPMPKKLRFNITPE.IKN-DIEK-------------------AKQNLSIMI
Q20278_CAEEL/11-599............SKKSSQNKSSSM....QPVMPVKIEFLLTGS.VSQ-KISE-------------------AERDFYFLS
CLAT_RAT/22-612................KLVRADSV...SELPAPRRLRLKCSPE.TQG-HLAS-------------------SAEKLQRIV
CACM_YEAST/3-644VVDIFSDDDGKPSSSSLASAAHSA...NLITIPRKLEWRTDNF.LQS-SLHF-------------------AETRISDLI
Q23066_CAEEL/147-743...........SIEEQEKMAVIEENDKKSLKLATPLNFEVPDQEMLS-EITR-------------------CYDAHQIAK
CPT1B_HUMAN/172-763............TETGHCLGKPNP....ALAPPTRLQWDIPKQ.CQA-VIES-------------------SYQVAKALA
CLAT_CAEEL/19-623................KMVWNDVR.....NVHPKSLTWHFSEN.SRN-ILKK-------------------QAEVFDELA
OCTC_RAT/19-605............E..GRWKGSEKV...RDIPLPEELAFTVDEK.ILN-DVYQ-------------------AKAQHLKAA
OCTC_BOVIN/19-605............E..GRWKGSEKV...RDIPVPEELVFTVDEK.VLN-DINQ-------------------AKAQYFKQV
Q17499_CAEEL/21-602..............TFITEGTPS......NSPVQRLDISTDEE.INK-RIAK-------------------SSKNMDSIA
O44619_CAEEL/140-733...........STEEQLEIIKMTFTEKNSLRLAQKLDFQEVDG.MET-EVNR-------------------CFEQHHKAS
CLAT_DROME/87-717.............DNGLPQHH........LPPPERLEWHVGPQ.LQL-RFAQ-------------------ASKSVDKCI
CACP_COLLI/35-617................ELVRSP....MIPLPMPKKLRFNITPE.IKS-DIEK-------------------AKQNLNIMV
CPT2_HUMAN/48-649...........VTPQSQPATTDS......TVTVQKLNFELTDA.LKT-GITA-------------------AKEKFDATM
CACP_YEAST/73-658...........VDDFMRKVITPSS...TVAMKPMELPFIITPK.IHK-AIES-------------------AQLQFKETI
CACP_CANTR/41-613...........PNDLIVEIGS.SA...PRFGNAEILPFDINPT.TRA-NIKD-------------------AIAKFDATI
CPT1A_HUMAN/170-763............AEDGHCKGDINP...N.IPYPTRLQWDIPGE.CQE-VIET-------------------SLNTANLLA

PF00198

Q7PG41_ANOGA/236-467--------DFAN.GTFALSN--------------IGII.G-.G-----TYTHPVVMT.PQVAIGGLGQT.RVLP.RFDAD
A4H464_LEIBR/234-468--------DMAG.GTFTLSN--------------IGPI.G-.A-----TVTAPVLLP.PQVAIGAIGRL.QKLP.RFDAN
Q8IJJ4_PLAF7/416-640--------DMTG.SNFYISN--------------LGMF.N-.T-----YQFDAILPK.NSSCILSIGTN..IGS.ID.NL
B0K8I7_THEP3/156-382--------EIIG.STFTITN--------------LGMY.E-.I-----DSFTPIINP.PESAILGVNKI.YKEP.VV.LD
A9B180_HERA2/216-442--------DLQG.GTFTVSN--------------LGMF.D-.V-----TNFIAIITP.PQSAILAVGST.IATP.VV.RD
B9LC79_CHLSY/227-461--------EVVD.GTFSISN--------------LGMF.G-.I-----ERFSAIINP.PQVAILAVGAV.CREV.VADEN
B8GAA3_CHLAD/150-362--------DLAE.ATFSI..--------------VATT.G-.W-----WRFAPPL.P.GTAAALTLSEA.QRQP.IAFNA
Q7MB23_PHOLL/166-382--------DVTG.ATFTVSD--------------LSGQ.N-.V-----LHFQPMLNK.QQCAILGIGGD.K.........
A5G2C9_ACICJ/193-425--------EFQG.GSFSISN--------------LGMY.G-.I-----SSFSAIINP.PQGGILAIGAG.EKRP.VV.KG
A7K5W2_VIBSE/398-631--------DMQG.GCFTISS--------------LGGI.G-.G-----TAFTPIVNA.PEVGILGVSKS.EMKP.VW.NG
A6QGW5_STAAE/188-420--------DMVN.GSFTITN--------------GGIF.G-.S-----MMSTPIING.NQAAILGMHSI.ITRP.IAIDQ
Q8IEA6_PLAF7/189-419--------DFSG.GTFTISN--------------GGVF.G-.S-----MLSTPIINM.PQSAILGMHTI.KNRP.VV.VN
Q6C806_YARLI/226-463--------DLTG.GTISISN--------------IGNV.G-.G-----TYLSPVIVS.EQVAIVGLGKA.RKLP.RYNSQ
A6Q9K5_SULNB/241-441--------DLTG.STFGISN--------------LGMT.G-.I-----EQFDAMINK.DDCAIAAIGSE...........
A4CCC7_9GAMM/276-508--------DLKG.GTISISN--------------IGAI.G-.G-----TTATPIINK.PEVAIVALGKV.QHLP.RFDVN
A4IKZ7_GEOTN/204-435--------EMSG.GTCTVSN--------------IGSA.N-.G-----SWFTPIIHY.PQSCILGIGKI.DKKP.IV.IN
A5IXN4_MYCAP/10-243--------DMSG.GCFAITN--------------VGSA.G-.V-----LFGSPIMNK.GNTAISATGAI.IDEL.KLNKE
Q05SD7_9SYNE/221-446--------EYST.GTFTLSN--------------LGMF.G-.V-----DRFDAILPP.GTGAILAVAA...SRP.TV.VA
Q2B858_9BACI/159-388--------ETAG.GTFTVSN--------------VGPLNG-.S-----TGATPIILH.PQTSIISLHKT.KKMP.VVDKD
ODP2_MYCPN/169-401--------DLSK.GTISVTN--------------FGSL.G-.A-----AFGTPIIKH.PEMCIVATGNM.EERV.VR.AE
A6DTS5_9BACT/215-442--------EYQG.GSFTISN--------------LGMF.G-AV-----DSFTAILNP.PQSAILAVAGT..QEE.LKLVN
Q67RX4_SYMTH/33-262--------ELSG.HTFVITN--------------TGRY.G-AT-----LFGTPIIQP.PNVGILAFEAI.QKRP.VV.VG
A0QDC1_MYCA1/158-386--------ELRG.STFTVSN--------------FGAL.G-.V-----DDGVPVINH.PEAAILGMGAI.KPRP.VA.VG
A3RZM1_RALSL/164-375--------ELRG.NTITLSN--------------FGMI.A-.G-----KYAAPVVVP.PTVAILGAGRI.HEQV.VA.AA
Q018W7_OSTTA/269-503--------DMTG.GTFTISN--------------LGMF.G-.V-----KSFAAIVNP.PQAAILAVGGA.RKEV.IKNES
A0JUQ7_ARTS2/229-460--------ELTG.GTISITN--------------IGVF.G-.I-----DAGTPILNP.GEAAILAMGAV.RKMP.WE.YR
Q9CJD7_LACLA/298-530--------QMQG.STITISN--------------IGSARG-..-----SWFTPIING.SDVVILGLGSI.VKEP.IVNGE
A0LSF1_ACIC1/217-449--------DIGG.STFTISN--------------LGMF.G-.V-----DQFTAVINP.PEAAILAVGAV.REVP.VV.RD
Q253H7_CHLFF/159-388--------ETQD.GSVTVTN--------------FGMT.G-.A-----LIGMPIIRY.PEVAILGIGTI.QKRV.IVRDD
KGD_MYCS2/97-344--------DFSG.VTISLTN--------------PGTL.G-.T-----VHSVPRLMQ.GQGAIIGAGAM..EYP.AE.FQ
A5GAC3_GEOUR/194-419--------DISG.GTFSVSN--------------LGMF.G-.V-----EEFSAIIHP.PQGAILAVGAV.QDEA.VV.KG
Q55ZP3_CRYNB/357-619--------SQEG.AHLTVSS--------------VGGL.G-EC-----SGASPILPPGGGLAICAVGRAKWEVE.WVKKE
Q1NYU2_9FLAO/144-371--------ELEG.STFTVSN--------------LGMF.G-.I-----DSFTSIINQ.PNSCILSVGSI.KKKP.II.NN
A2QTN3_ASPNC/236-469--------DLSG.GTITASN--------------IGNI.G-.G-----TYVAPVVIP.NEMAILGIGKS.RTVP.IFDEA
Q59298_9CLOT/219-443--------NMTG.GTFTITN--------------LGMF.G-.I-----EYFSPIINQ.PEVAILGVNKI.TETP.VV.QN
Q9M724_ARATH/249-480--------DVTG.GTITLSN--------------IGAI.G-.G-----KFGSPLLNL.PEVAIIALGRI.EKVP.KFSKE
A0CLV5_PARTE/180-390--------.....SFNCLIN--------------IGTI.G-.G-----TYTGPLILA.PQVCIVGIGRL.ITVP.RYDAK
A4FGQ0_SACEN/225-452--------DLTG.GTFTVNN--------------YGVF.G-.V-----DGSAAIINQ.PEAAILGVGRI.IDRP.WA.VD
Q6MPR6_BDEBA/309-540--------EMKG.ATITVTN--------------IGSI.G-.G-----TYATPVINH.PEVAILGMYKI.DEK..VVLKN
A1SQ65_NOCSJ/201-427--------ELEG.GTISVTN--------------LGMY.G-.V-----EEFAAIINP.PHAAILAVGAV.REEP.VV.ED
Q6AFG4_LEIXX/233-470--------ELAG.GTFTLTN--------------TGSR.G-.A-----LFDTPVVFL.PQVAILGTGIV.TKKP.VV.VS
A6U1Y7_STAA2/191-418--------DMQG.GTFTVNN--------------TGTF.G-.S-----VSSMGIINH.PQAAILQVESI.VKKP.VV.IN
A5GEF2_GEOUR/180-403--------EMTD.ATITVTN--------------LGDL.G-.V-----KTVFGVIYP.PQVALVGFGRI.MERP.WA.EN
A5V538_SPHWW/170-392--------DVGA.AAIGISN--------------VGMF.A-.V-----RSLTPIIDP.DQSFMLGVGAP..RAA.FR.AD
Q03DD0_PEDPA/195-427--------ELKG.GTVTITN--------------IGSESG-.S-----GFFTPIINP.GESAILGIGRI.RKTP.VVNED
Q0RVL0_RHOSR/192-421--------DLTG.GTFTVTN--------------IGSY.G-.S-----HFGTPVLNL.PQVAILATGAI.LDRP.VV.RD
Q5P9L2_ANAMM/204-433--------EFQG.GGFTVSN--------------LGMF.G-.V-----REFYAIINP.PQSCIMAVGQS.EKRA.VV.VD
Q5UWH1_HALMA/304-539--------EMRG.GTFTISN--------------IGGI.G-.G-----EYGTPIINQ.PESAILALGEI.KKKPRVVEAD
Q1Q664_9BACT/170-401--------DVRG.GTFTITN--------------YGVN.G-.S-----LFGTPLILQ.PQSAILGVGAV.VKRP.VI.LG
Q6MTX8_MYCMS/197-428--------EMTE.ATFTVSN--------------FGSV.E-.L-----DYATPIINS.PESAILGVGAM.SQTP.LY.IN
Q820B9_TROW8/211-440--------DTLN.GTITITN--------------IGVF.G-.V-----DSGTPILNV.GESSIVFIGAI.KPRP.WV.VN
A7NKS9_ROSCS/223-453--------LLQG.GTFTVSN--------------LGMY.G-.I-----TEFTSIITP.PQAASLAVGTI.RRVPAFKDDS
A6U0R3_STAA2/197-428--------EMKG.ATCTISN--------------IGSA.G-.G-----QWFTPVINH.PEVAILGIGRI.AQKP.IV.KD
ODO2_BUCAI/188-418--------ELMG.GNFTITN--------------GGVF.G-.S-----LMSTPIINP.PQTAILGMHVI.QERP.VV.VN
Q2NJY8_AYWBP/185-416--------QLQN.GTFTITN--------------FGSI.D-.I-----TYGTPVINY.PELAILGVGKI.TKKP.IV.EN
A4XEQ9_NOVAD/253-480--------DMDG.GTFSVSN--------------LGMF.G-.I-----EQFDAIINP.PQGAILAVGGV.NRVA.VEAAN
Q5SLR1_THET8/217-449--------EVTG.STFTITN--------------IGSV.G-.A-----TLSFPIIHL.PDAAILGVHSI.RKRPWVM.PD
Q5DM38_NYCOV/252-485--------QFIG.GTFTISN--------------AGMY.G-.I-----SQLIPIVNP.PQACILGVSAV.EKKV.VVDEA
Q5F3G9_CHICK/271-501--------EYQG.GSFSISN--------------LGMF.G-.I-----NDFIAVINP.PQACILAVGRARPELK.IVEDE
A4F1Y4_STRVG/208-431--------GR...VTLMLSH--------------LGDQ.G-.A-----TFAVPVVVP.PAAATLFLGAPSG.........
A4ICH2_LEIIN/226-463--------EFQG.GTCSVSN--------------LGAT.G-.I-----PGFTAIINP.PQAMILAVGSA.KPRAEIVKSE
Q9KG97_BACHD/180-411--------QMTG.STFTISN--------------VGPI.G-.G-----LHATPIINY.PEVAILALHKM.EPRN.VV.RE
A0LLM2_SYNFM/206-441--------EMTG.GTFTLTN--------------IGAL.G-.G-----TAFTPIINH.PQSAILGMGQA.RLQP.VV.RG
Q04KE8_STRP2/115-347--------ELQN.STFTISN--------------LGMF.G-.V-----QSFGPIINQ.PNSAILGVSST.IEKP.VV.VN
A7HBV2_ANADF/220-451--------DMGR.STFTITS--------------LGAL.G-.G-----MFATPVLNY.PEVGILGVHRI.RPTP.VV.RD
Q1IIF0_KORVE/320-555--------DVQG.GTFTITN--------------PGIF.G-.A-----KFGMPIISQ.PQLAILGIGAI.TKVP.MV.VT
A5JBE6_BURML/251-482--------ELSG.STITITS--------------LGAL.G-.G-----IASTPVINS.PEVGIVGVNRI.VERP.MF.RG
A5G5K2_GEOUR/156-387--------DLKG.RTFTITN--------------YGHF.G-.G-----VFATPIINW.PDVAILGCGRI.VERPWVY..R
Q4XMM8_PLACH/203-444--------EIEN.GTITISN--------------YGAI.G-.G-----TFATPIIFD.NQGCIIGISKI..QNM.IS.LK
Q8RD59_THETN/185-414--------EYTG.GSFTISN--------------LGMF.D-.V-----VRFAAIINP.PEVAILAVGKI.REIP.VV.EE
Q8CTW0_STAES/196-425--------QLEG.ATFTITN--------------MGAS.G-.I-----EYFTPILNL.GETGILGVGAL..TKE.VVLEA
A4XHV3_CALS8/229-459--------LLKG.ATFTVTN--------------LGSF.G-.I-----EGFTPVLNP.PQTGILGVNTI..VMR.AKEQN
A6TMP1_ALKMQ/205-437--------QLKG.STFTITN--------------LGSL.G-.V-----KSGMPIINY.PEVAIIGIGQI.EQKP.VV.VD
Q04RI4_LEPBJ/240-470--------EYTD.GTFTVSN--------------LGMF.G-.V-----SSFTAVINE.PEAAILAVGAL.VEKP.VL.KA
A7SJI4_NEMVE/174-396--------EFHG.GSLTLSN--------------LGMF.G-.V-----TEFSAIINP.LQASILAVGAT..RLS.VS.TD
A1ZHD0_9BACT/218-453--------ELSG.GTYTMSN--------------IGGF.G-.N-----EMGTPILVQ.PQVGILAIGAI.KKKP.VV.IE
Q4DDM3_TRYCC/200-436--------HMRD.GTFTISN--------------VGTI.G-.A-----TYATPMILP.PQVAISAFGRL.QVLP.RFDVD
A7BC27_9ACTO/216-447--------FLSG.GTFTVSN--------------IGSF.G-.I-----ETFTPVINL.PQTAILGVGAI.TPRP.TVAAD
O84249_CHLTR/201-428--------EYKG.GSFCVSN--------------LGMT.G-.I-----SDFTAILNP.PQAAILAVGSV.EEQP.VV.LN
Q6KH63_MYCMO/220-452--------ELKG.SDFTVTN--------------YASV.G-.S-----LFGIPVINY.PDMAIAGIGVI.KDEP.IV.TK
Q5DAR0_SCHJA/35-267--------EFQG.GSFTISN--------------LGMY.G-.I-----REFTAIVNP.PQVAILAVGT...GLP.EACIS
Q87IG1_VIBPA/172-383--------DLQH.ATITLSN--------------FGAI.G-.G-----IFATPVVSP.PQVAIVGAGRI.VDRV.VI.RN
Q6A613_PROAC/233-468--------DYAD.GTFSITN--------------VGVF.G-.L-----DAGTPVVNR.TESAILVLGAL.ARRP.WV.VG
Q2PY29_9BACT/192-418--------DWEG.NTFTISN--------------LGMF.G-.V-----EDFTAIINP.PDACILAIGGI.QSVP.VV.KD
ODP2_SCHPO/252-483--------EYQG.GTFTISN--------------LGMF.P-.V-----DQFTAIINP.PQACILAVGTT.VDTV.VPDST
O45279_CAEEL/97-322--------QFQG.GSFTISN--------------LGMF.G-SV-----TNFTAIINP.PQCAILTIGGT..RSE.VVSVD
Q97CK2_THEVO/179-398--------EVQD.STFTITN--------------VGTI.G-.G-----VLSTPIINY.PEVAILGVHR.......VMDEN
A0NRH8_9RHOB/70-301--------EMGG.ASMTITN--------------LGGI.G-.G-----TAFTPIVNP.PEVAILGITRT.ELAP.VW.DG
Q3A0D1_PELCD/165-395--------DLQG.GTFSISN--------------GGVY.G-.S-----LLSTPLLNP.PQSAILGMHSI.QQRP.VV.RD
Q1IX53_DEIGD/361-594--------EMQG.ATFTISN--------------LGGI.G-.G-----TGFTPIVNA.PEVAILGVSRG.GFEP.VWNKE
Q7WED2_BORBR/182-409--------DMSG.GAISISN--------------AGMF.N-.V-----TYMAPIINP.PQSAILGVGSI.RELF.RPDEQ
Q3J9C7_NITOC/185-392--------EYSN.PTFVISN--------------MGML.G-.V-----AYFDAIPSP.GTSAILAIATT.GPQG......
Q0W153_UNCMA/195-425--------QLRG.STFTIAN--------------IGSI.G-.G-----LFATPIINP.PESAILEMQQI.RDMP.RV.CD
Q7UU97_RHOBA/235-467--------DLRG.GSFTISN--------------LGAI.G-.G-----QYSTPIVNV.PEVAILLVGRS.RKLP.VVMPD
Q81CI7_BACCR/169-399--------DMHG.TTFTISN--------------LGSF.G-.I-----EYFTPVLNT.PETGILGIGAI.EHVP.VY.KG
ODP2_BUCBP/176-410--------DIKEYGSFTISN--------------LGGI.G-.G-----TNFTPIIKY.PELAILGISRA.LIKP.YW.NS
ODP2_YEAST/248-482--------EFQG.GTICISN--------------MGMN.N-AV-----NMFTSIINP.PQSTILAIATV.ERVA.VEDAA
Q8RBW8_THETN/173-398--------ELQG.GTFTVTN--------------LGTY.G-.V-----DFFTPVLYP.KQSAILGIGRI.VERP.VL.EN
Q4P9L5_USTMA/1242-1493--------DLKPTGTITLSN--------------VGAV.G-GG-----TYTHPLLPPTGQLAIGALGRS.RVLP.RFASE
A8FC90_BACP2/211-441--------QLKG.STFTISN--------------LGMY.A-.I-----DAFTPIINQ.PEVAILGVGRI.QDKP.VA.VD

PF00302

CAT3_ECOLX/1-205--------GVTPENHLNISA--------------LPWV-N--F-----DSFNLNVAN-FTDYFAPIITM-AKYQ----QE
CAT_PROMI/6-209--------E.FIENMFFVSA--------------NPWV-S--F-----TSFNLNMAN-INNFFAPVFTI-GKYY----TQ
CAT2_CLOPF/1-202--------PNAPENIFNVSM--------------IPWS-T--F-----DGFNLNLQK-GYDYLIPIFTM-GKYY----KE
CAT_CLOBU/1-206--------SNEPDNTFSVSS--------------IPWV-S--F-----TGFNLNVYN-EGTYLIPIFTA-GKYF----KQ
CAT1_STAAU/1-205--------TPIPENAFSLSI--------------IPWT-S--F-----TGFNLNINN-NSNYLLPIITA-GKFI----NK
CAT_SALTI/6-209--------G.FIENMFFVSA--------------NPWV-S--F-----TSFDLNVAN-MDNFFAPVFTM-GKYY----TQ
CAT_STRAC/6-211--------GNPPPNAFDVSS--------------LPWV-S--F-----TGFTLDIRD-GWDHLAPIFTL-GRYT----ER
CAT2_ECOLX/1-205--------GNLPENHLNISS--------------LPWV-S--F-----DGFNLNITG-NDDYFAPVFTM-AKFQ----QE
CAT2_STAAU/1-205--------KPIPENTIPISM--------------IPWI-D--F-----SSFNLNIGN-NSNFLLPIITI-GKFY----SE
CAT_BACPU/1-203--------PHMPENMFNISS--------------LPWI-D--F-----TSFNLNVST-DEAYLLPIFTI-GKFK----VE
CAT1_CLOPF/1-206--------TGEPANTINVSS--------------IPWV-N--F-----TGFNLNIYN-DATYLIPIFTL-GKYF----QQ
CAT_CAMCO/1-202--------PNPPENTFPVSM--------------IPWT-S--F-----EGFNLNLKK-GYDYLLPIFTF-GKYY----EE

PF07247

Q6CJX7_KLULA/18-514--------FLLSQMGKKLLT-KKW..............DQ-PI-----TRPIDASPA-SHMAH..IIKIDPT---GMQKM
Q6XBS9_SACPS/47-542--------LLSGFIYSHLRF-SS................K-GV-----CTRMDEIEK-SDEIVTEIINISPS---EFQKI
Q6BRP8_DEBHA/9-477--------FSLSAIVQSMLL-PKWLADGFWSLFSTNAEQK-PL-----Y.THLPVQK-GAKSNQRHVNIKPD---DVKRL
Q6FVS8_CANGA/40-557--------MLVSFLKTALNF-KSD......ALETRCNDEY-SG-----EPETSAVQM-GDVCYDSILNYTCE---EVAVI
Q5ANM4_CANAL/12-486--------HFQDKIIPEGFP-SKW...............K-GR-----FDTVDTHDI-SFK....LINFSKQ---ETKII
YA33_SCHPO/9-444--------LWTN...SGLPF-SKG.............FRS-PS-----YKGHAPV.R-PFSSHTIFFSISNA---VVKNI
Q5AEJ2_CANAL/10-465--------SSSNSI.....L-KKWVPFYDTICGFIWPSDP-PI-----FDTDTPVTK-NLQTKYKLLKLTSN---QIGQI
Q6XBT1_SACPS/23-529--------FLTTFIYEHCNF-KTS.............SES-TL-----TARYSPSTN-ANASYNYSLHFSTK---EVEQI
Q6FND8_CANGA/4-456--------AVVSQDASIIQF-DEY........KIPEDYLK-KN-----SNDDGCYQI-KNTNRQISLKMSSN---KLKVI

PF00668

PKSJ_BACSU/690-989--------YWQKQLSGTLPN-...--------..LQLPNV-SA-----SSVDSQFRE-D....TYTRRLSSG...FMNQV
SRFAA_BACSU/3121-3425--------YWRQLEEQAVA.-...--------..AKLPKD-RE-----SGDQRMKHT-K....TIEFSLTAE..ETEQLT
SRFAA_BACSU/2097-2386--------HWLKELDGELPV-...--------..LTLPTD-YS-----RPAVQTFEG-D....RIAFSLEAG...KADAL
SRFAA_BACSU/1058-1346--------YWKEVFAGELPV-...--------..LQLLSD-YP-----RPPVQSFEG-D....RVSIKLDAG...VKDRL
SRFAA_BACSU/2-303--------FWNKQFESVPE.-...--------..LVSLKR-NA-----S.AGGSLDA-E....RFSKDVPEA...LHQQI
SRFAB_BACSU/3117-3421--------YWSQIAAEQVSP-...--------....LPKD-CE-----TEQRIVKDT-S....SVLCELTAE..DTKHLL
PPSA_BACSU/2089-2400--------YWQTILDAHTAF-...--------....LPKD-IE-----NVPDKLQMN-S...DAAAFVLSGD..WTEKLL
ACVS_EMENI/3105-3393--------YWEGLLAQTAA.-...--------....NISA-LP-----PVTGTRT..-.....RLARTWSDD...RTVIL
SRFAB_BACSU/6-306--------YWSERLAGFEQP-...--------..SVLPGR-LP-----VKKDEYV.N-K....EYSFTWDET...LVARI
SRFAC_BACSU/9-309--------YWREYLEGFEG.-...--------..QTTFAE-QR-----KKQKDGYEP-K....ELLFSLSEA...ETKAF
ACVS_EMENI/944-1252--------YWAGIVNQIEER-CDM--------NALLNERS-RY-----KIQLADYDK-VEDQQQLTLTVPDA..SWLSKL
SRFAB_BACSU/1054-1340--------YWLDVFKGELPI-...--------..LDLPAD-FE-----RPAERSFAG-E....RVMFGLDKQ...ITAQI
SRFAB_BACSU/2093-2382--------YWMSVLSGELPE-...--------..LDLPLD-YA-----RPPVQSFKG-D....TIRFRTGSE...TAKAV
PPSA_BACSU/1048-1338--------YWLKQLEGELPV-...--------..LDLPAD-HA-----RPPVRSFAG-D....KVSFTLDQE...VASGL
ACVS_EMENI/2018-2321--------FWLQRLDGLEP.-...--------..LQLLPD-YP-----RPAQFNYDG-G....DLSVILDGV...VLETL
PPSA_BACSU/2-300--------FWTQTFEHPLE.-...--------..YHSLAD-QT-----SLQKQSTSA-S....RDTIILSPD...LEQTI
GRSB_BREBE/9-310--------YWKEHLMNYDQS-...--------..VTLPKK-KA-----AINNTTYEP-A....QFRFAFDKV...LTQQL
GRSB_BREBE/1058-1347--------YWLNVFTEEIPV-...--------..LNLPTD-YP-----RPTIQSFDG-K....RFTFSTGKQ...LMDDL
GRSB_BREBE/2093-2382--------YWLNTFAEDIPV-...--------..LNLSTD-YP-----RPTIQSFEG-D....IVTFSAGKQ...LAEEL
GRSB_BREBE/3138-3427--------YWVNVFADERPI-...--------..LDIPTD-YP-----RPMQQSFDG-A....QLTFGTGKQ...LMDGL
HTS1_COCCA/4782-5060--------FWSSYLSDVKP.-...--------..ARLMFN-YN-----LVSNPRQD.-.R.LYEARINIPKR......VL
GRSA_BREBE/620-923--------YWHHLNYYTDN.-...--------..VQIKKD-YV-----TMNNKQK..-.N.IRYVGMELTIE..ETEKLL
TYCA_BREPA/610-913--------YWESLESQAKN.-...--------..VSLPKD-YE-----VTDCKQK..-.S.VRNMRIRLHPE..ETEQLL
PPSB_BACSU/2088-2393--------YWDECENRHIQP-...--------....IPKD-ND-----AASNTFK..-.D.TEVIDFELSRH..HTELLL
ACVS_CEPAC/3050-3340--------HWNVLRKTVAQS-...--------........-FE-----TLPICMG..-.G.VLQCQEKFSRE..TTTALL
ACVS1_PENCH/3082-3370--------HWNKLVMETASS-...--------........-IS-----ALPTSTG..-.S.RVRLSRSLSPE..KTASLI
ACVS_NOCLA/2998-3282--------FWAETTRDMES.-...--------.....AEL-LA-----QTEGTTRR.-.....REEFALTAP..DTRTLL
HTS1_COCCA/854-1158--------VDRTVPLIPKIP-...--------..TADFGY-WG-----LKHDENVYG-N....TVERKIPLGHSITEDLL
PPSB_BACSU/7-310--------YWSEYLKEYGN.-...--------.TASIPRI-KR-----RTADGNYKA-D....QVSFSLAP...DMVEKL
PPSC_BACSU/7-306--------YWKKRLQHFEK.-...--------.STPLPKR-TD-----QIPNGTLQ.-.....QITFAIPE...KETAEL
ACVS_CEPAC/893-1203--------FWAEQIGRIEER-CDM--------NALLNEAS-RY-----KVPLADYDQ-VREQRQQTISLPWNN.SMDAGV
ACVS1_PENCH/916-1226--------FWAGVVQKINER-CDM--------NALLNERS-RY-----KVQLADYDQ-VQEQRQLTIALSG.D.AWLADL
ACVS_NOCLA/876-1186--------YWVEQLGRIDER-GDF--------AGLLNEKS-RY-----RVSLGDYDH-VQRHRTRKLYLGA...DLTGAL
HTS1_COCCA/1337-1660--------YWKNALRGATT.-...--------..CSFPPL-FD-----QITSEKAMP-R....QSWASVPIPLCVDSKEL
HTS1_COCCA/2530-2808--------FWRKLLVKPDQ.-...--------....ESFR-FP-----DVPVGHK..-.....PATRCTTN....FHFPF
PPSB_BACSU/1052-1342--------YWLGQLGGSLPT-...--------..LELPLD-KT-----RPRLPDFRG-G....TIEVNIDKD...MADEL
ACVS_CEPAC/1969-2278--------YWLRKLSDMEA.-...--------..SYLVPD-RP-----RPAQFDYTG-N....DLQFSTTPE...TTAQL
ACVS1_PENCH/1992-2295--------FWLRKLIGLEP.-...--------..LQLITD-RP-----RPVQFKYDG-D....DLSIELSKK...ETENL
ACVS_NOCLA/1948-2242--------FWTGALGGFET.-...--------..IALPLD-HP-----RPPRFDYRG-R....ELEFELDER...TTEAL
ENTF_ECOLI/1-301--------FWAEQRRQLPP.-...--------.....PAS-LS-----PAPLPGRSA-SADILRLKLEFTDG.....EFR
HMWP2_YERE8/111-410--------YWLAKASTLPPA-...--------.P.VLPLV-CE-----PATLREVRN-T....RRRMIVPAT...RWHAF
HMWP2_YERE8/1492-1782--------WWQAQLDDIPPA-...--------.P.ALPLR-CL-----PQEVETPRF-A....RLNGALDST...RWHRL

PF03007

Q9RIU8_STRCO/6-253--------LPD.........-...................-.V-----RALPDRLRG-ALSDAGRALDIG..........
TGS3_MYCTU/5-271--------LLRAVG......-...........DWLVRPGA-QL-----QAVGSAVAG-LVTNSGQLVETGR....KVLDI
Y3154_MYCBO/4-256--------SVRRGG......-............FRVNPSE-AL-----TASTAVMAG-IVRAAKGASE...........I
Y3115_MYCBO/4-273--------PATVSRRAQLQG-............QLQGMIK-GL-----TKLPSGLFG-VSADAADLGAQALS......LK
Y1760_MYCTU/38-298--------QIAASG......-.............LEGFAS-RP-----VRLATVVPA-TVLTLVRTLLRAR........E
Y919_MYCBO/32-296--------APRGSS......-............RPLTLAK-GV-----LGQARGVPG-MVRVVADTTWRAA........Q
Q9X7A8_MYCLE/4-282--------DLMLQG......-............INHLPVA-LA-----GGVVGGLSG-VASVAGRAILRPA........S
Y1425_MYCTU/4-264--------ERRAIG......-..............ALINV-GI-----MTPFRIVRL-LEQTVRQQIAALG........V
Y3371_MYCTU/4-237--------DAR.........-...............SWAE-TL-----WRMSVSIAG-AVCTAA................
Y3480_MYCTU/8-298--------QDSVGGGLIAGA-GNVLDGLGDVVRGLGGLVS-GV-----GSVLGSVAG-AGRSTFELTKALVNAQLRSDHE
Y3761_MYCBO/4-262--------RPPSDG......-..............SSLLD-AL-----FKMAGSVVG-LAPSTLKLARAAL........L
Y2484_MYCTU/4-282--------DLMRRG......-............INHLPIA-VV-----GGVLDALSG-AVSMAGRAVLEPV........S
Y3087_MYCTU/4-268--------RQR.LG......-...........WALRDLPS-RL-----GKIAPTVRA-VRDRVRIEREFAKD.......G
Y221_MYCTU/4-263--------QLLSAA......-.............FIDHLR-HL-----GRIPATIRY-TTQGLGRVRRSSRK.......L
Y3740_MYCTU/1-257--------AIKRR.......-..............RGRLQ-QL-----GGMLGSVAG-LAPSTLRLARSAL........I
Y2306_MYCBO/4-256--------DLAS........-..............VLAAA-TT-----KRAVEGVSA-VSELAGRLSSMVLG.......A

PF02458

O64549_ARATH/128-561KLESFSAFLWKLVAEHAAKD-PVPIK.....TSKLGIVVD-GRRRLM.EKENNTYFG-NVLSVPFGGQRI..DDLISKPL
O04201_ARATH/6-476SFQSLCALLWRAITRARKLP-SSKT.......TTFRMAVN-CRHRLS.PKLNPEYFG-NAIQSVPTFATA..AEVLSRDL
Q43583_TOBAC/11-441TFELLTAVLWRCRTMSLKPD-PEEE.......VRALCIVN-ARSRFN.PPLPTGYYG-NAFAFPVAVTTA..AKLSKNPL
O23392_ARATH/6-435RVESVTALIWKCFVASSKTT-TCDH.......KVLVQLAN-LRSKIP.SLLQESSIG-NLMFSSVVLSIGRGGEVKIEEA
O64988_CLABR/1-429RVDLVTAFLSKSLIEMDCAK-KEQTK...SRPSLMVHMMN-LRKRTK.LALENDVSG-NFFIVVNAESKITVAPKITDLT
O23393_ARATH/3-424RVEAIMSLIWRCARNSSRSN-LLIPR.....QAVMWQAMD-IRLRIPSSVAPKDVIG-NLQSGFSLKKDA.ESEFEIPEI
HCBT2_DIACA/1-446TYEVVAGHVWRSVSKARGLS-DHEE.......IKLIMPVD-GRSRINNPSLPKGYCG-NVVFLAVCTATV..GDLSCNPL
O80816_ARATH/16-448GFNVVTALVWRCKALSVAAE-EGEETN.LERESTILYAVD-IRGRLN.PELPPSYTG-NAVLTAYAKEKC..KALLEEPF
O64470_ARATH/2-450RYETVTGHVWRCACKARGHS-PEQP.......TALGICID-TRSRME.PPLPRGYFG-NATLDVVAASTS..GELISNEL
DAT_CATRO/8-434RVEVLTAFLSRCATVAGKSA-AKNNNCGQSLPFPVLQAIN-LRPILELPQNSVGNLV-SIYFSRTIKENDYLNEKEYTKL
O80467_ARATH/11-450TFEVIGAYLWKSRVKALNLD-RDGV.......TVLGLSVG-IRNVVD.PPLPDGYYG-NAYIDMYVPLTA..REVEEFTI

PF00755

CACP_MOUSE/34-616QDLDIMMLTFHHFGKDFPKS.EKLSPDAFIQVALQLAYYR.IY-----GQACATYES-ASLRMFHLGRTDTIRSASIDSL
Q20278_CAEEL/11-599SKTNVNVYHYTNFGATYCKQ.RTLYADTIIQIALQMAYLK.TH-----NKLAPTYET-ASTRMFYHGRTETVRSLTTDME
CLAT_RAT/22-612KNLDFIVYKFDNYGKTFIKK.QKYSPDGFIQVALQLAYYR.LY-----QRLVPTYES-ASIRRFQEGRVDNIRSATPEAL
CACM_YEAST/3-644SQYEFVNLDFSNYGASHIKTVFKCSPDAFVQQVFQVAYFA.LY-----GRFETVYEP-AMTKAFQNGRTEAIRSVTGQSK
Q23066_CAEEL/147-743NDLDLYALAFRDFGKGRIKK.CGVSPDAFIQMAIQLANYR.DQ-----GKFVLTYEP-ASARFFANSRTETLRTVNDHSC
CPT1B_HUMAN/172-763DDVELYCFQFLPFGKGLIKK.CRTSPDAFVQIALQLAHFR.DR-----GKFCLTYEA-SMTRMFREGRTETVRSCTSEST
CLAT_CAEEL/19-623NELELEVLIFNEFGKDSIKN.WRVSPDGFIQLIMQLAHYK.TH-----GHLVSTYES-ASVRRFGAGRVDNIRANTQEAL
OCTC_RAT/19-605SDLQIAASTFTSFGKKLTKK.EALHPDTFIQLALQLAYYR.LH-----GRPGCCYET-AMTRYFYHGRTETVRSCTVEAV
OCTC_BOVIN/19-605SDLQLVVYAFTSFGKKLTKE.KQLHPDTFIQLALQLAYYR.LH-----GRPGCCYET-AMTRLFYHGRTETVRPCTVEAV
Q17499_CAEEL/21-602EDLDIVAFTFKPYGKNFPKS.SKISPDSFIQMAYQLAFYR.IH-----SSLPPTYET-ATLRKFTEGRTENIRSPNTAAA
O44619_CAEEL/140-733DDLHMHSIAFTDFGKGRVKK.CGISPDGFLQMAIQLANY.YDQ-----GKFVLTYEP-GSVRFYANSRTETLRPVTDYSC
CLAT_DROME/87-717DDLDFYVYRYQSYGKTFIKS.CQVSPDVYIQLALQLAHYK.LY-----GRLVATYES-ASTRRFLHGRVDCIRAASTEAL
CACP_COLLI/35-617EDLDVIVLVFHQFGKNYPKS.EKISPDAFIQLALQLAYYR.MY-----GHSCATYES-ASLRMFRLGRTDTIRSTSIESH
CPT2_HUMAN/48-649KTLTIDCVQFQRGGKEFLKK.QKLSPDAVAQLAFQMAFLR.QY-----GQTVATYES-CSTAAFKHGRTETIRPASVYTK
CACP_YEAST/73-658GEHDLRVWHYNKYGKTFIKR.HGMSPDAFIQQVIQLAVFK.YL-----KRQLPTYEA-ASTRKYFKGRTETGRSVSTASL
CACP_CANTR/41-613AAHDEEIFQHYGYGKGLIKK.FKVSPDAYVQLLMQLAYFK.YT-----GKIRPTYES-AATRKFLKGRTETGRTVSNESK
CPT1A_HUMAN/170-763NDVDFHSFPFVAFGKGIIKK.CRTSPDAFVQLALQLAHYK.DM-----GKFCLTYEA-SMTRLFREGRTETVRSCTTESC

PF00198

Q7PG41_ANOGA/236-467GR....--------------.....VV-------------PAHI.....MVVSWTADHRII-------------------
A4H464_LEIBR/234-468GN....--------------.....LY-------------AANV.....VCFSFTADHRVI-------------------
Q8IJJ4_PLAF7/416-640ED....--------------.....LK-------------IQKG.....MMMTLTCDHRHI-------------------
B0K8I7_THEP3/156-382DN....--------------.....IV-------------IRHI.....IKLSLSFDHRLI-------------------
A9B180_HERA2/216-442GE....--------------.....IV-------------IRQL.....MNVTVSADHRAT-------------------
B9LC79_CHLSY/227-461NG....--------------.....IS-------------VRPL.....VKLTLCVDHRVV-------------------
B8GAA3_CHLAD/150-362TT....--------------.....LV-------------VGAV.....AQLSLCYDARIL-------------------
Q7MB23_PHOLL/166-382......--------------.....DL-------------EGYP.....MSLTLVFDHRVI-------------------
A5G2C9_ACICJ/193-425EQ....--------------.....IA-------------IATM.....MTVTLSCDHRVV-------------------
A7K5W2_VIBSE/398-631KE....--------------.....FE-------------PRLQ.....LPLSLSYDHRVI-------------------
A6QGW5_STAAE/188-420DT....--------------.....IE-------------NRPM.....MYIALSYDHRII-------------------
Q8IEA6_PLAF7/189-419NE....--------------.....IV-------------IRPI.....MYLALTYDHRLL-------------------
Q6C806_YARLI/226-463GD....--------------.....IV-------------PEQI.....INASWSGDHRVL-------------------
A6Q9K5_SULNB/241-441......--------------.....IE-------------GR.......ITVTLTVDHRIV-------------------
A4CCC7_9GAMM/276-508GS....--------------.....VV-------------SRAI.....MQVSWSGDHRVI-------------------
A4IKZ7_GEOTN/204-435DS....--------------.....IE-------------ISFV.....MPLSLTYDHRLI-------------------
A5IXN4_MYCAP/10-243GA....--------------.....VE-------------NRKV.....MYLSIAADHQWV-------------------
Q05SD7_9SYNE/221-446GKD...--------------...GSIS-------------VKRQ.....MQVNLTADHRVI-------------------
Q2B858_9BACI/159-388DQ....--------------.....IV-------------IRSI.....MKLSMSFDHRIA-------------------
ODP2_MYCPN/169-401GG....--------------.....VA-------------VHTI.....LPLTIAADHRWV-------------------
A6DTS5_9BACT/215-442GE....--------------.....VK-------------SAKV.....CKMTITCDHRVI-------------------
Q67RX4_SYMTH/33-262..D...--------------...DQLA-------------IRPM.....MYLALTADHRAV-------------------
A0QDC1_MYCA1/158-386TE....--------------.....VV-------------VRPT.....MSLSAVFDHRIA-------------------
A3RZM1_RALSL/164-375GA....--------------.....PA-------------VHRV.....LPLSLTFDHRVV-------------------
Q018W7_OSTTA/269-503GG....--------------.....YE-------------EITV.....MSATLSCDHRVV-------------------
A0JUQ7_ARTS2/229-460DE....--------------.....VA-------------LRQV.....MTLSLSFDHRLV-------------------
Q9CJD7_LACLA/298-530GE....--------------.....IV-------------VGQN.....MKLSMTYDHRLI-------------------
A0LSF1_ACIC1/217-449GQ....--------------.....LA-------------VGKV.....MTITLSIDHRAL-------------------
Q253H7_CHLFF/159-388DS....--------------.....LV-------------IRKM.....VYVTLTFDHRVL-------------------
KGD_MYCS2/97-344GASEE.--------------.RIADLG-------------IGKL.....ITLTSTYDHRII-------------------
A5GAC3_GEOUR/194-419GQ....--------------.....VV-------------AARV.....MRATLSADHRLI-------------------
Q55ZP3_CRYNB/357-619GGKVFD--------------LGVEDVK-------------SAGLKAVLRVPVGWSADHRVL-------------------
Q1NYU2_9FLAO/144-371DK....--------------.....IV-------------IGHT.....TKFTLTCDHRII-------------------
A2QTN3_ASPNC/236-469GQ....--------------.....VT-------------KGEL.....VNFSWSADHRVV-------------------
Q59298_9CLOT/219-443GE....--------------.....IV-------------IKPL.....MNLSLTANHRAV-------------------
Q9M724_ARATH/249-480GT....--------------.....VY-------------PASI.....MMVNIAADHRVL-------------------
A0CLV5_PARTE/180-390MN....--------------.....IV-------------PRKI.....MNLSFGCDHRVI-------------------
A4FGQ0_SACEN/225-452GR....--------------.....LA-------------VRKV.....CELTLAFDHRVC-------------------
Q6MPR6_BDEBA/309-540GQ....--------------.....VS-------------AIKV.....MNYTMTADHRLI-------------------
A1SQ65_NOCSJ/201-427GA....--------------.....VV-------------PGKV.....LTVTLSVDHRPV-------------------
Q6AFG4_LEIXX/233-470ADGT..--------------...DSIA-------------IRST.....IYLALSYDHRIV-------------------
A6U1Y7_STAA2/191-418DM....--------------.....IA-------------IRSM.....VNLCISIDHRIL-------------------
A5GEF2_GEOUR/180-403GM....--------------.....LG-------------VRRV.....MSASLAGDHRAT-------------------
A5V538_SPHWW/170-392ENG...--------------...APVA-------------VRK......VTLTLACDHRAI-------------------
Q03DD0_PEDPA/195-427GE....--------------.....LA-------------VGNT.....LKLSLSFDHRLI-------------------
Q0RVL0_RHOSR/192-421GE....--------------.....VR-------------AGKV.....VHLSLTVDHRII-------------------
Q5P9L2_ANAMM/204-433GC....--------------.....VV-------------PADV.....MTVTLSVDHRSV-------------------
Q5UWH1_HALMA/304-539GEE...--------------....TIE-------------PRHI.....MTLSLSFDHRVL-------------------
Q1Q664_9BACT/170-401DAD...--------------....AIA-------------VRSM.....VYLSLSFDHRVM-------------------
Q6MTX8_MYCMS/197-428GE....--------------.....LQ-------------KRFI.....MPLSMTCDHRII-------------------
Q820B9_TROW8/211-440GE....--------------.....IS-------------VRRV.....ATIGGSFDHRVM-------------------
A7NKS9_ROSCS/223-453DE....--------------.....VV-------------AKHL.....MMLTLSADHRVT-------------------
A6U0R3_STAA2/197-428GE....--------------.....IV-------------AAPV.....LALSLSFDHRQI-------------------
ODO2_BUCAI/188-418GQ....--------------.....IK-------------ILPM.....MYLALSYDHRLI-------------------
Q2NJY8_AYWBP/185-416NQ....--------------.....IV-------------IADM.....LPLSLAIDHRII-------------------
A4XEQ9_NOVAD/253-480GD....--------------.....IA-------------FENR.....IQLTMSVDHRAI-------------------
Q5SLR1_THET8/217-449GS....--------------.....IR-------------PRDI.....MFLSLSFDHRLV-------------------
Q5DM38_NYCOV/252-485KNEHM.--------------..PGPLR-------------IASK.....MTVSLSCDHRVV-------------------
Q5F3G9_CHICK/271-501EGN...--------------...EKLK-------------QHQL.....MTVTLSSDGRVV-------------------
A4F1Y4_STRVG/208-431......--------------.....SG-------------PKAV.....RRIVLAFDHTVF-------------------
A4ICH2_LEIIN/226-463ETGEF.--------------..EMTGR-------------VENV.....VNFSASFDHRIV-------------------
Q9KG97_BACHD/180-411WE....--------------.....SV-------------IKLM.....MNMSLSFDHRLV-------------------
A0LLM2_SYNFM/206-441DLER..--------------...HEIV-------------PRLL.....LPLIVAFDHRIV-------------------
Q04KE8_STRP2/115-347GE....--------------.....IV-------------IRPI.....MSLGLTIDHRVV-------------------
A7HBV2_ANADF/220-451GQ....--------------.....VV-------------VRDV.....MHVSVTSDHRVV-------------------
Q1IIF0_KORVE/320-555DKDG..--------------..NDSIA-------------IRSR.....CHISIGYDHRVI-------------------
A5JBE6_BURML/251-482GA....--------------.....VV-------------ARKL.....MNLSSSFDHRVI-------------------
A5G5K2_GEOUR/156-387GA....--------------.....IV-------------VRKI.....LPLSLTFDHRVT-------------------
Q4XMM8_PLACH/203-444NGVNKI--------------SSLDDLE-------------IANN.....MNITYGADHRYI-------------------
Q8RD59_THETN/185-414GQ....--------------.....IE-------------IEPI.....MEMTLSSDHRVI-------------------
Q8CTW0_STAES/196-425DN....--------------.....IK-------------QVSK.....IPLSLTFDHQIL-------------------
A4XHV3_CALS8/229-459GQ....--------------.....IT-------------YYPA.....IGLSLTFDHRAL-------------------
A6TMP1_ALKMQ/205-437NE....--------------.....VV-------------IRWM.....MPLSLSFDHRVL-------------------
Q04RI4_LEPBJ/240-470GN....--------------.....IV-------------PGKI.....LNVTLSCDHRVI-------------------
A7SJI4_NEMVE/174-396GQ....--------------.......-------------LQNV.....ITVKLSCDARVV-------------------
A1ZHD0_9BACT/218-453TPTG..--------------...DVIG-------------IRHM.....MFMSHAYDHRIV-------------------
Q4DDM3_TRYCC/200-436GN....--------------.....VV-------------RANI.....VHLSSTADHRVI-------------------
A7BC27_9ACTO/216-447GS....--------------.....IG-------------VEQR.....LNLSLTIDHQVI-------------------
O84249_CHLTR/201-428GE....--------------.....LA-------------VGLT.....CMLTLSVDHRVI-------------------
Q6KH63_MYCMO/220-452NG....--------------.....IV-------------AGKI.....MNLTVAADHRWV-------------------
Q5DAR0_SCHJA/35-267TSFT..--------------..ENEIT-------------FSTY.....LTLTLSNDSRCV-------------------
Q87IG1_VIBPA/172-383GQ....--------------.....AV-------------AVKA.....MPLSITFDHRAC-------------------
Q6A613_PROAC/233-468TGDD..--------------...ERVV-------------PRWV.....TTMSLGFDHRLI-------------------
Q2PY29_9BACT/192-418GE....--------------.....IV-------------PGHV.....MKVTLSCDHRAV-------------------
ODP2_SCHPO/252-483SEK...--------------....GFK-------------VAPI.....MKCTLSSDHRVV-------------------
O45279_CAEEL/97-322GQ....--------------.....LE-------------TQKL.....MGVNLCFDGRAI-------------------
Q97CK2_THEVO/179-398GK....--------------.......-------------..KI.....MYLSLSCDHRLI-------------------
A0NRH8_9RHOB/70-301ET....--------------.....FQ-------------PVQM.....VPLDLSYDHRVI-------------------
Q3A0D1_PELCD/165-395DQ....--------------.....IV-------------ARPM.....MYLALSYDHRLI-------------------
Q1IX53_DEIGD/361-594TG....--------------....SFE-------------PRNM.....LPLSLTYDHRLI-------------------
Q7WED2_BORBR/182-409GA....--------------.....PA-------------LRRE.....MGLVLAADHRLH-------------------
Q3J9C7_NITOC/185-392......--------------.......-------------.........MPVTITADHRIV-------------------
Q0W153_UNCMA/195-425GN....--------------.....VC-------------VRKV.....MNLSLTIDHRII-------------------
Q7UU97_RHOBA/235-467DS....--------------.....IQ-------------PRLM.....MPLSLSYDHRLV-------------------
Q81CI7_BACCR/169-399KK....--------------.....LK-------------KGSM.....LPLSLTFDHRVL-------------------
ODP2_BUCBP/176-410HA....--------------.....FI-------------PKLM.....LPLSLSYDHRAI-------------------
ODP2_YEAST/248-482AEN...--------------....GFS-------------FDNQ.....VTITGTFDHRTI-------------------
Q8RBW8_THETN/173-398GN....--------------.....IR-------------SAQF.....MTLSLTVDHQVI-------------------
Q4P9L5_USTMA/1242-1493IPSLGV--------------SDPDKIV-------------RRLI.....MSVSFTGDHRVV-------------------
A8FC90_BACP2/211-441GE....--------------.....IQ-------------VRPM.....MGVSLSFDHRVV-------------------

PF00302

CAT3_ECOLX/1-205GD---------------------------------------RLL-----LPLSVQVHHAVC-------------------
CAT_PROMI/6-209GD---------------------------------------KVL-----MPLAIQVHHAVC-------------------
CAT2_CLOPF/1-202DN---------------------------------------KII-----LPLAIQVHHAVC-------------------
CAT_CLOBU/1-206EN---------------------------------------KIF-----IPISIQVHHAIC-------------------
CAT1_STAAU/1-205GN---------------------------------------SIY-----LPLSLQVHHSVC-------------------
CAT_SALTI/6-209GD---------------------------------------KVL-----MPLAIQVHHAVC-------------------
CAT_STRAC/6-211DT---------------------------------------RLL-----LPLSVQIHHAAA-------------------
CAT2_ECOLX/1-205GD---------------------------------------RVL-----LPVSVQVHHAVC-------------------
CAT2_STAAU/1-205NN---------------------------------------KIY-----IPVALQLHHAVC-------------------
CAT_BACPU/1-203EG---------------------------------------KII-----LPVAIQVHHAVC-------------------
CAT1_CLOPF/1-206DN---------------------------------------KIL-----LPMSVQVHHAVC-------------------
CAT_CAMCO/1-202GG---------------------------------------KYY-----IPLSIQVHHAVC-------------------

PF07247

Q6CJX7_KLULA/18-514RARVKD--------------KLNGKAT-------------LTPF-----MQACWFVSCYEAGLF......DDRKWNEFFI
Q6XBS9_SACPS/47-542RTKIKL--------------NIPGKCT-------------ITPF-----LEVCWFVTLHKWGKF......FKPLKFEWLT
Q6BRP8_DEBHA/9-477RAFCRS--------------Q...STT-------------LTPY-----ITAIAMYALQETVF.......PVVSNSQCSF
Q6FVS8_CANGA/40-557RDRIKH--------------NVHGKCT-------------VTPF-----IQAAFFVAMHQSRKLLGQKQGFKEWMSEWGV
Q5ANM4_CANAL/12-486LSKCKE--------------H...KVG-------------ITSY-----IEVVHALTLQ...........PIFGDNSFTT
YA33_SCHPO/9-444KQLSKN--------------I...DAS-------------FTSI-----FYSVFMLSIYY..........AIAKNGKVNL
Q5AEJ2_CANAL/10-465SKYCRS--------------H...GIT-------------LTTY-----FDIICICALQETVF.......SVVKSSATHT
Q6XBT1_SACPS/23-529RAQIKK--------------NVHDGCT-------------LTPF-----IQACFLVALYRLDKL......FTKSLLEYGF
Q6FND8_CANGA/4-456MKDCKQ--------------H...HVS-------------FTAY-----LTAVLYLALGKI.........PKEKYSGSTI

PF00668

PKSJ_BACSU/690-989RTFAKE--------------H---SVN-------------VTTV-----FLSCYMMLLGRY-------------------
SRFAA_BACSU/3121-3425TKVHEA--------------Y---HTE-------------MNDI-----LLTAFGLAMKEW-------------------
SRFAA_BACSU/2097-2386RRLAKE--------------T---DST-------------LYMV-----LLASYSAFLSKI-------------------
SRFAA_BACSU/1058-1346NRLAEQ--------------N---GAT-------------LYMV-----MLSAYYTLLSKY-------------------
SRFAA_BACSU/2-303LSFCEA--------------N---KVS-------------VLSV-----FQSLLAAYLYRV-------------------
SRFAB_BACSU/3117-3421TDVHQP--------------Y---GTE-------------INDI-----LLSALGLTMKEW-------------------
PPSA_BACSU/2089-2400FETQQA--------------Y---GTD-------------ANEL-----LLTALGMALSEW-------------------
ACVS_EMENI/3105-3393LNEASN--------------Q---NAS-------------IQDL-----LLAAVGLALQQV-------------------
SRFAB_BACSU/6-306QQTANL--------------H---QVT-------------GPNL-----FQAVWGIVLSKY-------------------
SRFAC_BACSU/9-309TELAKS--------------Q---HTT-------------LSTA-----LQAVWSVLISRY-------------------
ACVS_EMENI/944-1252RQTCSA--------------Q---GIT-------------LHSI-----LQFVWHAVLHAY-------------------
SRFAB_BACSU/1054-1340KSLMAE--------------T---DTT-------------MYMF-----LLAAFNVLLSKY-------------------
SRFAB_BACSU/2093-2382EKLLAE--------------T---GTT-------------LHMV-----LHAVFHVFLSKI-------------------
PPSA_BACSU/1048-1338HKLARE--------------N---GST-------------LYMV-----LLAAYTAFLSRL-------------------
ACVS_EMENI/2018-2321RGIAKD--------------H---GVT-------------LYAV-----LLAVYCLMLSTY-------------------
PPSA_BACSU/2-300RIFCEE--------------H---KIN-------------IISL-----FMASFYICISRI-------------------
GRSB_BREBE/9-310LRIANQ--------------S---QVT-------------LNIV-----FQTIWGIVLQKY-------------------
GRSB_BREBE/1058-1347YKVATE--------------T---GTT-------------LYMV-----LLAAYNVFLSKY-------------------
GRSB_BREBE/2093-2382KRLATE--------------T---GTT-------------LYML-----LLAAYNVLLHKY-------------------
GRSB_BREBE/3138-3427YRVATE--------------T---GTT-------------LYMV-----LLAAYNVLLSKY-------------------
HTS1_COCCA/4782-5060S.....--------------.---QAT-------------AATV-----LLAGLTLLVARV-------------------
GRSA_BREBE/620-923KNVNKA--------------Y---RTE-------------INDI-----LLTALGFALKEW-------------------
TYCA_BREPA/610-913KHANQA--------------Y---QTE-------------INDL-----LLAALGLAFAEW-------------------
PPSB_BACSU/2088-2393TAAHKA--------------Y---STE-------------MNDI-----LLTALGLALQKW-------------------
ACVS_CEPAC/3050-3340SKACPA--------------L---DSG-------------MHEI-----LLMAVGSALQKA-------------------
ACVS1_PENCH/3082-3370QGGIDR--------------Q---DVS-------------VYDS-----LLTSVGLALQHI-------------------
ACVS_NOCLA/2998-3282AESPWA--------------Y---DTE-------------VNDL-----LLTATGFALRSI-------------------
HTS1_COCCA/854-1158YKCHDS--------------L---HTK-------------TIDV-----LLAAVLVSFRRS-------------------
PPSB_BACSU/7-310TEAAQN--------------W---GVT-------------LNTL-----FMSIWGVLLHRY-------------------
PPSC_BACSU/7-306QKIAAA--------------S---GAT-------------LNTV-----FQALWGIMLQKV-------------------
ACVS_CEPAC/893-1203REELSS--------------R---GIT-------------LHSI-----LQTVWHLVLHSY-------------------
ACVS1_PENCH/916-1226RQTCSA--------------Q---GIT-------------LHSI-----LQFVWHAVLHAY-------------------
ACVS_NOCLA/876-1186KAGCAA--------------D---QVT-------------LHSV-----LQFVWHKVLHAI-------------------
HTS1_COCCA/1337-1660SKTLAN--------------L---GIT-------------MSTM-----FQTVWAIVLRIY-------------------
HTS1_COCCA/2530-2808S.MQSK--------------I---GTT-------------ANTC-----INAAWAITLAQY-------------------
PPSB_BACSU/1052-1342HRLMAE--------------T---GTT-------------LYMI-----LLAVYSILLSKL-------------------
ACVS_CEPAC/1969-2278KELAKR--------------E---GSS-------------LYTV-----VAAAYFLLLYVY-------------------
ACVS1_PENCH/1992-2295RGVAKR--------------C---KSS-------------LYVV-----LVSVYCVMLASY-------------------
ACVS_NOCLA/1948-2242RELART--------------A---RVS-------------LYSV-----LLGAWCLMLNMY-------------------
ENTF_ECOLI/1-301QLATQL--------------S---GVQ-------------RTDL-----ALALAALWLGRL-------------------
HMWP2_YERE8/111-410SNRAGE--------------Y---GVT-------------PTMA-----LATCFSAVLARW-------------------
HMWP2_YERE8/1492-1782KKRAAD--------------A---HLT-------------PSAV-----LLSVWSTVLSAW-------------------

PF03007

Q9RIU8_STRCO/6-253AAAALS--------------T---LDV-------------R...-----...SSPALTAAS-------------------
TGS3_MYCTU/5-271ARTVAR--------------G---TAP-------------S...-----....SPLN.ATV-------------------
Y3154_MYCBO/4-256AAGVLS--------------P---AAS-------------....-----.....SLN.GPI-------------------
Y3115_MYCBO/4-273ARKASL--------------P---FTA-------------R...-----...RTLFNNTAK-------------------
Y1760_MYCTU/38-298GRTMAA--------------P---FSA-------------P...-----...PTPFN.GPL-------------------
Y919_MYCBO/32-296CRSGPL--------------T---LAA-------------P...-----...HTPLN.EPI-------------------
Q9X7A8_MYCLE/4-282TVSGVV--------------G---YVR-------------SGIR-----VLSQAAEP.SPL-------------------
Y1425_MYCTU/4-264AGKPAR--------------Y---FEA-------------P...-----...KTRFN.APV-------------------
Y3371_MYCTU/4-237ARAVSW--------------P---AVT-------------....-----.....SPA.GPV-------------------
Y3480_MYCTU/8-298YRNLVG--------------S---VQA-------------P...-----...HCILN.TRI-------------------
Y3761_MYCBO/4-262EQQLTL--------------P---FAA-------------P...-----...HSMFN.VKV-------------------
Y2484_MYCTU/4-282TVSGIL--------------G---YAR-------------SGIR-----VLNRAAEP.SPL-------------------
Y3087_MYCTU/4-268DRRVPP--------------T---FDR-------------SAP.-----...PGPFQ.RGL-------------------
Y221_MYCTU/4-263SPALTM--------------P---FTP-------------P...-----...PTFMN.HRL-------------------
Y3740_MYCTU/1-257EQQLTL--------------P---FGA-------------P...-----...HTMLN.VAV-------------------
Y2306_MYCBO/4-256NSSVRA--------------A---LTT-------------P...-----...RTPFN.TRV-------------------

PF02458

O64549_ARATH/128-561SWVTEE--------------V---HRF-------------LKKS-----VTKEHFLNLIDWVETCRP.....TPAV----
O04201_ARATH/6-476KWCADQ--------------L---NQS-------------VAAH-----QDGRIRSVVADWEAN..........PR----
Q43583_TOBAC/11-441GYALEL--------------V---KKT-------------KS..-----...DVTEEYMKSVAD........LMVL----
O23392_ARATH/6-435VRDLRK--------------K---KEE-------------LGTV-----ILDEGGSSDSSSMIGSKLAN....LML----
O64988_CLABR/1-429ESLGSA--------------C---GEI-------------ISEV-----AKVDDAEVVSSMVLN.........SVR----
O23393_ARATH/3-424VATFRK--------------N---KER-------------VNEM-----IKESLQGNTIGQSLLS........LMA----
HCBT2_DIACA/1-446TDTAGK--------------V---QEA-------------LKG.-----LDDDYLRSAIDHTESKPDL....PVPY----
O80816_ARATH/16-448GRIVEM--------------V---GEG-------------SKR.-----ITDEYARSAIDWGEL............----
O64470_ARATH/2-450GFAASL--------------I---SKA-------------IKN.-----VTNEYVMIGIEYLKNQKDLKKFQDLHA----
DAT_CATRO/8-434VINELR--------------K---EKQ-------------KIKN-----LSREKLTYVAQMEEFV........KSL----
O80467_ARATH/11-450SDIVKL--------------I---KEA-------------KRNA-----HDKDYLQEELANTEK........IIKM----

PF00755

CACP_MOUSE/34-616AFVKGM..........GD..STVPEQQ.............KVEL-----LRKAVQAHRAYTDRAIR--------------
Q20278_CAEEL/11-599KYLTAC..........EN...SATNET.............LKLL-----FFDAYNSHNTLMDAARE--------------
CLAT_RAT/22-612AFVQAM..........TDHKAAMPASE.............KLQL-----LQTAMQAHKQYTVMAIT--------------
CACM_YEAST/3-644LFVKSL..........LD..QDASDAT.............KIQL-----LHDACTAHSQITRECSQ--------------
Q23066_CAEEL/147-743EFVEAM..........LN..ANETKEA.............KIAL-----LKKACETHVLRNKKCMV--------------
CPT1B_HUMAN/172-763AFVQAM..........ME..GSHTKAD.............LRDL-----FQKAAKKHQNMYRLAMT--------------
CLAT_CAEEL/19-623EWVTAM..........AS..KKESKER.............KLEL-----FKKAVLKQVKVTLENIS--------------
OCTC_RAT/19-605RWCQSM..........QD..PSASLLE.............RQQK-----MLDAFAKHNKMMRDCSH--------------
OCTC_BOVIN/19-605NWCQSM..........QN..PSTSLLE.............RKHM-----MLEAFAKHNKMMKDCST--------------
Q17499_CAEEL/21-602SFVKKM..........VS.KPPTPVSE.............IYDA-----LVHATNSHKKYTMDCMD--------------
O44619_CAEEL/140-733KFVQAM..........LS..DESTQKE.............RRDL-----LKKACEAHVENCKEVMT--------------
CLAT_DROME/87-717EWAKAMCQGEGANVPLES..DREDEEESRKVKFSIYSKDHLREL-----FRCAVARQTEVMVKNIL--------------
CACP_COLLI/35-617KFVQSM..........DS..PDKSDQE.............KADL-----LRRATQAHKEYTNMAIQ--------------
CPT2_HUMAN/48-649RCSEAF..........VREPSRHSAGE.............LQQM-----MVECSKYHGQLTKEAAM--------------
CACP_YEAST/73-658EFVSKW..........QN..GDVPIAE.............KIQA-----LKHSAKEHSTYLKNAAN--------------
CACP_CANTR/41-613KFVETW..........SD..PNASSAD.............KVAT-----FQAAAKQHVAYLSAAAD--------------
CPT1A_HUMAN/170-763DFVRAM..........VD..PAQTVEQ.............RLKL-----FKLASEKHQHMYRLAMT--------------

PF00198

Q7PG41_ANOGA/236-467--------------------------------------------------------------------------------
A4H464_LEIBR/234-468--------------------------------------------------------------------------------
Q8IJJ4_PLAF7/416-640--------------------------------------------------------------------------------
B0K8I7_THEP3/156-382--------------------------------------------------------------------------------
A9B180_HERA2/216-442--------------------------------------------------------------------------------
B9LC79_CHLSY/227-461--------------------------------------------------------------------------------
B8GAA3_CHLAD/150-362--------------------------------------------------------------------------------
Q7MB23_PHOLL/166-382--------------------------------------------------------------------------------
A5G2C9_ACICJ/193-425--------------------------------------------------------------------------------
A7K5W2_VIBSE/398-631--------------------------------------------------------------------------------
A6QGW5_STAAE/188-420--------------------------------------------------------------------------------
Q8IEA6_PLAF7/189-419--------------------------------------------------------------------------------
Q6C806_YARLI/226-463--------------------------------------------------------------------------------
A6Q9K5_SULNB/241-441--------------------------------------------------------------------------------
A4CCC7_9GAMM/276-508--------------------------------------------------------------------------------
A4IKZ7_GEOTN/204-435--------------------------------------------------------------------------------
A5IXN4_MYCAP/10-243--------------------------------------------------------------------------------
Q05SD7_9SYNE/221-446--------------------------------------------------------------------------------
Q2B858_9BACI/159-388--------------------------------------------------------------------------------
ODP2_MYCPN/169-401--------------------------------------------------------------------------------
A6DTS5_9BACT/215-442--------------------------------------------------------------------------------
Q67RX4_SYMTH/33-262--------------------------------------------------------------------------------
A0QDC1_MYCA1/158-386--------------------------------------------------------------------------------
A3RZM1_RALSL/164-375--------------------------------------------------------------------------------
Q018W7_OSTTA/269-503--------------------------------------------------------------------------------
A0JUQ7_ARTS2/229-460--------------------------------------------------------------------------------
Q9CJD7_LACLA/298-530--------------------------------------------------------------------------------
A0LSF1_ACIC1/217-449--------------------------------------------------------------------------------
Q253H7_CHLFF/159-388--------------------------------------------------------------------------------
KGD_MYCS2/97-344--------------------------------------------------------------------------------
A5GAC3_GEOUR/194-419--------------------------------------------------------------------------------
Q55ZP3_CRYNB/357-619--------------------------------------------------------------------------------
Q1NYU2_9FLAO/144-371--------------------------------------------------------------------------------
A2QTN3_ASPNC/236-469--------------------------------------------------------------------------------
Q59298_9CLOT/219-443--------------------------------------------------------------------------------
Q9M724_ARATH/249-480--------------------------------------------------------------------------------
A0CLV5_PARTE/180-390--------------------------------------------------------------------------------
A4FGQ0_SACEN/225-452--------------------------------------------------------------------------------
Q6MPR6_BDEBA/309-540--------------------------------------------------------------------------------
A1SQ65_NOCSJ/201-427--------------------------------------------------------------------------------
Q6AFG4_LEIXX/233-470--------------------------------------------------------------------------------
A6U1Y7_STAA2/191-418--------------------------------------------------------------------------------
A5GEF2_GEOUR/180-403--------------------------------------------------------------------------------
A5V538_SPHWW/170-392--------------------------------------------------------------------------------
Q03DD0_PEDPA/195-427--------------------------------------------------------------------------------
Q0RVL0_RHOSR/192-421--------------------------------------------------------------------------------
Q5P9L2_ANAMM/204-433--------------------------------------------------------------------------------
Q5UWH1_HALMA/304-539--------------------------------------------------------------------------------
Q1Q664_9BACT/170-401--------------------------------------------------------------------------------
Q6MTX8_MYCMS/197-428--------------------------------------------------------------------------------
Q820B9_TROW8/211-440--------------------------------------------------------------------------------
A7NKS9_ROSCS/223-453--------------------------------------------------------------------------------
A6U0R3_STAA2/197-428--------------------------------------------------------------------------------
ODO2_BUCAI/188-418--------------------------------------------------------------------------------
Q2NJY8_AYWBP/185-416--------------------------------------------------------------------------------
A4XEQ9_NOVAD/253-480--------------------------------------------------------------------------------
Q5SLR1_THET8/217-449--------------------------------------------------------------------------------
Q5DM38_NYCOV/252-485--------------------------------------------------------------------------------
Q5F3G9_CHICK/271-501--------------------------------------------------------------------------------
A4F1Y4_STRVG/208-431--------------------------------------------------------------------------------
A4ICH2_LEIIN/226-463--------------------------------------------------------------------------------
Q9KG97_BACHD/180-411--------------------------------------------------------------------------------
A0LLM2_SYNFM/206-441--------------------------------------------------------------------------------
Q04KE8_STRP2/115-347--------------------------------------------------------------------------------
A7HBV2_ANADF/220-451--------------------------------------------------------------------------------
Q1IIF0_KORVE/320-555--------------------------------------------------------------------------------
A5JBE6_BURML/251-482--------------------------------------------------------------------------------
A5G5K2_GEOUR/156-387--------------------------------------------------------------------------------
Q4XMM8_PLACH/203-444--------------------------------------------------------------------------------
Q8RD59_THETN/185-414--------------------------------------------------------------------------------
Q8CTW0_STAES/196-425--------------------------------------------------------------------------------
A4XHV3_CALS8/229-459--------------------------------------------------------------------------------
A6TMP1_ALKMQ/205-437--------------------------------------------------------------------------------
Q04RI4_LEPBJ/240-470--------------------------------------------------------------------------------
A7SJI4_NEMVE/174-396--------------------------------------------------------------------------------
A1ZHD0_9BACT/218-453--------------------------------------------------------------------------------
Q4DDM3_TRYCC/200-436--------------------------------------------------------------------------------
A7BC27_9ACTO/216-447--------------------------------------------------------------------------------
O84249_CHLTR/201-428--------------------------------------------------------------------------------
Q6KH63_MYCMO/220-452--------------------------------------------------------------------------------
Q5DAR0_SCHJA/35-267--------------------------------------------------------------------------------
Q87IG1_VIBPA/172-383--------------------------------------------------------------------------------
Q6A613_PROAC/233-468--------------------------------------------------------------------------------
Q2PY29_9BACT/192-418--------------------------------------------------------------------------------
ODP2_SCHPO/252-483--------------------------------------------------------------------------------
O45279_CAEEL/97-322--------------------------------------------------------------------------------
Q97CK2_THEVO/179-398--------------------------------------------------------------------------------
A0NRH8_9RHOB/70-301--------------------------------------------------------------------------------
Q3A0D1_PELCD/165-395--------------------------------------------------------------------------------
Q1IX53_DEIGD/361-594--------------------------------------------------------------------------------
Q7WED2_BORBR/182-409--------------------------------------------------------------------------------
Q3J9C7_NITOC/185-392--------------------------------------------------------------------------------
Q0W153_UNCMA/195-425--------------------------------------------------------------------------------
Q7UU97_RHOBA/235-467--------------------------------------------------------------------------------
Q81CI7_BACCR/169-399--------------------------------------------------------------------------------
ODP2_BUCBP/176-410--------------------------------------------------------------------------------
ODP2_YEAST/248-482--------------------------------------------------------------------------------
Q8RBW8_THETN/173-398--------------------------------------------------------------------------------
Q4P9L5_USTMA/1242-1493--------------------------------------------------------------------------------
A8FC90_BACP2/211-441--------------------------------------------------------------------------------

PF00302

CAT3_ECOLX/1-205--------------------------------------------------------------------------------
CAT_PROMI/6-209--------------------------------------------------------------------------------
CAT2_CLOPF/1-202--------------------------------------------------------------------------------
CAT_CLOBU/1-206--------------------------------------------------------------------------------
CAT1_STAAU/1-205--------------------------------------------------------------------------------
CAT_SALTI/6-209--------------------------------------------------------------------------------
CAT_STRAC/6-211--------------------------------------------------------------------------------
CAT2_ECOLX/1-205--------------------------------------------------------------------------------
CAT2_STAAU/1-205--------------------------------------------------------------------------------
CAT_BACPU/1-203--------------------------------------------------------------------------------
CAT1_CLOPF/1-206--------------------------------------------------------------------------------
CAT_CAMCO/1-202--------------------------------------------------------------------------------

PF07247

Q6CJX7_KLULA/18-514NMAVPMNTRQYLPEDPEVRDRFRYGTVVGGTNFNFLISSFNI..TSNQQF.......WDLTEYYQQWFTKTREEGLATKT
Q6XBS9_SACPS/47-542DVFIPADCRSLLPEDEEVRAMYRYGANVGFVDFTPWISKFNM.NDSKENF.......WPLIAHYHEVISGAIKDKKHLNG
Q6BRP8_DEBHA/9-477QVDIPIDGRRYFPDKAN...DTKYGIYVGA..FSCKMGPVSKSTGSYDDL.......KVPINTLTTQLSSSMADNSPFRY
Q6FVS8_CANGA/40-557DMATPSSTRRYLPEDPEVRDMYKYGSNVGGIHYLYMISGMKVEREETEKF.......WSLVEYYHDILLASHSNGDQTVG
Q5ANM4_CANAL/12-486HRTAMTLRRHYTPDLAE....PPYKKILSDSEY..KIFGTSAHMGFVQNFPPIKVFSWDLVKKVNLDLSKAVKNKRALNQ
YA33_SCHPO/9-444DMLIDVNARRFLPVAKQTMGNYVFSYVHHLNGF....QPSQRQEDYKHTM.......VDLATEFSHRLKAALSNPREMSQ
Q5AEJ2_CANAL/10-465SSLVAINGRRYYSDEIK...NFLYGTLVCGAPI...ILPTIENK.............LEAMQIFHQEMTNDINTKKSFQS
Q6XBT1_SACPS/23-529DVAIPSNARRFLPNDEELRDSYKYGSNVGGSHYAYLISSFDIPEGDNDKF.......WSLVEYYYDRFLESYDNGDHLIG
Q6FND8_CANGA/4-456KYEVPMNTRNRISNSGE..YSNSYGTFVAGGEF...IETLDFERDE...........WELAQSIHKKIVE.....KSTTG

PF00668

PKSJ_BACSU/690-989--------------------------------------------------------------------------------
SRFAA_BACSU/3121-3425--------------------------------------------------------------------------------
SRFAA_BACSU/2097-2386--------------------------------------------------------------------------------
SRFAA_BACSU/1058-1346--------------------------------------------------------------------------------
SRFAA_BACSU/2-303--------------------------------------------------------------------------------
SRFAB_BACSU/3117-3421--------------------------------------------------------------------------------
PPSA_BACSU/2089-2400--------------------------------------------------------------------------------
ACVS_EMENI/3105-3393--------------------------------------------------------------------------------
SRFAB_BACSU/6-306--------------------------------------------------------------------------------
SRFAC_BACSU/9-309--------------------------------------------------------------------------------
ACVS_EMENI/944-1252--------------------------------------------------------------------------------
SRFAB_BACSU/1054-1340--------------------------------------------------------------------------------
SRFAB_BACSU/2093-2382--------------------------------------------------------------------------------
PPSA_BACSU/1048-1338--------------------------------------------------------------------------------
ACVS_EMENI/2018-2321--------------------------------------------------------------------------------
PPSA_BACSU/2-300--------------------------------------------------------------------------------
GRSB_BREBE/9-310--------------------------------------------------------------------------------
GRSB_BREBE/1058-1347--------------------------------------------------------------------------------
GRSB_BREBE/2093-2382--------------------------------------------------------------------------------
GRSB_BREBE/3138-3427--------------------------------------------------------------------------------
HTS1_COCCA/4782-5060--------------------------------------------------------------------------------
GRSA_BREBE/620-923--------------------------------------------------------------------------------
TYCA_BREPA/610-913--------------------------------------------------------------------------------
PPSB_BACSU/2088-2393--------------------------------------------------------------------------------
ACVS_CEPAC/3050-3340--------------------------------------------------------------------------------
ACVS1_PENCH/3082-3370--------------------------------------------------------------------------------
ACVS_NOCLA/2998-3282--------------------------------------------------------------------------------
HTS1_COCCA/854-1158--------------------------------------------------------------------------------
PPSB_BACSU/7-310--------------------------------------------------------------------------------
PPSC_BACSU/7-306--------------------------------------------------------------------------------
ACVS_CEPAC/893-1203--------------------------------------------------------------------------------
ACVS1_PENCH/916-1226--------------------------------------------------------------------------------
ACVS_NOCLA/876-1186--------------------------------------------------------------------------------
HTS1_COCCA/1337-1660--------------------------------------------------------------------------------
HTS1_COCCA/2530-2808--------------------------------------------------------------------------------
PPSB_BACSU/1052-1342--------------------------------------------------------------------------------
ACVS_CEPAC/1969-2278--------------------------------------------------------------------------------
ACVS1_PENCH/1992-2295--------------------------------------------------------------------------------
ACVS_NOCLA/1948-2242--------------------------------------------------------------------------------
ENTF_ECOLI/1-301--------------------------------------------------------------------------------
HMWP2_YERE8/111-410--------------------------------------------------------------------------------
HMWP2_YERE8/1492-1782--------------------------------------------------------------------------------

PF03007

Q9RIU8_STRCO/6-253--------------------------------------------------------------------------------
TGS3_MYCTU/5-271--------------------------------------------------------------------------------
Y3154_MYCBO/4-256--------------------------------------------------------------------------------
Y3115_MYCBO/4-273--------------------------------------------------------------------------------
Y1760_MYCTU/38-298--------------------------------------------------------------------------------
Y919_MYCBO/32-296--------------------------------------------------------------------------------
Q9X7A8_MYCLE/4-282--------------------------------------------------------------------------------
Y1425_MYCTU/4-264--------------------------------------------------------------------------------
Y3371_MYCTU/4-237--------------------------------------------------------------------------------
Y3480_MYCTU/8-298--------------------------------------------------------------------------------
Y3761_MYCBO/4-262--------------------------------------------------------------------------------
Y2484_MYCTU/4-282--------------------------------------------------------------------------------
Y3087_MYCTU/4-268--------------------------------------------------------------------------------
Y221_MYCTU/4-263--------------------------------------------------------------------------------
Y3740_MYCTU/1-257--------------------------------------------------------------------------------
Y2306_MYCBO/4-256--------------------------------------------------------------------------------

PF02458

O64549_ARATH/128-561--------------------------------------------------------------------------------
O04201_ARATH/6-476--------------------------------------------------------------------------------
Q43583_TOBAC/11-441--------------------------------------------------------------------------------
O23392_ARATH/6-435--------------------------------------------------------------------------------
O64988_CLABR/1-429--------------------------------------------------------------------------------
O23393_ARATH/3-424--------------------------------------------------------------------------------
HCBT2_DIACA/1-446--------------------------------------------------------------------------------
O80816_ARATH/16-448--------------------------------------------------------------------------------
O64470_ARATH/2-450--------------------------------------------------------------------------------
DAT_CATRO/8-434--------------------------------------------------------------------------------
O80467_ARATH/11-450--------------------------------------------------------------------------------

PF00755

CACP_MOUSE/34-616--------------------------------------------------------------------------------
Q20278_CAEEL/11-599--------------------------------------------------------------------------------
CLAT_RAT/22-612--------------------------------------------------------------------------------
CACM_YEAST/3-644--------------------------------------------------------------------------------
Q23066_CAEEL/147-743--------------------------------------------------------------------------------
CPT1B_HUMAN/172-763--------------------------------------------------------------------------------
CLAT_CAEEL/19-623--------------------------------------------------------------------------------
OCTC_RAT/19-605--------------------------------------------------------------------------------
OCTC_BOVIN/19-605--------------------------------------------------------------------------------
Q17499_CAEEL/21-602--------------------------------------------------------------------------------
O44619_CAEEL/140-733--------------------------------------------------------------------------------
CLAT_DROME/87-717--------------------------------------------------------------------------------
CACP_COLLI/35-617--------------------------------------------------------------------------------
CPT2_HUMAN/48-649--------------------------------------------------------------------------------
CACP_YEAST/73-658--------------------------------------------------------------------------------
CACP_CANTR/41-613--------------------------------------------------------------------------------
CPT1A_HUMAN/170-763--------------------------------------------------------------------------------

PF00198

Q7PG41_ANOGA/236-467------------------------------DGVT----------------------------------------------
A4H464_LEIBR/234-468------------------------------DGAS----------------------------------------------
Q8IJJ4_PLAF7/416-640------------------------------YGSH----------------------------------------------
B0K8I7_THEP3/156-382------------------------------DGAT----------------------------------------------
A9B180_HERA2/216-442------------------------------DGAS----------------------------------------------
B9LC79_CHLSY/227-461------------------------------DGAV---------------------