Sequence alignment for CL0151

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTN/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTN/7-239--------------------------------------------------------------------------------
B6HSS2_PENCW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
D4GMW6_PANAM/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_RUBBR/3-257--------------------------------------------------------------------------------
I0DRD2_PROSM/4-258--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
W6RP24_9RHIZ/9-265--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_BURRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
U5T1Y9_9GAMM/5-261--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_MYCSM/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENCW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARHV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_PSELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_AZOSU/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
C4XU18_DESMR/3-260--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
E4U2F8_SULKY/3-258--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_ZYMTI/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
T0ULG9_9STRE/2-260--------------------------------------------------------------------------------
PANB_ALTMD/3-259--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
E8T692_THEA1/2-260--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
C5CWU9_VARPS/32-292--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTN/24-281--------------------------------------------------------------------------------
I2F2C6_9BACT/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9ENTR/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALSC/10-273--------------------------------------------------------------------------------
F0S4V2_PSESL/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_9FIRM/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_ARTAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCR/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICSR/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_RALME/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
A0A0D2VT44_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9SPHI/9-267--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_PSEFD/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
F2KYW8_PREDF/10-268--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_RHISN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTN/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_BURP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_GRATM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_PIRID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
I3YPM0_ALIFI/9-267--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
A0A068NY03_9BACT/4-257--------------------------------------------------------------------------------
D5DBX1_BACMD/3-259--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
PANB_ERWT9/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
C7R7Z0_KANKD/3-259--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
E3HRX5_ACHXA/19-273--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENCW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CHRO/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGMM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
I3R834_HALMT/2-256--------------------------------------------------------------------------------
C4R687_PICPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_AMYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_BURP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOJR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_RHISN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
E3HW38_ACHXA/8-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METRA/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_ZYMTI/9-275--------------------------------------------------------------------------------
N1PYG8_DOTSN/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
J4G6Y7_FIBRA/9-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_MODMB/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------------------------
CAPP_ACTP2/128-879--------------------------------------------------------------------------------
A0ZJ69_NODSP/196-1034--------------------------------------------------------------------------------
D3VH32_XENNA/127-879--------------------------------------------------------------------------------
Q2KZS8_BORA1/137-936--------------------------------------------------------------------------------
D2QW47_PIRSD/157-942--------------------------------------------------------------------------------
A5GVT4_SYNR3/167-992--------------------------------------------------------------------------------
C6D470_PAESJ/147-936--------------------------------------------------------------------------------
B8HVC9_CYAP4/199-1018--------------------------------------------------------------------------------
C1F4Y2_ACIC5/161-947--------------------------------------------------------------------------------
CAPP_SYNY3/193-1034--------------------------------------------------------------------------------
B1XMB9_SYNP2/163-995--------------------------------------------------------------------------------
A4S610_OSTLU/183-1007--------------------------------------------------------------------------------
A9RUR8_PHYPA/162-969--------------------------------------------------------------------------------
B8GNA5_THISH/143-947--------------------------------------------------------------------------------
CAPP_HAHCH/132-881--------------------------------------------------------------------------------
B1Y159_LEPCP/163-950--------------------------------------------------------------------------------
CAPP_THEEB/197-1011--------------------------------------------------------------------------------
A9S2G6_PHYPA/161-965--------------------------------------------------------------------------------
Q54JZ3_DICDI/144-931--------------------------------------------------------------------------------
C1MJ77_MICPC/164-991--------------------------------------------------------------------------------
E0UJ33_CYAP2/184-1020--------------------------------------------------------------------------------
A5WCX5_PSYWF/133-932--------------------------------------------------------------------------------
A0JSJ3_ARTS2/161-954--------------------------------------------------------------------------------
B7G725_PHATC/84-877--------------------------------------------------------------------------------
CAPP_GLOVI/141-939--------------------------------------------------------------------------------
C5Z450_SORBI/157-961--------------------------------------------------------------------------------
D1CE74_THET1/138-931--------------------------------------------------------------------------------
Q117S5_TRIEI/186-1038--------------------------------------------------------------------------------
C1AE63_GEMAT/147-933--------------------------------------------------------------------------------
A9QPD2_METI4/151-931--------------------------------------------------------------------------------
B0BZ90_ACAM1/184-1012--------------------------------------------------------------------------------
A4X3B0_SALTO/171-972--------------------------------------------------------------------------------
E3JCU0_FRASU/173-968--------------------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------------------------
A9IDM8_BORPD/139-951--------------------------------------------------------------------------------
A4G3V1_HERAR/147-944--------------------------------------------------------------------------------
C1DZM5_MICSR/162-982--------------------------------------------------------------------------------
D3EKG0_GEOS4/142-928--------------------------------------------------------------------------------
B1VUI2_STRGG/125-909--------------------------------------------------------------------------------
CAPP_SYNPW/180-1003--------------------------------------------------------------------------------
B0JPY0_MICAN/183-1018--------------------------------------------------------------------------------
B1WNZ1_CYAA5/187-1020--------------------------------------------------------------------------------
C8WQK0_ALIAD/133-906--------------------------------------------------------------------------------
D4ZQG2_ARTPN/196-1035--------------------------------------------------------------------------------
M1FKU6_9ALTE/130-889--------------------------------------------------------------------------------
CAPP_ECOLI/129-883--------------------------------------------------------------------------------
CAPP_HAEIN/129-879--------------------------------------------------------------------------------
Q0K7M4_CUPNH/207-1012--------------------------------------------------------------------------------
Q31KY7_SYNE7/201-1017--------------------------------------------------------------------------------
Q46IP1_PROMT/168-994--------------------------------------------------------------------------------
CAPP_PROMP/165-989--------------------------------------------------------------------------------
CAPP_VIBPA/129-877--------------------------------------------------------------------------------
CAPP_SHEON/129-881--------------------------------------------------------------------------------
U5GXD4_POPTR/166-968--------------------------------------------------------------------------------

PF15617

H9TH48_SALET/4-300--------RL----------------------------------------------------------------------
A0A0E3A3C9_ENTCL/4-300--------RL----------------------------------------------------------------------
A0A023YVC9_ECOLX/4-300--------RL----------------------------------------------------------------------
A7MPV2_CROS8/4-300--------RL----------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------QP----------------------------------------------------------------------
D0KLU5_PECWW/4-299--------RL----------------------------------------------------------------------
B4EW80_PROMH/4-300--------RL----------------------------------------------------------------------
D3V2D7_XENBS/4-302--------IP----------------------------------------------------------------------
Q7CKQ7_YERPE/4-300--------TP----------------------------------------------------------------------
E1PL56_PANVC/4-300--------NI----------------------------------------------------------------------
D3VJW5_XENNA/4-307--------IP----------------------------------------------------------------------
Q888S8_PSESM/3-297--------LF----------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------LF----------------------------------------------------------------------
F3K7E7_PSEAJ/3-297--------LF----------------------------------------------------------------------
Q39AX0_BURL3/4-298--------TI----------------------------------------------------------------------
Q6FAX8_ACIAD/1-291--------ML----------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------PL----------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------MH----------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------MR----------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------ML----------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------MH----------------------------------------------------------------------
Q3JCD2_NITOC/22-310--------IP----------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------MA----------------------------------------------------------------------
Q2RVZ6_RHORT/5-292--------IS----------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------PL----------------------------------------------------------------------
D5BYR3_NITHN/21-309--------IP----------------------------------------------------------------------
D8K7I6_NITWC/22-310--------IP----------------------------------------------------------------------
E8U9R3_DEIML/2-291--------LN----------------------------------------------------------------------
A8MM95_ALKOO/30-358--------DK----------------------------------------------------------------------
Q891X5_CLOTE/30-379--------TY----------------------------------------------------------------------
A8F9P5_BACP2/30-369--------HV----------------------------------------------------------------------
C9RML9_FIBSS/26-364--------SL----------------------------------------------------------------------
E3IYR0_FRASU/30-378--------RL----------------------------------------------------------------------
Q9KY27_STRCO/30-371--------RL----------------------------------------------------------------------
A0A080UMD5_BACIU/30-361--------KL----------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------EL----------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------DI----------------------------------------------------------------------
F2JGK5_CELLD/30-375--------EK----------------------------------------------------------------------
Q65NP8_BACLD/30-368--------RI----------------------------------------------------------------------
D1BEK0_SANKS/30-368--------GM----------------------------------------------------------------------
D1A9P4_THECD/30-368--------AL----------------------------------------------------------------------
C9ZE12_STRSW/30-371--------RI----------------------------------------------------------------------
F4H5N5_CELFA/32-371--------AL----------------------------------------------------------------------
B7HBK1_BACC4/30-348--------EQ----------------------------------------------------------------------
A0A0B5R5V5_BACTU/30-348--------EQ----------------------------------------------------------------------
C8W644_DESAS/30-371--------KT----------------------------------------------------------------------
Q82B97_STRAW/30-370--------RV----------------------------------------------------------------------
Q0SDY5_RHOJR/44-383--------TV----------------------------------------------------------------------
Q72YD0_BACC1/30-348--------EQ----------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------TV----------------------------------------------------------------------
A4J1D5_DESRM/16-360--------DT----------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------DL----------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------EV----------------------------------------------------------------------
Q186J7_PEPD6/30-345--------DV----------------------------------------------------------------------
E3EE66_PAEPS/10-368--------SI----------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------EL----------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------EL----------------------------------------------------------------------
D0L8D1_GORB4/35-372--------TQ----------------------------------------------------------------------
B1VYI2_STRGG/30-395--------RM----------------------------------------------------------------------
C9YLT5_PEPDR/30-345--------DV----------------------------------------------------------------------
F4EXE4_SELS3/15-331--------EI----------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------SV----------------------------------------------------------------------
A8L403_FRASN/30-378--------RL----------------------------------------------------------------------
A6WD82_KINRD/30-375--------DE----------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------RL----------------------------------------------------------------------
A2RKY2_LACLM/29-388--------EM----------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------HL----------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------NQ----------------------------------------------------------------------

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOJR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947PALSGDLGTF----------------------------------------------------------------------
PT1_STACT/251-543KQELQKLRDA----------------------------------------------------------------------
PT1_CUPNH/262-557KKRLQRLRHT----------------------------------------------------------------------
PT1_ECOLI/250-542KAELAKLKDL----------------------------------------------------------------------
PT1_HAEIN/250-542KAELAKLKDL----------------------------------------------------------------------
PT1P_ECOLI/416-708SRLAEDDVNL----------------------------------------------------------------------
PPSA_PYRFU/496-796KAEGGQVVVA----------------------------------------------------------------------
PTFAX_XANCP/521-808REREAAQRAL----------------------------------------------------------------------
PT1_STRMU/252-546KAEWALLKDA----------------------------------------------------------------------
PTFX2_ECOLI/362-654REQQRVWLTQ----------------------------------------------------------------------
PPSA_STAMF/504-813VAGVGISPEQ----------------------------------------------------------------------
D5AMJ7_RHOCB/521-803...EARERYK----------------------------------------------------------------------
Q24801_ENTHI/517-878..GSGYFGTI----------------------------------------------------------------------
Q5L199_GEOKA/251-541KAEWAKLVDQ----------------------------------------------------------------------
Q6MTX2_MYCMS/252-540.DQLKKFKDK----------------------------------------------------------------------

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531VAILGSVSNEARKILTKEACAFLAILHRTFNPTRKALLQRRVDRQAEIDKGH.LP............DFL.PETKHIRDD
MASZ_CORGL/35-713YDFVTEAVLPRVGVDAEKFWSGFAAIARDLTPRNRELLARRDELQMLIDDYHRNNSGTID..QEAYEDFL.KEIGYLVEE
MASY_MYXXD/17-538VVVKGTWHPDYAEVLTPEALEFVAKLARNFGERRLALLERRKTVQAAWSKGA.RP............HFL.PETKAVR.E
MASZ_ECOLI/17-697KRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVK..DKAAYKSFLRELGYLVPQ
Q9RYN3_DEIRA/10-521MTINAPIKPEYAEILTPEALAFVAELHRRFEPRRRELMQKREERQQRLDAGE.LP............DFL.PETAEIR.A
MASY_MAIZE/16-548VDVRGRYDREFAGILTRDALDFVAGLQREFRGAVRYAMEQRREAQRRYDAGE.LP............RFD.PATTLVR.E
MASY_ECOLI/11-533LAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDNGT.LP............DFI.SETASIR.D
MASZ_MYCLE/17-704YDFVNNEALPGTDINPNSFWSGVAKVVADLTPQNQSLLNSRDELQAQIDKWHRHRVIEPF..DVDAYRQFLIDIGYLLPE
MASY_YEAST/18-542EPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQVVQKKLDSGS.YH...........LDFL.PETANIRND
B5GRN8_STRC2/12-539..VTAPAVPRQDEVLTEAALVFLAELHRRFTPRRDELLARRARRRAEISRTG.TL............DFL.PETAHVRAD
C5MBE7_CANTT/16-539.QILGPIPDDAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQKLRDQGF.LP............DFL.PETEYIRND
F2KMB8_PSEBN/18-697.DFVNNEAIPGTGLTADAFWAGADKVIHDLAPKNKALLAKRDDFQARIDAWH.QARAGQAHDAVAYKAFL.QDIGYLLPE
M4EJ48_BRARP/22-551.EVRGRYDQVFAKILTRDALGFVAELQREFRGHVRYAMECRREAKRRYNSGA.VP............GFD.PSTKFIR.D
W1QBI0_OGAPD/27-543........ATPRDILTKDALKFIVLLHRSFNETRKQLLENRQKVQERLDAGE.SL............HFL.EETKYIRED

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTN/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTN/7-239--------------------------------------------------------------------------------
B6HSS2_PENCW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
D4GMW6_PANAM/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_RUBBR/3-257--------------------------------------------------------------------------------
I0DRD2_PROSM/4-258--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
W6RP24_9RHIZ/9-265--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_BURRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
U5T1Y9_9GAMM/5-261--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_MYCSM/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENCW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARHV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_PSELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_AZOSU/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
C4XU18_DESMR/3-260--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
E4U2F8_SULKY/3-258--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_ZYMTI/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
T0ULG9_9STRE/2-260--------------------------------------------------------------------------------
PANB_ALTMD/3-259--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
E8T692_THEA1/2-260--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
C5CWU9_VARPS/32-292--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTN/24-281--------------------------------------------------------------------------------
I2F2C6_9BACT/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9ENTR/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALSC/10-273--------------------------------------------------------------------------------
F0S4V2_PSESL/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_9FIRM/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_ARTAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCR/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICSR/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_RALME/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
A0A0D2VT44_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9SPHI/9-267--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_PSEFD/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
F2KYW8_PREDF/10-268--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_RHISN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTN/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_BURP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_GRATM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_PIRID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
I3YPM0_ALIFI/9-267--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
A0A068NY03_9BACT/4-257--------------------------------------------------------------------------------
D5DBX1_BACMD/3-259--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
PANB_ERWT9/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
C7R7Z0_KANKD/3-259--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
E3HRX5_ACHXA/19-273--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENCW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CHRO/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGMM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
I3R834_HALMT/2-256--------------------------------------------------------------------------------
C4R687_PICPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_AMYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_BURP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOJR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_RHISN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
E3HW38_ACHXA/8-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METRA/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_ZYMTI/9-275--------------------------------------------------------------------------------
N1PYG8_DOTSN/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
J4G6Y7_FIBRA/9-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_MODMB/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------------------------
CAPP_ACTP2/128-879--------------------------------------------------------------------------------
A0ZJ69_NODSP/196-1034--------------------------------------------------------------------------------
D3VH32_XENNA/127-879--------------------------------------------------------------------------------
Q2KZS8_BORA1/137-936--------------------------------------------------------------------------------
D2QW47_PIRSD/157-942--------------------------------------------------------------------------------
A5GVT4_SYNR3/167-992--------------------------------------------------------------------------------
C6D470_PAESJ/147-936--------------------------------------------------------------------------------
B8HVC9_CYAP4/199-1018--------------------------------------------------------------------------------
C1F4Y2_ACIC5/161-947--------------------------------------------------------------------------------
CAPP_SYNY3/193-1034--------------------------------------------------------------------------------
B1XMB9_SYNP2/163-995--------------------------------------------------------------------------------
A4S610_OSTLU/183-1007--------------------------------------------------------------------------------
A9RUR8_PHYPA/162-969--------------------------------------------------------------------------------
B8GNA5_THISH/143-947--------------------------------------------------------------------------------
CAPP_HAHCH/132-881--------------------------------------------------------------------------------
B1Y159_LEPCP/163-950--------------------------------------------------------------------------------
CAPP_THEEB/197-1011--------------------------------------------------------------------------------
A9S2G6_PHYPA/161-965--------------------------------------------------------------------------------
Q54JZ3_DICDI/144-931--------------------------------------------------------------------------------
C1MJ77_MICPC/164-991--------------------------------------------------------------------------------
E0UJ33_CYAP2/184-1020--------------------------------------------------------------------------------
A5WCX5_PSYWF/133-932--------------------------------------------------------------------------------
A0JSJ3_ARTS2/161-954--------------------------------------------------------------------------------
B7G725_PHATC/84-877--------------------------------------------------------------------------------
CAPP_GLOVI/141-939--------------------------------------------------------------------------------
C5Z450_SORBI/157-961--------------------------------------------------------------------------------
D1CE74_THET1/138-931--------------------------------------------------------------------------------
Q117S5_TRIEI/186-1038--------------------------------------------------------------------------------
C1AE63_GEMAT/147-933--------------------------------------------------------------------------------
A9QPD2_METI4/151-931--------------------------------------------------------------------------------
B0BZ90_ACAM1/184-1012--------------------------------------------------------------------------------
A4X3B0_SALTO/171-972--------------------------------------------------------------------------------
E3JCU0_FRASU/173-968--------------------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------------------------
A9IDM8_BORPD/139-951--------------------------------------------------------------------------------
A4G3V1_HERAR/147-944--------------------------------------------------------------------------------
C1DZM5_MICSR/162-982--------------------------------------------------------------------------------
D3EKG0_GEOS4/142-928--------------------------------------------------------------------------------
B1VUI2_STRGG/125-909--------------------------------------------------------------------------------
CAPP_SYNPW/180-1003--------------------------------------------------------------------------------
B0JPY0_MICAN/183-1018--------------------------------------------------------------------------------
B1WNZ1_CYAA5/187-1020--------------------------------------------------------------------------------
C8WQK0_ALIAD/133-906--------------------------------------------------------------------------------
D4ZQG2_ARTPN/196-1035--------------------------------------------------------------------------------
M1FKU6_9ALTE/130-889--------------------------------------------------------------------------------
CAPP_ECOLI/129-883--------------------------------------------------------------------------------
CAPP_HAEIN/129-879--------------------------------------------------------------------------------
Q0K7M4_CUPNH/207-1012--------------------------------------------------------------------------------
Q31KY7_SYNE7/201-1017--------------------------------------------------------------------------------
Q46IP1_PROMT/168-994--------------------------------------------------------------------------------
CAPP_PROMP/165-989--------------------------------------------------------------------------------
CAPP_VIBPA/129-877--------------------------------------------------------------------------------
CAPP_SHEON/129-881--------------------------------------------------------------------------------
U5GXD4_POPTR/166-968--------------------------------------------------------------------------------

PF15617

H9TH48_SALET/4-300--------------------------------------------------------------------------------
A0A0E3A3C9_ENTCL/4-300--------------------------------------------------------------------------------
A0A023YVC9_ECOLX/4-300--------------------------------------------------------------------------------
A7MPV2_CROS8/4-300--------------------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------------------------------------------------------------------------------
D0KLU5_PECWW/4-299--------------------------------------------------------------------------------
B4EW80_PROMH/4-300--------------------------------------------------------------------------------
D3V2D7_XENBS/4-302--------------------------------------------------------------------------------
Q7CKQ7_YERPE/4-300--------------------------------------------------------------------------------
E1PL56_PANVC/4-300--------------------------------------------------------------------------------
D3VJW5_XENNA/4-307--------------------------------------------------------------------------------
Q888S8_PSESM/3-297--------------------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------------------------------------------------------------------------------
F3K7E7_PSEAJ/3-297--------------------------------------------------------------------------------
Q39AX0_BURL3/4-298--------------------------------------------------------------------------------
Q6FAX8_ACIAD/1-291--------------------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------------------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------------------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------------------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------------------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------------------------------------------------------------------------------
Q3JCD2_NITOC/22-310--------------------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------------------------------------------------------------------------------
Q2RVZ6_RHORT/5-292--------------------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------------------------------------------------------------------------------
D5BYR3_NITHN/21-309--------------------------------------------------------------------------------
D8K7I6_NITWC/22-310--------------------------------------------------------------------------------
E8U9R3_DEIML/2-291--------------------------------------------------------------------------------
A8MM95_ALKOO/30-358--------------------------------------------------------------------------------
Q891X5_CLOTE/30-379--------------------------------------------------------------------------------
A8F9P5_BACP2/30-369--------------------------------------------------------------------------------
C9RML9_FIBSS/26-364--------------------------------------------------------------------------------
E3IYR0_FRASU/30-378--------------------------------------------------------------------------------
Q9KY27_STRCO/30-371--------------------------------------------------------------------------------
A0A080UMD5_BACIU/30-361--------------------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------------------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------------------------------------------------------------------------------
F2JGK5_CELLD/30-375--------------------------------------------------------------------------------
Q65NP8_BACLD/30-368--------------------------------------------------------------------------------
D1BEK0_SANKS/30-368--------------------------------------------------------------------------------
D1A9P4_THECD/30-368--------------------------------------------------------------------------------
C9ZE12_STRSW/30-371--------------------------------------------------------------------------------
F4H5N5_CELFA/32-371--------------------------------------------------------------------------------
B7HBK1_BACC4/30-348--------------------------------------------------------------------------------
A0A0B5R5V5_BACTU/30-348--------------------------------------------------------------------------------
C8W644_DESAS/30-371--------------------------------------------------------------------------------
Q82B97_STRAW/30-370--------------------------------------------------------------------------------
Q0SDY5_RHOJR/44-383--------------------------------------------------------------------------------
Q72YD0_BACC1/30-348--------------------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------------------------------------------------------------------------------
A4J1D5_DESRM/16-360--------------------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------------------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------------------------------------------------------------------------------
Q186J7_PEPD6/30-345--------------------------------------------------------------------------------
E3EE66_PAEPS/10-368--------------------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------------------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------------------------------------------------------------------------------
D0L8D1_GORB4/35-372--------------------------------------------------------------------------------
B1VYI2_STRGG/30-395--------------------------------------------------------------------------------
C9YLT5_PEPDR/30-345--------------------------------------------------------------------------------
F4EXE4_SELS3/15-331--------------------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------------------------------------------------------------------------------
A8L403_FRASN/30-378--------------------------------------------------------------------------------
A6WD82_KINRD/30-375--------------------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------------------------------------------------------------------------------
A2RKY2_LACLM/29-388--------------------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------------------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------------------------------------------------------------------------------

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOJR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------------------------
PT1_STACT/251-543--------------------------------------------------------------------------------
PT1_CUPNH/262-557--------------------------------------------------------------------------------
PT1_ECOLI/250-542--------------------------------------------------------------------------------
PT1_HAEIN/250-542--------------------------------------------------------------------------------
PT1P_ECOLI/416-708--------------------------------------------------------------------------------
PPSA_PYRFU/496-796--------------------------------------------------------------------------------
PTFAX_XANCP/521-808--------------------------------------------------------------------------------
PT1_STRMU/252-546--------------------------------------------------------------------------------
PTFX2_ECOLI/362-654--------------------------------------------------------------------------------
PPSA_STAMF/504-813--------------------------------------------------------------------------------
D5AMJ7_RHOCB/521-803--------------------------------------------------------------------------------
Q24801_ENTHI/517-878--------------------------------------------------------------------------------
Q5L199_GEOKA/251-541--------------------------------------------------------------------------------
Q6MTX2_MYCMS/252-540--------------------------------------------------------------------------------

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531PSWKG.AP........................................................................
MASZ_CORGL/35-713PEAAEIRTQNVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEKGKEYNPVRGQKVI..EWG
MASY_MYXXD/17-538GDWTV.AP........................................................................
MASZ_ECOLI/17-697PERVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIA...WVR
Q9RYN3_DEIRA/10-521GDWKI.SP........................................................................
MASY_MAIZE/16-548GDWTC.AS........................................................................
MASY_ECOLI/11-533ADWKI.RG........................................................................
MASZ_MYCLE/17-704PDDFTISTSGVDDEITMTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDTIPETEGAEKGSEYNKIRGDKVI.AYAR
MASY_YEAST/18-542PTWQG.PI........................................................................
B5GRN8_STRC2/12-539DSWRV.AP........................................................................
C5MBE7_CANTT/16-539PTWTG.PA........................................................................
F2KMB8_PSEBN/18-697AADFQ.ATTQNVDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDAISEADGAEKGKGYNKVRGDKVIAFAR
M4EJ48_BRARP/22-551GEWVC.AS........................................................................
W1QBI0_OGAPD/27-543PNWKC.LP........................................................................

PF00463

ACEA_EMENI/14-536---------------------------------------------------------------------EVAAVKNWWK-
ACEA_YEAST/22-550---------------------------------------------------------------------DAAEIEKWWS-
ACEA1_SOYBN/3-534---------------------------------------------------------------------EVAEVQAWWN-
ACEA_YARLI/10-536---------------------------------------------------------------------EVEEIKKWWS-
ACEA_NEUCR/23-547---------------------------------------------------------------------EVEEVKKWWS-
C5MF59_CANTT/18-543---------------------------------------------------------------------EVAEIKKWWS-

PF13714

A0JTC7_ARTS2/12-246-------------------------------------------------------------------------LLR.LH.
A0K276_ARTS2/27-270-------------------------------------------------------------------------FHA.LH.
A0QPJ7_MYCS2/16-251-------------------------------------------------------------------------LLA.LH.
A0R0I0_MYCS2/10-256-------------------------------------------------------------------------FAERLH.
A1CA54_ASPCL/14-274-------------------------------------------------------------------------LCR.LH.
A1SIA9_NOCSJ/3-233-------------------------------------------------------------------------FRA.LH.
A4F7M3_SACEN/8-232-------------------------------------------------------------------------FRA.LH.
A4FH54_SACEN/26-273-------------------------------------------------------------------------LRD.LH.
A4X5C0_SALTO/32-264-------------------------------------------------------------------------FRS.LH.
A4X7L5_SALTO/4-223-------------------------------------------------------------------------FAA.LH.
A4XS21_PSEMY/12-254-------------------------------------------------------------------------FQA.LH.
A4YVZ4_BRASO/12-249-------------------------------------------------------------------------FRK.LH.
A5G4A7_GEOUR/12-254-------------------------------------------------------------------------FLR.LH.
A5V3Q4_SPHWW/10-252-------------------------------------------------------------------------FSK.LH.
A9WM41_RENSM/9-245-------------------------------------------------------------------------FRS.LH.
B1VSN1_STRGG/14-249-------------------------------------------------------------------------LKH.LH.
B4RBF1_PHEZH/10-242-------------------------------------------------------------------------FRK.LH.
B5HHA0_STRPR/15-253-------------------------------------------------------------------------LRE.LH.
B5HRK0_9ACTN/12-259-------------------------------------------------------------------------FAE.LH.
B5HVC7_9ACTN/7-239-------------------------------------------------------------------------FRA.LHR
B6HSS2_PENCW/11-259-------------------------------------------------------------------------FRA.LH.
B8MDA8_TALSN/5-285-------------------------------------------------------------------------IKSVLK.
B9JNZ3_AGRRK/15-273-------------------------------------------------------------------------LRALLE.
B9K4D9_AGRVS/8-247-------------------------------------------------------------------------FRQ.LH.
C1D0L9_DEIDV/16-251-------------------------------------------------------------------------LLD.LH.
D5UDN5_CELFN/12-253-------------------------------------------------------------------------LRS.FH.
C5C673_BEUC1/6-244-------------------------------------------------------------------------FRR.RH.
C5K5X0_PERM5/22-289-------------------------------------------------------------------------LRQLIN.
D9SPL5_CLOC7/7-255-------------------------------------------------------------------------LKKLLN.
C6W6H2_DYAFD/19-261-------------------------------------------------------------------------LKK.LH.
C7Q1F2_CATAD/16-252-------------------------------------------------------------------------FAS.LH.
C7YUL0_NECH7/9-264-------------------------------------------------------------------------LKA.LH.
C7YZU2_NECH7/391-674-------------------------------------------------------------------------IRAAFK.
D6Z4R6_DESAT/153-411-------------------------------------------------------------------------LRRLID.
C9SRU6_VERA1/11-259-------------------------------------------------------------------------LKA.LH.
D1A2J0_THECD/5-232-------------------------------------------------------------------------FGE.LH.
D1BED0_SANKS/11-246-------------------------------------------------------------------------FAS.LH.
D1BI43_SANKS/12-247-------------------------------------------------------------------------FRS.LH.
D9TER7_MICAI/8-239-------------------------------------------------------------------------FRE.LH.
E3J806_FRASU/10-249-------------------------------------------------------------------------FLA.LH.
D2B1P9_STRRD/6-236-------------------------------------------------------------------------FRA.LH.
E3I6J4_RHOVT/30-272-------------------------------------------------------------------------FRKRLQ.
D2PR97_KRIFD/29-269-------------------------------------------------------------------------LRA.LH.
D2Q3B1_KRIFD/7-234-------------------------------------------------------------------------FRA.LH.
D2Q4L3_KRIFD/4-243-------------------------------------------------------------------------FRD.LH.
D3EII1_GEOS4/13-252-------------------------------------------------------------------------FKK.LH.
D3V3K7_XENBS/39-278-------------------------------------------------------------------------FRQ.LH.
D4AZN8_ARTBC/10-268-------------------------------------------------------------------------LRS.LH.
D4LCE5_RUMC1/6-261-------------------------------------------------------------------------LGSLLK.
Q01YZ5_SOLUE/12-251-------------------------------------------------------------------------FRA.LH.
Q08U27_STIAD/11-246-------------------------------------------------------------------------FRA.LH.
Q0BYP5_HYPNA/11-255-------------------------------------------------------------------------FAS.LH.
Q0RPX9_FRAAA/13-247-------------------------------------------------------------------------FRE.LH.
Q12Q29_SHEDO/14-259-------------------------------------------------------------------------LKDILL.
Q1GKC0_RUEST/10-253-------------------------------------------------------------------------FAA.LH.
Q1GQT2_SPHAL/9-246-------------------------------------------------------------------------FRA.LH.
Q28RZ5_JANSC/10-249-------------------------------------------------------------------------FAR.LH.
Q2JAX2_FRASC/15-255-------------------------------------------------------------------------FRE.LH.
Q4DNR3_TRYCC/14-261-------------------------------------------------------------------------LKSMLR.
Q4KET5_PSEF5/11-270-------------------------------------------------------------------------LSQLLR.
Q5E5F2_VIBF1/18-278-------------------------------------------------------------------------LINVIK.
Q5LNA0_RUEPO/10-253-------------------------------------------------------------------------FAA.LH.
Q5LUG9_RUEPO/10-245-------------------------------------------------------------------------FRT.LH.
Q5WBL4_BACSK/19-257-------------------------------------------------------------------------FRC.LH.
Q65ND9_BACLD/10-248-------------------------------------------------------------------------FLD.LH.
Q7NXV8_CHRVO/33-277-------------------------------------------------------------------------FRR.LH.
Q7P124_CHRVO/3-243-------------------------------------------------------------------------FAQ.LH.
Q893V9_CLOTE/153-411-------------------------------------------------------------------------LRQLLK.
Q8EI00_SHEON/9-240-------------------------------------------------------------------------FKA.LH.
A6TFP2_KLEP7/3-236-------------------------------------------------------------------------FNA.LH.
G2J0B0_PSEUL/10-251-------------------------------------------------------------------------FKE.LH.
G8PVS4_PSEUV/10-253-------------------------------------------------------------------------FAA.LH.
D4GMW6_PANAM/3-261-------------------------------------------------------------------------.KK.LI.
Y1998_MYCTU/3-229-------------------------------------------------------------------------FHD.LH.
Q2IK57_ANADE/11-247-------------------------------------------------------------------------FRA.LH.
Q2KD40_RHIEC/10-252-------------------------------------------------------------------------FGA.LH.
Q63MP0_BURPS/20-277-------------------------------------------------------------------------FKEKLA.
Q8F693_LEPIN/12-250-------------------------------------------------------------------------FRS.LH.
Q8YAP2_LISMO/8-250-------------------------------------------------------------------------LKS.LH.
Q98AR7_RHILO/15-259-------------------------------------------------------------------------.RR.MI.
R5T8T3_9CLOT/12-269-------------------------------------------------------------------------.......
R5TTB9_9CLOT/13-246-------------------------------------------------------------------------.......

PF02548

C8XKD1_NAKMY/14-272-------------------------------------------------------------------.IAIPDLFE-LK-
A7HMC7_FERNB/3-256-------------------------------------------------------------------..NTKKIID-MK-
PANB_NITMU/2-259-------------------------------------------------------------------RITQDVFQK-MR-
E3I2N4_RHOVT/9-264-------------------------------------------------------------------RVTAPDIRA-KK-
PANB_THEFY/18-275-------------------------------------------------------------------RVTVQDLAA-AK-
F0NZT0_WEEVC/9-267-------------------------------------------------------------------RITTETIRK-MK-
C5DYQ5_ZYGRC/31-296-------------------------------------------------------------------SNTIQSLHE-KY-
D8RYD4_SELML/4-266-------------------------------------------------------------------KVTMRYLQS-KY-
S9W2M7_SCHCR/5-262-------------------------------------------------------------------PITTSVLRQ-WK-
D2PXN9_KRIFD/534-791-------------------------------------------------------------------KYRIHHLRD-LK-
H1Z987_MYROD/10-268-------------------------------------------------------------------KVTTKSLID-MK-
C5BN63_TERTT/12-267-------------------------------------------------------------------SVSIKTLQA-MK-
A8LKB6_DINSH/13-268-------------------------------------------------------------------RLTVPQIAA-RK-
D7BNG1_ARCHD/5-260-------------------------------------------------------------------RVRAHHLAQ-MK-
D7A714_STAND/9-264-------------------------------------------------------------------RLTAPDIRA-KK-
PANB_BORPD/9-265-------------------------------------------------------------------RKTTTAIRQ-AK-
PANB_MAGSA/9-265-------------------------------------------------------------------RITTRDIRA-RK-
E8RFZ1_DESPD/5-262-------------------------------------------------------------------KLTIPDLRN-RK-
PANB_PROMA/4-255-------------------------------------------------------------------....KELVR-FK-
K9RVA1_SYNP3/11-268-------------------------------------------------------------------PVTIPQLQH-WK-
D5WZ20_THIK1/22-279-------------------------------------------------------------------PLTLHRLRA-MR-
B8LYN4_TALSN/78-338-------------------------------------------------------------------PVTISTLRN-MY-
K9RDA0_9CYAN/11-264-------------------------------------------------------------------AITIQKLIQ-YK-
PANB_METRJ/10-267-------------------------------------------------------------------.LRAIDIGK-RK-
A9UP51_MONBE/1-268-------------------------------------------------------------------.VTMNKLKR-KR-
PANB_PROA2/11-273-------------------------------------------------------------------HVTTRRLHD-MK-
F2UAL1_SALR5/62-329-------------------------------------------------------------------.VTIPSIHA-AY-
V2XXG0_MONRO/40-299-------------------------------------------------------------------KVTIDTLQA-MK-
G2IQV3_9SPHN/23-282-------------------------------------------------------------------RLTIPALRA-RK-
PANB_CLONN/2-260-------------------------------------------------------------------KNTVTTFQK-AK-
PANB_WIGBR/3-260-------------------------------------------------------------------KTNIYDLYK-LK-
M1FDT2_9ALTE/4-264-------------------------------------------------------------------KVTIPRLQQ-MK-
E4TII1_CALNY/9-264-------------------------------------------------------------------KVTVNQIKN-MK-
K0I9Q1_NITGG/2-255-------------------------------------------------------------------..SVNDIVA-MK-
C7MD29_BRAFD/11-267-------------------------------------------------------------------KIRLRHLQQ-AK-
G8PQN3_PSEUV/9-264-------------------------------------------------------------------RKTIKDIMK-AK-
PANB_LEPCP/16-279-------------------------------------------------------------------PLTLPALRA-MQ-
K1VYW4_TRIAC/1535-1794-------------------------------------------------------------------KLTVGALQK-QY-
B8I2Z4_CLOCE/9-266-------------------------------------------------------------------KNTAASIQN-QK-
I0AFM0_IGNAJ/3-258-------------------------------------------------------------------..SILEFQK-KK-
I4CAV2_DESTA/3-261-------------------------------------------------------------------KITIQTLRE-KK-
PANB_SULDN/4-259-------------------------------------------------------------------KMTITSIKK-SK-
S8DNJ0_FOMPI/15-274-------------------------------------------------------------------KITIQHLHA-MK-
PANB_METCA/5-260-------------------------------------------------------------------.VTLPDLLA-MK-
F3YUG3_DESAF/5-260-------------------------------------------------------------------.LTAPDIAS-RK-
PANB_SYNAS/9-267-------------------------------------------------------------------KITTSVIRG-MK-
C7LVL7_DESBD/2-259-------------------------------------------------------------------.KTISDFLQ-MK-
PANB_NOCSJ/34-291-------------------------------------------------------------------RIRTHHLRE-MK-
F0SK13_RUBBR/3-257-------------------------------------------------------------------QMTVPRFVA-AK-
I0DRD2_PROSM/4-258-------------------------------------------------------------------.ISLATLGQ-FK-
D3E7N3_GEOS4/7-265-------------------------------------------------------------------.LNIVKLKN-MK-
G7EAQ5_MIXOS/98-357-------------------------------------------------------------------KVTLLDIAK-AK-
R7GY01_9FIRM/2-260-------------------------------------------------------------------KNTIATLQQ-QK-
U9SMK5_RHIID/19-277-------------------------------------------------------------------KVTINTIQK-LY-
R5GD14_9BACT/11-269-------------------------------------------------------------------KVTTLRLKE-MK-
R1GLQ8_BOTPV/11-271-------------------------------------------------------------------KVTLNTLHS-LH-
PANB_DESAH/4-258-------------------------------------------------------------------RVTTTTLFK-MK-
PANB_DEIDV/5-258-------------------------------------------------------------------...IPELLQ-SE-
S6CEI7_9ACTN/2-260-------------------------------------------------------------------SVTVSTFLK-MK-
R5KEY8_9CLOT/2-260-------------------------------------------------------------------KNTVVTFQK-AK-
K0SSA9_THAOC/101-366-------------------------------------------------------------------KVTTLTIRA-KK-
C6XKS3_HIRBI/9-264-------------------------------------------------------------------RKTVRDIAK-AK-
J9QSS2_RIEAN/9-267-------------------------------------------------------------------KVTTEVLRK-MK-
S6BYU9_9GAMM/3-260-------------------------------------------------------------------KITITTLER-MK-
D0KZU6_HALNC/20-275-------------------------------------------------------------------.KTLTTLQN-AK-
W6RP24_9RHIZ/9-265-------------------------------------------------------------------RLTTASIRA-MK-
G0W8X4_NAUDC/30-294-------------------------------------------------------------------.TTILDIQS-KR-
E5AM95_BURRH/11-268-------------------------------------------------------------------AVTVPRLQQ-MR-
I3TFJ1_THEC1/4-259-------------------------------------------------------------------KVTVRDIIK-KK-
PANB_GRABC/9-265-------------------------------------------------------------------RISVPALRA-RK-
G0GCR3_SPITZ/2-257-------------------------------------------------------------------..NVRSFLA-RK-
G1XV43_ARTOA/82-342-------------------------------------------------------------------KVTINTIRK-MY-
D9Q2W0_ACIS3/6-261-------------------------------------------------------------------KVTVRKIVN-LK-
B1ZVH1_OPITP/3-258-------------------------------------------------------------------..TIRDLAA-AK-
R7EXA6_9BACT/11-269-------------------------------------------------------------------KVTTRRLVE-MK-
F6B538_DESCC/4-262-------------------------------------------------------------------RVTTADFRR-MK-
D5UZ54_ARCNC/10-265-------------------------------------------------------------------KMNINKIKK-AK-
U1GVM1_ENDPU/59-319-------------------------------------------------------------------PVTIQTIRD-LH-
G2QRB2_THITE/68-328-------------------------------------------------------------------KVTIGTLRA-LY-
B7FR45_PHATC/3-276-------------------------------------------------------------------KVSALSLTS-KR-
PANB_THEEB/5-261-------------------------------------------------------------------SVTLPQLQA-KK-
R7D6U7_9ACTN/3-263-------------------------------------------------------------------KNTVLTLKK-KV-
E3GPR0_EUBLK/2-261-------------------------------------------------------------------KKSIIDFRR-MA-
C1DI17_AZOVD/17-274-------------------------------------------------------------------RVRIPYLKE-LK-
A5VB06_SPHWW/22-276-------------------------------------------------------------------RLTVPAIRA-AK-
A4CLQ4_ROBBH/10-268-------------------------------------------------------------------RVTVRSLVE-MK-
D5BTJ5_PUNMI/4-260-------------------------------------------------------------------KMTVDTFTA-LK-
C9RK32_FIBSS/3-246-------------------------------------------------------------------..TPEDIKA-KK-
C4LHZ4_CORK4/17-275-------------------------------------------------------------------KTRIHHLDQ-FK-
W8KF56_HALHR/9-265-------------------------------------------------------------------RLTLRDLQG-LR-
G7V5R4_THELD/5-262-------------------------------------------------------------------.LSIPDFMR-MK-
I3ZIP5_TERRK/17-275-------------------------------------------------------------------KVTPQTLLQ-SK-
S6AIG3_9PROT/2-259-------------------------------------------------------------------RVTLSNLQK-MA-
F3ZPG7_9BACE/11-269-------------------------------------------------------------------KVTTHHLAE-MK-
PANB_AQUAE/2-260-------------------------------------------------------------------AINLQTLFK-KK-
R7ALC5_9ACTN/29-287-------------------------------------------------------------------KNTVATFQE-MK-
U5N9B5_9BURK/27-288-------------------------------------------------------------------.FTLPRLRE-MH-
C6BVH5_DESAD/3-260-------------------------------------------------------------------KVTAPDITA-.L-
C5KFU4_PERM5/79-341-------------------------------------------------------------------KITLTQIKK-LH-
U5T1Y9_9GAMM/5-261-------------------------------------------------------------------.VTLATLRR-MK-
F4H271_CELFA/7-264-------------------------------------------------------------------RVRVHHLRE-AK-
F8AZ74_FRADG/51-306-------------------------------------------------------------------RTTVRELQA-AK-
E4NQR1_HALBP/4-256-------------------------------------------------------------------...VRDVRE-K.-
C6VWE8_DYAFD/10-268-------------------------------------------------------------------RITTHVIQE-MK-
R5KSN9_9FIRM/2-260-------------------------------------------------------------------KNTVNTLLQ-QK-
PANB_NATPD/3-255-------------------------------------------------------------------...AKDIRA-K.-
L0IYN2_MYCSM/17-274-------------------------------------------------------------------KVRTHHLQK-WK-
PANB_CLOTH/4-262-------------------------------------------------------------------KFTTASFLE-SK-
PANB_SPHAL/26-281-------------------------------------------------------------------RLTVPRIRQ-RK-
I0A221_FERFK/7-263-------------------------------------------------------------------KITMRKFIK-KK-
T2GAB0_DESGI/5-261-------------------------------------------------------------------.QTARSVSA-RK-
C6WXZ0_METML/2-266-------------------------------------------------------------------..TLPKLHE-MA-
F2IID2_FLUTR/9-267-------------------------------------------------------------------RVTTNVLQE-MK-
D5BNG2_PUNMI/9-267-------------------------------------------------------------------KVTYKTLLK-KM-
PANB_ARTAT/40-297-------------------------------------------------------------------RVRIHHLQQ-AK-
PANB_CARHZ/3-261-------------------------------------------------------------------RVTVSSLKE-MK-
A4G8C6_HERAR/16-272-------------------------------------------------------------------AVTVPALFA-LR-
E1QUY6_VULDI/5-260-------------------------------------------------------------------KVTVQTIMS-MK-
PANB_METFK/3-256-------------------------------------------------------------------...LLTLQQ-MK-
PANB_CHESB/10-264-------------------------------------------------------------------.FTPPDIAK-AK-
B6GXN5_PENCW/75-335-------------------------------------------------------------------KVTIQTLQN-MH-
I0GU87_SELRL/2-260-------------------------------------------------------------------KNTVATFAK-MK-
R9AIM6_WALI9/451-714-------------------------------------------------------------------KVTISSLNK-LK-
R5BQ58_9FIRM/5-264-------------------------------------------------------------------PKTITTIKQ-MK-
F8AC68_THEID/6-263-------------------------------------------------------------------KITVPELIA-KK-
PANB_ALKEH/12-269-------------------------------------------------------------------PVTVGRLQR-MK-
F8E6G1_FLESM/9-265-------------------------------------------------------------------KITVSHFKK-MK-
PANB_BORPE/9-264-------------------------------------------------------------------RITTRQLRM-RT-
E1VL92_9GAMM/2-258-------------------------------------------------------------------AVTLSTINK-IK-
R6CEN3_9FIRM/2-260-------------------------------------------------------------------KNTAATLMS-QK-
PANB_LEPBP/4-261-------------------------------------------------------------------..IILQYKK-KY-
D5MI67_9BACT/6-263-------------------------------------------------------------------.VRTVTLQQ-MK-
G0EFC1_PYRF1/3-258-------------------------------------------------------------------RISVRDILA-KK-
PANB_EXIS2/3-258-------------------------------------------------------------------..TMTPLLK-KQ-
I4BB70_TURPD/157-414-------------------------------------------------------------------.MNIHDFTK-KK-
PANB_MARHV/2-258-------------------------------------------------------------------AVTINTLRE-YK-
D8J2A6_HALJB/4-255-------------------------------------------------------------------...VADIR.-..-
PANB_IGNH4/3-259-------------------------------------------------------------------KVTIRDIMK-KY-
G4RJI6_THETK/5-260-------------------------------------------------------------------KITVQTFLN-MK-
K8GUE9_9CYAN/2-256-------------------------------------------------------------------PVTTQQIVQ-WK-
W6SJ04_9CLOT/2-259-------------------------------------------------------------------KNTSATFIE-MK-
D9SXD7_CLOC7/2-260-------------------------------------------------------------------KNTVITFKE-MK-
W5W0X3_9PSEU/35-292-------------------------------------------------------------------RVRIHHLQE-LK-
F7V601_CLOSS/2-260-------------------------------------------------------------------SKTLNTFRK-MK-
PANB_SYNE7/2-256-------------------------------------------------------------------PITPRHLRQ-WK-
I2GYS6_TETBL/22-285-------------------------------------------------------------------.LTIPDLLR-KY-
F2N7R6_CORGP/2-260-------------------------------------------------------------------KTTVTTFQQ-AK-
PANB_SODGM/2-257-------------------------------------------------------------------.TTISHLRK-WK-
PANB_MYXXD/4-262-------------------------------------------------------------------KVTIHTLKR-FK-
W0JJ73_DESAE/2-258-------------------------------------------------------------------KMTVPKFVS-MK-
PANB_SALRD/3-261-------------------------------------------------------------------RVTTKTVQE-MK-
H1XSD8_9BACT/9-267-------------------------------------------------------------------RITVPVIKR-MK-
K4KI34_SIMAS/15-270-------------------------------------------------------------------AVTVNTLRK-MK-
PANB_PHEZH/11-266-------------------------------------------------------------------RIAAPDIAA-RK-
C1F8U4_ACIC5/19-277-------------------------------------------------------------------KVTLATLQE-KK-
PANB_BDEBA/2-258-------------------------------------------------------------------.KTILDFHD-KK-
PANB_PSELT/2-257-------------------------------------------------------------------..NVNKFKS-MK-
PANB_POLSJ/34-294-------------------------------------------------------------------.LSLPRLRE-MH-
G0A0M7_METMM/10-265-------------------------------------------------------------------TLSIADLRA-MK-
E3E4R6_PAEPS/7-265-------------------------------------------------------------------.LNIVKMRK-MK-
R7P8R5_9BACT/11-269-------------------------------------------------------------------KVTTHRLQE-MK-
G8QNM1_AZOSU/9-266-------------------------------------------------------------------RLTITDMAK-LK-
V6JZL1_STRNV/26-283-------------------------------------------------------------------RVTVHDIAA-AK-
F4GUY4_PUSST/9-264-------------------------------------------------------------------RISVPQLMQ-YK-
R7C4Y8_9BURK/5-261-------------------------------------------------------------------..KVTDFAR-MK-
R6EWT4_9BACT/11-269-------------------------------------------------------------------KVTAPLFFE-MK-
PANB_PSYA2/2-261-------------------------------------------------------------------.TTLSTLNK-FK-
E6UF09_RUMA7/2-260-------------------------------------------------------------------KNTVSTLLK-QK-
PANB_PROMM/4-256-------------------------------------------------------------------....SELTQ-LK-
F8GE64_NITSI/2-259-------------------------------------------------------------------RITQTTLQK-ML-
G8YQ94_PICSO/33-293-------------------------------------------------------------------RYSIADIQE-LH-
R6EER5_9BACT/10-268-------------------------------------------------------------------KVTVKTFAE-MK-
R6MV46_9FIRM/2-260-------------------------------------------------------------------KKTVTTFAK-AK-
E1ZCJ6_CHLVA/23-287-------------------------------------------------------------------RVTLRTLRD-KY-
PANB_NITSB/4-255-------------------------------------------------------------------RHTVNTIKS-AK-
M4VAT0_9DELT/3-258-------------------------------------------------------------------..SILDFQK-RK-
C4XU18_DESMR/3-260-------------------------------------------------------------------RTTAPDVAA-AK-
J9ZD86_LEPFM/6-263-------------------------------------------------------------------.MTIDQFPI-RK-
L0K4F1_HALHC/4-262-------------------------------------------------------------------QVTIKTLQQ-KK-
E6WZE1_NITSE/11-266-------------------------------------------------------------------KVTVRTVQK-LK-
R7IQM6_9FIRM/7-262-------------------------------------------------------------------...AVTFKN-AK-
R5JJK8_9FIRM/2-260-------------------------------------------------------------------KNTTTTIKA-QK-
F8DZN0_CORRG/23-280-------------------------------------------------------------------QVRISDFHR-YK-
I4D5R2_DESAJ/3-259-------------------------------------------------------------------..STKDFLE-MK-
PANB_LEIXX/16-273-------------------------------------------------------------------RVRTRHFQA-AK-
E4U2F8_SULKY/3-258-------------------------------------------------------------------KLSIGSILK-RK-
PANB_NITMS/2-259-------------------------------------------------------------------HKSVQDIVN-MK-
PANB1_PSEAE/9-265-------------------------------------------------------------------RLSVPDIQR-RK-
G8BMS9_TETPH/44-308-------------------------------------------------------------------.KTILDIQR-KY-
R5V6Z6_9FIRM/2-260-------------------------------------------------------------------KNTVVTFQE-AK-
R5U793_9BACE/11-269-------------------------------------------------------------------KVTTHRLVE-MK-
F6CMZ4_DESK7/5-263-------------------------------------------------------------------QVTTAYFRE-AK-
B9L8Y5_NAUPA/4-254-------------------------------------------------------------------..TLKTLYK-K.-
PANB_DESPS/2-260-------------------------------------------------------------------RKTVVDIIA-MK-
L0F2P8_DESDL/3-259-------------------------------------------------------------------..TTTDFLA-MK-
K9Y6F0_HALP7/3-258-------------------------------------------------------------------.VTTAQLLK-WK-
PANB_NITEU/8-264-------------------------------------------------------------------RMTITTLQN-AC-
M5C834_THACB/15-272-------------------------------------------------------------------KVTIQKLHA-LK-
T2KQ61_9FLAO/10-268-------------------------------------------------------------------KVTVKTLSD-MK-
I1NLG6_ORYGL/83-346-------------------------------------------------------------------RVTLATLRG-KH-
E6TZJ1_BACCJ/3-259-------------------------------------------------------------------..TTTDFFN-MK-
K0B4S7_CLOA9/4-262-------------------------------------------------------------------KFTVNSFLE-SK-
R6VBN9_9CLOT/2-260-------------------------------------------------------------------KNTIITFKQ-SK-
G4QJL3_GLANF/3-259-------------------------------------------------------------------KVTTSTLMQ-LK-
PANB_RHOBA/10-264-------------------------------------------------------------------RITTRTLQR-MR-
R5DYA6_9BURK/9-266-------------------------------------------------------------------PVRLSTIKK-MY-
PANB_RHORT/10-268-------------------------------------------------------------------RLTVRDIAS-RK-
A5DVU0_LODEL/36-294-------------------------------------------------------------------KKTISYIQN-LY-
B6JWN4_SCHJY/27-297-------------------------------------------------------------------..TVRSIRK-LY-
PANB_CORGL/8-265-------------------------------------------------------------------KIRTRHFRE-AK-
PANB_RALSO/12-268-------------------------------------------------------------------AVTVTSLQG-MR-
R6LXN4_9CLOT/2-260-------------------------------------------------------------------KNTVRTFQM-AK-
PANB_MOOTA/6-264-------------------------------------------------------------------RVTLPQLQA-MK-
F2F6S0_SOLSS/3-258-------------------------------------------------------------------..TTAQFLK-MK-
PANB_AZOSB/9-267-------------------------------------------------------------------PVTLFELGK-MR-
D3SC34_THISK/3-258-------------------------------------------------------------------PITVNTLAR-RK-
D4H852_DENA2/9-265-------------------------------------------------------------------KINLNTFKK-MK-
H6L4G9_SAPGL/9-267-------------------------------------------------------------------KVTTHVLHA-MK-
R6DPQ8_9CLOT/2-260-------------------------------------------------------------------KKTVSTLQQ-AK-
N0B212_9BACI/3-259-------------------------------------------------------------------..QTTNFLK-MK-
R7K0E3_9CLOT/2-260-------------------------------------------------------------------KNTVQTWRQ-AK-
Q6BIM6_DEBHA/33-293-------------------------------------------------------------------RKTLLDIQR-LY-
K0KXD0_WICCF/32-290-------------------------------------------------------------------RKSLNDIRQ-LY-
E8RS63_ASTEC/11-266-------------------------------------------------------------------RLTAPEIYA-RK-
F9X8W4_ZYMTI/67-327-------------------------------------------------------------------KITLQTLQA-MY-
A4XA35_SALTO/20-277-------------------------------------------------------------------RVRARDLLA-AK-
D5U1C4_THEAM/4-259-------------------------------------------------------------------KVNVKTIMK-MK-
T0ULG9_9STRE/2-260-------------------------------------------------------------------KNTVLSFQK-AK-
PANB_ALTMD/3-259-------------------------------------------------------------------KVTVSGLLK-KK-
I0ICC5_PHYMF/8-267-------------------------------------------------------------------RTTLRDLRH-RA-
F4PL25_DICFS/108-366-------------------------------------------------------------------KTTILDIKK-KF-
G4KQR4_OSCVS/3-261-------------------------------------------------------------------KKTVIDLYK-MK-
K9YNE4_CYASC/2-257-------------------------------------------------------------------KVTIQKLCQ-WK-
PANB_WOLSU/3-258-------------------------------------------------------------------NITVSSIKK-KK-
E6U5I9_ETHHY/4-262-------------------------------------------------------------------TVTTQSFLD-AK-
B8BWG2_THAPS/41-307-------------------------------------------------------------------KVTTLTIAA-KK-
K9SYS3_9SYNE/2-257-------------------------------------------------------------------PVTISQLLT-WK-
PANB_AERPE/5-260-------------------------------------------------------------------KVTARRILK-MK-
R7DES0_9PORP/10-268-------------------------------------------------------------------KVTTRRLAE-MK-
PANB_BAUCH/4-259-------------------------------------------------------------------.TTISHLRK-YK-
I5AYL4_9DELT/4-258-------------------------------------------------------------------KITTSSLMK-MK-
PANB_BACSK/2-259-------------------------------------------------------------------.KTTKTFKQ-MK-
R6A0K1_9BACT/11-268-------------------------------------------------------------------KVTTHRLKE-MK-
B2IDS4_BEII9/7-254-------------------------------------------------------------------...AARFAE-MK-
K0C447_CYCSP/9-266-------------------------------------------------------------------KITNTDLLT-MK-
PANB_LISMO/5-258-------------------------------------------------------------------....VDFFA-MK-
PANB_RHILO/16-267-------------------------------------------------------------------.....LIRR-RK-
K9VPY0_9CYAN/2-258-------------------------------------------------------------------SVTTHQLIQ-WK-
C0ZCH0_BREBN/7-265-------------------------------------------------------------------PITTSSIRK-KK-
A7TTC6_VANPO/36-301-------------------------------------------------------------------RKSILDLNK-KY-
M4ZY73_9ACTN/20-278-------------------------------------------------------------------RVRTRHFQQ-AK-
D2U9Y6_XANAP/10-266-------------------------------------------------------------------.WTVPALAD-AK-
PANB_BACLD/3-259-------------------------------------------------------------------..TKTDFLK-MK-
K9ZZ09_DEIPD/3-257-------------------------------------------------------------------.KTVPDLVR-SE-
E8T692_THEA1/2-260-------------------------------------------------------------------RVTVATLAE-KK-
D3UG21_HELM1/2-256-------------------------------------------------------------------KTTITSLQK-KK-
R5FZT9_9PORP/11-269-------------------------------------------------------------------KITATRFMA-MK-
E0SBL5_DICD3/3-259-------------------------------------------------------------------ATTISHLRQ-WK-
PANB_HALSA/12-261-------------------------------------------------------------------.......NT-D.-
PANB_CAMJE/4-258-------------------------------------------------------------------..SMISFLE-KK-
C5CWU9_VARPS/32-292-------------------------------------------------------------------.LSLPRLAD-MH-
Q0UNM3_PHANO/57-317-------------------------------------------------------------------PVTINTLQA-LY-
PANB_SULAC/5-259-------------------------------------------------------------------KVSIRDFLK-KK-
M4NHU9_9GAMM/13-271-------------------------------------------------------------------PVTVPGLLA-MK-
C5C4X5_BEUC1/14-271-------------------------------------------------------------------RVRVQHLRA-AK-
E2SAV3_9ACTN/24-281-------------------------------------------------------------------RVRTHHLRQ-WK-
I2F2C6_9BACT/2-256-------------------------------------------------------------------..NVREIVQ-MK-
PANB_DECAR/9-266-------------------------------------------------------------------RLTQADLAK-LY-
W1Q8C1_OGAPD/26-284-------------------------------------------------------------------QKTLTDIKK-LY-
PANB_KOSOT/2-256-------------------------------------------------------------------..NIRQIIN-SK-
PANB2_BRADU/11-267-------------------------------------------------------------------RVTIPALQQ-WK-
R7NSE5_9FIRM/2-259-------------------------------------------------------------------KNNVSTFAK-MK-
A8DWD1_NEMVE/4-260-------------------------------------------------------------------.VTLTTLQS-LK-
D9SIJ1_GALCS/2-259-------------------------------------------------------------------RTTLTTLKA-MK-
PANB2_VIBF1/3-259-------------------------------------------------------------------KITISDLNN-WK-
C4Y7C6_CLAL4/28-286-------------------------------------------------------------------RTTLTDLRK-LY-
E0UPX6_SULAO/4-259-------------------------------------------------------------------KLTISTIKK-SK-
C0QS02_PERMH/2-258-------------------------------------------------------------------.KTIHDFLR-AK-
PANB_PELUB/4-253-------------------------------------------------------------------..KILNFIK-KK-
F2LWA6_HIPMA/2-259-------------------------------------------------------------------AITVPKIKD-MK-
PANB_THICR/2-256-------------------------------------------------------------------..TLTKLHK-MK-
M5DV17_9GAMM/4-263-------------------------------------------------------------------.ISIRSLQT-MK-
X2HEZ8_9NEIS/2-257-------------------------------------------------------------------.HTIHTLRK-MK-
I1YKY2_METFJ/3-261-------------------------------------------------------------------RLSLSHLRK-MK-
D2NU30_ROTMD/61-319-------------------------------------------------------------------KVRTVHLAQ-AK-
R5SB00_9GAMM/3-259-------------------------------------------------------------------..TVTSFQR-LK-
E1VAR3_HALED/19-275-------------------------------------------------------------------TVTLSTLQA-HK-
D3SNL0_THEAH/2-259-------------------------------------------------------------------KVTLRTLFR-KR-
U3U9E1_9ENTR/4-259-------------------------------------------------------------------.TTISYLNQ-LK-
PANB_CLOAB/2-260-------------------------------------------------------------------KNTTETFKN-SK-
B7GHT0_ANOFW/22-277-------------------------------------------------------------------..TKLDFLN-MK-
B8EK33_METSB/5-251-------------------------------------------------------------------....ARFFE-MK-
C8X1K5_DESRD/4-262-------------------------------------------------------------------KLSVHTLQG-LK-
G4T0T2_META2/12-267-------------------------------------------------------------------PLTITDLQS-MK-
PANB_ANAMF/4-256-------------------------------------------------------------------..NILDIQA-KK-
I4YBJ3_WALSC/10-273-------------------------------------------------------------------KVTIAKLNK-MR-
F0S4V2_PSESL/9-267-------------------------------------------------------------------RVTTFSLQE-MK-
E6SCG6_INTC7/25-282-------------------------------------------------------------------RVRIPHLQA-MK-
PANB_CORJK/21-279-------------------------------------------------------------------KVRIADLKA-RK-
F4PBH9_BATDJ/27-283-------------------------------------------------------------------KVTITALRK-LY-
PANB_CYAP4/3-259-------------------------------------------------------------------.VTIPQLQQ-WK-
U5QGT4_9CYAN/2-258-------------------------------------------------------------------AVSIHHLRR-LK-
E7A9J8_HELFC/3-264-------------------------------------------------------------------KITLDSLYR-KK-
PANB_ROSDO/14-264-------------------------------------------------------------------.....DIKS-RK-
I0H0N1_ACTM4/15-272-------------------------------------------------------------------RVRTRDLIN-AK-
M2PBF7_CERS8/43-302-------------------------------------------------------------------KVTIHHLQA-MR-
V4KY10_9DELT/4-261-------------------------------------------------------------------KLTRFDLQT-MK-
D4MUX9_9FIRM/2-260-------------------------------------------------------------------KTTVSTVQK-MK-
K4II33_PSYTT/10-268-------------------------------------------------------------------RITVKSLIE-MK-
G2TM93_BACCO/3-259-------------------------------------------------------------------..QTTDFVK-MK-
PANB_NOCFA/22-279-------------------------------------------------------------------KTRIPHLRQ-MK-
PANB_STRMK/10-265-------------------------------------------------------------------.WTVPALAE-AK-
R6Q9M5_9FIRM/3-261-------------------------------------------------------------------KNTVSTFRE-QK-
PANB_GEOLS/4-261-------------------------------------------------------------------KITIPEILL-MK-
PANB_STACT/3-256-------------------------------------------------------------------..QLSNLFD-MK-
D3IAK5_9BACT/11-269-------------------------------------------------------------------KITTQKFIE-LK-
E3RMD4_PYRTT/56-316-------------------------------------------------------------------PVTINTLQS-MY-
F8C4E6_THEGP/11-262-------------------------------------------------------------------......LIE-KK-
PANB_RHOCS/9-265-------------------------------------------------------------------RLAVPDIAA-RK-
G8LWQ2_CLOCD/4-262-------------------------------------------------------------------KITVSNFRE-SK-
Q6CLY9_KLULA/32-295-------------------------------------------------------------------QLTVKDIMA-KY-
PANB_SYNR3/10-261-------------------------------------------------------------------....EQLRQ-RK-
R5J4T6_9FIRM/2-260-------------------------------------------------------------------KNTVLTFKE-AK-
R5CPJ0_9BACT/11-269-------------------------------------------------------------------KVTTHRFIE-MK-
PANB2_ZYMMO/10-265-------------------------------------------------------------------RRTIPELRA-RK-
PANB_UNCTG/3-261-------------------------------------------------------------------KKTVLTILK-KK-
A9SWR9_PHYPA/44-307-------------------------------------------------------------------RVTLRHLEA-KY-
PANB_PSYWF/2-265-------------------------------------------------------------------.ITLSTLKK-YK-
E1VXC6_ARTAR/15-272-------------------------------------------------------------------RIRLHHLQQ-AK-
F2J6X3_POLGS/33-294-------------------------------------------------------------------RTTLSTLDR-IK-
PANB_GEOSW/3-259-------------------------------------------------------------------..TKTDFFK-MK-
D3PCJ6_DEFDS/9-265-------------------------------------------------------------------KITVNHLKK-MK-
F5XK06_MICPN/12-270-------------------------------------------------------------------RIRIPDLQQ-AK-
R5PEY0_9BACT/11-269-------------------------------------------------------------------KVTAPAFFK-MK-
D1BFU9_SANKS/24-281-------------------------------------------------------------------RFRVHHLAE-HK-
I3VRB5_THESW/4-262-------------------------------------------------------------------KITVSTLKR-LK-
PANB_AGRVS/9-265-------------------------------------------------------------------RLTPTTIAA-LK-
PANB_XYLFA/10-265-------------------------------------------------------------------.WTVPALAE-AK-
M4SFZ5_9SPHN/23-277-------------------------------------------------------------------RMTVPQIQA-RK-
G0RQ21_HYPJQ/11-271-------------------------------------------------------------------KVTMSTIKS-LY-
R7FC11_9FIRM/2-261-------------------------------------------------------------------KQTVQTIQA-KK-
C1MW11_MICPC/19-288-------------------------------------------------------------------RFTLRKLAA-KY-
W5XWQ3_9CORY/8-265-------------------------------------------------------------------RVRTRHFFE-AK-
L0EU60_LIBCB/3-258-------------------------------------------------------------------TTTIETLNQ-LK-
L0E1F4_THIND/2-256-------------------------------------------------------------------RTTIRTLEK-YK-
K9Z7J6_CYAAP/2-257-------------------------------------------------------------------KVTIQNLQQ-WK-
I4A0H9_ORNRL/9-266-------------------------------------------------------------------KITTETLRN-LK-
A5HYW9_CLOBH/2-260-------------------------------------------------------------------RNTVSTFQE-LK-
I3U7Q6_ADVKW/24-279-------------------------------------------------------------------RITVPQLRA-YK-
PANB1_PSEF5/9-264-------------------------------------------------------------------RLSVPQLVA-MK-
E8UZX7_TERSS/17-275-------------------------------------------------------------------KTTPQSLQD-QK-
PANB_CHLTE/11-273-------------------------------------------------------------------HVTTRRMLD-MK-
F4CPV3_PSEUX/31-288-------------------------------------------------------------------RTRIHHLAE-MK-
PANB_MARMM/13-268-------------------------------------------------------------------RITAPDIRA-RK-
K9WEF5_9CYAN/2-259-------------------------------------------------------------------AVTTQQLIQ-WK-
K9SKS8_9CYAN/2-258-------------------------------------------------------------------TVTTANLQT-FK-
R4VYJ3_9EURY/3-265-------------------------------------------------------------------RTTIRDLQT-RY-
K5WY16_AGABU/47-306-------------------------------------------------------------------KVTIQGLHA-LR-
A8NR68_COPC7/47-306-------------------------------------------------------------------KVTIQTLHS-MR-
S5SZ30_9CORY/8-265-------------------------------------------------------------------RVRTRHFAQ-AK-
E3H7X2_ILYPC/2-260-------------------------------------------------------------------KNTVVSFRN-SK-
B8D3I6_DESK1/7-262-------------------------------------------------------------------RVTVRDIVK-MK-
I2BCN0_SHIBC/38-294-------------------------------------------------------------------PTTVANLRQ-LK-
D8PBH0_9BACT/1-257-------------------------------------------------------------------.MTVPDLQK-CK-
A7I1C3_CAMHC/4-259-------------------------------------------------------------------.ITPNAIIA-KK-
D3Q8M5_STANL/19-275-------------------------------------------------------------------RVRTRDLKL-AK-
V5UCI0_9BURK/11-268-------------------------------------------------------------------AVTVPGLAQ-MR-
L0H3K5_9GAMM/8-264-------------------------------------------------------------------.IGISTLAA-MK-
L0JL26_NATP1/3-257-------------------------------------------------------------------..TVRDVRS-K.-
A8IKB7_CHLRE/113-377-------------------------------------------------------------------RVTLRTIRK-KY-
PANB_HELPY/10-265-------------------------------------------------------------------KITLNHLQA-KK-
R7BQ71_9ACTN/2-260-------------------------------------------------------------------KNTVTTFKD-AK-
D5V951_MORCR/17-276-------------------------------------------------------------------.ITLSTLNK-LK-
U7PLW4_SPOS1/41-301-------------------------------------------------------------------KVTVGTLRS-LY-
R7LEZ2_9BACT/2-258-------------------------------------------------------------------KKSIKTIFK-KK-
D3FBP3_CONWI/22-279-------------------------------------------------------------------.VSLPQLAE-KK-
C5CCN7_MICLC/23-281-------------------------------------------------------------------RYRTVHLQR-AK-
F8PSJ9_SERL3/44-301-------------------------------------------------------------------KVTIQSLYN-QH-
PANB_PELCD/4-262-------------------------------------------------------------------RKTVLDIQR-MK-
D7CJ47_SYNLT/3-261-------------------------------------------------------------------RVTTTLLRE-KK-
Q6FJH7_CANGA/29-292-------------------------------------------------------------------.KTILDLQR-KY-
D8M6X1_BLAHO/33-296-------------------------------------------------------------------KVTVSTIAS-KY-
E1SVW3_FERBD/3-259-------------------------------------------------------------------RITTSTLNR-YK-
PANB_METS5/3-254-------------------------------------------------------------------RLTIRDFLK-KK-
C1EBW8_MICSR/72-335-------------------------------------------------------------------RMTLKRLRA-KY-
J7S291_KAZNA/30-296-------------------------------------------------------------------RTTLSDITG-RY-
B8MWV2_ASPFN/53-313-------------------------------------------------------------------KVTIQTLQS-LH-
PANB_GLUDA/2-258-------------------------------------------------------------------RITLFDVQA-MK-
PANB3_BRADU/9-264-------------------------------------------------------------------RKTAPDLRI-RK-
PANB_HALMA/3-256-------------------------------------------------------------------..TVRDLQA-M.-
PANB_STAA8/2-256-------------------------------------------------------------------.KTVSQLID-MK-
G4RCR9_PELHB/16-265-------------------------------------------------------------------......ILA-RK-
F7YY72_9THEM/2-258-------------------------------------------------------------------.ITLQKLIS-MK-
D2W044_NAEGR/75-331-------------------------------------------------------------------.VTLQCINY-KY-
F4C347_SPHS2/9-267-------------------------------------------------------------------KVTVNSILE-MK-
B1I1N7_DESAP/5-263-------------------------------------------------------------------RLTTLDIRR-KK-
A8NPY9_COPC7/58-317-------------------------------------------------------------------KVTIQTLHS-LR-
R5E9H5_9CLOT/2-260-------------------------------------------------------------------KNTVLTFKQ-AK-
B8J200_DESDA/2-259-------------------------------------------------------------------KNTVVTFRA-AK-
V4IHK4_9GAMM/6-262-------------------------------------------------------------------.ITSASLVR-MK-
PANB_RALME/11-266-------------------------------------------------------------------TVTIPKLQA-MR-
PANB_SYNJB/4-259-------------------------------------------------------------------.LSIHHFRQ-AK-
PANB_SACEN/31-288-------------------------------------------------------------------RVRTRHLLE-LK-
G0VBF0_NAUCC/42-307-------------------------------------------------------------------PITIPDIHS-KY-
D2SAW9_GEOOG/14-271-------------------------------------------------------------------RVRVHHLQQ-AK-
A5FWA4_ACICJ/13-269-------------------------------------------------------------------.KSIGSWER-AK-
N0B2M6_9RHIZ/10-264-------------------------------------------------------------------.LMAPDITA-RK-
H9UMW1_SPIAZ/3-258-------------------------------------------------------------------..RLADFPV-RK-
PANB_CAMFF/3-258-------------------------------------------------------------------KVTINDLFM-MK-
G7USF2_PSEUP/10-266-------------------------------------------------------------------.WTVPALRQ-AK-
A0A0D2VT44_CAPO3/54-312-------------------------------------------------------------------KRTIIDLKK-MH-
A8ZX35_DESOH/4-253-------------------------------------------------------------------...LSVFRD-YK-
PANB_CAUCR/12-266-------------------------------------------------------------------.LAAPDIAA-RK-
D5WPY7_KYRT2/8-259-------------------------------------------------------------------.......FR-KR-
I0JN82_HALH3/5-258-------------------------------------------------------------------....SQFIK-MK-
E4T2P1_PALPW/10-268-------------------------------------------------------------------RVTTQRLLE-MK-
E4U845_OCEP5/3-257-------------------------------------------------------------------KLTIPELKS-RK-
B8IX11_METNO/22-279-------------------------------------------------------------------KRTITDIRN-SK-
PANB_PARL1/9-264-------------------------------------------------------------------RVTVPEIRA-RK-
C1D7E8_LARHH/49-306-------------------------------------------------------------------KVTVSTLAR-LK-
PANB_YEAST/26-290-------------------------------------------------------------------.NTIQDIRN-KY-
I1XL09_METNJ/3-260-------------------------------------------------------------------RTSLNQLRK-MK-
PANB_TRIEI/2-260-------------------------------------------------------------------AVTTKQLIQ-WK-
K7AE29_9ALTE/3-259-------------------------------------------------------------------KVTTSSLLK-MK-
S2J9Z0_MUCC1/36-294-------------------------------------------------------------------KVSIKTIQS-LY-
W0EVM7_9SPHI/9-267-------------------------------------------------------------------RVTTHTLAK-MK-
PANB_CALMQ/5-260-------------------------------------------------------------------KVTIRYFLE-SK-
S0EZ89_CHTCT/9-267-------------------------------------------------------------------RITVPELRA-RK-
Q6CE35_YARLI/40-298-------------------------------------------------------------------KVTIPELAK-MR-
R5ACL8_9FIRM/2-260-------------------------------------------------------------------KNTVATLQQ-QK-
G8R5C5_OWEHD/10-268-------------------------------------------------------------------KVTTNSVQE-MK-
PANB_TOLAT/3-259-------------------------------------------------------------------KISLTQVQK-MK-
B3QT33_CHLT3/14-276-------------------------------------------------------------------QVTTRKLVE-MK-
B0VG23_CLOAI/8-266-------------------------------------------------------------------KTDIAVFKE-MK-
G8B7V6_CANPC/30-291-------------------------------------------------------------------RKTVADIHQ-FH-
D5UXM6_TSUPD/25-282-------------------------------------------------------------------KVRIHHLAD-LK-
W0DU54_9GAMM/2-258-------------------------------------------------------------------KKTLKQLYK-MA-
F0YK17_AURAN/2-266-------------------------------------------------------------------.TTAMSLLR-MK-
N1QBK2_PSEFD/41-301-------------------------------------------------------------------KTSLQTLKS-MY-
G8TR11_NIAKG/11-269-------------------------------------------------------------------KITTHTLQK-MK-
K0NQW1_DESTT/4-258-------------------------------------------------------------------RVTTSTLIK-MK-
C5DIL6_LACTC/24-292-------------------------------------------------------------------.KTLADLFS-KH-
F4B4G2_ACIHW/4-258-------------------------------------------------------------------KITVKSFLK-KK-
PANB_DESAG/9-266-------------------------------------------------------------------AITAADIRA-AK-
E1QGK1_DESB2/5-263-------------------------------------------------------------------KVTISDLYQ-KK-
F9Z613_ODOSD/10-267-------------------------------------------------------------------.VTTHVLSE-MK-
R6QG64_9CLOT/9-267-------------------------------------------------------------------DVTVNTFFK-KK-
PANB_NEIG1/2-257-------------------------------------------------------------------.ITVNTLQK-MK-
PANB_ALKMQ/4-261-------------------------------------------------------------------KKSILDLMK-MK-
F0LTK0_VIBFN/3-259-------------------------------------------------------------------KITINDLMK-WK-
A5D5T4_PELTS/5-263-------------------------------------------------------------------KVTTATIKQ-MK-
PANB_TROWT/13-267-------------------------------------------------------------------RTRIHRFHK-.G-
J7IT73_DESMD/3-259-------------------------------------------------------------------..STKDFWV-QK-
D4KZZ1_9FIRM/4-262-------------------------------------------------------------------KNTVVTLQK-QK-
PANB_SACD2/11-266-------------------------------------------------------------------KVTVNTLRK-MK-
PANB_CYAP8/2-257-------------------------------------------------------------------AMTLPYLIQ-AK-
PANB1_ZYMMO/33-296-------------------------------------------------------------------KTTTARISQ-MR-
PANB1_HAHCH/9-265-------------------------------------------------------------------RITIPQIRS-MK-
B4U641_HYDS0/4-261-------------------------------------------------------------------KLNIELLFK-KK-
C7PAE1_CHIPD/9-267-------------------------------------------------------------------RITTHILQK-MK-
PANB_EXISA/3-259-------------------------------------------------------------------..TMTTLLK-KM-
PANB_FRAAA/42-298-------------------------------------------------------------------RFTVRDVAA-AK-
A8GIZ6_SERP5/25-281-------------------------------------------------------------------PTTVTHLHQ-WK-
PANB_MARMS/13-269-------------------------------------------------------------------AVTLSTLKK-MK-
B9I8Q3_POPTR/46-310-------------------------------------------------------------------RVTLTHLKQ-KH-
F2KYW8_PREDF/10-268-------------------------------------------------------------------KVTAKTLLQ-MK-
W8X8F9_CASDE/9-264-------------------------------------------------------------------RVTVPQLVS-FK-
C7MWE6_SACVD/37-294-------------------------------------------------------------------RVRIHHLRE-LK-
W8TJC5_EUBAC/5-263-------------------------------------------------------------------KFTVSSFME-SK-
R6MRV8_9FIRM/2-260-------------------------------------------------------------------KNTTVTFKN-KK-
E1R683_SPISS/12-255-------------------------------------------------------------------KVT......-..-
E0TIB5_PARBH/9-264-------------------------------------------------------------------RQTAASITA-RK-
C9R9H9_AMMDK/3-261-------------------------------------------------------------------KVTTADFRR-WK-
L0ECE9_THECK/4-262-------------------------------------------------------------------.LTVTKWLK-MK-
PANB_RHIEC/9-265-------------------------------------------------------------------RLTPPRISA-MK-
PANB_RHOS4/11-264-------------------------------------------------------------------..MAADILA-RK-
C8W3T9_DESAS/5-263-------------------------------------------------------------------KVTTATFRN-MK-
H8GHP8_METAL/6-259-------------------------------------------------------------------.LSIHDLAA-MK-
R6FWR6_9CLOT/2-260-------------------------------------------------------------------KNTVVTFKQ-AK-
Q7NSX9_CHRVO/10-253-------------------------------------------------------------------RVTVPAIRN-SK-
PANB_DESVH/21-277-------------------------------------------------------------------.LTTADIRK-AK-
PANB_RHISN/11-264-------------------------------------------------------------------..SPASIEA-LK-
K9SDR5_9CYAN/2-259-------------------------------------------------------------------AVTVRQLMQ-RK-
R6FYY2_9FIRM/2-260-------------------------------------------------------------------KNTVTTFQA-MK-
PANB_THIDA/2-258-------------------------------------------------------------------PVTLSTLKA-LR-
PANB2_METPP/16-274-------------------------------------------------------------------PVTLHTLRE-MH-
PANB_ROSS1/2-259-------------------------------------------------------------------RKTITDIQQ-MK-
H6C1C9_EXODN/62-322-------------------------------------------------------------------PVTIQTLQK-MY-
F2NLZ2_MARHT/3-259-------------------------------------------------------------------KLTVLDLKA-KK-
F0R8P2_BACSH/11-269-------------------------------------------------------------------KVTTHRLME-MK-
D5SWW3_PLAL2/21-276-------------------------------------------------------------------RMTVPRFQG-AK-
R5EQ78_9GAMM/2-259-------------------------------------------------------------------KVTVATFAK-MK-
E8U6D3_DEIML/3-257-------------------------------------------------------------------.LTVPDIVR-AE-
B3PI46_CELJU/20-275-------------------------------------------------------------------SVTINTLYK-LK-
PANB_SYNFM/4-261-------------------------------------------------------------------RVTVPEIIA-SK-
H2J7Z9_MARPK/2-256-------------------------------------------------------------------..SIRKFLK-MK-
PANB_CHRSD/3-259-------------------------------------------------------------------TVTLSRLNA-FK-
H8L6Y3_FRAAD/13-270-------------------------------------------------------------------PVTAPGLRA-MK-
PANB_DEHM1/2-259-------------------------------------------------------------------RTTISQLKE-MK-
PANB_HELHP/5-260-------------------------------------------------------------------KMSIATLKA-KK-
B2GG07_KOCRD/16-273-------------------------------------------------------------------RVRTVHLQR-AK-
J3YT69_9ENTR/2-257-------------------------------------------------------------------.TTISHLQT-WK-
PANB_RUTMC/2-256-------------------------------------------------------------------..NIEALNN-FK-
F4KKJ6_PORAD/11-269-------------------------------------------------------------------KVTTRRLLE-MK-
E4TNZ1_MARTH/10-268-------------------------------------------------------------------KITTHQLQE-MK-
PANB_ACIAD/3-261-------------------------------------------------------------------..SLSDLRK-FK-
M1E8E9_9FIRM/4-260-------------------------------------------------------------------KLYAPDIIK-LK-
H2FZS0_OCESG/3-259-------------------------------------------------------------------KITTARLQA-MK-
E3D016_9BACT/4-262-------------------------------------------------------------------RMTLPRLRE-MK-
R7Y0I9_9ACTN/27-284-------------------------------------------------------------------KIRTHHLRE-MK-
C7R4W8_JONDD/10-267-------------------------------------------------------------------RFRVHDFAR-AK-
B3DYC2_METI4/5-256-------------------------------------------------------------------KITPDWIRL-RK-
PANB_BURP8/11-267-------------------------------------------------------------------AVTVPKLMA-MR-
PANB_OCEIH/3-256-------------------------------------------------------------------..ALKDFMR-MK-
K4LJP4_9FIRM/4-262-------------------------------------------------------------------KVNINALQN-KV-
C7M6V0_CAPOD/10-268-------------------------------------------------------------------RVTTKSIVE-MK-
E6SG79_THEM7/29-287-------------------------------------------------------------------RVTVRTVLE-SK-
H0UKG2_9BACT/4-262-------------------------------------------------------------------KMSVLDFKR-YK-
G0AG10_COLFT/18-274-------------------------------------------------------------------PITIPALQA-LR-
D0MKC7_RHOM4/15-273-------------------------------------------------------------------RVTTQTLQE-MK-
K9TFZ3_9CYAN/2-258-------------------------------------------------------------------PITPQQLIE-RK-
PANB_SYNY3/2-258-------------------------------------------------------------------AITPTQLLD-WK-
PANB_CHRVO/2-258-------------------------------------------------------------------KITVNTLHK-LA-
PANB_PYRAE/11-257-------------------------------------------------------------------.........-VK-
D3G0K7_BACPE/3-259-------------------------------------------------------------------..TTATFKK-MK-
G8ZML5_TORDC/45-310-------------------------------------------------------------------SNTIHDMHN-AY-
B8GNA9_THISH/9-265-------------------------------------------------------------------RITTRRLQE-MR-
PANB_YERPE/3-260-------------------------------------------------------------------TTTMSQLRQ-WK-
PANB_HALHL/14-269-------------------------------------------------------------------.VTVSRMRA-MK-
I7H5U9_9HELI/5-260-------------------------------------------------------------------KMSITDLQA-KK-
PANB_FLAJ1/10-268-------------------------------------------------------------------RITTKSLIE-MK-
H2AZP6_KAZAF/28-293-------------------------------------------------------------------RITIQDIQK-KY-
PANB_HYPNA/9-263-------------------------------------------------------------------RKTVKDIAA-AK-
F0T218_SYNGF/3-260-------------------------------------------------------------------KKTILDFWK-MS-
K0J2M4_AMPXN/5-260-------------------------------------------------------------------....FEFLK-MK-
PANB_PELPD/7-264-------------------------------------------------------------------KVTIPDILK-MK-
PANB_ACAM1/2-259-------------------------------------------------------------------AVTIHQLRT-WK-
R5HLC5_9SPIR/4-262-------------------------------------------------------------------KVTVNTIQK-YK-
E6W3R1_DESIS/9-267-------------------------------------------------------------------KITTTAVMS-MK-
E8WV64_GRATM/17-275-------------------------------------------------------------------KVTPQTLLD-RK-
B0RBZ8_CLAMS/26-283-------------------------------------------------------------------RVRIRHFAR-AK-
R7J318_9BACT/11-269-------------------------------------------------------------------KVTTARLTE-MK-
D1C1L8_SPHTD/5-263-------------------------------------------------------------------RVTIADLKA-MK-
D5CQ24_SIDLE/3-260-------------------------------------------------------------------RKTLSTLQA-MR-
K9U8V4_9CYAN/2-257-------------------------------------------------------------------PITTQQLIQ-WK-
R7Z1Y2_CONA1/60-319-------------------------------------------------------------------KVTLGTLRA-LY-
A3GFD5_PICST/27-288-------------------------------------------------------------------RKTVADINR-FY-
PANB_GEOMG/4-262-------------------------------------------------------------------KKTIIDIQK-MK-
D1B8U6_THEAS/5-263-------------------------------------------------------------------KVTIPALRE-MK-
D1AZH1_SULD5/18-272-------------------------------------------------------------------.KTITSIKQ-HK-
K9V2Q3_9CYAN/2-257-------------------------------------------------------------------PVTIQQLIQ-WK-
G4TES8_PIRID/16-274-------------------------------------------------------------------KVTLARLAE-MR-
PANB_AERHH/3-259-------------------------------------------------------------------KITTTNLLK-MK-
B5Y864_COPPD/3-251-------------------------------------------------------------------...ATQFKK-LK-
E6VV69_DESAO/18-273-------------------------------------------------------------------.VTAPDIMA-RK-
D0LB03_GORB4/26-283-------------------------------------------------------------------KTRVHHLAQ-MK-
R4XB88_TAPDE/13-270-------------------------------------------------------------------.LNLGTIQK-LY-
C5XKA7_SORBI/74-338-------------------------------------------------------------------RVTLATLRG-KH-
PANB_HELMI/4-262-------------------------------------------------------------------KITLPQCKE-MK-
D4ZUG3_ARTPN/2-258-------------------------------------------------------------------AVTTQQLID-WK-
D3AXV1_POLPA/114-372-------------------------------------------------------------------KTTILDIKK-KY-
W5Y2G7_9CORY/15-272-------------------------------------------------------------------KIRVSDLVK-LK-
W0IZ08_9BACT/4-264-------------------------------------------------------------------...VLDFKA-RK-
G3AZ68_CANTC/24-285-------------------------------------------------------------------RNTIADIYS-MY-
E8R215_ISOPI/23-275-------------------------------------------------------------------..QPPDLIR-YK-
R4KP81_9FIRM/5-263-------------------------------------------------------------------KANILTFKE-MK-
K5W3S2_PHACS/44-303-------------------------------------------------------------------KVTIQHLHH-LR-
A9WS61_RENSM/30-287-------------------------------------------------------------------KIRVHHLQQ-AK-
PANB_ANADF/10-272-------------------------------------------------------------------RVTIHELRR-MK-
PANB_THEM4/1-256-------------------------------------------------------------------.MTIQKFLA-MK-
PANB_SULSO/3-259-------------------------------------------------------------------KVTIRDFIK-KK-
F0S244_DESTD/2-259-------------------------------------------------------------------AITTATFLE-KK-
B9L4S0_THERP/5-263-------------------------------------------------------------------RVTVADLRA-MK-
C8WT97_ALIAD/4-262-------------------------------------------------------------------TVTVRTLAN-MK-
PANB_STAEQ/2-256-------------------------------------------------------------------.KTLNHLNK-MK-
PANB_OLICO/9-264-------------------------------------------------------------------RKTAPEIFA-RK-
F6FX13_ISOV2/15-272-------------------------------------------------------------------RVRVHHLAE-AK-
PANB_GEODF/4-262-------------------------------------------------------------------ATTILDIQK-MK-
D9QPL3_ACEAZ/4-262-------------------------------------------------------------------KKSILDFME-MK-
F2JV64_MARM1/12-268-------------------------------------------------------------------PVTLSKLRK-MK-
E0UCI4_CYAP2/2-257-------------------------------------------------------------------AVTTGQIIK-WK-
D5EMA1_CORAD/2-258-------------------------------------------------------------------SISTQTIAR-LK-
G2IWQ8_PSEUL/2-259-------------------------------------------------------------------KINVNTLFK-MA-
X2GVH3_9BACI/3-258-------------------------------------------------------------------..TTSDFLK-MK-
D6XUX0_BACIE/3-260-------------------------------------------------------------------..TTSDFRT-MK-
D6Z2X7_DESAT/7-263-------------------------------------------------------------------..TVCDLAA-KK-
PANB_KORVE/11-269-------------------------------------------------------------------KVTSSTLLD-KK-
A6QC29_SULNB/11-266-------------------------------------------------------------------KITLSTISA-MK-
D3V561_XENBS/3-258-------------------------------------------------------------------PTTLTDLSQ-LK-
C6X7E4_METGS/1-265-------------------------------------------------------------------.MTVHDLQT-MA-
D7WER9_9CORY/10-268-------------------------------------------------------------------KVRVADLRQ-KK-
I3YPM0_ALIFI/9-267-------------------------------------------------------------------AVTTYRLTE-MK-
R5HUC8_9FIRM/3-261-------------------------------------------------------------------QNNVVTLAA-MK-
R5U8N9_9FIRM/2-260-------------------------------------------------------------------KTTVSTLKK-QK-
PANB_HYPBU/6-262-------------------------------------------------------------------KVTVRDIVR-AK-
B8P6R4_POSPM/2-261-------------------------------------------------------------------KVTIQHLHS-LR-
PANB_SHELP/3-259-------------------------------------------------------------------KITSSTLLK-FK-
PANB_CHLAA/2-258-------------------------------------------------------------------RITIRDIQQ-MR-
PANB_PHOLL/3-258-------------------------------------------------------------------PMTMTDLNQ-LK-
PANB_CLOK5/3-261-------------------------------------------------------------------KNNVSTFVS-AK-
I0HQJ4_RUBGI/17-276-------------------------------------------------------------------.LNLVRLRE-MA-
R5ZHJ8_9FIRM/2-260-------------------------------------------------------------------KTTVTTLQN-MK-
U5MUW3_CLOSA/2-260-------------------------------------------------------------------KNTILTFKK-AK-
A0A068NY03_9BACT/4-257-------------------------------------------------------------------RVTVPHIRA-MR-
D5DBX1_BACMD/3-259-------------------------------------------------------------------..TKLDFLR-MK-
K9T7C7_9CYAN/2-258-------------------------------------------------------------------AVTIQQLIQ-WK-
PANB_AZOPC/10-268-------------------------------------------------------------------KITIQHLIE-MK-
K3W4X2_PYTUL/57-320-------------------------------------------------------------------KVTTLDLGI-LK-
A1CTJ0_ASPCL/72-332-------------------------------------------------------------------KVTMQTLRS-LY-
A6WW04_OCHA4/18-274-------------------------------------------------------------------RLTPKAISA-LK-
V5SAA2_9RHIZ/10-264-------------------------------------------------------------------.LMAPDISA-LK-
D3HPA3_LEGLN/2-258-------------------------------------------------------------------..KIQDFKR-KK-
R5BRB9_9FIRM/4-262-------------------------------------------------------------------KKCIHDLYK-MK-
B1VGE7_CORU7/16-274-------------------------------------------------------------------QVRISDLTA-RK-
W0RJ42_9BACT/5-261-------------------------------------------------------------------.VTTGDLAA-MK-
PANB_PARDP/15-266-------------------------------------------------------------------.....DIRA-RK-
D5QI36_KOMHA/9-263-------------------------------------------------------------------RRTIRDVT.-.K-
D1BSH7_XYLCX/21-280-------------------------------------------------------------------RVTPPSLAA-LA-
L0DD73_SINAD/8-261-------------------------------------------------------------------.VTPPDFAR-WK-
PANB_PEPD6/2-260-------------------------------------------------------------------KNTIQTFKN-AK-
PANB_THEMA/2-256-------------------------------------------------------------------..NVEKLKK-MK-
C7N2J4_SLAHD/19-269-------------------------------------------------------------------..NLAYLQK-QK-
A4SZR6_POLSQ/9-266-------------------------------------------------------------------PITITKLLA-MH-
D7B2F6_NOCDD/27-283-------------------------------------------------------------------RVTIRDLAA-AK-
H3ZNX9_THELN/3-257-------------------------------------------------------------------EITPKKIME-MK-
M4UAA2_9GAMM/3-259-------------------------------------------------------------------RISVSHLMK-MK-
K9QBM1_9NOSO/2-258-------------------------------------------------------------------PVTTQQLIQ-WK-
PANB_SALTY/3-258-------------------------------------------------------------------PTTISLLQK-CK-
W0E2Q1_MARPU/6-262-------------------------------------------------------------------.TTVASLAA-MK-
I1YQZ3_PREI7/10-268-------------------------------------------------------------------KITAKTLRE-MK-
L0A954_CALLD/5-260-------------------------------------------------------------------KLTIRDIMK-MK-
D4Z3Z8_SPHJU/23-282-------------------------------------------------------------------RLTVPAIQR-RK-
E6WRV2_PSEUU/10-266-------------------------------------------------------------------.WTVPALAE-AK-
F9ZNB5_ACICS/4-257-------------------------------------------------------------------..KLEVWRR-GK-
R5AXG3_9BACT/10-268-------------------------------------------------------------------KVTTRRLVE-MK-
R6QI65_9FIRM/2-260-------------------------------------------------------------------KNTVSTFQK-MK-
F4L4T8_HALH1/9-267-------------------------------------------------------------------RITTHVLQA-MK-
PANB_COLP3/3-259-------------------------------------------------------------------KITTASLLN-MK-
PANB_ERWT9/3-259-------------------------------------------------------------------PTTVSTLRQ-WK-
D2B380_STRRD/20-276-------------------------------------------------------------------RITVRDIAA-AK-
Q54LH3_DICDI/91-349-------------------------------------------------------------------KKTVLDILK-KY-
R6RU48_9CLOT/2-260-------------------------------------------------------------------KNTAVTFKN-AK-
C7QBN8_CATAD/33-291-------------------------------------------------------------------RVTVRDLAK-AK-
E8NFW7_MICTS/5-263-------------------------------------------------------------------RVTLRRLSE-LA-
PANB_THET8/2-257-------------------------------------------------------------------RRTVKDFRN-.A-
M1PUL5_DESSD/4-262-------------------------------------------------------------------RKTVAGILA-MK-
PANB_HERA2/2-258-------------------------------------------------------------------RTQLSDIQR-MK-
PANB_CORDI/5-259-------------------------------------------------------------------.VRLQDLRD-YK-
G8P0T0_GRAMM/17-275-------------------------------------------------------------------RVTADVLLQ-KK-
B0JGU8_MICAN/2-253-------------------------------------------------------------------AVTTSKLIE-WK-
A4RSY4_OSTLU/35-299-------------------------------------------------------------------RFTLGELRK-KY-
G0VMJ3_MEGEL/4-263-------------------------------------------------------------------KVTNLTIKK-MK-
G8JVR3_ERECY/22-285-------------------------------------------------------------------QKTIPDLLQ-KY-
D4ALU8_ARTBC/69-329-------------------------------------------------------------------KVTIKSLEA-LY-
D8IYH6_HERSS/15-271-------------------------------------------------------------------PVTTHTLQA-MR-
D5EGN8_AMICL/9-262-------------------------------------------------------------------.....EFVK-MK-
K0CGS1_ALCDB/3-252-------------------------------------------------------------------KKHAQALME-MK-
M3HH38_CANMX/30-289-------------------------------------------------------------------RKTIEDIHQ-LY-
C7R7Z0_KANKD/3-259-------------------------------------------------------------------TLTISDIEQ-LK-
H8KSY4_SOLCM/9-267-------------------------------------------------------------------RITTNTVQE-MK-
Q75D37_ASHGO/24-287-------------------------------------------------------------------QKTIPDIFK-KY-
E4RTA9_LEAB4/5-263-------------------------------------------------------------------RITTNTLRE-FK-
E3HRX5_ACHXA/19-273-------------------------------------------------------------------.LSVPAFRA-RK-
PANB_DESAA/4-258-------------------------------------------------------------------KVTVTVLAK-MK-
D3DI50_HYDTT/5-262-------------------------------------------------------------------.ITIRHLFK-KK-
T1KER8_TETUR/72-325-------------------------------------------------------------------KVRTIDIVS-MK-
D9QLF2_BRESC/11-266-------------------------------------------------------------------RLAAPDIMK-RK-
F8I3G8_SULAT/4-259-------------------------------------------------------------------KLTAPELRR-QK-
E8SI87_STAPH/2-256-------------------------------------------------------------------.KTLNHIQQ-MK-
D5BZ31_NITHN/3-259-------------------------------------------------------------------RLTLTKLRK-MK-
PANB_ACIC1/10-267-------------------------------------------------------------------RVTIHDLQL-RK-
PANB_BUCAI/3-259-------------------------------------------------------------------SITISQLKN-WK-
D8RRV3_SELML/38-302-------------------------------------------------------------------RVTLRHLQS-KY-
R5IEN0_9BACT/10-267-------------------------------------------------------------------.MTTHRLLE-MK-
R5LDT0_9FIRM/2-259-------------------------------------------------------------------.TTVTTLMN-MK-
D6ZCH0_SEGRD/15-271-------------------------------------------------------------------RVRISHLHE-MK-
PANB_LEPIN/9-261-------------------------------------------------------------------.......SP-EK-
PANB_FRATT/7-257-------------------------------------------------------------------......FKK-AK-
W0EB65_9FIRM/2-259-------------------------------------------------------------------RKTVPYFFQ-MK-
PANB_IDILO/5-261-------------------------------------------------------------------KTSIATLQK-MK-
PANB2_HAHCH/2-258-------------------------------------------------------------------SITLSTLLD-LK-
PANB_CHLPD/11-273-------------------------------------------------------------------HVTTRKLLD-MK-
F0VHK9_NEOCL/2-249-------------------------------------------------------------------....ADLLQ-RK-
W5X1Y4_BDEBC/3-258-------------------------------------------------------------------..SILEFQE-AK-
PANB_ACISJ/26-287-------------------------------------------------------------------.VSLPRLAQ-MR-
PANB_SULTO/3-259-------------------------------------------------------------------KVTIRDFLK-KK-
U4KYW8_PYROM/61-321-------------------------------------------------------------------KVTINTLRN-LY-
G8M4H3_9BURK/11-267-------------------------------------------------------------------TITVPKLQA-MR-
R7I0S5_9CLOT/17-275-------------------------------------------------------------------KHTVLTLQE-QK-
PANB_LEGPH/2-258-------------------------------------------------------------------..KIHDFKI-KK-
PANB_PSYIN/3-259-------------------------------------------------------------------KISVSRLTK-MK-
B4EJY2_BURCJ/9-265-------------------------------------------------------------------RKTVTAIRS-TK-
C3PI15_CORA7/10-267-------------------------------------------------------------------RLRTRHFAR-AK-
D4G919_RIEPU/9-267-------------------------------------------------------------------.TTIEDIRI-WK-
I7A1E3_MELRP/3-258-------------------------------------------------------------------..TVSEFRK-SK-
R6HBG1_9ACTN/2-260-------------------------------------------------------------------KNTVATFKK-MK-
C5ZWV0_9HELI/9-263-------------------------------------------------------------------QTTITQILE-KK-
PANB_STAMF/3-258-------------------------------------------------------------------KITIRDILK-MK-
PANB_CYTH3/10-268-------------------------------------------------------------------KVTTHQLQE-MK-
H5WJ91_9BURK/17-281-------------------------------------------------------------------...LVRLRD-MG-
PANB_ALCBS/2-258-------------------------------------------------------------------SITIRTLQK-RK-
B2V9F5_SULSY/3-258-------------------------------------------------------------------..SINEFFK-AK-
I4ANF3_FLELS/11-269-------------------------------------------------------------------RITTHSLQE-MK-
B6H969_PENCW/50-309-------------------------------------------------------------------KVTIQTIQN-LY-
X2GXI3_9GAMM/2-259-------------------------------------------------------------------KKTILTLQQ-RK-
G4V1E0_NEUT9/11-271-------------------------------------------------------------------KVTLNTLQS-MY-
C5ME17_CANTT/28-287-------------------------------------------------------------------RKTLADIRQ-LY-
K9UIR8_9CHRO/3-253-------------------------------------------------------------------..TVRQLLQ-YK-
A9GRC2_SORC5/21-278-------------------------------------------------------------------KVTVPEIRS-RK-
R5NDJ7_9BACT/11-269-------------------------------------------------------------------KVTTHRLIE-MK-
D2QWS1_PIRSD/7-261-------------------------------------------------------------------RVTVPEFVS-FK-
C7RR60_ACCPU/9-266-------------------------------------------------------------------RLTQLDLAR-MR-
PANB_MAGMM/4-262-------------------------------------------------------------------RVRVPDLVR-MK-
PANB_SYNWW/3-261-------------------------------------------------------------------RVTVSVLKD-KK-
D5AMQ4_RHOCB/10-264-------------------------------------------------------------------.LMPSDILA-LK-
PANB_BACHD/3-259-------------------------------------------------------------------..TTASFKK-MK-
D0LJC1_HALO1/5-263-------------------------------------------------------------------KVTIHTLQQ-KK-
PANB_METS4/17-272-------------------------------------------------------------------.VTIPMLQA-WR-
B2UME9_AKKM8/9-253-------------------------------------------------------------------....ERIRA-CK-
R5BAJ9_9BACE/11-269-------------------------------------------------------------------KVTTALLRK-MK-
PANB_EDWI9/4-259-------------------------------------------------------------------.TTLSHLRK-RK-
R4KDW0_CLOPA/2-260-------------------------------------------------------------------KNTSSTFVS-AK-
PANB_CALS8/3-260-------------------------------------------------------------------KVTTKTLFE-KK-
D8QAA7_SCHCM/53-309-------------------------------------------------------------------KVTVADLQK-MH-
R5KL99_9CLOT/2-260-------------------------------------------------------------------KNTTTSIMQ-MK-
E3JA95_FRASU/46-302-------------------------------------------------------------------RPTVRDLAT-WK-
D6ZI06_MOBCV/16-270-------------------------------------------------------------------.FRVQHVQQ-YF-
I3Y5B5_THIV6/6-262-------------------------------------------------------------------.ISVTALAA-MK-
U5Q4L3_9BACT/10-267-------------------------------------------------------------------.ITTQRLLE-MK-
B8DSD1_DESVM/24-276-------------------------------------------------------------------.....DVRA-AK-
PANB_PROMH/3-258-------------------------------------------------------------------PVTLSTLNR-YK-
R7JBN8_9FUSO/4-262-------------------------------------------------------------------KVTVNTIQK-YK-
M1WKJ2_DESPC/25-280-------------------------------------------------------------------.VTAPSVQA-SK-
W0BBT9_9GAMM/2-258-------------------------------------------------------------------..KIHDFKR-KK-
R5IDU3_9FIRM/17-266-------------------------------------------------------------------.KTINYLQK-LR-
A6RA45_AJECN/56-315-------------------------------------------------------------------KVTIKSLRA-LY-
PANB_SYNP2/2-257-------------------------------------------------------------------RVTPRTLQN-YK-
E4NAD9_KITSK/28-286-------------------------------------------------------------------RVTVRDLAK-AK-
I3Z4N3_BELBD/11-269-------------------------------------------------------------------RITTHTLQE-MK-
D5X9N1_THEPJ/5-263-------------------------------------------------------------------KVTTLTLKQ-KK-
D8JZZ5_DEHLB/2-260-------------------------------------------------------------------RTTIQAVRD-FK-
C7NW69_HALMD/3-255-------------------------------------------------------------------...ANDIRA-K.-
K4LLM0_THEPS/3-261-------------------------------------------------------------------RVTTATLLE-MK-
PANB_XANP2/9-264-------------------------------------------------------------------RITAPQIQA-RK-
PANB_GEOBB/4-262-------------------------------------------------------------------QRTILDFQR-MK-
PANB_GLOVI/3-254-------------------------------------------------------------------.LSIHSLRK-LK-
A6WD73_KINRD/16-272-------------------------------------------------------------------RTRVHHFQQ-WK-
B5YIG6_THEYD/2-260-------------------------------------------------------------------RFTVTDLLM-KK-
H1XZL4_9SPHI/9-267-------------------------------------------------------------------KITTNTLQA-MK-
C6CUG2_PAESJ/4-263-------------------------------------------------------------------RLTITNLKK-MK-
PANB_ERYLH/23-282-------------------------------------------------------------------RLTVPKIRA-RK-
PANB_SCHPO/5-262-------------------------------------------------------------------QITISTLRQ-WK-
D1CBZ3_THET1/7-265-------------------------------------------------------------------KVTIQDLIR-LK-
K9XAD9_9CHRO/2-257-------------------------------------------------------------------AVTIQQLIQ-WK-
PANB_PSEHT/3-259-------------------------------------------------------------------KITVSTLNK-MK-
PANB_RUEST/10-264-------------------------------------------------------------------.LTAEDIRA-MK-
V6JUX0_STRRC/32-289-------------------------------------------------------------------RITVRDITL-AK-
R6BVU7_9BACT/10-268-------------------------------------------------------------------KITTKTFAE-MK-
I3R834_HALMT/2-256-------------------------------------------------------------------.VTVRALRS-K.-
C4R687_PICPG/26-284-------------------------------------------------------------------QSTLRTLYS-KY-
K9XXG3_STAC7/2-258-------------------------------------------------------------------AITIQQLQK-WK-
A5DHH9_PICGU/32-292-------------------------------------------------------------------RKTLADIKQ-LY-
I2ESX7_EMTOG/9-267-------------------------------------------------------------------RVTTHTLQE-LK-
PANB_COXBU/4-260-------------------------------------------------------------------.MNTPDFQR-MK-
B1X124_CYAA5/10-265-------------------------------------------------------------------.LTTQQLIT-WK-
D5EWH2_PRER2/2-259-------------------------------------------------------------------RKSIFDLLE-RK-
G2LF65_CHLTF/5-263-------------------------------------------------------------------RVTPGDLTR-LK-
F6EEK6_AMYSD/18-275-------------------------------------------------------------------KTRIHHLQA-LK-
G8RMJ4_MYCRN/4-264-------------------------------------------------------------------KVKLADLQD-MK-
G8AKD6_AZOBR/9-265-------------------------------------------------------------------RVSVPALRA-RK-

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------DILAGLRE-NL-
A8MIW7_ALKOO/5-271--------------------------------------------------------------------EILANFRE-RI-
U5RTA7_9CLOT/8-273--------------------------------------------------------------------EIIAGFKK-QV-
D3EFW8_GEOS4/8-274--------------------------------------------------------------------EVLAKLKS-EV-
A0Q268_CLONN/3-268--------------------------------------------------------------------DILDKLKK-RI-
I0GM52_SELRL/9-273--------------------------------------------------------------------.ILRRLRA-EV-
R5TZH9_9CLOT/6-271--------------------------------------------------------------------EILKRLRA-QI-
A5I210_CLOBH/5-270--------------------------------------------------------------------KILENLKS-QI-
B2TMB2_CLOBB/6-270--------------------------------------------------------------------EIIKNLNL-QI-
E3GQA3_EUBLK/6-271--------------------------------------------------------------------AFLEKLRR-EI-
D3EFX0_GEOS4/19-284--------------------------------------------------------------------QVLDRLHR-GI-
K8END7_CARML/5-271--------------------------------------------------------------------KITKKIRR-EL-
E3DLS5_HALPG/3-268--------------------------------------------------------------------.IQNRIEK-SI-
Q893M0_CLOTE/5-270--------------------------------------------------------------------VILKTMEN-SI-
H6LDM1_ACEWD/6-271--------------------------------------------------------------------AIEKMIKN-SL-
G8AJD8_AZOBR/12-277--------------------------------------------------------------------QLLDDLRR-AC-
Q981G5_RHILO/24-290--------------------------------------------------------------------EIVAGLKA-TL-
H7C7V3_BRADU/40-302--------------------------------------------------------------------....GIRQ-FF-
L0D7P4_SINAD/6-270--------------------------------------------------------------------....KLFA-SH-
B2JXP4_BURP8/9-270--------------------------------------------------------------------.IRDGLLR-QV-
K4LCM9_THEPS/9-273--------------------------------------------------------------------QVLERLRK-ES-
Q0RZM6_RHOJR/7-274--------------------------------------------------------------------QVVDRLNT-QV-
K4LRH4_THEPS/9-277--------------------------------------------------------------------EVLKRLKK-TI-
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------EILRRLRK-NI-
A4FLF5_SACEN/6-272--------------------------------------------------------------------EIVRRLRA-KV-
G7V878_THELD/7-273--------------------------------------------------------------------EILEKLRK-KV-
I0HWG9_RUBGI/8-274--------------------------------------------------------------------QILDTFRA-KI-
Y4OV_RHISN/14-280--------------------------------------------------------------------ELIDRFHS-KI-
Q92YY4_RHIME/8-274--------------------------------------------------------------------TILEKFHG-MI-
D5BMI1_PUNMI/9-274--------------------------------------------------------------------SILKRLRA-KI-
E3HW38_ACHXA/8-274--------------------------------------------------------------------ELLDKYRA-MV-
I3TKL1_TISMK/9-274--------------------------------------------------------------------.LMDRFRR-MV-
J7TQW5_MORMO/8-273--------------------------------------------------------------------.LLKKFND-MI-
Q2RQL8_RHORT/9-274--------------------------------------------------------------------.LLETFHE-MV-
Q89PU9_BRADU/9-274--------------------------------------------------------------------.LLRRFRG-MA-
D3VIG2_XENNA/6-272--------------------------------------------------------------------QIIKDIKQ-KI-
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------QIIETLKQ-KV-
L0D8C0_SINAD/27-292--------------------------------------------------------------------EIVKQLRK-KV-
Q7UK17_RHOBA/15-279--------------------------------------------------------------------SILSGFRK-KR-
B2ATL3_PODAN/9-281--------------------------------------------------------------------EILHRLRS-QI-
M7SDL1_EUTLA/15-281--------------------------------------------------------------------EALEALRA-SL-
G9MDH1_HYPVG/9-275--------------------------------------------------------------------KILASLRA-RI-
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------.ILANLRA-QV-
M1WHF6_CLAP2/9-277--------------------------------------------------------------------DIVAKLRA-QI-
M2T3U4_COCSN/9-275--------------------------------------------------------------------SILENLRS-QI-
C8VLH6_EMENI/9-275--------------------------------------------------------------------EILSRLRA-QI-
E9F7B6_METRA/5-271--------------------------------------------------------------------EIIQRLRG-QI-
J4W7A5_BEAB2/10-276--------------------------------------------------------------------EILERLRG-QI-
F9X0V4_ZYMTI/9-275--------------------------------------------------------------------QILSGFRQ-QI-
N1PYG8_DOTSN/9-275--------------------------------------------------------------------QILDTFRK-QT-
B8LW35_TALSN/9-275--------------------------------------------------------------------EILARLRK-VI-
C5GK37_AJEDR/9-275--------------------------------------------------------------------EVLQRLRD-TI-
B8NIT8_ASPFN/9-275--------------------------------------------------------------------EVLDRLRK-TV-
S7ZNB6_PENO1/9-275--------------------------------------------------------------------EVLARLRK-TV-
H6C7I3_EXODN/9-275--------------------------------------------------------------------EVLSHLRE-QV-
M7TTH7_BOTF1/10-275--------------------------------------------------------------------.VLGRLKN-AV-
J4G6Y7_FIBRA/9-275--------------------------------------------------------------------EALQHLRE-TI-
M2QNQ6_CERS8/9-277--------------------------------------------------------------------ETLAQLRE-II-
F8Q7T4_SERL3/8-272--------------------------------------------------------------------..LKHLRE-CI-
D7SP84_VITVI/487-753--------------------------------------------------------------------SIIQRLKD-QI-
K3XVH5_SETIT/468-734--------------------------------------------------------------------SILNKLKQ-HI-
D8R7X4_SELML/473-739--------------------------------------------------------------------TILANLKK-QI-
R9NXA1_PSEHS/13-279--------------------------------------------------------------------EAVERLRA-TA-
U4LH42_PYROM/9-281--------------------------------------------------------------------EALARLHA-TI-
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------EILQRLRA-QI-
B9L5F1_THERP/10-276--------------------------------------------------------------------EALAKLRQ-TL-
I4EWM7_MODMB/6-271--------------------------------------------------------------------.ARQRLRE-TR-
C5C4B4_BEUC1/7-272--------------------------------------------------------------------ELLDRLNA-KI-
L0DC12_SINAD/11-276--------------------------------------------------------------------EILDRFRR-KV-
B5Y6G1_COPPD/8-273--------------------------------------------------------------------.ALERLQS-QV-
I4BU20_ANAMD/8-273--------------------------------------------------------------------EALKKLRA-NV-
Q5UWI2_HALMA/21-288--------------------------------------------------------------------.SLLRLRE-TV-
D2R8M3_PIRSD/8-274--------------------------------------------------------------------EILLRLRA-KV-
G8XHR5_STREN/101-367--------------------------------------------------------------------DVLRRLHA-KA-
K7SG60_PROA4/5-271--------------------------------------------------------------------EILDRFRA-QV-
X4REF3_9ACTO/5-271--------------------------------------------------------------------TILERLHT-QV-
B2A8A0_NATTJ/6-272--------------------------------------------------------------------DILKHIDE-QE-
E4RLZ6_HALHG/7-273--------------------------------------------------------------------EVREKLLA-EV-
Q893M3_CLOTE/7-273--------------------------------------------------------------------QIYENLKK-QI-
H6LDL9_ACEWD/7-273--------------------------------------------------------------------EVLRRLRE-QG-
R6I4I1_9ACTN/8-274--------------------------------------------------------------------EILDRFRK-SL-

PF14010

CAPPA_METHJ/3-484---------------------------------------------------------------------IPRTMST-QH-
D3S0D1_FERPA/2-476---------------------------------------------------------------------VPRVMST-QH-
CAPPA_HALSA/4-492---------------------------------------------------------------------VPRLMST-QH-
CAPPA_METTH/3-483---------------------------------------------------------------------VPRCMST-QH-
CAPPA_METKA/9-532---------------------------------------------------------------------IARTLAT-QH-
A8A9C2_IGNH4/3-488---------------------------------------------------------------------VPKLMAT-QH-
CAPPA_SULTO/4-511---------------------------------------------------------------------IPRTMST-QH-
B1I2W1_DESAP/7-489---------------------------------------------------------------------ISRTMST-QH-
CAPPA_PICTO/6-508---------------------------------------------------------------------IPKTMST-QH-
CAPPA_CALMQ/4-512---------------------------------------------------------------------IPRTMCT-QH-
CAPPA_METS5/4-509---------------------------------------------------------------------IPRTMST-QH-
CAPPA_ARCFU/2-471---------------------------------------------------------------------VPRVMST-QH-
CAPPA_PYRAE/3-460---------------------------------------------------------------------IPCLMCT-QH-
CAPPA_SULAC/4-511---------------------------------------------------------------------IPRTMST-QH-
J9ZD85_LEPFM/19-520---------------------------------------------------------------------IPTTMAT-QH-
CAPPA_CLOPE/3-537---------------------------------------------------------------------IPCSMMT-QH-
CAPPA_SULSO/4-511---------------------------------------------------------------------IPRTMST-QH-

PF00311

C7M9P2_BRAFD/148-942-------------------------------------------------------------------SLDVRLVFT-AH-
CAPP_ACTP2/128-879-------------------------------------------------------------------KLSIELVLT-AH-
A0ZJ69_NODSP/196-1034-------------------------------------------------------------------HLDVRLVFT-AH-
D3VH32_XENNA/127-879-------------------------------------------------------------------ELAIELVLT-AH-
Q2KZS8_BORA1/137-936-------------------------------------------------------------------EACVMPVLT-AH-
D2QW47_PIRSD/157-942-------------------------------------------------------------------KMLIELVFT-AH-
A5GVT4_SYNR3/167-992-------------------------------------------------------------------ELDVRLVFT-AH-
C6D470_PAESJ/147-936-------------------------------------------------------------------NISLELVMT-AH-
B8HVC9_CYAP4/199-1018-------------------------------------------------------------------QLDIKLVFT-AH-
C1F4Y2_ACIC5/161-947-------------------------------------------------------------------RIFVVPVFT-AH-
CAPP_SYNY3/193-1034-------------------------------------------------------------------HLDIRLVIT-AH-
B1XMB9_SYNP2/163-995-------------------------------------------------------------------QLDIRLVFT-AH-
A4S610_OSTLU/183-1007-------------------------------------------------------------------VQHVDLVLT-AH-
A9RUR8_PHYPA/162-969-------------------------------------------------------------------EQTVDLVFT-AH-
B8GNA5_THISH/143-947-------------------------------------------------------------------QLAYVPVFT-AH-
CAPP_HAHCH/132-881-------------------------------------------------------------------DLNLEFVLT-AH-
B1Y159_LEPCP/163-950-------------------------------------------------------------------HAYISPVLT-AH-
CAPP_THEEB/197-1011-------------------------------------------------------------------QLDIKLVFT-AH-
A9S2G6_PHYPA/161-965-------------------------------------------------------------------HQTVDLVLT-AH-
Q54JZ3_DICDI/144-931-------------------------------------------------------------------QQKIELVLT-AH-
C1MJ77_MICPC/164-991-------------------------------------------------------------------EQEVDLVFT-AH-
E0UJ33_CYAP2/184-1020-------------------------------------------------------------------QLDVRLVFT-AH-
A5WCX5_PSYWF/133-932-------------------------------------------------------------------QLKFIPVFT-AH-
A0JSJ3_ARTS2/161-954-------------------------------------------------------------------ELDVRPIFT-AH-
B7G725_PHATC/84-877-------------------------------------------------------------------KQKVEIVLT-AH-
CAPP_GLOVI/141-939-------------------------------------------------------------------QLDVRLVFT-AH-
C5Z450_SORBI/157-961-------------------------------------------------------------------NQSVDLVFT-AH-
D1CE74_THET1/138-931-------------------------------------------------------------------RLRARFVFT-AH-
Q117S5_TRIEI/186-1038-------------------------------------------------------------------NLDIRLVFT-AH-
C1AE63_GEMAT/147-933-------------------------------------------------------------------SALVSPVLT-AH-
A9QPD2_METI4/151-931-------------------------------------------------------------------KMEIVLVFT-AH-
B0BZ90_ACAM1/184-1012-------------------------------------------------------------------NLDIQLVFT-AH-
A4X3B0_SALTO/171-972-------------------------------------------------------------------RLAIRPVFT-AH-
E3JCU0_FRASU/173-968-------------------------------------------------------------------RLELRPVFT-AH-
Q2JKJ2_SYNJB/177-978-------------------------------------------------------------------QLHIRMVFT-AH-
A9IDM8_BORPD/139-951-------------------------------------------------------------------EARVVPVLT-AH-
A4G3V1_HERAR/147-944-------------------------------------------------------------------DALISPVLT-AH-
C1DZM5_MICSR/162-982-------------------------------------------------------------------EQEVDLVLT-AH-
D3EKG0_GEOS4/142-928-------------------------------------------------------------------SLSLELVMT-AH-
B1VUI2_STRGG/125-909-------------------------------------------------------------------NLNVRPVFT-AH-
CAPP_SYNPW/180-1003-------------------------------------------------------------------ELDIRLVFT-AH-
B0JPY0_MICAN/183-1018-------------------------------------------------------------------QLDIRLVFT-AH-
B1WNZ1_CYAA5/187-1020-------------------------------------------------------------------QLDIRLVFT-AH-
C8WQK0_ALIAD/133-906-------------------------------------------------------------------..GIELVLT-AH-
D4ZQG2_ARTPN/196-1035-------------------------------------------------------------------QLDIRLVFT-AH-
M1FKU6_9ALTE/130-889-------------------------------------------------------------------.LRVEFVLT-AH-
CAPP_ECOLI/129-883-------------------------------------------------------------------.LSLELVLT-AH-
CAPP_HAEIN/129-879-------------------------------------------------------------------.LLIELVLT-AH-
Q0K7M4_CUPNH/207-1012-------------------------------------------------------------------..LIVPVLT-AH-
Q31KY7_SYNE7/201-1017-------------------------------------------------------------------.LDIRLVFT-AH-
Q46IP1_PROMT/168-994-------------------------------------------------------------------EMDIRLVFT-AH-
CAPP_PROMP/165-989-------------------------------------------------------------------EMDIRLVFT-AH-
CAPP_VIBPA/129-877-------------------------------------------------------------------.LNIELVLT-AH-
CAPP_SHEON/129-881-------------------------------------------------------------------.LDIDLVLT-AH-
U5GXD4_POPTR/166-968-------------------------------------------------------------------.QTVELVFT-AH-

PF15617

H9TH48_SALET/4-300----------------------------------------------------------------SPWNLGATLYMP-AT-
A0A0E3A3C9_ENTCL/4-300----------------------------------------------------------------SPWNLGATLYMP-AT-
A0A023YVC9_ECOLX/4-300----------------------------------------------------------------SPWNLGATLYMP-AT-
A7MPV2_CROS8/4-300----------------------------------------------------------------SPWNLGATLYMP-AT-
B5RKC3_KLEP3/4-300----------------------------------------------------------------TPWELGATLYMP-AT-
D0KLU5_PECWW/4-299----------------------------------------------------------------SPWNLGATLYMP-AT-
B4EW80_PROMH/4-300----------------------------------------------------------------SPWNLGATLYMP-AT-
D3V2D7_XENBS/4-302----------------------------------------------------------------SPHQLGATLYIP-AT-
Q7CKQ7_YERPE/4-300----------------------------------------------------------------SAYALGATLYMP-AT-
E1PL56_PANVC/4-300----------------------------------------------------------------SPFMLGATLYMP-AT-
D3VJW5_XENNA/4-307----------------------------------------------------------------SPHQLGATLYMP-AT-
Q888S8_PSESM/3-297----------------------------------------------------------------SPYALGATLYMP-AT-
Q4ZYA8_PSEU2/3-297----------------------------------------------------------------SPYALGATLYMP-AT-
F3K7E7_PSEAJ/3-297----------------------------------------------------------------SPYALGATLYMP-AT-
Q39AX0_BURL3/4-298----------------------------------------------------------------SPFALGATLYMP-AT-
Q6FAX8_ACIAD/1-291----------------------------------------------------------------SALSLGATLYIP-AT-
A5WBK4_PSYWF/17-339----------------------------------------------------------------HPYQLGASLYMP-AT-
Q4FTQ0_PSYA2/59-368----------------------------------------------------------------HPYQLGASLYMP-AT-
Q5NWT6_AROAE/1-291----------------------------------------------------------------DATELGASLYLP-AT-
D3RPA3_ALLVD/1-291----------------------------------------------------------------DAYRLGGSLYVP-VT-
Q1QCR8_PSYCK/1-315----------------------------------------------------------------HPYQLGASLYMP-AT-
Q3JCD2_NITOC/22-310----------------------------------------------------------------HYMELGATLYMP-AT-
A1VWQ0_POLNA/1-291----------------------------------------------------------------EKKMLGASLYVP-AT-
Q2RVZ6_RHORT/5-292----------------------------------------------------------------A.LRLGASLYVP-AT-
Q9RSA7_DEIRA/8-299----------------------------------------------------------------SPWQLGASLYAP-AT-
D5BYR3_NITHN/21-309----------------------------------------------------------------CYMELGATLYMP-AT-
D8K7I6_NITWC/22-310----------------------------------------------------------------HYMELGATLYMP-AT-
E8U9R3_DEIML/2-291----------------------------------------------------------------FPFALGASLYIP-AT-
A8MM95_ALKOO/30-358----------------------------------------------------------------LAYSLGATLYMP-GI-
Q891X5_CLOTE/30-379----------------------------------------------------------------MQYALGATLYMP-GV-
A8F9P5_BACP2/30-369----------------------------------------------------------------LAHALGSTLYMP-AT-
C9RML9_FIBSS/26-364----------------------------------------------------------------LQYCLGATMYMP-GT-
E3IYR0_FRASU/30-378----------------------------------------------------------------VATALGATLYAP-GT-
Q9KY27_STRCO/30-371----------------------------------------------------------------LSAALGATLYSP-AT-
A0A080UMD5_BACIU/30-361----------------------------------------------------------------LEQALGAVLYMP-AT-
Q5YN23_NOCFA/30-368----------------------------------------------------------------LAIALGATLYAP-AT-
B1HUS4_LYSSC/26-371----------------------------------------------------------------LSYALGATLYMP-AS-
F2JGK5_CELLD/30-375----------------------------------------------------------------LSYALGATLYIP-AI-
Q65NP8_BACLD/30-368----------------------------------------------------------------LEYALGAALYVP-GN-
D1BEK0_SANKS/30-368----------------------------------------------------------------LAVGLGATLYSP-GT-
D1A9P4_THECD/30-368----------------------------------------------------------------LAVALGATLYSP-AT-
C9ZE12_STRSW/30-371----------------------------------------------------------------LAAALGATLYSP-AT-
F4H5N5_CELFA/32-371----------------------------------------------------------------LAVALGATLYMP-GT-
B7HBK1_BACC4/30-348----------------------------------------------------------------LAYALGATLYTP-GT-
A0A0B5R5V5_BACTU/30-348----------------------------------------------------------------LAYALGATLYTP-GT-
C8W644_DESAS/30-371----------------------------------------------------------------LSYSLGATLYMP-GS-
Q82B97_STRAW/30-370----------------------------------------------------------------LAAALGATLYSP-AT-
Q0SDY5_RHOJR/44-383----------------------------------------------------------------LAVALGATLYVP-AT-
Q72YD0_BACC1/30-348----------------------------------------------------------------LAYALGATLYTP-GT-
C1B1Z6_RHOOB/52-391----------------------------------------------------------------LAVALGATLYVP-AT-
A4J1D5_DESRM/16-360----------------------------------------------------------------LAHALGATLYMP-GT-
C0ZNQ3_RHOE4/41-379----------------------------------------------------------------LAIALGATLYVP-AT-
C0Z9Y5_BREBN/30-378----------------------------------------------------------------LAHALGATLYMP-AI-
Q186J7_PEPD6/30-345----------------------------------------------------------------LKYALGAFLYVP-AT-
E3EE66_PAEPS/10-368----------------------------------------------------------------LAYAIGAALYMP-AT-
F4D0A7_PSEUX/30-375----------------------------------------------------------------LSVALGATLYMP-GD-
E6UGJ0_RUMA7/26-367----------------------------------------------------------------LQYCLGATMYMP-GT-
D0L8D1_GORB4/35-372----------------------------------------------------------------LALALGATLYVP-GT-
B1VYI2_STRGG/30-395----------------------------------------------------------------LSVALGATLYSP-AT-
C9YLT5_PEPDR/30-345----------------------------------------------------------------LKYALGAFLYVP-AT-
F4EXE4_SELS3/15-331----------------------------------------------------------------LQYKVGGLLYMP-AY-
C8XAU7_NAKMY/30-369----------------------------------------------------------------LAHALGATLYVP-AT-
A8L403_FRASN/30-378----------------------------------------------------------------VATALGATLYAP-GT-
A6WD82_KINRD/30-375----------------------------------------------------------------LAVALGATLYCP-AT-
Q0RDF4_FRAAA/30-378----------------------------------------------------------------LATALGATLYAP-GT-
A2RKY2_LACLM/29-388----------------------------------------------------------------LASSLGASIYCP-LD-
Q2J6S0_FRASC/45-393----------------------------------------------------------------LATALGATLYAP-GT-
E3PRQ7_CLOSD/30-367----------------------------------------------------------------LRYALGATLYLP-AT-

PF03328

Q9RYM1_DEIRA/24-251---------------------------------------------------------------------QIGLWLG-LA-
Q8XL94_CLOPE/6-225---------------------------------------------------------------------RSMMFVP-GS-
Q9CGA8_LACLA/9-229---------------------------------------------------------------------RTMMFVP-GN-
RHMA_ECOLI/19-246---------------------------------------------------------------------QIGLWLS-ST-
Q8RDW5_FUSNN/9-227---------------------------------------------------------------------RTMMFLP-GN-
GARL_ECOLI/20-246---------------------------------------------------------------------QIGCWSA-LS-
Q9KTU0_VIBCH/11-230---------------------------------------------------------------------RSMLFVP-GA-
Q93167_CAEEL/26-259---------------------------------------------------------------------RALLYVP-AS-
Q9HRM8_HALSA/29-241---------------------------------------------------------------------RSVLFSP-GD-
O82487_ARATH/90-322---------------------------------------------------------------------LYGLFLL-SF-
CITEL_DEIRA/9-223---------------------------------------------------------------------RSVLFAP-GN-
BPHF_RHOJR/18-244---------------------------------------------------------------------QIGFWLA-LG-
A4XDW8_NOVAD/18-242---------------------------------------------------------------------QLGFWLA-LA-
HPCH_KLEP7/15-240---------------------------------------------------------------------QIGLWLG-LC-
C0ZQX9_RHOE4/12-226---------------------------------------------------------------------RASLVAP-GS-
CITE_ECOLI/15-234---------------------------------------------------------------------RSMLFVP-GA-
Q4DGT6_TRYCC/18-249---------------------------------------------------------------------KFGVFLN-SA-
Q8ZRY2_SALTY/5-223---------------------------------------------------------------------RSMLFIP-GA-
Q99ZK8_STRP1/6-224---------------------------------------------------------------------RTMMFVP-GA-

PF02896

PPDK1_MAIZE/589-947----------------------------------------------------------------MAWVDDVRKLKV-LA-
PT1_STACT/251-543----------------------------------------------------------------ESVTADGHHVEL-AA-
PT1_CUPNH/262-557----------------------------------------------------------------PAVTLDGLEIDL-LA-
PT1_ECOLI/250-542----------------------------------------------------------------PAITLDGHQVEV-CA-
PT1_HAEIN/250-542----------------------------------------------------------------PAITLDGHKVDV-VA-
PT1P_ECOLI/416-708----------------------------------------------------------------PAQLKSGERIKV-ML-
PPSA_PYRFU/496-796----------------------------------------------------------------GAPLVTGTMVKV-..-
PTFAX_XANCP/521-808----------------------------------------------------------------PAETTDGHHIDI-GA-
PT1_STRMU/252-546----------------------------------------------------------------ETVTADGKHFEL-AA-
PTFX2_ECOLI/362-654----------------------------------------------------------------QARTADGIRIEI-AA-
PPSA_STAMF/504-813----------------------------------------------------------------LLPLYPVTATKI-YM-
D5AMJ7_RHOCB/521-803----------------------------------------------------------------PALTVDGARVEV-VA-
Q24801_ENTHI/517-878----------------------------------------------------------------LKWANEIKKIGV-FA-
Q5L199_GEOKA/251-541----------------------------------------------------------------PTVTADGVHVEL-AA-
Q6MTX2_MYCMS/252-540----------------------------------------------------------------PSLTKDKIKKLI-EA-

PF00224

KPYK_EMENI/32-379------------------------------------------------------------------FRRTSIICTI-GP-
KPYM_FELCA/42-395------------------------------------------------------------------ARNTGIICTI-GP-
KPYK_HAEIN/5-350------------------------------------------------------------------LRRTKIVCTM-GP-
KPYK_YARLI/29-376------------------------------------------------------------------YRKSSIIGTI-GP-
KPYC_SOLTU/19-365------------------------------------------------------------------IPKTKIVCTL-GP-
KPYR_HUMAN/85-438------------------------------------------------------------------ARSTSIIATI-GP-
KPYK_LACLA/2-375------------------------------------------------------------------NKRVKIVSTL-GP-
KPYK1_YEAST/18-365------------------------------------------------------------------LRRTSIIGTI-GP-
G0RKV7_HYPJQ/42-387------------------------------------------------------------------.RRTSIICTI-GP-
Q1GAL0_LACDA/1-345------------------------------------------------------------------MKKTKIVSTL-GP-
Q5KWB2_GEOKA/3-345------------------------------------------------------------------.RKTKIVCTI-GP-

PF01274

MASY_EMENI/11-531................................................................PAPGLVDRRVEI-TG-
MASZ_CORGL/35-713REFLDSVVPLDGASHADVEKYNITDGKLAAHIGDSVYRLKNRESYRGFTGNFLDPEAILLETNGLHIELQIDPVHP-IG-
MASY_MYXXD/17-538................................................................LPADLQDRRVEI-TG-
MASZ_ECOLI/17-697RFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIELQIDANGR-IG-
Q9RYN3_DEIRA/10-521................................................................LPDALKDRRVEI-TG-
MASY_MAIZE/16-548................................................................VPPAVADRTVEI-TG-
MASY_ECOLI/11-533................................................................IPADLEDRRVEI-TG-
MASZ_MYCLE/17-704KFMDQAVPLASDSWTNATGVSIFDGQLQIAIGTNSTGLASPEKFVGYNRQLRSSNWSVLLANHGLHIEVLIDPESP-IG-
MASY_YEAST/18-542................................................................LAPGLINRSTEI-TG-
B5GRN8_STRC2/12-539................................................................APPALQDRRVEI-TG-
C5MBE7_CANTT/16-539................................................................LAPGLIDRRCEI-TG-
F2KMB8_PSEBN/18-697AFLDEAAPLAAGSHVDSTAYKIVDGKLVVTLKGGSNSGLRDDAQLIGFQGDASAPTTVLLKHNGLHFEIQIDASTP-VG-
M4EJ48_BRARP/22-551................................................................VPPAVADRRVEI-TG-
W1QBI0_OGAPD/27-543................................................................THPKLQCRKIEI-TG-

PF00463

ACEA_EMENI/14-536--D-----------------SRWRYTKR-P----FTAEQIVAKRGNLK.IEYPSNVQAKKLWGILERNFKNKEASFTY--
ACEA_YEAST/22-550--D-----------------SRWSKTKR-N----YSARDIAVRRGTFPPIEYPSSVMARKLFKVLEKHHNEGTVSKTF--
ACEA1_SOYBN/3-534--S-----------------ERFRLTKR-P----YTARDVVSLRGNLR.QTYASNEMAKKLWRLLKNHQANGTASRTF--
ACEA_YARLI/10-536--S-----------------PRWKHTKR-V----YSPEDIASRRGTIK.VPQASSQQADKLFKLLQEHEKNHTASFTY--
ACEA_NEUCR/23-547--D-----------------SRWRQTKR-P----FTAEQIVSKRGNLK.IEYASNAQAKKLWKILEDRFAKRDASYTY--
C5MF59_CANTT/18-543--E-----------------PRWRKTKR-I----YSAEDIAKKRGSLK.ISYPSSQQADKLFKLLEQHDAEKSVSFTF--

PF13714

A0JTC7_ARTS2/12-246..Q-----------------AP.E....-I----L........................................QVI--
A0K276_ARTS2/27-270..D-----------------GA.A....-P----L........................................VLV--
A0QPJ7_MYCS2/16-251..R-----------------PG.D....-P----G........................................VLP--
A0R0I0_MYCS2/10-256..A-----------------GGNI....-.----.........................................VAP--
A1CA54_ASPCL/14-274..T-----------------PG.K....-P----L........................................VLT--
A1SIA9_NOCSJ/3-233..H-----------------AE.L....-P----L........................................LLP--
A4F7M3_SACEN/8-232..R-----------------AG.D....-P----L........................................LLP--
A4FH54_SACEN/26-273..V-----------------PK.R....-P----L........................................VLP--
A4X5C0_SALTO/32-264..R-----------------PG.Q....-P----L........................................VLP--
A4X7L5_SALTO/4-223..R-----------------TG.D....-P----L........................................VLP--
A4XS21_PSEMY/12-254..Q-----------------RD.E....-L----L........................................VLP--
A4YVZ4_BRASO/12-249..E-----------------S..G....-C----F........................................VLP--
A5G4A7_GEOUR/12-254..Q-----------------GP.G....-T----L........................................VLP--
A5V3Q4_SPHWW/10-252..V-----------------AG.D....-P----L........................................RLV--
A9WM41_RENSM/9-245..D-----------------DL......-.----L........................................ILP--
B1VSN1_STRGG/14-249..A-----------------EH.R....-P----L........................................VLP--
B4RBF1_PHEZH/10-242..T-----------------GA.E....-I----L........................................VLP--
B5HHA0_STRPR/15-253..H-----------------G..E....-M----L........................................VLP--
B5HRK0_9ACTN/12-259..R-----------------E..G....-C----F........................................LLP--
B5HVC7_9ACTN/7-239GRL-----------------PG.D....-P----L........................................VLP--
B6HSS2_PENCW/11-259..Q-----------------PG.N....-P----L........................................ILT--
B8MDA8_TALSN/5-285..K-----------------N..Q...D-R----V........................................RLL--
B9JNZ3_AGRRK/15-273..K-----------------R..T....-F----L........................................RFL--
B9K4D9_AGRVS/8-247..E-----------------GS.G....-T----F........................................IIP--
C1D0L9_DEIDV/16-251..E-----------------AP.E....-I----L........................................TLA--
D5UDN5_CELFN/12-253..E-----------------SG......-A----L........................................VLP--
C5C673_BEUC1/6-244..R-----------------PG.A....-P----L........................................LLP--
C5K5X0_PERM5/22-289..T-----------------K..APNDG-V----I........................................RAM--
D9SPL5_CLOC7/7-255..S-----------------K..N....-T----L........................................IMP--
C6W6H2_DYAFD/19-261..H-----------------SG.K....-M----L........................................VLP--
C7Q1F2_CATAD/16-252..A-----------------GP.D....-V----F........................................VIA--
C7YUL0_NECH7/9-264..K-----------------PS.T....-P----I........................................VFP--
C7YZU2_NECH7/391-674..A-----------------R..Q....-L----IHPCPHLYQHQPQSSSINIAMSATQSKVDILRERLNTAKPAIAM--
D6Z4R6_DESAT/153-411..A-----------------K..P....-M----V........................................RLM--
C9SRU6_VERA1/11-259..K-----------------PS.S....-P----L........................................ILP--
D1A2J0_THECD/5-232..R-----------------AG.D....-P----L........................................VLP--
D1BED0_SANKS/11-246..V-----------------SG.A....-P----L........................................VLP--
D1BI43_SANKS/12-247..D-----------------PR.H....-P----L........................................LLS--
D9TER7_MICAI/8-239..R-----------------PG.D....-P----L........................................LLP--
E3J806_FRASU/10-249..T-----------------RT.G....-G----L........................................VMP--
D2B1P9_STRRD/6-236..H-----------------GP.E....-P----L........................................LLP--
E3I6J4_RHOVT/30-272..A-----------------R..E....-A----F........................................ILP--
D2PR97_KRIFD/29-269..V-----------------PG.K....-P----L........................................VLP--
D2Q3B1_KRIFD/7-234..H-----------------GG.T....-P----L........................................VLP--
D2Q4L3_KRIFD/4-243..T-----------------...G....-S----F........................................VMP--
D3EII1_GEOS4/13-252...-----------------.S.N....-F----F........................................ILP--
D3V3K7_XENBS/39-278..E-----------------EG......-R----L........................................ILA--
D4AZN8_ARTBC/10-268..R-----------------KG.N....-P----L........................................VLC--
D4LCE5_RUMC1/6-261..N-----------------G..A....-P----L........................................RIL--
Q01YZ5_SOLUE/12-251..D-----------------GP.G....-V----F........................................IIP--
Q08U27_STIAD/11-246..A-----------------PG.Q....-L----L........................................VLP--
Q0BYP5_HYPNA/11-255..G-----------------GA.Q....-P----L........................................VLV--
Q0RPX9_FRAAA/13-247..R-----------------PG.V....-P----L........................................VMP--
Q12Q29_SHEDO/14-259..S-----------------P..T....-T----E........................................YLM--
Q1GKC0_RUEST/10-253..Q-----------------KG.D....-P----V........................................VLY--
Q1GQT2_SPHAL/9-246..V-----------------PG.D....-P----L........................................ILV--
Q28RZ5_JANSC/10-249..Q-----------------SG.C....-.----F........................................VMP--
Q2JAX2_FRASC/15-255..E-----------------QA.S....-P----F........................................VMA--
Q4DNR3_TRYCC/14-261..S-----------------K..E....-L----S........................................FLM--
Q4KET5_PSEF5/11-270..R-----------------K..R....-C----L........................................RVL--
Q5E5F2_VIBF1/18-278..S-----------------H..G....-C----I........................................RIL--
Q5LNA0_RUEPO/10-253..R-----------------PG.Q....-P----L........................................ILY--
Q5LUG9_RUEPO/10-245..V-----------------PG.N....-P----L........................................VMP--
Q5WBL4_BACSK/19-257..E-----------------QS.S....-T----F........................................VLP--
Q65ND9_BACLD/10-248..H-----------------QS.D....-P----F........................................VLP--
Q7NXV8_CHRVO/33-277..Q-----------------DE.R....-P----L........................................LLP--
Q7P124_CHRVO/3-243..R-----------------QA.E....-P----L........................................LLA--
Q893V9_CLOTE/153-411..L-----------------R..P....-I----V........................................KAI--
Q8EI00_SHEON/9-240..Q-----------------QS.E....-P----L........................................ILT--
A6TFP2_KLEP7/3-236..Q-----------------QN.Q....-P----L........................................LLA--
G2J0B0_PSEUL/10-251..R-----------------RS.G....-T----F........................................LMP--
G8PVS4_PSEUV/10-253..V-----------------KG.E....-P----I........................................TIY--
D4GMW6_PANAM/3-261..A-----------------EK.G....-T----L........................................IFI--
Y1998_MYCTU/3-229..H-----------------QG.V....-P----F........................................VLP--
Q2IK57_ANADE/11-247..Q-----------------D..G....-C----F........................................VLP--
Q2KD40_RHIEC/10-252..R-----------------KG.D....-P----I........................................VLY--
Q63MP0_BURPS/20-277..T-----------------G..R....-A----L........................................RFI--
Q8F693_LEPIN/12-250..E-----------------R..G....-T----F........................................IMP--
Q8YAP2_LISMO/8-250..E-----------------LP.T....-P----L........................................ILY--
Q98AR7_RHILO/15-259..A-----------------SS.E....-L----A........................................FAM--
R5T8T3_9CLOT/12-269..E-----------------KG.E....-Q----V........................................FAP--
R5TTB9_9CLOT/13-246...-----------------...G....-Q----L........................................IAP--

PF02548

C8XKD1_NAKMY/14-272--R-----------------AG.....R-K----I----------------------------------------VMV..
A7HMC7_FERNB/3-256--G-----------------K......E-P----I----------------------------------------TMI..
PANB_NITMU/2-259--D-----------------DG.....E-K----I----------------------------------------AIV..
E3I2N4_RHOVT/9-264--.-----------------.G....GD-K----I----------------------------------------VSL..
PANB_THEFY/18-275--E-----------------RG.....E-R----W----------------------------------------PML..
F0NZT0_WEEVC/9-267--F-----------------SG.....E-K----I----------------------------------------SML..
C5DYQ5_ZYGRC/31-296--L-----------------KG.....I-P----I----------------------------------------TVS..
D8RYD4_SELML/4-266--A-----------------RK.....E-P----I----------------------------------------TMV..
S9W2M7_SCHCR/5-262--L-----------------AK.....E-K----F----------------------------------------SCI..
D2PXN9_KRIFD/534-791--N-----------------RG.....E-K----W----------------------------------------AML..
H1Z987_MYROD/10-268--A-----------------NG.....E-K----I----------------------------------------SML..
C5BN63_TERTT/12-267--D-----------------RC.....E-K----F----------------------------------------TTV..
A8LKB6_DINSH/13-268--.-----------------.G....AE-P----I----------------------------------------VAL..
D7BNG1_ARCHD/5-260--A-----------------EG.....T-P----I----------------------------------------TML..
D7A714_STAND/9-264--.-----------------.G....GE-P----I----------------------------------------VSL..
PANB_BORPD/9-265--.-----------------.G....PG-K----V----------------------------------------VAL..
PANB_MAGSA/9-265--.-----------------.G....AE-P----L----------------------------------------VVL..
E8RFZ1_DESPD/5-262--N-----------------G......T-P----I----------------------------------------AEI..
PANB_PROMA/4-255--E-----------------LG.....N-Q----I----------------------------------------TIL..
K9RVA1_SYNP3/11-268--Q-----------------QG.....R-P----I----------------------------------------TML..
D5WZ20_THIK1/22-279--E-----------------AG.....E-K----I----------------------------------------AML..
B8LYN4_TALSN/78-338--K-----------------KN.....E-P----I----------------------------------------AML..
K9RDA0_9CYAN/11-264--Q-----------------QQ.....R-P----I----------------------------------------VVL..
PANB_METRJ/10-267--A-----------------EG.....R-K----I----------------------------------------IAL..
A9UP51_MONBE/1-268--R-----------------QG.....E-P----I----------------------------------------VMV..
PANB_PROA2/11-273--S-----------------EG.....E-K----I----------------------------------------SML..
F2UAL1_SALR5/62-329--A-----------------QG.....T-P----L----------------------------------------SMI..
V2XXG0_MONRO/40-299--T-----------------KK.....T-P----I----------------------------------------SMI..
G2IQV3_9SPHN/23-282--A-----------------DG..ETAE-P----L----------------------------------------VVL..
PANB_CLONN/2-260--N-----------------NG.....E-K----L----------------------------------------TML..
PANB_WIGBR/3-260--E-----------------QN.....K-K----F----------------------------------------ASI..
M1FDT2_9ALTE/4-264--K-----------------SG.....D-K----I----------------------------------------VGI..
E4TII1_CALNY/9-264--H-----------------K......E-K----I----------------------------------------VSL..
K0I9Q1_NITGG/2-255--G-----------------M......E-K----I----------------------------------------SVL..
C7MD29_BRAFD/11-267--V-----------------EG.....R-P----F----------------------------------------TML..
G8PQN3_PSEUV/9-264--.-----------------.G....HH-K----L----------------------------------------VCL..
PANB_LEPCP/16-279--Q-----------------RG.....E-K----I----------------------------------------AML..
K1VYW4_TRIAC/1535-1794--A-----------------SG.....T-P----I----------------------------------------SVL..
B8I2Z4_CLOCE/9-266--R-----------------NG.....D-K----I----------------------------------------SML..
I0AFM0_IGNAJ/3-258--Q-----------------LN.....I-P----I----------------------------------------SMV..
I4CAV2_DESTA/3-261--A-----------------RK.....E-P----M----------------------------------------TFL..
PANB_SULDN/4-259--G-----------------V......H-P----L----------------------------------------VMI..
S8DNJ0_FOMPI/15-274--K-----------------NR.....T-P----I----------------------------------------AML..
PANB_METCA/5-260--R-----------------RG.....E-K----I----------------------------------------ACL..
F3YUG3_DESAF/5-260--G-----------------G......E-R----L----------------------------------------AML..
PANB_SYNAS/9-267--K-----------------KG.....E-K----I----------------------------------------TML..
C7LVL7_DESBD/2-259--K-----------------NG.....E-K----I----------------------------------------VML..
PANB_NOCSJ/34-291--Q-----------------RG.....E-K----F----------------------------------------AML..
F0SK13_RUBBR/3-257--G-----------------Q......K-K----L----------------------------------------TVL..
I0DRD2_PROSM/4-258--K-----------------DK.....H-K----F----------------------------------------ATM..
D3E7N3_GEOS4/7-265--K-----------------KG.....V-P----I----------------------------------------TML..
G7EAQ5_MIXOS/98-357--E-----------------RE.....E-P----I----------------------------------------TVI..
R7GY01_9FIRM/2-260--Q-----------------SG.....D-K----I----------------------------------------TML..
U9SMK5_RHIID/19-277--K-----------------SK.....E-P----I----------------------------------------TVL..
R5GD14_9BACT/11-269--E-----------------QG.....R-R----I----------------------------------------AML..
R1GLQ8_BOTPV/11-271--R-----------------KN.....E-P----I----------------------------------------TVL..
PANB_DESAH/4-258--Q-----------------EG.....K-R----I----------------------------------------TAL..
PANB_DEIDV/5-258--.-----------------.......Q-P----L----------------------------------------VMV..
S6CEI7_9ACTN/2-260--A-----------------EG.....K-K----I----------------------------------------SMI..
R5KEY8_9CLOT/2-260--Q-----------------EG.....R-K----I----------------------------------------SML..
K0SSA9_THAOC/101-366--R-----------------RN.....Q-K----I----------------------------------------TMV..
C6XKS3_HIRBI/9-264--.-----------------.G....ET-P----I----------------------------------------VCL..
J9QSS2_RIEAN/9-267--F-----------------SK.....E-K----I----------------------------------------TML..
S6BYU9_9GAMM/3-260--G-----------------AG.....E-K----I----------------------------------------VAI..
D0KZU6_HALNC/20-275--R-----------------DQ.....T-P----I----------------------------------------AMI..
W6RP24_9RHIZ/9-265--.-----------------.G....KD-R----V----------------------------------------VCL..
G0W8X4_NAUDC/30-294--S-----------------KD.....I-P----I----------------------------------------TMT..
E5AM95_BURRH/11-268--E-----------------AG.....E-P----I----------------------------------------AML..
I3TFJ1_THEC1/4-259--G-----------------A......E-K----I----------------------------------------AAI..
PANB_GRABC/9-265--.-----------------.G....GT-P----I----------------------------------------VAL..
G0GCR3_SPITZ/2-257--R-----------------QG.....K-K----I----------------------------------------SMV..
G1XV43_ARTOA/82-342--E-----------------KG.....E-K----I----------------------------------------TML..
D9Q2W0_ACIS3/6-261--G-----------------K......K-P----I----------------------------------------VMI..
B1ZVH1_OPITP/3-258--A-----------------GG.....R-K----I----------------------------------------VMV..
R7EXA6_9BACT/11-269--Q-----------------RG.....E-K----I----------------------------------------SML..
F6B538_DESCC/4-262--Q-----------------EG.....Q-P----I----------------------------------------AML..
D5UZ54_ARCNC/10-265--N-----------------I......K-K----L----------------------------------------TMI..
U1GVM1_ENDPU/59-319--R-----------------KK.....I-P----I----------------------------------------TML..
G2QRB2_THITE/68-328--K-----------------KG.....E-P----I----------------------------------------TMI..
B7FR45_PHATC/3-276--R-----------------HG.....K-K----I----------------------------------------SMV..
PANB_THEEB/5-261--A-----------------LG.....E-P----I----------------------------------------TML..
R7D6U7_9ACTN/3-263--D-----------------EG.....G-K----V----------------------------------------TMV..
E3GPR0_EUBLK/2-261--A-----------------EG.....E-K----I----------------------------------------VYL..
C1DI17_AZOVD/17-274--A-----------------QG.....R-K----W----------------------------------------AML..
A5VB06_SPHWW/22-276--.-----------------.G....KT-P----V----------------------------------------VVL..
A4CLQ4_ROBBH/10-268--Q-----------------QG.....E-K----I----------------------------------------SML..
D5BTJ5_PUNMI/4-260--S-----------------E......R-K----I----------------------------------------VCL..
C9RK32_FIBSS/3-246--S-----------------KH.....E-M----I----------------------------------------SMI..
C4LHZ4_CORK4/17-275--R-----------------ES.....K-R----W----------------------------------------AML..
W8KF56_HALHR/9-265--E-----------------QA.....E-P----I----------------------------------------ASL..
G7V5R4_THELD/5-262--Q-----------------EK.....E-P----I----------------------------------------VMV..
I3ZIP5_TERRK/17-275--Q-----------------AR.....T-P----I----------------------------------------TAL..
S6AIG3_9PROT/2-259--G-----------------SG.....E-K----I----------------------------------------AVL..
F3ZPG7_9BACE/11-269--Q-----------------NG.....E-K----I----------------------------------------SML..
PANB_AQUAE/2-260--R-----------------EG.....K-K----I----------------------------------------TMV..
R7ALC5_9ACTN/29-287--Q-----------------KG.....E-K----I----------------------------------------SML..
U5N9B5_9BURK/27-288--T-----------------RR.....E-A----I----------------------------------------AML..
C6BVH5_DESAD/3-260--K-----------------GQ.....R-K----I----------------------------------------SMV..
C5KFU4_PERM5/79-341--R-----------------EG.....D-K----I----------------------------------------TMM..
U5T1Y9_9GAMM/5-261--T-----------------EQ.....S-P----I----------------------------------------VAI..
F4H271_CELFA/7-264--T-----------------RG.....E-R----L----------------------------------------TML..
F8AZ74_FRADG/51-306--D-----------------RG.....E-K----W----------------------------------------AML..
E4NQR1_HALBP/4-256--A-----------------GT.....T-P----I----------------------------------------TML..
C6VWE8_DYAFD/10-268--N-----------------RG.....E-K----I----------------------------------------TCL..
R5KSN9_9FIRM/2-260--K-----------------DG.....N-K----I----------------------------------------TML..
PANB_NATPD/3-255--A-----------------GD.....E-P----I----------------------------------------TML..
L0IYN2_MYCSM/17-274--A-----------------EG.....H-K----W----------------------------------------AML..
PANB_CLOTH/4-262--K-----------------QG.....R-K----I----------------------------------------TML..
PANB_SPHAL/26-281--.-----------------.G....GE-P----I----------------------------------------VML..
I0A221_FERFK/7-263--E-----------------LK.....E-K----I----------------------------------------VMI..
T2GAB0_DESGI/5-261--G-----------------G......D-P----L----------------------------------------VML..
C6WXZ0_METML/2-266--A-----------------SG.....E-K----I----------------------------------------AML..
F2IID2_FLUTR/9-267--N-----------------SG.....A-K----I----------------------------------------SML..
D5BNG2_PUNMI/9-267--E-----------------KG.....E-P----I----------------------------------------TQL..
PANB_ARTAT/40-297--D-----------------NG.....E-H----F----------------------------------------AML..
PANB_CARHZ/3-261--E-----------------AG.....Q-K----I----------------------------------------AMI..
A4G8C6_HERAR/16-272--A-----------------KG.....E-K----I----------------------------------------TML..
E1QUY6_VULDI/5-260--G-----------------K......Q-R----I----------------------------------------AMI..
PANB_METFK/3-256--E-----------------RG.....E-K----I----------------------------------------AVL..
PANB_CHESB/10-264--.-----------------.G....KA-P----I----------------------------------------VCL..
B6GXN5_PENCW/75-335--K-----------------KG.....E-P----I----------------------------------------TML..
I0GU87_SELRL/2-260--A-----------------NG.....E-K----I----------------------------------------SML..
R9AIM6_WALI9/451-714--K-----------------QH.....M-P----I----------------------------------------TVL..
R5BQ58_9FIRM/5-264--E-----------------QG.....E-P----I----------------------------------------TMI..
F8AC68_THEID/6-263--G-----------------R......E-K----I----------------------------------------CAL..
PANB_ALKEH/12-269--A-----------------DG.....Q-K----V----------------------------------------VAL..
F8E6G1_FLESM/9-265--A-----------------EG.....E-K----I----------------------------------------SCL..
PANB_BORPE/9-264--.-----------------.P....DE-P----I----------------------------------------VAL..
E1VL92_9GAMM/2-258--S-----------------QG.....E-K----F----------------------------------------TCL..
R6CEN3_9FIRM/2-260--Q-----------------SG.....E-K----I----------------------------------------TML..
PANB_LEPBP/4-261--D-----------------AG.....E-P----I----------------------------------------SVV..
D5MI67_9BACT/6-263--R-----------------EG.....R-K----I----------------------------------------TML..
G0EFC1_PYRF1/3-258--G-----------------R......E-P----I----------------------------------------VMV..
PANB_EXIS2/3-258--Q-----------------AG.....E-K----L----------------------------------------VML..
I4BB70_TURPD/157-414--L-----------------AG.....E-K----I----------------------------------------SVV..
PANB_MARHV/2-258--Q-----------------KG.....E-A----F----------------------------------------SAL..
D8J2A6_HALJB/4-255--A-----------------AD.....E-P----I----------------------------------------TML..
PANB_IGNH4/3-259--K-----------------NG.....E-K----I----------------------------------------VMV..
G4RJI6_THETK/5-260--G-----------------R......E-K----I----------------------------------------AML..
K8GUE9_9CYAN/2-256--Q-----------------QG.....R-P----I----------------------------------------AVL..
W6SJ04_9CLOT/2-259--K-----------------RG.....E-K----I----------------------------------------SML..
D9SXD7_CLOC7/2-260--E-----------------RK.....E-K----I----------------------------------------TML..
W5W0X3_9PSEU/35-292--D-----------------RG.....E-P----W----------------------------------------PML..
F7V601_CLOSS/2-260--A-----------------AG.....D-K----I----------------------------------------TMI..
PANB_SYNE7/2-256--Q-----------------QG.....R-P----I----------------------------------------VAL..
I2GYS6_TETBL/22-285--Q-----------------QH.....V-P----I----------------------------------------TMI..
F2N7R6_CORGP/2-260--D-----------------EG.....R-K----L----------------------------------------AML..
PANB_SODGM/2-257--Q-----------------QQ.....R-K----F----------------------------------------TSI..
PANB_MYXXD/4-262--Q-----------------IG.....Q-K----I----------------------------------------CMV..
W0JJ73_DESAE/2-258--S-----------------K......E-K----I----------------------------------------TMI..
PANB_SALRD/3-261--E-----------------EG.....V-P----I----------------------------------------AAL..
H1XSD8_9BACT/9-267--A-----------------QG.....E-P----I----------------------------------------AML..
K4KI34_SIMAS/15-270--A-----------------EG.....E-K----F----------------------------------------VTV..
PANB_PHEZH/11-266--.-----------------.G....GT-P----I----------------------------------------VCL..
C1F8U4_ACIC5/19-277--E-----------------QK.....Q-P----I----------------------------------------VAL..
PANB_BDEBA/2-258--S-----------------KK.....Q-K----I----------------------------------------SMI..
PANB_PSELT/2-257--G-----------------K......K-P----I----------------------------------------VML..
PANB_POLSJ/34-294--A-----------------QG.....E-K----I----------------------------------------TML..
G0A0M7_METMM/10-265--Q-----------------AG.....E-K----I----------------------------------------TSL..
E3E4R6_PAEPS/7-265--Q-----------------EG.....I-P----L----------------------------------------SML..
R7P8R5_9BACT/11-269--E-----------------HG.....K-K----I----------------------------------------AML..
G8QNM1_AZOSU/9-266--A-----------------AG.....E-K----I----------------------------------------AML..
V6JZL1_STRNV/26-283--R-----------------RG.....E-K----W----------------------------------------PML..
F4GUY4_PUSST/9-264--.-----------------.G....QQ-K----I----------------------------------------AAL..
R7C4Y8_9BURK/5-261--A-----------------AG.....E-P----I----------------------------------------AML..
R6EWT4_9BACT/11-269--K-----------------CG.....E-K----I----------------------------------------SWL..
PANB_PSYA2/2-261--K-----------------DG.....T-K----F----------------------------------------TCL..
E6UF09_RUMA7/2-260--Q-----------------SG.....E-K----I----------------------------------------TML..
PANB_PROMM/4-256--Q-----------------DG.....R-A----I----------------------------------------SIL..
F8GE64_NITSI/2-259--E-----------------NN.....E-K----F----------------------------------------TVL..
G8YQ94_PICSO/33-293--R-----------------QR.....K-P----I----------------------------------------SMI..
R6EER5_9BACT/10-268--A-----------------AG.....E-K----V----------------------------------------TMM..
R6MV46_9FIRM/2-260--Q-----------------SG.....E-K----L----------------------------------------TML..
E1ZCJ6_CHLVA/23-287--R-----------------RG.....E-P----I----------------------------------------SMV..
PANB_NITSB/4-255--N-----------------S......N-K----L----------------------------------------VMI..
M4VAT0_9DELT/3-258--K-----------------SG.....E-K----I----------------------------------------TML..
C4XU18_DESMR/3-260--G-----------------V......R-K----I----------------------------------------VML..
J9ZD86_LEPFM/6-263--K-----------------EG.....P-P----L----------------------------------------TMV..
L0K4F1_HALHC/4-262--D-----------------AG.....K-K----I----------------------------------------TML..
E6WZE1_NITSE/11-266--G-----------------V......E-P----V----------------------------------------TMI..
R7IQM6_9FIRM/7-262--K-----------------NG.....E-R----L----------------------------------------AML..
R5JJK8_9FIRM/2-260--G-----------------TE.....N-K----I----------------------------------------SMI..
F8DZN0_CORRG/23-280--A-----------------EG.....K-K----F----------------------------------------AML..
I4D5R2_DESAJ/3-259--N-----------------QR.....K-K----I----------------------------------------VMV..
PANB_LEIXX/16-273--E-----------------EG.....S-R----F----------------------------------------TGL..
E4U2F8_SULKY/3-258--G-----------------A......L-P----L----------------------------------------VMI..
PANB_NITMS/2-259--K-----------------GK.....K-K----V----------------------------------------SVI..
PANB1_PSEAE/9-265--.-----------------.G....AG-S----L----------------------------------------VAL..
G8BMS9_TETPH/44-308--T-----------------LK.....Q-P----I----------------------------------------TMC..
R5V6Z6_9FIRM/2-260--D-----------------KG.....E-K----L----------------------------------------SML..
R5U793_9BACE/11-269--Q-----------------RG.....E-K----I----------------------------------------SML..
F6CMZ4_DESK7/5-263--K-----------------TG.....R-K----I----------------------------------------TML..
B9L8Y5_NAUPA/4-254--.-----------------.......D-K----L----------------------------------------TMI..
PANB_DESPS/2-260--A-----------------AG.....Q-K----I----------------------------------------SML..
L0F2P8_DESDL/3-259--E-----------------QG.....Q-K----I----------------------------------------VMV..
K9Y6F0_HALP7/3-258--Q-----------------QQ.....R-P----I----------------------------------------TVL..
PANB_NITEU/8-264--E-----------------QG.....E-K----I----------------------------------------AVL..
M5C834_THACB/15-272--Q-----------------KG.....T-A----I----------------------------------------TVL..
T2KQ61_9FLAO/10-268--A-----------------HG.....E-K----I----------------------------------------SML..
I1NLG6_ORYGL/83-346--R-----------------RG.....E-P----I----------------------------------------SMV..
E6TZJ1_BACCJ/3-259--K-----------------NG.....D-K----I----------------------------------------TMV..
K0B4S7_CLOA9/4-262--R-----------------NN.....E-K----I----------------------------------------TVL..
R6VBN9_9CLOT/2-260--Q-----------------QG.....R-K----I----------------------------------------SML..
G4QJL3_GLANF/3-259--Q-----------------KG.....E-K----I----------------------------------------AAL..
PANB_RHOBA/10-264--D-----------------RG.....E-R----I----------------------------------------TML..
R5DYA6_9BURK/9-266--E-----------------AG.....E-P----I----------------------------------------VML..
PANB_RHORT/10-268--S-----------------PA....AE-P----V----------------------------------------VCL..
A5DVU0_LODEL/36-294--H-----------------EK.....K-P----I----------------------------------------TMV..
B6JWN4_SCHJY/27-297--E-----------------KG.....E-P----I----------------------------------------ACM..
PANB_CORGL/8-265--V-----------------NG.....Q-K----V----------------------------------------SVL..
PANB_RALSO/12-268--A-----------------AG.....E-R----I----------------------------------------AML..
R6LXN4_9CLOT/2-260--E-----------------KG.....E-K----L----------------------------------------TML..
PANB_MOOTA/6-264--E-----------------RG.....E-R----I----------------------------------------TMV..
F2F6S0_SOLSS/3-258--E-----------------QG.....E-K----I----------------------------------------VMI..
PANB_AZOSB/9-267--A-----------------EG.....R-K----I----------------------------------------AML..
D3SC34_THISK/3-258--Q-----------------AG.....E-P----I----------------------------------------TCL..
D4H852_DENA2/9-265--A-----------------DG.....E-K----I----------------------------------------TSI..
H6L4G9_SAPGL/9-267--Q-----------------RG.....E-K----I----------------------------------------SML..
R6DPQ8_9CLOT/2-260--E-----------------NG.....Q-K----I----------------------------------------TML..
N0B212_9BACI/3-259--E-----------------NN.....E-K----I----------------------------------------VML..
R7K0E3_9CLOT/2-260--Q-----------------DG.....V-K----I----------------------------------------AML..
Q6BIM6_DEBHA/33-293--E-----------------TK.....T-P----I----------------------------------------SVV..
K0KXD0_WICCF/32-290--N-----------------SN.....T-K----I----------------------------------------SVL..
E8RS63_ASTEC/11-266--.-----------------.G....GT-P----L----------------------------------------VSL..
F9X8W4_ZYMTI/67-327--T-----------------RH.....E-P----I----------------------------------------TMI..
A4XA35_SALTO/20-277--E-----------------RG.....E-R----W----------------------------------------AML..
D5U1C4_THEAM/4-259--N-----------------R......E-K----I----------------------------------------AAV..
T0ULG9_9STRE/2-260--K-----------------DG.....Q-K----L----------------------------------------TML..
PANB_ALTMD/3-259--Q-----------------AG.....E-K----I----------------------------------------TSL..
I0ICC5_PHYMF/8-267--R-----------------DR.....R-P----F----------------------------------------AML..
F4PL25_DICFS/108-366--E-----------------SN.....I-P----I----------------------------------------TMV..
G4KQR4_OSCVS/3-261--Q-----------------DG.....E-K----V----------------------------------------SWI..
K9YNE4_CYASC/2-257--Q-----------------EK.....K-P----I----------------------------------------VCL..
PANB_WOLSU/3-258--N-----------------Q......E-K----I----------------------------------------TMI..
E6U5I9_ETHHY/4-262--Q-----------------NR.....R-K----I----------------------------------------AML..
B8BWG2_THAPS/41-307--R-----------------RG.....H-K----I----------------------------------------TMV..
K9SYS3_9SYNE/2-257--S-----------------EG.....R-A----I----------------------------------------AAL..
PANB_AERPE/5-260--G-----------------S......R-P----I----------------------------------------VAV..
R7DES0_9PORP/10-268--Q-----------------RG.....E-K----V----------------------------------------SML..
PANB_BAUCH/4-259--Q-----------------RQ.....Q-K----F----------------------------------------AAI..
I5AYL4_9DELT/4-258--Q-----------------EG.....K-K----I----------------------------------------TAL..
PANB_BACSK/2-259--R-----------------DG.....E-P----I----------------------------------------AML..
R6A0K1_9BACT/11-268--A-----------------EG.....K-K----I----------------------------------------AML..
B2IDS4_BEII9/7-254--R-----------------RG.....E-P----I----------------------------------------AML..
K0C447_CYCSP/9-266--K-----------------RG.....E-K----I----------------------------------------VSL..
PANB_LISMO/5-258--E-----------------NG.....E-K----I----------------------------------------TMI..
PANB_RHILO/16-267--.-----------------.G....GV-P----L----------------------------------------VCL..
K9VPY0_9CYAN/2-258--Q-----------------QQ.....R-P----I----------------------------------------VAL..
C0ZCH0_BREBN/7-265--E-----------------TR.....T-P----I----------------------------------------TMV..
A7TTC6_VANPO/36-301--L-----------------AC.....E-P----L----------------------------------------SMC..
M4ZY73_9ACTN/20-278--E-----------------NG.....I-K----I----------------------------------------TGL..
D2U9Y6_XANAP/10-266--R-----------------RQ.....Q-K----L----------------------------------------VML..
PANB_BACLD/3-259--Q-----------------EG.....E-P----I----------------------------------------VML..
K9ZZ09_DEIPD/3-257--.-----------------.......D-K----L----------------------------------------VMV..
E8T692_THEA1/2-260--R-----------------KG.....E-K----I----------------------------------------TVL..
D3UG21_HELM1/2-256--N-----------------Q......E-K----I----------------------------------------TAI..
R5FZT9_9PORP/11-269--G-----------------EG.....D-K----I----------------------------------------AML..
E0SBL5_DICD3/3-259--Q-----------------EQ.....K-K----F----------------------------------------ATL..
PANB_HALSA/12-261--E-----------------ET.....D-P----V----------------------------------------TML..
PANB_CAMJE/4-258--A-----------------KN.....E-K----I----------------------------------------TMV..
C5CWU9_VARPS/32-292--A-----------------RG.....E-K----I----------------------------------------SML..
Q0UNM3_PHANO/57-317--R-----------------KN.....E-P----I----------------------------------------TMI..
PANB_SULAC/5-259--.-----------------GK.....E-K----I----------------------------------------TML..
M4NHU9_9GAMM/13-271--T-----------------QG.....R-R----I----------------------------------------VML..
C5C4X5_BEUC1/14-271--E-----------------RG.....E-R----L----------------------------------------TML..
E2SAV3_9ACTN/24-281--A-----------------DG.....E-K----W----------------------------------------AML..
I2F2C6_9BACT/2-256--G-----------------Q......S-K----L----------------------------------------SVI..
PANB_DECAR/9-266--Q-----------------AG.....E-K----I----------------------------------------AQF..
W1Q8C1_OGAPD/26-284--K-----------------AK.....E-P----L----------------------------------------AVI..
PANB_KOSOT/2-256--G-----------------K......R-K----L----------------------------------------SMV..
PANB2_BRADU/11-267--D-----------------KG.....R-R----V----------------------------------------VMT..
R7NSE5_9FIRM/2-259--A-----------------NG.....E-K----I----------------------------------------SML..
A8DWD1_NEMVE/4-260--Q-----------------SG.....E-K----I----------------------------------------AML..
D9SIJ1_GALCS/2-259--S-----------------RS.....E-K----I----------------------------------------AVL..
PANB2_VIBF1/3-259--E-----------------VG.....E-K----F----------------------------------------ASI..
C4Y7C6_CLAL4/28-286--A-----------------EN.....T-P----I----------------------------------------SVA..
E0UPX6_SULAO/4-259--G-----------------V......R-P----L----------------------------------------VMI..
C0QS02_PERMH/2-258--E-----------------EG.....K-K----I----------------------------------------TMI..
PANB_PELUB/4-253--N-----------------K......T-K----I----------------------------------------ISL..
F2LWA6_HIPMA/2-259--D-----------------K......E-K----I----------------------------------------SMI..
PANB_THICR/2-256--Q-----------------AG.....E-K----I----------------------------------------VCL..
M5DV17_9GAMM/4-263--E-----------------QQ.....Q-K----F----------------------------------------AVL..
X2HEZ8_9NEIS/2-257--A-----------------AG.....E-K----I----------------------------------------AML..
I1YKY2_METFJ/3-261--A-----------------AH.....D-K----I----------------------------------------AVL..
D2NU30_ROTMD/61-319--A-----------------TG.....Q-K----F----------------------------------------SML..
R5SB00_9GAMM/3-259--E-----------------NN.....E-K----I----------------------------------------AML..
E1VAR3_HALED/19-275--R-----------------AG.....E-A----F----------------------------------------SCL..
D3SNL0_THEAH/2-259--E-----------------EG.....R-K----I----------------------------------------TMV..
U3U9E1_9ENTR/4-259--S-----------------DG.....C-K----F----------------------------------------AAL..
PANB_CLOAB/2-260--F-----------------KK.....E-K----L----------------------------------------VML..
B7GHT0_ANOFW/22-277--K-----------------NH.....E-P----I----------------------------------------VML..
B8EK33_METSB/5-251--R-----------------RG.....E-P----I----------------------------------------AVL..
C8X1K5_DESRD/4-262--T-----------------GG.....E-K----L----------------------------------------AMA..
G4T0T2_META2/12-267--Q-----------------RG.....E-K----I----------------------------------------SCL..
PANB_ANAMF/4-256--G-----------------L......E-K----I----------------------------------------ACL..
I4YBJ3_WALSC/10-273--R-----------------QN.....H-P----I----------------------------------------TVL..
F0S4V2_PSESL/9-267--Q-----------------KG.....E-R----I----------------------------------------AML..
E6SCG6_INTC7/25-282--T-----------------EG.....R-R----W----------------------------------------AML..
PANB_CORJK/21-279--G-----------------TG.....E-P----F----------------------------------------AML..
F4PBH9_BATDJ/27-283--N-----------------TK.....T-P----I----------------------------------------TVM..
PANB_CYAP4/3-259--R-----------------SG.....R-A----I----------------------------------------AVL..
U5QGT4_9CYAN/2-258--E-----------------RA.....Q-P----I----------------------------------------VAL..
E7A9J8_HELFC/3-264--H-----------------PKEGASPC-K----I----------------------------------------SAI..
PANB_ROSDO/14-264--.-----------------.G....GE-P----I----------------------------------------VSL..
I0H0N1_ACTM4/15-272--A-----------------RG.....D-R----W----------------------------------------PML..
M2PBF7_CERS8/43-302--R-----------------SG.....T-P----I----------------------------------------TML..
V4KY10_9DELT/4-261--D-----------------EG.....R-K----V----------------------------------------VWV..
D4MUX9_9FIRM/2-260--D-----------------NG.....E-K----I----------------------------------------TML..
K4II33_PSYTT/10-268--A-----------------NA.....E-K----I----------------------------------------SML..
G2TM93_BACCO/3-259--A-----------------QE.....E-K----I----------------------------------------AMV..
PANB_NOCFA/22-279--A-----------------DG.....E-R----W----------------------------------------AML..
PANB_STRMK/10-265--R-----------------NG.....Q-K----L----------------------------------------VML..
R6Q9M5_9FIRM/3-261--A-----------------KG.....E-K----I----------------------------------------SML..
PANB_GEOLS/4-261--Q-----------------EG.....R-K----V----------------------------------------TVL..
PANB_STACT/3-256--K-----------------NS.....E-K----I----------------------------------------TMV..
D3IAK5_9BACT/11-269--K-----------------QG.....E-K----I----------------------------------------TML..
E3RMD4_PYRTT/56-316--R-----------------KG.....E-P----I----------------------------------------TMI..
F8C4E6_THEGP/11-262--G-----------------K......E-P----I----------------------------------------VAI..
PANB_RHOCS/9-265--.-----------------.G....RE-P----V----------------------------------------AVL..
G8LWQ2_CLOCD/4-262--R-----------------TG.....R-K----I----------------------------------------TML..
Q6CLY9_KLULA/32-295--H-----------------RR.....N-P----I----------------------------------------SMV..
PANB_SYNR3/10-261--Q-----------------RR.....Q-P----I----------------------------------------AVL..
R5J4T6_9FIRM/2-260--K-----------------NK.....D-K----L----------------------------------------TML..
R5CPJ0_9BACT/11-269--Q-----------------RG.....E-K----I----------------------------------------SML..
PANB2_ZYMMO/10-265--.-----------------.G....KS-P----I----------------------------------------VAL..
PANB_UNCTG/3-261--Q-----------------SG.....E-K----I----------------------------------------TML..
A9SWR9_PHYPA/44-307--Q-----------------TN.....Q-P----I----------------------------------------TMV..
PANB_PSYWF/2-265--K-----------------EG.....R-K----F----------------------------------------SCL..
E1VXC6_ARTAR/15-272--D-----------------NG.....E-K----F----------------------------------------AML..
F2J6X3_POLGS/33-294--A-----------------QG.....E-R----F----------------------------------------AVL..
PANB_GEOSW/3-259--Q-----------------EN.....E-P----I----------------------------------------VML..
D3PCJ6_DEFDS/9-265--K-----------------DG.....E-K----I----------------------------------------ACL..
F5XK06_MICPN/12-270--Q-----------------RH.....E-R----W----------------------------------------AML..
R5PEY0_9BACT/11-269--Q-----------------AG.....E-K----I----------------------------------------AML..
D1BFU9_SANKS/24-281--E-----------------AG.....R-K----I----------------------------------------TML..
I3VRB5_THESW/4-262--K-----------------DG.....I-K----I----------------------------------------TAL..
PANB_AGRVS/9-265--.-----------------.H....QR-P----I----------------------------------------VSL..
PANB_XYLFA/10-265--R-----------------NG.....S-K----I----------------------------------------VML..
M4SFZ5_9SPHN/23-277--.-----------------.G....KE-P----I----------------------------------------VML..
G0RQ21_HYPJQ/11-271--Q-----------------KG.....E-P----I----------------------------------------AMI..
R7FC11_9FIRM/2-261--Q-----------------RG.....E-K----I----------------------------------------TML..
C1MW11_MICPC/19-288--R-----------------RG.....E-R----I----------------------------------------TMV..
W5XWQ3_9CORY/8-265--A-----------------AG.....S-P----I----------------------------------------SAL..
L0EU60_LIBCB/3-258--K-----------------CN.....T-K----F----------------------------------------AII..
L0E1F4_THIND/2-256--R-----------------EG.....R-P----I----------------------------------------TCL..
K9Z7J6_CYAAP/2-257--G-----------------EK.....R-P----I----------------------------------------VSL..
I4A0H9_ORNRL/9-266--G-----------------KG......-K----I----------------------------------------AML..
A5HYW9_CLOBH/2-260--N-----------------KG.....E-K----I----------------------------------------TML..
I3U7Q6_ADVKW/24-279--.-----------------.N....QK-K----I----------------------------------------VSL..
PANB1_PSEF5/9-264--.-----------------.G....RQ-K----I----------------------------------------VSL..
E8UZX7_TERSS/17-275--R-----------------RQ.....T-P----I----------------------------------------TAL..
PANB_CHLTE/11-273--E-----------------RG.....E-K----I----------------------------------------AML..
F4CPV3_PSEUX/31-288--Q-----------------RG.....E-R----W----------------------------------------PML..
PANB_MARMM/13-268--.-----------------.G....GE-P----L----------------------------------------VCL..
K9WEF5_9CYAN/2-259--Q-----------------QG.....R-P----I----------------------------------------VVL..
K9SKS8_9CYAN/2-258--E-----------------RG.....Q-P----I----------------------------------------TAL..
R4VYJ3_9EURY/3-265--E-----------------SG.....E-P----I----------------------------------------TML..
K5WY16_AGABU/47-306--S-----------------SK.....T-P----I----------------------------------------SMI..
A8NR68_COPC7/47-306--K-----------------AN.....K-P----I----------------------------------------TMV..
S5SZ30_9CORY/8-265--A-----------------EG.....R-R----I----------------------------------------SAL..
E3H7X2_ILYPC/2-260--E-----------------KG.....K-K----L----------------------------------------SVV..