Sequence alignment for CL0151

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTN/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTN/7-239--------------------------------------------------------------------------------
B6HSS2_PENRW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
D4GMW6_PANAM/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_RUBBR/3-257--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_PARRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_9MYCO/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENRW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARHV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_PSELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_DECSP/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_ZYMTI/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTN/24-281--------------------------------------------------------------------------------
I2F2C6_9BACT/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9GAMM/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALMC/10-273--------------------------------------------------------------------------------
F0S4V2_PSESL/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_ANAHA/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_GLUAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCB/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICCC/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_CUPMC/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
A0A0D2VT44_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9BACT/9-267--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_PSEFD/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_SINFN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTN/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_PARP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_GRATM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_SERID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
A0A068NY03_9BACT/4-257--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENRW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CYAN/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGMM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
C4R687_KOMPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_HOYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_PARP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOJR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_SINFN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METRA/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_ZYMTI/9-275--------------------------------------------------------------------------------
N1PYG8_DOTSN/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_9ACTN/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF15617

H9TH48_SALET/4-300--------RL----------------------------------------------------------------------
A0A0H3CW75_ENTCC/4-300--------RL----------------------------------------------------------------------
A0A023YVC9_ECOLX/4-300--------RL----------------------------------------------------------------------
A7MPV2_CROS8/4-300--------RL----------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------QP----------------------------------------------------------------------
D0KLU5_PECWW/4-299--------RL----------------------------------------------------------------------
B4EW80_PROMH/4-300--------RL----------------------------------------------------------------------
D3V2D7_XENBS/4-302--------IP----------------------------------------------------------------------
Q7CKQ7_YERPE/4-300--------TP----------------------------------------------------------------------
E1PL56_PANVC/4-300--------NI----------------------------------------------------------------------
D3VJW5_XENNA/4-307--------IP----------------------------------------------------------------------
Q888S8_PSESM/3-297--------LF----------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------LF----------------------------------------------------------------------
F3K7E7_PSEAJ/3-297--------LF----------------------------------------------------------------------
Q39AX0_BURL3/4-298--------TI----------------------------------------------------------------------
Q6FAX8_ACIAD/1-291--------ML----------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------PL----------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------MH----------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------MR----------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------ML----------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------MH----------------------------------------------------------------------
Q3JCD2_NITOC/22-310--------IP----------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------MA----------------------------------------------------------------------
Q2RVZ6_RHORT/5-292--------IS----------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------PL----------------------------------------------------------------------
D5BYR3_NITHN/21-309--------IP----------------------------------------------------------------------
D8K7I6_NITWC/22-310--------IP----------------------------------------------------------------------
E8U9R3_DEIML/2-291--------LN----------------------------------------------------------------------
A8MM95_ALKOO/30-358--------DK----------------------------------------------------------------------
Q891X5_CLOTE/30-379--------TY----------------------------------------------------------------------
A8F9P5_BACP2/30-369--------HV----------------------------------------------------------------------
C9RML9_FIBSS/26-364--------SL----------------------------------------------------------------------
E3IYR0_FRASU/30-378--------RL----------------------------------------------------------------------
Q9KY27_STRCO/30-371--------RL----------------------------------------------------------------------
A0A080UMD5_BACIU/30-361--------KL----------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------EL----------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------DI----------------------------------------------------------------------
F2JGK5_CELLD/30-375--------EK----------------------------------------------------------------------
Q65NP8_BACLD/30-368--------RI----------------------------------------------------------------------
D1BEK0_SANKS/30-368--------GM----------------------------------------------------------------------
D1A9P4_THECD/30-368--------AL----------------------------------------------------------------------
C9ZE12_STRSW/30-371--------RI----------------------------------------------------------------------
F4H5N5_CELFA/32-371--------AL----------------------------------------------------------------------
B7HBK1_BACC4/30-348--------EQ----------------------------------------------------------------------
A0A0B5R5V5_BACTU/30-348--------EQ----------------------------------------------------------------------
C8W644_DESAS/30-371--------KT----------------------------------------------------------------------
Q82B97_STRAW/30-370--------RV----------------------------------------------------------------------
Q0SDY5_RHOJR/44-383--------TV----------------------------------------------------------------------
Q72YD0_BACC1/30-348--------EQ----------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------TV----------------------------------------------------------------------
A4J1D5_DESRM/16-360--------DT----------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------DL----------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------EV----------------------------------------------------------------------
Q186J7_PEPD6/30-345--------DV----------------------------------------------------------------------
E3EE66_PAEPS/10-368--------SI----------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------EL----------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------EL----------------------------------------------------------------------
D0L8D1_GORB4/35-372--------TQ----------------------------------------------------------------------
B1VYI2_STRGG/30-395--------RM----------------------------------------------------------------------
C9YLT5_PEPDR/30-345--------DV----------------------------------------------------------------------
F4EXE4_SELS3/15-331--------EI----------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------SV----------------------------------------------------------------------
A8L403_FRASN/30-378--------RL----------------------------------------------------------------------
A6WD82_KINRD/30-375--------DE----------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------RL----------------------------------------------------------------------
A2RKY2_LACLM/29-388--------EM----------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------HL----------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------NQ----------------------------------------------------------------------

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOJR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947PALSGDLGTF----------------------------------------------------------------------
PT1_STACT/251-543KQELQKLRDA----------------------------------------------------------------------
PT1_CUPNH/262-557KKRLQRLRHT----------------------------------------------------------------------
PT1_ECOLI/250-542KAELAKLKDL----------------------------------------------------------------------
PT1_HAEIN/250-542KAELAKLKDL----------------------------------------------------------------------
PT1P_ECOLI/416-708SRLAEDDVNL----------------------------------------------------------------------
PPSA_PYRFU/496-796KAEGGQVVVA----------------------------------------------------------------------
PTFAX_XANCP/521-808REREAAQRAL----------------------------------------------------------------------
PT1_STRMU/252-546KAEWALLKDA----------------------------------------------------------------------
PTFX2_ECOLI/362-654REQQRVWLTQ----------------------------------------------------------------------
PPSA_STAMF/504-813VAGVGISPEQ----------------------------------------------------------------------
D5AMJ7_RHOCB/521-803...EARERYK----------------------------------------------------------------------
Q24801_ENTHI/517-878..GSGYFGTI----------------------------------------------------------------------
Q5L199_GEOKA/251-541KAEWAKLVDQ----------------------------------------------------------------------
Q6MTX2_MYCMS/252-540.DQLKKFKDK----------------------------------------------------------------------

PF01274

MASY_EMENI/11-531VAILGSVSNEARKILTKEACAFLAILHRTFNPTRKALLQRRVDRQAEIDKGH.LP..........DFL.PETKHIRDDPS
MASZ_CORGL/35-713YDFVTEAVLPRVGVDAEKFWSGFAAIARDLTPRNRELLARRDELQMLIDDYHRNNSGTIDQEAYEDFL.KEIGYLVEEPE
MASY_MYXXD/17-538VVVKGTWHPDYAEVLTPEALEFVAKLARNFGERRLALLERRKTVQAAWSKGA.RP..........HFL.PETKAVR.EGD
MASZ_ECOLI/17-697KRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPE
Q9RYN3_DEIRA/10-521MTINAPIKPEYAEILTPEALAFVAELHRRFEPRRRELMQKREERQQRLDAGE.LP..........DFL.PETAEIR.AGD
MASY_MAIZE/16-548VDVRGRYDREFAGILTRDALDFVAGLQREFRGAVRYAMEQRREAQRRYDAGE.LP..........RFD.PATTLVR.EGD
MASY_ECOLI/11-533LAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDNGT.LP..........DFI.SETASIR.DAD
MASZ_MYCLE/17-704YDFVNNEALPGTDINPNSFWSGVAKVVADLTPQNQSLLNSRDELQAQIDKWHRHRVIEPFDVDAYRQFLIDIGYLLPEPD
MASY_YEAST/18-542EPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQVVQKKLDSGS.YH.........LDFL.PETANIRNDPT
B5GRN8_STRC2/12-539..VTAPAVPRQDEVLTEAALVFLAELHRRFTPRRDELLARRARRRAEISRTG.TL..........DFL.PETAHVRADDS
C5MBE7_CANTT/16-539.QILGPIPDDAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQKLRDQGF.LP..........DFL.PETEYIRNDPT
M4EJ48_BRARP/22-551.EVRGRYDQVFAKILTRDALGFVAELQREFRGHVRYAMECRREAKRRYNSGA.VP..........GFD.PSTKFIR.DGE
W1QBI0_OGAPD/27-543........ATPRDILTKDALKFIVLLHRSFNETRKQLLENRQKVQERLDAGE.SL..........HFL.EETKYIREDPN

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------------------------
CAPP_ACTP2/128-879--------------------------------------------------------------------------------
A0ZJ69_NODSP/196-1034--------------------------------------------------------------------------------
D3VH32_XENNA/127-879--------------------------------------------------------------------------------
Q2KZS8_BORA1/137-936--------------------------------------------------------------------------------
D2QW47_PIRSD/157-942--------------------------------------------------------------------------------
A5GVT4_SYNR3/167-992--------------------------------------------------------------------------------
C6D470_PAESJ/147-936--------------------------------------------------------------------------------
B8HVC9_CYAP4/199-1018--------------------------------------------------------------------------------
C1F4Y2_ACIC5/161-947--------------------------------------------------------------------------------
CAPP_SYNY3/193-1034--------------------------------------------------------------------------------
B1XMB9_SYNP2/163-995--------------------------------------------------------------------------------
A4S610_OSTLU/183-1007--------------------------------------------------------------------------------
A9RUR8_PHYPA/162-969--------------------------------------------------------------------------------
B8GNA5_THISH/143-947--------------------------------------------------------------------------------
CAPP_HAHCH/132-881--------------------------------------------------------------------------------
B1Y159_LEPCP/163-950--------------------------------------------------------------------------------
CAPP_THEEB/197-1011--------------------------------------------------------------------------------
A9S2G6_PHYPA/161-965--------------------------------------------------------------------------------
Q54JZ3_DICDI/144-931--------------------------------------------------------------------------------
C1MJ77_MICPC/164-991--------------------------------------------------------------------------------
E0UJ33_CYAP2/184-1020--------------------------------------------------------------------------------
A5WCX5_PSYWF/133-932--------------------------------------------------------------------------------
A0JSJ3_ARTS2/161-954--------------------------------------------------------------------------------
B7G725_PHATC/84-877--------------------------------------------------------------------------------
CAPP_GLOVI/141-939--------------------------------------------------------------------------------
D1CE74_THET1/138-931--------------------------------------------------------------------------------
Q117S5_TRIEI/186-1038--------------------------------------------------------------------------------
C1AE63_GEMAT/147-933--------------------------------------------------------------------------------
A9QPD2_METI4/151-931--------------------------------------------------------------------------------
B0BZ90_ACAM1/184-1012--------------------------------------------------------------------------------
A4X3B0_SALTO/171-972--------------------------------------------------------------------------------
E3JCU0_FRASU/173-968--------------------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------------------------
A9IDM8_BORPD/139-951--------------------------------------------------------------------------------
A4G3V1_HERAR/147-944--------------------------------------------------------------------------------
C1DZM5_MICCC/162-982--------------------------------------------------------------------------------
D3EKG0_GEOS4/142-928--------------------------------------------------------------------------------
B1VUI2_STRGG/125-909--------------------------------------------------------------------------------
CAPP_SYNPW/180-1003--------------------------------------------------------------------------------
B0JPY0_MICAN/183-1018--------------------------------------------------------------------------------
B1WNZ1_CYAA5/187-1020--------------------------------------------------------------------------------
C8WQK0_ALIAD/133-906--------------------------------------------------------------------------------
D4ZQG2_ARTPN/196-1035--------------------------------------------------------------------------------
M1FKU6_9ALTE/130-889--------------------------------------------------------------------------------
CAPP_ECOLI/129-883--------------------------------------------------------------------------------
CAPP_HAEIN/129-879--------------------------------------------------------------------------------
Q0K7M4_CUPNH/207-1012--------------------------------------------------------------------------------
Q31KY7_SYNE7/201-1017--------------------------------------------------------------------------------
Q46IP1_PROMT/168-994--------------------------------------------------------------------------------
CAPP_PROMP/165-989--------------------------------------------------------------------------------
CAPP_VIBPA/129-877--------------------------------------------------------------------------------
CAPP_SHEON/129-881--------------------------------------------------------------------------------
U5GXD4_POPTR/166-968--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTN/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTN/7-239--------------------------------------------------------------------------------
B6HSS2_PENRW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
D4GMW6_PANAM/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_RUBBR/3-257--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_PARRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_9MYCO/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENRW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARHV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_PSELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_DECSP/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_ZYMTI/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTN/24-281--------------------------------------------------------------------------------
I2F2C6_9BACT/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9GAMM/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALMC/10-273--------------------------------------------------------------------------------
F0S4V2_PSESL/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_ANAHA/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_GLUAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCB/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICCC/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_CUPMC/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
A0A0D2VT44_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9BACT/9-267--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_PSEFD/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_SINFN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTN/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_PARP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_GRATM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_SERID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
A0A068NY03_9BACT/4-257--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENRW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CYAN/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGMM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
C4R687_KOMPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_HOYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_PARP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOJR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_SINFN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METRA/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_ZYMTI/9-275--------------------------------------------------------------------------------
N1PYG8_DOTSN/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_9ACTN/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF15617

H9TH48_SALET/4-300--------------------------------------------------------------------------------
A0A0H3CW75_ENTCC/4-300--------------------------------------------------------------------------------
A0A023YVC9_ECOLX/4-300--------------------------------------------------------------------------------
A7MPV2_CROS8/4-300--------------------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------------------------------------------------------------------------------
D0KLU5_PECWW/4-299--------------------------------------------------------------------------------
B4EW80_PROMH/4-300--------------------------------------------------------------------------------
D3V2D7_XENBS/4-302--------------------------------------------------------------------------------
Q7CKQ7_YERPE/4-300--------------------------------------------------------------------------------
E1PL56_PANVC/4-300--------------------------------------------------------------------------------
D3VJW5_XENNA/4-307--------------------------------------------------------------------------------
Q888S8_PSESM/3-297--------------------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------------------------------------------------------------------------------
F3K7E7_PSEAJ/3-297--------------------------------------------------------------------------------
Q39AX0_BURL3/4-298--------------------------------------------------------------------------------
Q6FAX8_ACIAD/1-291--------------------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------------------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------------------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------------------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------------------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------------------------------------------------------------------------------
Q3JCD2_NITOC/22-310--------------------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------------------------------------------------------------------------------
Q2RVZ6_RHORT/5-292--------------------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------------------------------------------------------------------------------
D5BYR3_NITHN/21-309--------------------------------------------------------------------------------
D8K7I6_NITWC/22-310--------------------------------------------------------------------------------
E8U9R3_DEIML/2-291--------------------------------------------------------------------------------
A8MM95_ALKOO/30-358--------------------------------------------------------------------------------
Q891X5_CLOTE/30-379--------------------------------------------------------------------------------
A8F9P5_BACP2/30-369--------------------------------------------------------------------------------
C9RML9_FIBSS/26-364--------------------------------------------------------------------------------
E3IYR0_FRASU/30-378--------------------------------------------------------------------------------
Q9KY27_STRCO/30-371--------------------------------------------------------------------------------
A0A080UMD5_BACIU/30-361--------------------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------------------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------------------------------------------------------------------------------
F2JGK5_CELLD/30-375--------------------------------------------------------------------------------
Q65NP8_BACLD/30-368--------------------------------------------------------------------------------
D1BEK0_SANKS/30-368--------------------------------------------------------------------------------
D1A9P4_THECD/30-368--------------------------------------------------------------------------------
C9ZE12_STRSW/30-371--------------------------------------------------------------------------------
F4H5N5_CELFA/32-371--------------------------------------------------------------------------------
B7HBK1_BACC4/30-348--------------------------------------------------------------------------------
A0A0B5R5V5_BACTU/30-348--------------------------------------------------------------------------------
C8W644_DESAS/30-371--------------------------------------------------------------------------------
Q82B97_STRAW/30-370--------------------------------------------------------------------------------
Q0SDY5_RHOJR/44-383--------------------------------------------------------------------------------
Q72YD0_BACC1/30-348--------------------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------------------------------------------------------------------------------
A4J1D5_DESRM/16-360--------------------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------------------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------------------------------------------------------------------------------
Q186J7_PEPD6/30-345--------------------------------------------------------------------------------
E3EE66_PAEPS/10-368--------------------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------------------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------------------------------------------------------------------------------
D0L8D1_GORB4/35-372--------------------------------------------------------------------------------
B1VYI2_STRGG/30-395--------------------------------------------------------------------------------
C9YLT5_PEPDR/30-345--------------------------------------------------------------------------------
F4EXE4_SELS3/15-331--------------------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------------------------------------------------------------------------------
A8L403_FRASN/30-378--------------------------------------------------------------------------------
A6WD82_KINRD/30-375--------------------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------------------------------------------------------------------------------
A2RKY2_LACLM/29-388--------------------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------------------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------------------------------------------------------------------------------

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOJR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------------------------
PT1_STACT/251-543--------------------------------------------------------------------------------
PT1_CUPNH/262-557--------------------------------------------------------------------------------
PT1_ECOLI/250-542--------------------------------------------------------------------------------
PT1_HAEIN/250-542--------------------------------------------------------------------------------
PT1P_ECOLI/416-708--------------------------------------------------------------------------------
PPSA_PYRFU/496-796--------------------------------------------------------------------------------
PTFAX_XANCP/521-808--------------------------------------------------------------------------------
PT1_STRMU/252-546--------------------------------------------------------------------------------
PTFX2_ECOLI/362-654--------------------------------------------------------------------------------
PPSA_STAMF/504-813--------------------------------------------------------------------------------
D5AMJ7_RHOCB/521-803--------------------------------------------------------------------------------
Q24801_ENTHI/517-878--------------------------------------------------------------------------------
Q5L199_GEOKA/251-541--------------------------------------------------------------------------------
Q6MTX2_MYCMS/252-540--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531WKG.AP..........................................................................
MASZ_CORGL/35-713AAEIRTQNVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEKGKEYNPVRGQKVI.EWGREF
MASY_MYXXD/17-538WTV.AP..........................................................................
MASZ_ECOLI/17-697RVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIA..WVRRFL
Q9RYN3_DEIRA/10-521WKI.SP..........................................................................
MASY_MAIZE/16-548WTC.AS..........................................................................
MASY_ECOLI/11-533WKI.RG..........................................................................
MASZ_MYCLE/17-704DFTISTSGVDDEITMTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDTIPETEGAEKGSEYNKIRGDKVIAYARKFM
MASY_YEAST/18-542WQG.PI..........................................................................
B5GRN8_STRC2/12-539WRV.AP..........................................................................
C5MBE7_CANTT/16-539WTG.PA..........................................................................
M4EJ48_BRARP/22-551WVC.AS..........................................................................
W1QBI0_OGAPD/27-543WKC.LP..........................................................................

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------------------------
CAPP_ACTP2/128-879--------------------------------------------------------------------------------
A0ZJ69_NODSP/196-1034--------------------------------------------------------------------------------
D3VH32_XENNA/127-879--------------------------------------------------------------------------------
Q2KZS8_BORA1/137-936--------------------------------------------------------------------------------
D2QW47_PIRSD/157-942--------------------------------------------------------------------------------
A5GVT4_SYNR3/167-992--------------------------------------------------------------------------------
C6D470_PAESJ/147-936--------------------------------------------------------------------------------
B8HVC9_CYAP4/199-1018--------------------------------------------------------------------------------
C1F4Y2_ACIC5/161-947--------------------------------------------------------------------------------
CAPP_SYNY3/193-1034--------------------------------------------------------------------------------
B1XMB9_SYNP2/163-995--------------------------------------------------------------------------------
A4S610_OSTLU/183-1007--------------------------------------------------------------------------------
A9RUR8_PHYPA/162-969--------------------------------------------------------------------------------
B8GNA5_THISH/143-947--------------------------------------------------------------------------------
CAPP_HAHCH/132-881--------------------------------------------------------------------------------
B1Y159_LEPCP/163-950--------------------------------------------------------------------------------
CAPP_THEEB/197-1011--------------------------------------------------------------------------------
A9S2G6_PHYPA/161-965--------------------------------------------------------------------------------
Q54JZ3_DICDI/144-931--------------------------------------------------------------------------------
C1MJ77_MICPC/164-991--------------------------------------------------------------------------------
E0UJ33_CYAP2/184-1020--------------------------------------------------------------------------------
A5WCX5_PSYWF/133-932--------------------------------------------------------------------------------
A0JSJ3_ARTS2/161-954--------------------------------------------------------------------------------
B7G725_PHATC/84-877--------------------------------------------------------------------------------
CAPP_GLOVI/141-939--------------------------------------------------------------------------------
D1CE74_THET1/138-931--------------------------------------------------------------------------------
Q117S5_TRIEI/186-1038--------------------------------------------------------------------------------
C1AE63_GEMAT/147-933--------------------------------------------------------------------------------
A9QPD2_METI4/151-931--------------------------------------------------------------------------------
B0BZ90_ACAM1/184-1012--------------------------------------------------------------------------------
A4X3B0_SALTO/171-972--------------------------------------------------------------------------------
E3JCU0_FRASU/173-968--------------------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------------------------
A9IDM8_BORPD/139-951--------------------------------------------------------------------------------
A4G3V1_HERAR/147-944--------------------------------------------------------------------------------
C1DZM5_MICCC/162-982--------------------------------------------------------------------------------
D3EKG0_GEOS4/142-928--------------------------------------------------------------------------------
B1VUI2_STRGG/125-909--------------------------------------------------------------------------------
CAPP_SYNPW/180-1003--------------------------------------------------------------------------------
B0JPY0_MICAN/183-1018--------------------------------------------------------------------------------
B1WNZ1_CYAA5/187-1020--------------------------------------------------------------------------------
C8WQK0_ALIAD/133-906--------------------------------------------------------------------------------
D4ZQG2_ARTPN/196-1035--------------------------------------------------------------------------------
M1FKU6_9ALTE/130-889--------------------------------------------------------------------------------
CAPP_ECOLI/129-883--------------------------------------------------------------------------------
CAPP_HAEIN/129-879--------------------------------------------------------------------------------
Q0K7M4_CUPNH/207-1012--------------------------------------------------------------------------------
Q31KY7_SYNE7/201-1017--------------------------------------------------------------------------------
Q46IP1_PROMT/168-994--------------------------------------------------------------------------------
CAPP_PROMP/165-989--------------------------------------------------------------------------------
CAPP_VIBPA/129-877--------------------------------------------------------------------------------
CAPP_SHEON/129-881--------------------------------------------------------------------------------
U5GXD4_POPTR/166-968--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536------------------------------------------------------------------EVAAVKNWW-----
ACEA_YEAST/22-550------------------------------------------------------------------DAAEIEKWW-----
ACEA1_SOYBN/3-534------------------------------------------------------------------EVAEVQAWW-----
ACEA_YARLI/10-536------------------------------------------------------------------EVEEIKKWW-----
ACEA_NEUCR/23-547------------------------------------------------------------------EVEEVKKWW-----
C5MF59_CANTT/18-543------------------------------------------------------------------EVAEIKKWW-----

PF13714

A0JTC7_ARTS2/12-246----------------------------------------------------------------------LLR.L-----
A0K276_ARTS2/27-270----------------------------------------------------------------------FHA.L-----
A0QPJ7_MYCS2/16-251----------------------------------------------------------------------LLA.L-----
A0R0I0_MYCS2/10-256----------------------------------------------------------------------FAERL-----
A1CA54_ASPCL/14-274----------------------------------------------------------------------LCR.L-----
A1SIA9_NOCSJ/3-233----------------------------------------------------------------------FRA.L-----
A4F7M3_SACEN/8-232----------------------------------------------------------------------FRA.L-----
A4FH54_SACEN/26-273----------------------------------------------------------------------LRD.L-----
A4X5C0_SALTO/32-264----------------------------------------------------------------------FRS.L-----
A4X7L5_SALTO/4-223----------------------------------------------------------------------FAA.L-----
A4XS21_PSEMY/12-254----------------------------------------------------------------------FQA.L-----
A4YVZ4_BRASO/12-249----------------------------------------------------------------------FRK.L-----
A5G4A7_GEOUR/12-254----------------------------------------------------------------------FLR.L-----
A5V3Q4_SPHWW/10-252----------------------------------------------------------------------FSK.L-----
A9WM41_RENSM/9-245----------------------------------------------------------------------FRS.L-----
B1VSN1_STRGG/14-249----------------------------------------------------------------------LKH.L-----
B4RBF1_PHEZH/10-242----------------------------------------------------------------------FRK.L-----
B5HHA0_STRPR/15-253----------------------------------------------------------------------LRE.L-----
B5HRK0_9ACTN/12-259----------------------------------------------------------------------FAE.L-----
B5HVC7_9ACTN/7-239----------------------------------------------------------------------FRA.L-----
B6HSS2_PENRW/11-259----------------------------------------------------------------------FRA.L-----
B8MDA8_TALSN/5-285----------------------------------------------------------------------IKSVL-----
B9JNZ3_AGRRK/15-273----------------------------------------------------------------------LRALL-----
B9K4D9_AGRVS/8-247----------------------------------------------------------------------FRQ.L-----
C1D0L9_DEIDV/16-251----------------------------------------------------------------------LLD.L-----
D5UDN5_CELFN/12-253----------------------------------------------------------------------LRS.F-----
C5C673_BEUC1/6-244----------------------------------------------------------------------FRR.R-----
C5K5X0_PERM5/22-289----------------------------------------------------------------------LRQLI-----
D9SPL5_CLOC7/7-255----------------------------------------------------------------------LKKLL-----
C6W6H2_DYAFD/19-261----------------------------------------------------------------------LKK.L-----
C7Q1F2_CATAD/16-252----------------------------------------------------------------------FAS.L-----
C7YUL0_NECH7/9-264----------------------------------------------------------------------LKA.L-----
C7YZU2_NECH7/391-674----------------------------------------------------------------------IRAAF-----
D6Z4R6_DESAT/153-411----------------------------------------------------------------------LRRLI-----
C9SRU6_VERA1/11-259----------------------------------------------------------------------LKA.L-----
D1A2J0_THECD/5-232----------------------------------------------------------------------FGE.L-----
D1BED0_SANKS/11-246----------------------------------------------------------------------FAS.L-----
D1BI43_SANKS/12-247----------------------------------------------------------------------FRS.L-----
D9TER7_MICAI/8-239----------------------------------------------------------------------FRE.L-----
E3J806_FRASU/10-249----------------------------------------------------------------------FLA.L-----
D2B1P9_STRRD/6-236----------------------------------------------------------------------FRA.L-----
E3I6J4_RHOVT/30-272----------------------------------------------------------------------FRKRL-----
D2PR97_KRIFD/29-269----------------------------------------------------------------------LRA.L-----
D2Q3B1_KRIFD/7-234----------------------------------------------------------------------FRA.L-----
D2Q4L3_KRIFD/4-243----------------------------------------------------------------------FRD.L-----
D3EII1_GEOS4/13-252----------------------------------------------------------------------FKK.L-----
D3V3K7_XENBS/39-278----------------------------------------------------------------------FRQ.L-----
D4AZN8_ARTBC/10-268----------------------------------------------------------------------LRS.L-----
D4LCE5_RUMC1/6-261----------------------------------------------------------------------LGSLL-----
Q01YZ5_SOLUE/12-251----------------------------------------------------------------------FRA.L-----
Q08U27_STIAD/11-246----------------------------------------------------------------------FRA.L-----
Q0BYP5_HYPNA/11-255----------------------------------------------------------------------FAS.L-----
Q0RPX9_FRAAA/13-247----------------------------------------------------------------------FRE.L-----
Q12Q29_SHEDO/14-259----------------------------------------------------------------------LKDIL-----
Q1GKC0_RUEST/10-253----------------------------------------------------------------------FAA.L-----
Q1GQT2_SPHAL/9-246----------------------------------------------------------------------FRA.L-----
Q28RZ5_JANSC/10-249----------------------------------------------------------------------FAR.L-----
Q2JAX2_FRASC/15-255----------------------------------------------------------------------FRE.L-----
Q4DNR3_TRYCC/14-261----------------------------------------------------------------------LKSML-----
Q4KET5_PSEF5/11-270----------------------------------------------------------------------LSQLL-----
Q5E5F2_VIBF1/18-278----------------------------------------------------------------------LINVI-----
Q5LNA0_RUEPO/10-253----------------------------------------------------------------------FAA.L-----
Q5LUG9_RUEPO/10-245----------------------------------------------------------------------FRT.L-----
Q5WBL4_BACSK/19-257----------------------------------------------------------------------FRC.L-----
Q65ND9_BACLD/10-248----------------------------------------------------------------------FLD.L-----
Q7NXV8_CHRVO/33-277----------------------------------------------------------------------FRR.L-----
Q7P124_CHRVO/3-243----------------------------------------------------------------------FAQ.L-----
Q893V9_CLOTE/153-411----------------------------------------------------------------------LRQLL-----
Q8EI00_SHEON/9-240----------------------------------------------------------------------FKA.L-----
A6TFP2_KLEP7/3-236----------------------------------------------------------------------FNA.L-----
G2J0B0_PSEUL/10-251----------------------------------------------------------------------FKE.L-----
G8PVS4_PSEUV/10-253----------------------------------------------------------------------FAA.L-----
D4GMW6_PANAM/3-261----------------------------------------------------------------------.KK.L-----
Y1998_MYCTU/3-229----------------------------------------------------------------------FHD.L-----
Q2IK57_ANADE/11-247----------------------------------------------------------------------FRA.L-----
Q2KD40_RHIEC/10-252----------------------------------------------------------------------FGA.L-----
Q63MP0_BURPS/20-277----------------------------------------------------------------------FKEKL-----
Q8F693_LEPIN/12-250----------------------------------------------------------------------FRS.L-----
Q8YAP2_LISMO/8-250----------------------------------------------------------------------LKS.L-----
Q98AR7_RHILO/15-259----------------------------------------------------------------------.RR.M-----
R5T8T3_9CLOT/12-269----------------------------------------------------------------------.....-----
R5TTB9_9CLOT/13-246----------------------------------------------------------------------.....-----

PF02548

C8XKD1_NAKMY/14-272----------------------------------------------------------------.IAIPDLFE-L-----
A7HMC7_FERNB/3-256----------------------------------------------------------------..NTKKIID-M-----
PANB_NITMU/2-259----------------------------------------------------------------RITQDVFQK-M-----
E3I2N4_RHOVT/9-264----------------------------------------------------------------RVTAPDIRA-K-----
PANB_THEFY/18-275----------------------------------------------------------------RVTVQDLAA-A-----
F0NZT0_WEEVC/9-267----------------------------------------------------------------RITTETIRK-M-----
C5DYQ5_ZYGRC/31-296----------------------------------------------------------------SNTIQSLHE-K-----
D8RYD4_SELML/4-266----------------------------------------------------------------KVTMRYLQS-K-----
S9W2M7_SCHCR/5-262----------------------------------------------------------------PITTSVLRQ-W-----
D2PXN9_KRIFD/534-791----------------------------------------------------------------KYRIHHLRD-L-----
H1Z987_MYROD/10-268----------------------------------------------------------------KVTTKSLID-M-----
C5BN63_TERTT/12-267----------------------------------------------------------------SVSIKTLQA-M-----
A8LKB6_DINSH/13-268----------------------------------------------------------------RLTVPQIAA-R-----
D7BNG1_ARCHD/5-260----------------------------------------------------------------RVRAHHLAQ-M-----
D7A714_STAND/9-264----------------------------------------------------------------RLTAPDIRA-K-----
PANB_BORPD/9-265----------------------------------------------------------------RKTTTAIRQ-A-----
PANB_MAGSA/9-265----------------------------------------------------------------RITTRDIRA-R-----
E8RFZ1_DESPD/5-262----------------------------------------------------------------KLTIPDLRN-R-----
PANB_PROMA/4-255----------------------------------------------------------------....KELVR-F-----
K9RVA1_SYNP3/11-268----------------------------------------------------------------PVTIPQLQH-W-----
D5WZ20_THIK1/22-279----------------------------------------------------------------PLTLHRLRA-M-----
B8LYN4_TALSN/78-338----------------------------------------------------------------PVTISTLRN-M-----
K9RDA0_9CYAN/11-264----------------------------------------------------------------AITIQKLIQ-Y-----
PANB_METRJ/10-267----------------------------------------------------------------.LRAIDIGK-R-----
A9UP51_MONBE/1-268----------------------------------------------------------------.VTMNKLKR-K-----
PANB_PROA2/11-273----------------------------------------------------------------HVTTRRLHD-M-----
F2UAL1_SALR5/62-329----------------------------------------------------------------.VTIPSIHA-A-----
V2XXG0_MONRO/40-299----------------------------------------------------------------KVTIDTLQA-M-----
G2IQV3_9SPHN/23-282----------------------------------------------------------------RLTIPALRA-R-----
PANB_CLONN/2-260----------------------------------------------------------------KNTVTTFQK-A-----
PANB_WIGBR/3-260----------------------------------------------------------------KTNIYDLYK-L-----
M1FDT2_9ALTE/4-264----------------------------------------------------------------KVTIPRLQQ-M-----
E4TII1_CALNY/9-264----------------------------------------------------------------KVTVNQIKN-M-----
K0I9Q1_NITGG/2-255----------------------------------------------------------------..SVNDIVA-M-----
C7MD29_BRAFD/11-267----------------------------------------------------------------KIRLRHLQQ-A-----
G8PQN3_PSEUV/9-264----------------------------------------------------------------RKTIKDIMK-A-----
PANB_LEPCP/16-279----------------------------------------------------------------PLTLPALRA-M-----
K1VYW4_TRIAC/1535-1794----------------------------------------------------------------KLTVGALQK-Q-----
B8I2Z4_CLOCE/9-266----------------------------------------------------------------KNTAASIQN-Q-----
I0AFM0_IGNAJ/3-258----------------------------------------------------------------..SILEFQK-K-----
I4CAV2_DESTA/3-261----------------------------------------------------------------KITIQTLRE-K-----
PANB_SULDN/4-259----------------------------------------------------------------KMTITSIKK-S-----
S8DNJ0_FOMPI/15-274----------------------------------------------------------------KITIQHLHA-M-----
PANB_METCA/5-260----------------------------------------------------------------.VTLPDLLA-M-----
F3YUG3_DESAF/5-260----------------------------------------------------------------.LTAPDIAS-R-----
PANB_SYNAS/9-267----------------------------------------------------------------KITTSVIRG-M-----
C7LVL7_DESBD/2-259----------------------------------------------------------------.KTISDFLQ-M-----
PANB_NOCSJ/34-291----------------------------------------------------------------RIRTHHLRE-M-----
F0SK13_RUBBR/3-257----------------------------------------------------------------QMTVPRFVA-A-----
D3E7N3_GEOS4/7-265----------------------------------------------------------------.LNIVKLKN-M-----
G7EAQ5_MIXOS/98-357----------------------------------------------------------------KVTLLDIAK-A-----
R7GY01_9FIRM/2-260----------------------------------------------------------------KNTIATLQQ-Q-----
U9SMK5_RHIID/19-277----------------------------------------------------------------KVTINTIQK-L-----
R5GD14_9BACT/11-269----------------------------------------------------------------KVTTLRLKE-M-----
R1GLQ8_BOTPV/11-271----------------------------------------------------------------KVTLNTLHS-L-----
PANB_DESAH/4-258----------------------------------------------------------------RVTTTTLFK-M-----
PANB_DEIDV/5-258----------------------------------------------------------------...IPELLQ-S-----
S6CEI7_9ACTN/2-260----------------------------------------------------------------SVTVSTFLK-M-----
R5KEY8_9CLOT/2-260----------------------------------------------------------------KNTVVTFQK-A-----
K0SSA9_THAOC/101-366----------------------------------------------------------------KVTTLTIRA-K-----
C6XKS3_HIRBI/9-264----------------------------------------------------------------RKTVRDIAK-A-----
J9QSS2_RIEAN/9-267----------------------------------------------------------------KVTTEVLRK-M-----
S6BYU9_9GAMM/3-260----------------------------------------------------------------KITITTLER-M-----
D0KZU6_HALNC/20-275----------------------------------------------------------------.KTLTTLQN-A-----
G0W8X4_NAUDC/30-294----------------------------------------------------------------.TTILDIQS-K-----
E5AM95_PARRH/11-268----------------------------------------------------------------AVTVPRLQQ-M-----
I3TFJ1_THEC1/4-259----------------------------------------------------------------KVTVRDIIK-K-----
PANB_GRABC/9-265----------------------------------------------------------------RISVPALRA-R-----
G0GCR3_SPITZ/2-257----------------------------------------------------------------..NVRSFLA-R-----
G1XV43_ARTOA/82-342----------------------------------------------------------------KVTINTIRK-M-----
D9Q2W0_ACIS3/6-261----------------------------------------------------------------KVTVRKIVN-L-----
B1ZVH1_OPITP/3-258----------------------------------------------------------------..TIRDLAA-A-----
R7EXA6_9BACT/11-269----------------------------------------------------------------KVTTRRLVE-M-----
F6B538_DESCC/4-262----------------------------------------------------------------RVTTADFRR-M-----
D5UZ54_ARCNC/10-265----------------------------------------------------------------KMNINKIKK-A-----
U1GVM1_ENDPU/59-319----------------------------------------------------------------PVTIQTIRD-L-----
G2QRB2_THITE/68-328----------------------------------------------------------------KVTIGTLRA-L-----
B7FR45_PHATC/3-276----------------------------------------------------------------KVSALSLTS-K-----
PANB_THEEB/5-261----------------------------------------------------------------SVTLPQLQA-K-----
R7D6U7_9ACTN/3-263----------------------------------------------------------------KNTVLTLKK-K-----
E3GPR0_EUBLK/2-261----------------------------------------------------------------KKSIIDFRR-M-----
C1DI17_AZOVD/17-274----------------------------------------------------------------RVRIPYLKE-L-----
A5VB06_SPHWW/22-276----------------------------------------------------------------RLTVPAIRA-A-----
A4CLQ4_ROBBH/10-268----------------------------------------------------------------RVTVRSLVE-M-----
D5BTJ5_PUNMI/4-260----------------------------------------------------------------KMTVDTFTA-L-----
C9RK32_FIBSS/3-246----------------------------------------------------------------..TPEDIKA-K-----
C4LHZ4_CORK4/17-275----------------------------------------------------------------KTRIHHLDQ-F-----
W8KF56_HALHR/9-265----------------------------------------------------------------RLTLRDLQG-L-----
G7V5R4_THELD/5-262----------------------------------------------------------------.LSIPDFMR-M-----
I3ZIP5_TERRK/17-275----------------------------------------------------------------KVTPQTLLQ-S-----
S6AIG3_9PROT/2-259----------------------------------------------------------------RVTLSNLQK-M-----
F3ZPG7_9BACE/11-269----------------------------------------------------------------KVTTHHLAE-M-----
PANB_AQUAE/2-260----------------------------------------------------------------AINLQTLFK-K-----
R7ALC5_9ACTN/29-287----------------------------------------------------------------KNTVATFQE-M-----
U5N9B5_9BURK/27-288----------------------------------------------------------------.FTLPRLRE-M-----
C6BVH5_DESAD/3-260----------------------------------------------------------------KVTAPDITA-.-----
C5KFU4_PERM5/79-341----------------------------------------------------------------KITLTQIKK-L-----
F4H271_CELFA/7-264----------------------------------------------------------------RVRVHHLRE-A-----
F8AZ74_FRADG/51-306----------------------------------------------------------------RTTVRELQA-A-----
E4NQR1_HALBP/4-256----------------------------------------------------------------...VRDVRE-K-----
C6VWE8_DYAFD/10-268----------------------------------------------------------------RITTHVIQE-M-----
R5KSN9_9FIRM/2-260----------------------------------------------------------------KNTVNTLLQ-Q-----
PANB_NATPD/3-255----------------------------------------------------------------...AKDIRA-K-----
L0IYN2_9MYCO/17-274----------------------------------------------------------------KVRTHHLQK-W-----
PANB_CLOTH/4-262----------------------------------------------------------------KFTTASFLE-S-----
PANB_SPHAL/26-281----------------------------------------------------------------RLTVPRIRQ-R-----
I0A221_FERFK/7-263----------------------------------------------------------------KITMRKFIK-K-----
T2GAB0_DESGI/5-261----------------------------------------------------------------.QTARSVSA-R-----
C6WXZ0_METML/2-266----------------------------------------------------------------..TLPKLHE-M-----
F2IID2_FLUTR/9-267----------------------------------------------------------------RVTTNVLQE-M-----
D5BNG2_PUNMI/9-267----------------------------------------------------------------KVTYKTLLK-K-----
PANB_ARTAT/40-297----------------------------------------------------------------RVRIHHLQQ-A-----
PANB_CARHZ/3-261----------------------------------------------------------------RVTVSSLKE-M-----
A4G8C6_HERAR/16-272----------------------------------------------------------------AVTVPALFA-L-----
E1QUY6_VULDI/5-260----------------------------------------------------------------KVTVQTIMS-M-----
PANB_METFK/3-256----------------------------------------------------------------...LLTLQQ-M-----
PANB_CHESB/10-264----------------------------------------------------------------.FTPPDIAK-A-----
B6GXN5_PENRW/75-335----------------------------------------------------------------KVTIQTLQN-M-----
I0GU87_SELRL/2-260----------------------------------------------------------------KNTVATFAK-M-----
R9AIM6_WALI9/451-714----------------------------------------------------------------KVTISSLNK-L-----
R5BQ58_9FIRM/5-264----------------------------------------------------------------PKTITTIKQ-M-----
F8AC68_THEID/6-263----------------------------------------------------------------KITVPELIA-K-----
PANB_ALKEH/12-269----------------------------------------------------------------PVTVGRLQR-M-----
F8E6G1_FLESM/9-265----------------------------------------------------------------KITVSHFKK-M-----
PANB_BORPE/9-264----------------------------------------------------------------RITTRQLRM-R-----
E1VL92_9GAMM/2-258----------------------------------------------------------------AVTLSTINK-I-----
R6CEN3_9FIRM/2-260----------------------------------------------------------------KNTAATLMS-Q-----
PANB_LEPBP/4-261----------------------------------------------------------------..IILQYKK-K-----
D5MI67_9BACT/6-263----------------------------------------------------------------.VRTVTLQQ-M-----
G0EFC1_PYRF1/3-258----------------------------------------------------------------RISVRDILA-K-----
PANB_EXIS2/3-258----------------------------------------------------------------..TMTPLLK-K-----
I4BB70_TURPD/157-414----------------------------------------------------------------.MNIHDFTK-K-----
PANB_MARHV/2-258----------------------------------------------------------------AVTINTLRE-Y-----
D8J2A6_HALJB/4-255----------------------------------------------------------------...VADIR.-.-----
PANB_IGNH4/3-259----------------------------------------------------------------KVTIRDIMK-K-----
G4RJI6_THETK/5-260----------------------------------------------------------------KITVQTFLN-M-----
K8GUE9_9CYAN/2-256----------------------------------------------------------------PVTTQQIVQ-W-----
W6SJ04_9CLOT/2-259----------------------------------------------------------------KNTSATFIE-M-----
D9SXD7_CLOC7/2-260----------------------------------------------------------------KNTVITFKE-M-----
W5W0X3_9PSEU/35-292----------------------------------------------------------------RVRIHHLQE-L-----
F7V601_CLOSS/2-260----------------------------------------------------------------SKTLNTFRK-M-----
PANB_SYNE7/2-256----------------------------------------------------------------PITPRHLRQ-W-----
I2GYS6_TETBL/22-285----------------------------------------------------------------.LTIPDLLR-K-----
F2N7R6_CORGP/2-260----------------------------------------------------------------KTTVTTFQQ-A-----
PANB_SODGM/2-257----------------------------------------------------------------.TTISHLRK-W-----
PANB_MYXXD/4-262----------------------------------------------------------------KVTIHTLKR-F-----
W0JJ73_DESAE/2-258----------------------------------------------------------------KMTVPKFVS-M-----
PANB_SALRD/3-261----------------------------------------------------------------RVTTKTVQE-M-----
H1XSD8_9BACT/9-267----------------------------------------------------------------RITVPVIKR-M-----
K4KI34_SIMAS/15-270----------------------------------------------------------------AVTVNTLRK-M-----
PANB_PHEZH/11-266----------------------------------------------------------------RIAAPDIAA-R-----
C1F8U4_ACIC5/19-277----------------------------------------------------------------KVTLATLQE-K-----
PANB_BDEBA/2-258----------------------------------------------------------------.KTILDFHD-K-----
PANB_PSELT/2-257----------------------------------------------------------------..NVNKFKS-M-----
PANB_POLSJ/34-294----------------------------------------------------------------.LSLPRLRE-M-----
G0A0M7_METMM/10-265----------------------------------------------------------------TLSIADLRA-M-----
E3E4R6_PAEPS/7-265----------------------------------------------------------------.LNIVKMRK-M-----
R7P8R5_9BACT/11-269----------------------------------------------------------------KVTTHRLQE-M-----
G8QNM1_DECSP/9-266----------------------------------------------------------------RLTITDMAK-L-----
V6JZL1_STRNV/26-283----------------------------------------------------------------RVTVHDIAA-A-----
F4GUY4_PUSST/9-264----------------------------------------------------------------RISVPQLMQ-Y-----
R7C4Y8_9BURK/5-261----------------------------------------------------------------..KVTDFAR-M-----
R6EWT4_9BACT/11-269----------------------------------------------------------------KVTAPLFFE-M-----
PANB_PSYA2/2-261----------------------------------------------------------------.TTLSTLNK-F-----
E6UF09_RUMA7/2-260----------------------------------------------------------------KNTVSTLLK-Q-----
PANB_PROMM/4-256----------------------------------------------------------------....SELTQ-L-----
F8GE64_NITSI/2-259----------------------------------------------------------------RITQTTLQK-M-----
G8YQ94_PICSO/33-293----------------------------------------------------------------RYSIADIQE-L-----
R6EER5_9BACT/10-268----------------------------------------------------------------KVTVKTFAE-M-----
R6MV46_9FIRM/2-260----------------------------------------------------------------KKTVTTFAK-A-----
E1ZCJ6_CHLVA/23-287----------------------------------------------------------------RVTLRTLRD-K-----
PANB_NITSB/4-255----------------------------------------------------------------RHTVNTIKS-A-----
M4VAT0_9DELT/3-258----------------------------------------------------------------..SILDFQK-R-----
J9ZD86_LEPFM/6-263----------------------------------------------------------------.MTIDQFPI-R-----
L0K4F1_HALHC/4-262----------------------------------------------------------------QVTIKTLQQ-K-----
E6WZE1_NITSE/11-266----------------------------------------------------------------KVTVRTVQK-L-----
R7IQM6_9FIRM/7-262----------------------------------------------------------------...AVTFKN-A-----
R5JJK8_9FIRM/2-260----------------------------------------------------------------KNTTTTIKA-Q-----
F8DZN0_CORRG/23-280----------------------------------------------------------------QVRISDFHR-Y-----
I4D5R2_DESAJ/3-259----------------------------------------------------------------..STKDFLE-M-----
PANB_LEIXX/16-273----------------------------------------------------------------RVRTRHFQA-A-----
PANB_NITMS/2-259----------------------------------------------------------------HKSVQDIVN-M-----
PANB1_PSEAE/9-265----------------------------------------------------------------RLSVPDIQR-R-----
G8BMS9_TETPH/44-308----------------------------------------------------------------.KTILDIQR-K-----
R5V6Z6_9FIRM/2-260----------------------------------------------------------------KNTVVTFQE-A-----
R5U793_9BACE/11-269----------------------------------------------------------------KVTTHRLVE-M-----
F6CMZ4_DESK7/5-263----------------------------------------------------------------QVTTAYFRE-A-----
B9L8Y5_NAUPA/4-254----------------------------------------------------------------..TLKTLYK-K-----
PANB_DESPS/2-260----------------------------------------------------------------RKTVVDIIA-M-----
L0F2P8_DESDL/3-259----------------------------------------------------------------..TTTDFLA-M-----
K9Y6F0_HALP7/3-258----------------------------------------------------------------.VTTAQLLK-W-----
PANB_NITEU/8-264----------------------------------------------------------------RMTITTLQN-A-----
M5C834_THACB/15-272----------------------------------------------------------------KVTIQKLHA-L-----
T2KQ61_9FLAO/10-268----------------------------------------------------------------KVTVKTLSD-M-----
I1NLG6_ORYGL/83-346----------------------------------------------------------------RVTLATLRG-K-----
E6TZJ1_BACCJ/3-259----------------------------------------------------------------..TTTDFFN-M-----
K0B4S7_CLOA9/4-262----------------------------------------------------------------KFTVNSFLE-S-----
R6VBN9_9CLOT/2-260----------------------------------------------------------------KNTIITFKQ-S-----
G4QJL3_GLANF/3-259----------------------------------------------------------------KVTTSTLMQ-L-----
PANB_RHOBA/10-264----------------------------------------------------------------RITTRTLQR-M-----
R5DYA6_9BURK/9-266----------------------------------------------------------------PVRLSTIKK-M-----
PANB_RHORT/10-268----------------------------------------------------------------RLTVRDIAS-R-----
A5DVU0_LODEL/36-294----------------------------------------------------------------KKTISYIQN-L-----
B6JWN4_SCHJY/27-297----------------------------------------------------------------..TVRSIRK-L-----
PANB_CORGL/8-265----------------------------------------------------------------KIRTRHFRE-A-----
PANB_RALSO/12-268----------------------------------------------------------------AVTVTSLQG-M-----
R6LXN4_9CLOT/2-260----------------------------------------------------------------KNTVRTFQM-A-----
PANB_MOOTA/6-264----------------------------------------------------------------RVTLPQLQA-M-----
F2F6S0_SOLSS/3-258----------------------------------------------------------------..TTAQFLK-M-----
PANB_AZOSB/9-267----------------------------------------------------------------PVTLFELGK-M-----
D3SC34_THISK/3-258----------------------------------------------------------------PITVNTLAR-R-----
D4H852_DENA2/9-265----------------------------------------------------------------KINLNTFKK-M-----
H6L4G9_SAPGL/9-267----------------------------------------------------------------KVTTHVLHA-M-----
R6DPQ8_9CLOT/2-260----------------------------------------------------------------KKTVSTLQQ-A-----
N0B212_9BACI/3-259----------------------------------------------------------------..QTTNFLK-M-----
R7K0E3_9CLOT/2-260----------------------------------------------------------------KNTVQTWRQ-A-----
Q6BIM6_DEBHA/33-293----------------------------------------------------------------RKTLLDIQR-L-----
K0KXD0_WICCF/32-290----------------------------------------------------------------RKSLNDIRQ-L-----
E8RS63_ASTEC/11-266----------------------------------------------------------------RLTAPEIYA-R-----
F9X8W4_ZYMTI/67-327----------------------------------------------------------------KITLQTLQA-M-----
A4XA35_SALTO/20-277----------------------------------------------------------------RVRARDLLA-A-----
D5U1C4_THEAM/4-259----------------------------------------------------------------KVNVKTIMK-M-----
I0ICC5_PHYMF/8-267----------------------------------------------------------------RTTLRDLRH-R-----
F4PL25_DICFS/108-366----------------------------------------------------------------KTTILDIKK-K-----
G4KQR4_OSCVS/3-261----------------------------------------------------------------KKTVIDLYK-M-----
K9YNE4_CYASC/2-257----------------------------------------------------------------KVTIQKLCQ-W-----
PANB_WOLSU/3-258----------------------------------------------------------------NITVSSIKK-K-----
E6U5I9_ETHHY/4-262----------------------------------------------------------------TVTTQSFLD-A-----
B8BWG2_THAPS/41-307----------------------------------------------------------------KVTTLTIAA-K-----
K9SYS3_9SYNE/2-257----------------------------------------------------------------PVTISQLLT-W-----
PANB_AERPE/5-260----------------------------------------------------------------KVTARRILK-M-----
R7DES0_9PORP/10-268----------------------------------------------------------------KVTTRRLAE-M-----
PANB_BAUCH/4-259----------------------------------------------------------------.TTISHLRK-Y-----
I5AYL4_9DELT/4-258----------------------------------------------------------------KITTSSLMK-M-----
PANB_BACSK/2-259----------------------------------------------------------------.KTTKTFKQ-M-----
R6A0K1_9BACT/11-268----------------------------------------------------------------KVTTHRLKE-M-----
B2IDS4_BEII9/7-254----------------------------------------------------------------...AARFAE-M-----
K0C447_CYCSP/9-266----------------------------------------------------------------KITNTDLLT-M-----
PANB_LISMO/5-258----------------------------------------------------------------....VDFFA-M-----
PANB_RHILO/16-267----------------------------------------------------------------.....LIRR-R-----
K9VPY0_9CYAN/2-258----------------------------------------------------------------SVTTHQLIQ-W-----
C0ZCH0_BREBN/7-265----------------------------------------------------------------PITTSSIRK-K-----
A7TTC6_VANPO/36-301----------------------------------------------------------------RKSILDLNK-K-----
M4ZY73_9ACTN/20-278----------------------------------------------------------------RVRTRHFQQ-A-----
D2U9Y6_XANAP/10-266----------------------------------------------------------------.WTVPALAD-A-----
PANB_BACLD/3-259----------------------------------------------------------------..TKTDFLK-M-----
K9ZZ09_DEIPD/3-257----------------------------------------------------------------.KTVPDLVR-S-----
D3UG21_HELM1/2-256----------------------------------------------------------------KTTITSLQK-K-----
R5FZT9_9PORP/11-269----------------------------------------------------------------KITATRFMA-M-----
E0SBL5_DICD3/3-259----------------------------------------------------------------ATTISHLRQ-W-----
PANB_HALSA/12-261----------------------------------------------------------------.......NT-D-----
PANB_CAMJE/4-258----------------------------------------------------------------..SMISFLE-K-----
Q0UNM3_PHANO/57-317----------------------------------------------------------------PVTINTLQA-L-----
PANB_SULAC/5-259----------------------------------------------------------------KVSIRDFLK-K-----
M4NHU9_9GAMM/13-271----------------------------------------------------------------PVTVPGLLA-M-----
C5C4X5_BEUC1/14-271----------------------------------------------------------------RVRVQHLRA-A-----
E2SAV3_9ACTN/24-281----------------------------------------------------------------RVRTHHLRQ-W-----
I2F2C6_9BACT/2-256----------------------------------------------------------------..NVREIVQ-M-----
PANB_DECAR/9-266----------------------------------------------------------------RLTQADLAK-L-----
W1Q8C1_OGAPD/26-284----------------------------------------------------------------QKTLTDIKK-L-----
PANB_KOSOT/2-256----------------------------------------------------------------..NIRQIIN-S-----
PANB2_BRADU/11-267----------------------------------------------------------------RVTIPALQQ-W-----
R7NSE5_9FIRM/2-259----------------------------------------------------------------KNNVSTFAK-M-----
A8DWD1_NEMVE/4-260----------------------------------------------------------------.VTLTTLQS-L-----
D9SIJ1_GALCS/2-259----------------------------------------------------------------RTTLTTLKA-M-----
PANB2_VIBF1/3-259----------------------------------------------------------------KITISDLNN-W-----
C4Y7C6_CLAL4/28-286----------------------------------------------------------------RTTLTDLRK-L-----
E0UPX6_SULAO/4-259----------------------------------------------------------------KLTISTIKK-S-----
C0QS02_PERMH/2-258----------------------------------------------------------------.KTIHDFLR-A-----
PANB_PELUB/4-253----------------------------------------------------------------..KILNFIK-K-----
F2LWA6_HIPMA/2-259----------------------------------------------------------------AITVPKIKD-M-----
PANB_THICR/2-256----------------------------------------------------------------..TLTKLHK-M-----
M5DV17_9GAMM/4-263----------------------------------------------------------------.ISIRSLQT-M-----
X2HEZ8_9NEIS/2-257----------------------------------------------------------------.HTIHTLRK-M-----
I1YKY2_METFJ/3-261----------------------------------------------------------------RLSLSHLRK-M-----
D2NU30_ROTMD/61-319----------------------------------------------------------------KVRTVHLAQ-A-----
R5SB00_9GAMM/3-259----------------------------------------------------------------..TVTSFQR-L-----
E1VAR3_HALED/19-275----------------------------------------------------------------TVTLSTLQA-H-----
D3SNL0_THEAH/2-259----------------------------------------------------------------KVTLRTLFR-K-----
U3U9E1_9GAMM/4-259----------------------------------------------------------------.TTISYLNQ-L-----
PANB_CLOAB/2-260----------------------------------------------------------------KNTTETFKN-S-----
B7GHT0_ANOFW/22-277----------------------------------------------------------------..TKLDFLN-M-----
B8EK33_METSB/5-251----------------------------------------------------------------....ARFFE-M-----
C8X1K5_DESRD/4-262----------------------------------------------------------------KLSVHTLQG-L-----
G4T0T2_META2/12-267----------------------------------------------------------------PLTITDLQS-M-----
PANB_ANAMF/4-256----------------------------------------------------------------..NILDIQA-K-----
I4YBJ3_WALMC/10-273----------------------------------------------------------------KVTIAKLNK-M-----
F0S4V2_PSESL/9-267----------------------------------------------------------------RVTTFSLQE-M-----
E6SCG6_INTC7/25-282----------------------------------------------------------------RVRIPHLQA-M-----
PANB_CORJK/21-279----------------------------------------------------------------KVRIADLKA-R-----
F4PBH9_BATDJ/27-283----------------------------------------------------------------KVTITALRK-L-----
PANB_CYAP4/3-259----------------------------------------------------------------.VTIPQLQQ-W-----
U5QGT4_9CYAN/2-258----------------------------------------------------------------AVSIHHLRR-L-----
E7A9J8_HELFC/3-264----------------------------------------------------------------KITLDSLYR-K-----
PANB_ROSDO/14-264----------------------------------------------------------------.....DIKS-R-----
I0H0N1_ACTM4/15-272----------------------------------------------------------------RVRTRDLIN-A-----
M2PBF7_CERS8/43-302----------------------------------------------------------------KVTIHHLQA-M-----
V4KY10_9DELT/4-261----------------------------------------------------------------KLTRFDLQT-M-----
D4MUX9_ANAHA/2-260----------------------------------------------------------------KTTVSTVQK-M-----
K4II33_PSYTT/10-268----------------------------------------------------------------RITVKSLIE-M-----
G2TM93_BACCO/3-259----------------------------------------------------------------..QTTDFVK-M-----
PANB_NOCFA/22-279----------------------------------------------------------------KTRIPHLRQ-M-----
PANB_STRMK/10-265----------------------------------------------------------------.WTVPALAE-A-----
R6Q9M5_9FIRM/3-261----------------------------------------------------------------KNTVSTFRE-Q-----
PANB_GEOLS/4-261----------------------------------------------------------------KITIPEILL-M-----
PANB_STACT/3-256----------------------------------------------------------------..QLSNLFD-M-----
D3IAK5_9BACT/11-269----------------------------------------------------------------KITTQKFIE-L-----
E3RMD4_PYRTT/56-316----------------------------------------------------------------PVTINTLQS-M-----
F8C4E6_THEGP/11-262----------------------------------------------------------------......LIE-K-----
PANB_RHOCS/9-265----------------------------------------------------------------RLAVPDIAA-R-----
G8LWQ2_CLOCD/4-262----------------------------------------------------------------KITVSNFRE-S-----
Q6CLY9_KLULA/32-295----------------------------------------------------------------QLTVKDIMA-K-----
PANB_SYNR3/10-261----------------------------------------------------------------....EQLRQ-R-----
R5J4T6_9FIRM/2-260----------------------------------------------------------------KNTVLTFKE-A-----
R5CPJ0_9BACT/11-269----------------------------------------------------------------KVTTHRFIE-M-----
PANB2_ZYMMO/10-265----------------------------------------------------------------RRTIPELRA-R-----
PANB_UNCTG/3-261----------------------------------------------------------------KKTVLTILK-K-----
A9SWR9_PHYPA/44-307----------------------------------------------------------------RVTLRHLEA-K-----
PANB_PSYWF/2-265----------------------------------------------------------------.ITLSTLKK-Y-----
E1VXC6_GLUAR/15-272----------------------------------------------------------------RIRLHHLQQ-A-----
F2J6X3_POLGS/33-294----------------------------------------------------------------RTTLSTLDR-I-----
PANB_GEOSW/3-259----------------------------------------------------------------..TKTDFFK-M-----
D3PCJ6_DEFDS/9-265----------------------------------------------------------------KITVNHLKK-M-----
F5XK06_MICPN/12-270----------------------------------------------------------------RIRIPDLQQ-A-----
R5PEY0_9BACT/11-269----------------------------------------------------------------KVTAPAFFK-M-----
D1BFU9_SANKS/24-281----------------------------------------------------------------RFRVHHLAE-H-----
I3VRB5_THESW/4-262----------------------------------------------------------------KITVSTLKR-L-----
PANB_AGRVS/9-265----------------------------------------------------------------RLTPTTIAA-L-----
PANB_XYLFA/10-265----------------------------------------------------------------.WTVPALAE-A-----
M4SFZ5_9SPHN/23-277----------------------------------------------------------------RMTVPQIQA-R-----
G0RQ21_HYPJQ/11-271----------------------------------------------------------------KVTMSTIKS-L-----
R7FC11_9FIRM/2-261----------------------------------------------------------------KQTVQTIQA-K-----
C1MW11_MICPC/19-288----------------------------------------------------------------RFTLRKLAA-K-----
W5XWQ3_9CORY/8-265----------------------------------------------------------------RVRTRHFFE-A-----
L0EU60_LIBCB/3-258----------------------------------------------------------------TTTIETLNQ-L-----
L0E1F4_THIND/2-256----------------------------------------------------------------RTTIRTLEK-Y-----
K9Z7J6_CYAAP/2-257----------------------------------------------------------------KVTIQNLQQ-W-----
I4A0H9_ORNRL/9-266----------------------------------------------------------------KITTETLRN-L-----
A5HYW9_CLOBH/2-260----------------------------------------------------------------RNTVSTFQE-L-----
I3U7Q6_ADVKW/24-279----------------------------------------------------------------RITVPQLRA-Y-----
PANB1_PSEF5/9-264----------------------------------------------------------------RLSVPQLVA-M-----
E8UZX7_TERSS/17-275----------------------------------------------------------------KTTPQSLQD-Q-----
PANB_CHLTE/11-273----------------------------------------------------------------HVTTRRMLD-M-----
F4CPV3_PSEUX/31-288----------------------------------------------------------------RTRIHHLAE-M-----
PANB_MARMM/13-268----------------------------------------------------------------RITAPDIRA-R-----
K9WEF5_9CYAN/2-259----------------------------------------------------------------AVTTQQLIQ-W-----
K9SKS8_9CYAN/2-258----------------------------------------------------------------TVTTANLQT-F-----
R4VYJ3_9EURY/3-265----------------------------------------------------------------RTTIRDLQT-R-----
K5WY16_AGABU/47-306----------------------------------------------------------------KVTIQGLHA-L-----
A8NR68_COPC7/47-306----------------------------------------------------------------KVTIQTLHS-M-----
S5SZ30_9CORY/8-265----------------------------------------------------------------RVRTRHFAQ-A-----
E3H7X2_ILYPC/2-260----------------------------------------------------------------KNTVVSFRN-S-----
B8D3I6_DESK1/7-262----------------------------------------------------------------RVTVRDIVK-M-----
I2BCN0_SHIBC/38-294----------------------------------------------------------------PTTVANLRQ-L-----
D8PBH0_9BACT/1-257----------------------------------------------------------------.MTVPDLQK-C-----
A7I1C3_CAMHC/4-259----------------------------------------------------------------.ITPNAIIA-K-----
D3Q8M5_STANL/19-275----------------------------------------------------------------RVRTRDLKL-A-----
V5UCI0_9BURK/11-268----------------------------------------------------------------AVTVPGLAQ-M-----
L0H3K5_9GAMM/8-264----------------------------------------------------------------.IGISTLAA-M-----
L0JL26_NATP1/3-257----------------------------------------------------------------..TVRDVRS-K-----
A8IKB7_CHLRE/113-377----------------------------------------------------------------RVTLRTIRK-K-----
PANB_HELPY/10-265----------------------------------------------------------------KITLNHLQA-K-----
R7BQ71_9ACTN/2-260----------------------------------------------------------------KNTVTTFKD-A-----
D5V951_MORCB/17-276----------------------------------------------------------------.ITLSTLNK-L-----
U7PLW4_SPOS1/41-301----------------------------------------------------------------KVTVGTLRS-L-----
R7LEZ2_9BACT/2-258----------------------------------------------------------------KKSIKTIFK-K-----
D3FBP3_CONWI/22-279----------------------------------------------------------------.VSLPQLAE-K-----
C5CCN7_MICLC/23-281----------------------------------------------------------------RYRTVHLQR-A-----
F8PSJ9_SERL3/44-301----------------------------------------------------------------KVTIQSLYN-Q-----
PANB_PELCD/4-262----------------------------------------------------------------RKTVLDIQR-M-----
D7CJ47_SYNLT/3-261----------------------------------------------------------------RVTTTLLRE-K-----
Q6FJH7_CANGA/29-292----------------------------------------------------------------.KTILDLQR-K-----
D8M6X1_BLAHO/33-296----------------------------------------------------------------KVTVSTIAS-K-----
E1SVW3_FERBD/3-259----------------------------------------------------------------RITTSTLNR-Y-----
PANB_METS5/3-254----------------------------------------------------------------RLTIRDFLK-K-----
C1EBW8_MICCC/72-335----------------------------------------------------------------RMTLKRLRA-K-----
J7S291_KAZNA/30-296----------------------------------------------------------------RTTLSDITG-R-----
B8MWV2_ASPFN/53-313----------------------------------------------------------------KVTIQTLQS-L-----
PANB_GLUDA/2-258----------------------------------------------------------------RITLFDVQA-M-----
PANB3_BRADU/9-264----------------------------------------------------------------RKTAPDLRI-R-----
PANB_HALMA/3-256----------------------------------------------------------------..TVRDLQA-M-----
PANB_STAA8/2-256----------------------------------------------------------------.KTVSQLID-M-----
G4RCR9_PELHB/16-265----------------------------------------------------------------......ILA-R-----
F7YY72_9THEM/2-258----------------------------------------------------------------.ITLQKLIS-M-----
D2W044_NAEGR/75-331----------------------------------------------------------------.VTLQCINY-K-----
F4C347_SPHS2/9-267----------------------------------------------------------------KVTVNSILE-M-----
B1I1N7_DESAP/5-263----------------------------------------------------------------RLTTLDIRR-K-----
A8NPY9_COPC7/58-317----------------------------------------------------------------KVTIQTLHS-L-----
R5E9H5_9CLOT/2-260----------------------------------------------------------------KNTVLTFKQ-A-----
B8J200_DESDA/2-259----------------------------------------------------------------KNTVVTFRA-A-----
V4IHK4_9GAMM/6-262----------------------------------------------------------------.ITSASLVR-M-----
PANB_CUPMC/11-266----------------------------------------------------------------TVTIPKLQA-M-----
PANB_SYNJB/4-259----------------------------------------------------------------.LSIHHFRQ-A-----
PANB_SACEN/31-288----------------------------------------------------------------RVRTRHLLE-L-----
G0VBF0_NAUCC/42-307----------------------------------------------------------------PITIPDIHS-K-----
D2SAW9_GEOOG/14-271----------------------------------------------------------------RVRVHHLQQ-A-----
A5FWA4_ACICJ/13-269----------------------------------------------------------------.KSIGSWER-A-----
N0B2M6_9RHIZ/10-264----------------------------------------------------------------.LMAPDITA-R-----
H9UMW1_SPIAZ/3-258----------------------------------------------------------------..RLADFPV-R-----
PANB_CAMFF/3-258----------------------------------------------------------------KVTINDLFM-M-----
G7USF2_PSEUP/10-266----------------------------------------------------------------.WTVPALRQ-A-----
A0A0D2VT44_CAPO3/54-312----------------------------------------------------------------KRTIIDLKK-M-----
A8ZX35_DESOH/4-253----------------------------------------------------------------...LSVFRD-Y-----
PANB_CAUCR/12-266----------------------------------------------------------------.LAAPDIAA-R-----
D5WPY7_KYRT2/8-259----------------------------------------------------------------.......FR-K-----
I0JN82_HALH3/5-258----------------------------------------------------------------....SQFIK-M-----
E4T2P1_PALPW/10-268----------------------------------------------------------------RVTTQRLLE-M-----
E4U845_OCEP5/3-257----------------------------------------------------------------KLTIPELKS-R-----
B8IX11_METNO/22-279----------------------------------------------------------------KRTITDIRN-S-----
PANB_PARL1/9-264----------------------------------------------------------------RVTVPEIRA-R-----
C1D7E8_LARHH/49-306----------------------------------------------------------------KVTVSTLAR-L-----
PANB_YEAST/26-290----------------------------------------------------------------.NTIQDIRN-K-----
I1XL09_METNJ/3-260----------------------------------------------------------------RTSLNQLRK-M-----
PANB_TRIEI/2-260----------------------------------------------------------------AVTTKQLIQ-W-----
K7AE29_9ALTE/3-259----------------------------------------------------------------KVTTSSLLK-M-----
S2J9Z0_MUCC1/36-294----------------------------------------------------------------KVSIKTIQS-L-----
W0EVM7_9BACT/9-267----------------------------------------------------------------RVTTHTLAK-M-----
PANB_CALMQ/5-260----------------------------------------------------------------KVTIRYFLE-S-----
S0EZ89_CHTCT/9-267----------------------------------------------------------------RITVPELRA-R-----
Q6CE35_YARLI/40-298----------------------------------------------------------------KVTIPELAK-M-----
R5ACL8_9FIRM/2-260----------------------------------------------------------------KNTVATLQQ-Q-----
G8R5C5_OWEHD/10-268----------------------------------------------------------------KVTTNSVQE-M-----
PANB_TOLAT/3-259----------------------------------------------------------------KISLTQVQK-M-----
B3QT33_CHLT3/14-276----------------------------------------------------------------QVTTRKLVE-M-----
B0VG23_CLOAI/8-266----------------------------------------------------------------KTDIAVFKE-M-----
G8B7V6_CANPC/30-291----------------------------------------------------------------RKTVADIHQ-F-----
D5UXM6_TSUPD/25-282----------------------------------------------------------------KVRIHHLAD-L-----
W0DU54_9GAMM/2-258----------------------------------------------------------------KKTLKQLYK-M-----
F0YK17_AURAN/2-266----------------------------------------------------------------.TTAMSLLR-M-----
N1QBK2_PSEFD/41-301----------------------------------------------------------------KTSLQTLKS-M-----
G8TR11_NIAKG/11-269----------------------------------------------------------------KITTHTLQK-M-----
K0NQW1_DESTT/4-258----------------------------------------------------------------RVTTSTLIK-M-----
C5DIL6_LACTC/24-292----------------------------------------------------------------.KTLADLFS-K-----
F4B4G2_ACIHW/4-258----------------------------------------------------------------KITVKSFLK-K-----
PANB_DESAG/9-266----------------------------------------------------------------AITAADIRA-A-----
E1QGK1_DESB2/5-263----------------------------------------------------------------KVTISDLYQ-K-----
F9Z613_ODOSD/10-267----------------------------------------------------------------.VTTHVLSE-M-----
R6QG64_9CLOT/9-267----------------------------------------------------------------DVTVNTFFK-K-----
PANB_NEIG1/2-257----------------------------------------------------------------.ITVNTLQK-M-----
PANB_ALKMQ/4-261----------------------------------------------------------------KKSILDLMK-M-----
F0LTK0_VIBFN/3-259----------------------------------------------------------------KITINDLMK-W-----
A5D5T4_PELTS/5-263----------------------------------------------------------------KVTTATIKQ-M-----
PANB_TROWT/13-267----------------------------------------------------------------RTRIHRFHK-.-----
J7IT73_DESMD/3-259----------------------------------------------------------------..STKDFWV-Q-----
D4KZZ1_9FIRM/4-262----------------------------------------------------------------KNTVVTLQK-Q-----
PANB_SACD2/11-266----------------------------------------------------------------KVTVNTLRK-M-----
PANB_CYAP8/2-257----------------------------------------------------------------AMTLPYLIQ-A-----
PANB1_ZYMMO/33-296----------------------------------------------------------------KTTTARISQ-M-----
PANB1_HAHCH/9-265----------------------------------------------------------------RITIPQIRS-M-----
B4U641_HYDS0/4-261----------------------------------------------------------------KLNIELLFK-K-----
C7PAE1_CHIPD/9-267----------------------------------------------------------------RITTHILQK-M-----
PANB_EXISA/3-259----------------------------------------------------------------..TMTTLLK-K-----
PANB_FRAAA/42-298----------------------------------------------------------------RFTVRDVAA-A-----
A8GIZ6_SERP5/25-281----------------------------------------------------------------PTTVTHLHQ-W-----
PANB_MARMS/13-269----------------------------------------------------------------AVTLSTLKK-M-----
B9I8Q3_POPTR/46-310----------------------------------------------------------------RVTLTHLKQ-K-----
W8X8F9_CASDE/9-264----------------------------------------------------------------RVTVPQLVS-F-----
C7MWE6_SACVD/37-294----------------------------------------------------------------RVRIHHLRE-L-----
W8TJC5_EUBAC/5-263----------------------------------------------------------------KFTVSSFME-S-----
R6MRV8_9FIRM/2-260----------------------------------------------------------------KNTTVTFKN-K-----
E1R683_SPISS/12-255----------------------------------------------------------------KVT......-.-----
E0TIB5_PARBH/9-264----------------------------------------------------------------RQTAASITA-R-----
C9R9H9_AMMDK/3-261----------------------------------------------------------------KVTTADFRR-W-----
L0ECE9_THECK/4-262----------------------------------------------------------------.LTVTKWLK-M-----
PANB_RHIEC/9-265----------------------------------------------------------------RLTPPRISA-M-----
PANB_RHOS4/11-264----------------------------------------------------------------..MAADILA-R-----
C8W3T9_DESAS/5-263----------------------------------------------------------------KVTTATFRN-M-----
H8GHP8_METAL/6-259----------------------------------------------------------------.LSIHDLAA-M-----
R6FWR6_9CLOT/2-260----------------------------------------------------------------KNTVVTFKQ-A-----
Q7NSX9_CHRVO/10-253----------------------------------------------------------------RVTVPAIRN-S-----
PANB_DESVH/21-277----------------------------------------------------------------.LTTADIRK-A-----
PANB_SINFN/11-264----------------------------------------------------------------..SPASIEA-L-----
K9SDR5_9CYAN/2-259----------------------------------------------------------------AVTVRQLMQ-R-----
R6FYY2_9FIRM/2-260----------------------------------------------------------------KNTVTTFQA-M-----
PANB_THIDA/2-258----------------------------------------------------------------PVTLSTLKA-L-----
PANB2_METPP/16-274----------------------------------------------------------------PVTLHTLRE-M-----
PANB_ROSS1/2-259----------------------------------------------------------------RKTITDIQQ-M-----
H6C1C9_EXODN/62-322----------------------------------------------------------------PVTIQTLQK-M-----
F2NLZ2_MARHT/3-259----------------------------------------------------------------KLTVLDLKA-K-----
F0R8P2_BACSH/11-269----------------------------------------------------------------KVTTHRLME-M-----
D5SWW3_PLAL2/21-276----------------------------------------------------------------RMTVPRFQG-A-----
R5EQ78_9GAMM/2-259----------------------------------------------------------------KVTVATFAK-M-----
E8U6D3_DEIML/3-257----------------------------------------------------------------.LTVPDIVR-A-----
B3PI46_CELJU/20-275----------------------------------------------------------------SVTINTLYK-L-----
PANB_SYNFM/4-261----------------------------------------------------------------RVTVPEIIA-S-----
H2J7Z9_MARPK/2-256----------------------------------------------------------------..SIRKFLK-M-----
PANB_CHRSD/3-259----------------------------------------------------------------TVTLSRLNA-F-----
H8L6Y3_FRAAD/13-270----------------------------------------------------------------PVTAPGLRA-M-----
PANB_DEHM1/2-259----------------------------------------------------------------RTTISQLKE-M-----
PANB_HELHP/5-260----------------------------------------------------------------KMSIATLKA-K-----
B2GG07_KOCRD/16-273----------------------------------------------------------------RVRTVHLQR-A-----
J3YT69_9ENTR/2-257----------------------------------------------------------------.TTISHLQT-W-----
PANB_RUTMC/2-256----------------------------------------------------------------..NIEALNN-F-----
F4KKJ6_PORAD/11-269----------------------------------------------------------------KVTTRRLLE-M-----
E4TNZ1_MARTH/10-268----------------------------------------------------------------KITTHQLQE-M-----
PANB_ACIAD/3-261----------------------------------------------------------------..SLSDLRK-F-----
M1E8E9_9FIRM/4-260----------------------------------------------------------------KLYAPDIIK-L-----
H2FZS0_OCESG/3-259----------------------------------------------------------------KITTARLQA-M-----
E3D016_9BACT/4-262----------------------------------------------------------------RMTLPRLRE-M-----
R7Y0I9_9ACTN/27-284----------------------------------------------------------------KIRTHHLRE-M-----
C7R4W8_JONDD/10-267----------------------------------------------------------------RFRVHDFAR-A-----
B3DYC2_METI4/5-256----------------------------------------------------------------KITPDWIRL-R-----
PANB_PARP8/11-267----------------------------------------------------------------AVTVPKLMA-M-----
PANB_OCEIH/3-256----------------------------------------------------------------..ALKDFMR-M-----
K4LJP4_9FIRM/4-262----------------------------------------------------------------KVNINALQN-K-----
C7M6V0_CAPOD/10-268----------------------------------------------------------------RVTTKSIVE-M-----
E6SG79_THEM7/29-287----------------------------------------------------------------RVTVRTVLE-S-----
H0UKG2_9BACT/4-262----------------------------------------------------------------KMSVLDFKR-Y-----
G0AG10_COLFT/18-274----------------------------------------------------------------PITIPALQA-L-----
D0MKC7_RHOM4/15-273----------------------------------------------------------------RVTTQTLQE-M-----
K9TFZ3_9CYAN/2-258----------------------------------------------------------------PITPQQLIE-R-----
PANB_SYNY3/2-258----------------------------------------------------------------AITPTQLLD-W-----
PANB_CHRVO/2-258----------------------------------------------------------------KITVNTLHK-L-----
PANB_PYRAE/11-257----------------------------------------------------------------.........-V-----
D3G0K7_BACPE/3-259----------------------------------------------------------------..TTATFKK-M-----
G8ZML5_TORDC/45-310----------------------------------------------------------------SNTIHDMHN-A-----
B8GNA9_THISH/9-265----------------------------------------------------------------RITTRRLQE-M-----
PANB_YERPE/3-260----------------------------------------------------------------TTTMSQLRQ-W-----
PANB_HALHL/14-269----------------------------------------------------------------.VTVSRMRA-M-----
I7H5U9_9HELI/5-260----------------------------------------------------------------KMSITDLQA-K-----
PANB_FLAJ1/10-268----------------------------------------------------------------RITTKSLIE-M-----
H2AZP6_KAZAF/28-293----------------------------------------------------------------RITIQDIQK-K-----
PANB_HYPNA/9-263----------------------------------------------------------------RKTVKDIAA-A-----
F0T218_SYNGF/3-260----------------------------------------------------------------KKTILDFWK-M-----
K0J2M4_AMPXN/5-260----------------------------------------------------------------....FEFLK-M-----
PANB_PELPD/7-264----------------------------------------------------------------KVTIPDILK-M-----
PANB_ACAM1/2-259----------------------------------------------------------------AVTIHQLRT-W-----
R5HLC5_9SPIR/4-262----------------------------------------------------------------KVTVNTIQK-Y-----
E6W3R1_DESIS/9-267----------------------------------------------------------------KITTTAVMS-M-----
E8WV64_GRATM/17-275----------------------------------------------------------------KVTPQTLLD-R-----
B0RBZ8_CLAMS/26-283----------------------------------------------------------------RVRIRHFAR-A-----
R7J318_9BACT/11-269----------------------------------------------------------------KVTTARLTE-M-----
D1C1L8_SPHTD/5-263----------------------------------------------------------------RVTIADLKA-M-----
D5CQ24_SIDLE/3-260----------------------------------------------------------------RKTLSTLQA-M-----
K9U8V4_9CYAN/2-257----------------------------------------------------------------PITTQQLIQ-W-----
R7Z1Y2_CONA1/60-319----------------------------------------------------------------KVTLGTLRA-L-----
A3GFD5_PICST/27-288----------------------------------------------------------------RKTVADINR-F-----
PANB_GEOMG/4-262----------------------------------------------------------------KKTIIDIQK-M-----
D1B8U6_THEAS/5-263----------------------------------------------------------------KVTIPALRE-M-----
D1AZH1_SULD5/18-272----------------------------------------------------------------.KTITSIKQ-H-----
K9V2Q3_9CYAN/2-257----------------------------------------------------------------PVTIQQLIQ-W-----
G4TES8_SERID/16-274----------------------------------------------------------------KVTLARLAE-M-----
PANB_AERHH/3-259----------------------------------------------------------------KITTTNLLK-M-----
B5Y864_COPPD/3-251----------------------------------------------------------------...ATQFKK-L-----
E6VV69_DESAO/18-273----------------------------------------------------------------.VTAPDIMA-R-----
D0LB03_GORB4/26-283----------------------------------------------------------------KTRVHHLAQ-M-----
R4XB88_TAPDE/13-270----------------------------------------------------------------.LNLGTIQK-L-----
C5XKA7_SORBI/74-338----------------------------------------------------------------RVTLATLRG-K-----
PANB_HELMI/4-262----------------------------------------------------------------KITLPQCKE-M-----
D4ZUG3_ARTPN/2-258----------------------------------------------------------------AVTTQQLID-W-----
D3AXV1_POLPA/114-372----------------------------------------------------------------KTTILDIKK-K-----
W5Y2G7_9CORY/15-272----------------------------------------------------------------KIRVSDLVK-L-----
W0IZ08_9BACT/4-264----------------------------------------------------------------...VLDFKA-R-----
G3AZ68_CANTC/24-285----------------------------------------------------------------RNTIADIYS-M-----
E8R215_ISOPI/23-275----------------------------------------------------------------..QPPDLIR-Y-----
R4KP81_9FIRM/5-263----------------------------------------------------------------KANILTFKE-M-----
K5W3S2_PHACS/44-303----------------------------------------------------------------KVTIQHLHH-L-----
A9WS61_RENSM/30-287----------------------------------------------------------------KIRVHHLQQ-A-----
PANB_ANADF/10-272----------------------------------------------------------------RVTIHELRR-M-----
PANB_THEM4/1-256----------------------------------------------------------------.MTIQKFLA-M-----
PANB_SULSO/3-259----------------------------------------------------------------KVTIRDFIK-K-----
F0S244_DESTD/2-259----------------------------------------------------------------AITTATFLE-K-----
B9L4S0_THERP/5-263----------------------------------------------------------------RVTVADLRA-M-----
C8WT97_ALIAD/4-262----------------------------------------------------------------TVTVRTLAN-M-----
PANB_STAEQ/2-256----------------------------------------------------------------.KTLNHLNK-M-----
PANB_OLICO/9-264----------------------------------------------------------------RKTAPEIFA-R-----
F6FX13_ISOV2/15-272----------------------------------------------------------------RVRVHHLAE-A-----
PANB_GEODF/4-262----------------------------------------------------------------ATTILDIQK-M-----
D9QPL3_ACEAZ/4-262----------------------------------------------------------------KKSILDFME-M-----
F2JV64_MARM1/12-268----------------------------------------------------------------PVTLSKLRK-M-----
E0UCI4_CYAP2/2-257----------------------------------------------------------------AVTTGQIIK-W-----
D5EMA1_CORAD/2-258----------------------------------------------------------------SISTQTIAR-L-----
G2IWQ8_PSEUL/2-259----------------------------------------------------------------KINVNTLFK-M-----
X2GVH3_9BACI/3-258----------------------------------------------------------------..TTSDFLK-M-----
D6XUX0_BACIE/3-260----------------------------------------------------------------..TTSDFRT-M-----
D6Z2X7_DESAT/7-263----------------------------------------------------------------..TVCDLAA-K-----
PANB_KORVE/11-269----------------------------------------------------------------KVTSSTLLD-K-----
A6QC29_SULNB/11-266----------------------------------------------------------------KITLSTISA-M-----
D3V561_XENBS/3-258----------------------------------------------------------------PTTLTDLSQ-L-----
C6X7E4_METGS/1-265----------------------------------------------------------------.MTVHDLQT-M-----
D7WER9_9CORY/10-268----------------------------------------------------------------KVRVADLRQ-K-----
R5HUC8_9FIRM/3-261----------------------------------------------------------------QNNVVTLAA-M-----
R5U8N9_9FIRM/2-260----------------------------------------------------------------KTTVSTLKK-Q-----
PANB_HYPBU/6-262----------------------------------------------------------------KVTVRDIVR-A-----
B8P6R4_POSPM/2-261----------------------------------------------------------------KVTIQHLHS-L-----
PANB_SHELP/3-259----------------------------------------------------------------KITSSTLLK-F-----
PANB_CHLAA/2-258----------------------------------------------------------------RITIRDIQQ-M-----
PANB_PHOLL/3-258----------------------------------------------------------------PMTMTDLNQ-L-----
PANB_CLOK5/3-261----------------------------------------------------------------KNNVSTFVS-A-----
I0HQJ4_RUBGI/17-276----------------------------------------------------------------.LNLVRLRE-M-----
R5ZHJ8_9FIRM/2-260----------------------------------------------------------------KTTVTTLQN-M-----
U5MUW3_CLOSA/2-260----------------------------------------------------------------KNTILTFKK-A-----
A0A068NY03_9BACT/4-257----------------------------------------------------------------RVTVPHIRA-M-----
K9T7C7_9CYAN/2-258----------------------------------------------------------------AVTIQQLIQ-W-----
PANB_AZOPC/10-268----------------------------------------------------------------KITIQHLIE-M-----
K3W4X2_PYTUL/57-320----------------------------------------------------------------KVTTLDLGI-L-----
A1CTJ0_ASPCL/72-332----------------------------------------------------------------KVTMQTLRS-L-----
A6WW04_OCHA4/18-274----------------------------------------------------------------RLTPKAISA-L-----
V5SAA2_9RHIZ/10-264----------------------------------------------------------------.LMAPDISA-L-----
D3HPA3_LEGLN/2-258----------------------------------------------------------------..KIQDFKR-K-----
R5BRB9_9FIRM/4-262----------------------------------------------------------------KKCIHDLYK-M-----
B1VGE7_CORU7/16-274----------------------------------------------------------------QVRISDLTA-R-----
W0RJ42_9BACT/5-261----------------------------------------------------------------.VTTGDLAA-M-----
PANB_PARDP/15-266----------------------------------------------------------------.....DIRA-R-----
D5QI36_KOMHA/9-263----------------------------------------------------------------RRTIRDVT.-.-----
D1BSH7_XYLCX/21-280----------------------------------------------------------------RVTPPSLAA-L-----
L0DD73_SINAD/8-261----------------------------------------------------------------.VTPPDFAR-W-----
PANB_PEPD6/2-260----------------------------------------------------------------KNTIQTFKN-A-----
PANB_THEMA/2-256----------------------------------------------------------------..NVEKLKK-M-----
C7N2J4_SLAHD/19-269----------------------------------------------------------------..NLAYLQK-Q-----
A4SZR6_POLSQ/9-266----------------------------------------------------------------PITITKLLA-M-----
D7B2F6_NOCDD/27-283----------------------------------------------------------------RVTIRDLAA-A-----
H3ZNX9_THELN/3-257----------------------------------------------------------------EITPKKIME-M-----
M4UAA2_9GAMM/3-259----------------------------------------------------------------RISVSHLMK-M-----
K9QBM1_9NOSO/2-258----------------------------------------------------------------PVTTQQLIQ-W-----
PANB_SALTY/3-258----------------------------------------------------------------PTTISLLQK-C-----
W0E2Q1_MARPU/6-262----------------------------------------------------------------.TTVASLAA-M-----
I1YQZ3_PREI7/10-268----------------------------------------------------------------KITAKTLRE-M-----
L0A954_CALLD/5-260----------------------------------------------------------------KLTIRDIMK-M-----
D4Z3Z8_SPHJU/23-282----------------------------------------------------------------RLTVPAIQR-R-----
E6WRV2_PSEUU/10-266----------------------------------------------------------------.WTVPALAE-A-----
F9ZNB5_ACICS/4-257----------------------------------------------------------------..KLEVWRR-G-----
R5AXG3_9BACT/10-268----------------------------------------------------------------KVTTRRLVE-M-----
R6QI65_9FIRM/2-260----------------------------------------------------------------KNTVSTFQK-M-----
F4L4T8_HALH1/9-267----------------------------------------------------------------RITTHVLQA-M-----
PANB_COLP3/3-259----------------------------------------------------------------KITTASLLN-M-----
D2B380_STRRD/20-276----------------------------------------------------------------RITVRDIAA-A-----
Q54LH3_DICDI/91-349----------------------------------------------------------------KKTVLDILK-K-----
R6RU48_9CLOT/2-260----------------------------------------------------------------KNTAVTFKN-A-----
C7QBN8_CATAD/33-291----------------------------------------------------------------RVTVRDLAK-A-----
E8NFW7_MICTS/5-263----------------------------------------------------------------RVTLRRLSE-L-----
PANB_THET8/2-257----------------------------------------------------------------RRTVKDFRN-.-----
M1PUL5_DESSD/4-262----------------------------------------------------------------RKTVAGILA-M-----
PANB_HERA2/2-258----------------------------------------------------------------RTQLSDIQR-M-----
PANB_CORDI/5-259----------------------------------------------------------------.VRLQDLRD-Y-----
G8P0T0_GRAMM/17-275----------------------------------------------------------------RVTADVLLQ-K-----
B0JGU8_MICAN/2-253----------------------------------------------------------------AVTTSKLIE-W-----
A4RSY4_OSTLU/35-299----------------------------------------------------------------RFTLGELRK-K-----
G0VMJ3_MEGEL/4-263----------------------------------------------------------------KVTNLTIKK-M-----
G8JVR3_ERECY/22-285----------------------------------------------------------------QKTIPDLLQ-K-----
D4ALU8_ARTBC/69-329----------------------------------------------------------------KVTIKSLEA-L-----
D8IYH6_HERSS/15-271----------------------------------------------------------------PVTTHTLQA-M-----
D5EGN8_AMICL/9-262----------------------------------------------------------------.....EFVK-M-----
K0CGS1_ALCDB/3-252----------------------------------------------------------------KKHAQALME-M-----
M3HH38_CANMX/30-289----------------------------------------------------------------RKTIEDIHQ-L-----
H8KSY4_SOLCM/9-267----------------------------------------------------------------RITTNTVQE-M-----
Q75D37_ASHGO/24-287----------------------------------------------------------------QKTIPDIFK-K-----
E4RTA9_LEAB4/5-263----------------------------------------------------------------RITTNTLRE-F-----
PANB_DESAA/4-258----------------------------------------------------------------KVTVTVLAK-M-----
D3DI50_HYDTT/5-262----------------------------------------------------------------.ITIRHLFK-K-----
T1KER8_TETUR/72-325----------------------------------------------------------------KVRTIDIVS-M-----
D9QLF2_BRESC/11-266----------------------------------------------------------------RLAAPDIMK-R-----
F8I3G8_SULAT/4-259----------------------------------------------------------------KLTAPELRR-Q-----
E8SI87_STAPH/2-256----------------------------------------------------------------.KTLNHIQQ-M-----
D5BZ31_NITHN/3-259----------------------------------------------------------------RLTLTKLRK-M-----
PANB_ACIC1/10-267----------------------------------------------------------------RVTIHDLQL-R-----
PANB_BUCAI/3-259----------------------------------------------------------------SITISQLKN-W-----
D8RRV3_SELML/38-302----------------------------------------------------------------RVTLRHLQS-K-----
R5IEN0_9BACT/10-267----------------------------------------------------------------.MTTHRLLE-M-----
R5LDT0_9FIRM/2-259----------------------------------------------------------------.TTVTTLMN-M-----
D6ZCH0_SEGRD/15-271----------------------------------------------------------------RVRISHLHE-M-----
PANB_LEPIN/9-261----------------------------------------------------------------.......SP-E-----
PANB_FRATT/7-257----------------------------------------------------------------......FKK-A-----
W0EB65_9FIRM/2-259----------------------------------------------------------------RKTVPYFFQ-M-----
PANB_IDILO/5-261----------------------------------------------------------------KTSIATLQK-M-----
PANB2_HAHCH/2-258----------------------------------------------------------------SITLSTLLD-L-----
PANB_CHLPD/11-273----------------------------------------------------------------HVTTRKLLD-M-----
F0VHK9_NEOCL/2-249----------------------------------------------------------------....ADLLQ-R-----
W5X1Y4_BDEBC/3-258----------------------------------------------------------------..SILEFQE-A-----
PANB_ACISJ/26-287----------------------------------------------------------------.VSLPRLAQ-M-----
PANB_SULTO/3-259----------------------------------------------------------------KVTIRDFLK-K-----
U4KYW8_PYROM/61-321----------------------------------------------------------------KVTINTLRN-L-----
G8M4H3_9BURK/11-267----------------------------------------------------------------TITVPKLQA-M-----
R7I0S5_9CLOT/17-275----------------------------------------------------------------KHTVLTLQE-Q-----
PANB_LEGPH/2-258----------------------------------------------------------------..KIHDFKI-K-----
PANB_PSYIN/3-259----------------------------------------------------------------KISVSRLTK-M-----
B4EJY2_BURCJ/9-265----------------------------------------------------------------RKTVTAIRS-T-----
C3PI15_CORA7/10-267----------------------------------------------------------------RLRTRHFAR-A-----
D4G919_RIEPU/9-267----------------------------------------------------------------.TTIEDIRI-W-----
I7A1E3_MELRP/3-258----------------------------------------------------------------..TVSEFRK-S-----
R6HBG1_9ACTN/2-260----------------------------------------------------------------KNTVATFKK-M-----
C5ZWV0_9HELI/9-263----------------------------------------------------------------QTTITQILE-K-----
PANB_STAMF/3-258----------------------------------------------------------------KITIRDILK-M-----
PANB_CYTH3/10-268----------------------------------------------------------------KVTTHQLQE-M-----
H5WJ91_9BURK/17-281----------------------------------------------------------------...LVRLRD-M-----
PANB_ALCBS/2-258----------------------------------------------------------------SITIRTLQK-R-----
B2V9F5_SULSY/3-258----------------------------------------------------------------..SINEFFK-A-----
I4ANF3_FLELS/11-269----------------------------------------------------------------RITTHSLQE-M-----
B6H969_PENRW/50-309----------------------------------------------------------------KVTIQTIQN-L-----
X2GXI3_9GAMM/2-259----------------------------------------------------------------KKTILTLQQ-R-----
G4V1E0_NEUT9/11-271----------------------------------------------------------------KVTLNTLQS-M-----
C5ME17_CANTT/28-287----------------------------------------------------------------RKTLADIRQ-L-----
K9UIR8_9CYAN/3-253----------------------------------------------------------------..TVRQLLQ-Y-----
A9GRC2_SORC5/21-278----------------------------------------------------------------KVTVPEIRS-R-----
R5NDJ7_9BACT/11-269----------------------------------------------------------------KVTTHRLIE-M-----
D2QWS1_PIRSD/7-261----------------------------------------------------------------RVTVPEFVS-F-----
C7RR60_ACCPU/9-266----------------------------------------------------------------RLTQLDLAR-M-----
PANB_MAGMM/4-262----------------------------------------------------------------RVRVPDLVR-M-----
PANB_SYNWW/3-261----------------------------------------------------------------RVTVSVLKD-K-----
D5AMQ4_RHOCB/10-264----------------------------------------------------------------.LMPSDILA-L-----
PANB_BACHD/3-259----------------------------------------------------------------..TTASFKK-M-----
D0LJC1_HALO1/5-263----------------------------------------------------------------KVTIHTLQQ-K-----
PANB_METS4/17-272----------------------------------------------------------------.VTIPMLQA-W-----
B2UME9_AKKM8/9-253----------------------------------------------------------------....ERIRA-C-----
R5BAJ9_9BACE/11-269----------------------------------------------------------------KVTTALLRK-M-----
PANB_EDWI9/4-259----------------------------------------------------------------.TTLSHLRK-R-----
R4KDW0_CLOPA/2-260----------------------------------------------------------------KNTSSTFVS-A-----
PANB_CALS8/3-260----------------------------------------------------------------KVTTKTLFE-K-----
D8QAA7_SCHCM/53-309----------------------------------------------------------------KVTVADLQK-M-----
R5KL99_9CLOT/2-260----------------------------------------------------------------KNTTTSIMQ-M-----
E3JA95_FRASU/46-302----------------------------------------------------------------RPTVRDLAT-W-----
D6ZI06_MOBCV/16-270----------------------------------------------------------------.FRVQHVQQ-Y-----
I3Y5B5_THIV6/6-262----------------------------------------------------------------.ISVTALAA-M-----
U5Q4L3_9BACT/10-267----------------------------------------------------------------.ITTQRLLE-M-----
B8DSD1_DESVM/24-276----------------------------------------------------------------.....DVRA-A-----
PANB_PROMH/3-258----------------------------------------------------------------PVTLSTLNR-Y-----
R7JBN8_9FUSO/4-262----------------------------------------------------------------KVTVNTIQK-Y-----
M1WKJ2_DESPC/25-280----------------------------------------------------------------.VTAPSVQA-S-----
W0BBT9_9GAMM/2-258----------------------------------------------------------------..KIHDFKR-K-----
R5IDU3_9FIRM/17-266----------------------------------------------------------------.KTINYLQK-L-----
A6RA45_AJECN/56-315----------------------------------------------------------------KVTIKSLRA-L-----
PANB_SYNP2/2-257----------------------------------------------------------------RVTPRTLQN-Y-----
E4NAD9_KITSK/28-286----------------------------------------------------------------RVTVRDLAK-A-----
I3Z4N3_BELBD/11-269----------------------------------------------------------------RITTHTLQE-M-----
D5X9N1_THEPJ/5-263----------------------------------------------------------------KVTTLTLKQ-K-----
D8JZZ5_DEHLB/2-260----------------------------------------------------------------RTTIQAVRD-F-----
C7NW69_HALMD/3-255----------------------------------------------------------------...ANDIRA-K-----
K4LLM0_THEPS/3-261----------------------------------------------------------------RVTTATLLE-M-----
PANB_XANP2/9-264----------------------------------------------------------------RITAPQIQA-R-----
PANB_GEOBB/4-262----------------------------------------------------------------QRTILDFQR-M-----
PANB_GLOVI/3-254----------------------------------------------------------------.LSIHSLRK-L-----
A6WD73_KINRD/16-272----------------------------------------------------------------RTRVHHFQQ-W-----
B5YIG6_THEYD/2-260----------------------------------------------------------------RFTVTDLLM-K-----
H1XZL4_9SPHI/9-267----------------------------------------------------------------KITTNTLQA-M-----
C6CUG2_PAESJ/4-263----------------------------------------------------------------RLTITNLKK-M-----
PANB_ERYLH/23-282----------------------------------------------------------------RLTVPKIRA-R-----
PANB_SCHPO/5-262----------------------------------------------------------------QITISTLRQ-W-----
D1CBZ3_THET1/7-265----------------------------------------------------------------KVTIQDLIR-L-----
K9XAD9_9CHRO/2-257----------------------------------------------------------------AVTIQQLIQ-W-----
PANB_PSEHT/3-259----------------------------------------------------------------KITVSTLNK-M-----
PANB_RUEST/10-264----------------------------------------------------------------.LTAEDIRA-M-----
V6JUX0_STRRC/32-289----------------------------------------------------------------RITVRDITL-A-----
R6BVU7_9BACT/10-268----------------------------------------------------------------KITTKTFAE-M-----
C4R687_KOMPG/26-284----------------------------------------------------------------QSTLRTLYS-K-----
K9XXG3_STAC7/2-258----------------------------------------------------------------AITIQQLQK-W-----
A5DHH9_PICGU/32-292----------------------------------------------------------------RKTLADIKQ-L-----
I2ESX7_EMTOG/9-267----------------------------------------------------------------RVTTHTLQE-L-----
PANB_COXBU/4-260----------------------------------------------------------------.MNTPDFQR-M-----
B1X124_CYAA5/10-265----------------------------------------------------------------.LTTQQLIT-W-----
D5EWH2_PRER2/2-259----------------------------------------------------------------RKSIFDLLE-R-----
G2LF65_CHLTF/5-263----------------------------------------------------------------RVTPGDLTR-L-----
F6EEK6_HOYSD/18-275----------------------------------------------------------------KTRIHHLQA-L-----
G8RMJ4_MYCRN/4-264----------------------------------------------------------------KVKLADLQD-M-----
G8AKD6_AZOBR/9-265----------------------------------------------------------------RVSVPALRA-R-----

PF09370

I0GM51_SELRL/8-273-----------------------------------------------------------------DILAGLRE-N-----
A8MIW7_ALKOO/5-271-----------------------------------------------------------------EILANFRE-R-----
U5RTA7_9CLOT/8-273-----------------------------------------------------------------EIIAGFKK-Q-----
D3EFW8_GEOS4/8-274-----------------------------------------------------------------EVLAKLKS-E-----
A0Q268_CLONN/3-268-----------------------------------------------------------------DILDKLKK-R-----
I0GM52_SELRL/9-273-----------------------------------------------------------------.ILRRLRA-E-----
R5TZH9_9CLOT/6-271-----------------------------------------------------------------EILKRLRA-Q-----
A5I210_CLOBH/5-270-----------------------------------------------------------------KILENLKS-Q-----
B2TMB2_CLOBB/6-270-----------------------------------------------------------------EIIKNLNL-Q-----
E3GQA3_EUBLK/6-271-----------------------------------------------------------------AFLEKLRR-E-----
D3EFX0_GEOS4/19-284-----------------------------------------------------------------QVLDRLHR-G-----
K8END7_CARML/5-271-----------------------------------------------------------------KITKKIRR-E-----
E3DLS5_HALPG/3-268-----------------------------------------------------------------.IQNRIEK-S-----
Q893M0_CLOTE/5-270-----------------------------------------------------------------VILKTMEN-S-----
H6LDM1_ACEWD/6-271-----------------------------------------------------------------AIEKMIKN-S-----
G8AJD8_AZOBR/12-277-----------------------------------------------------------------QLLDDLRR-A-----
Q981G5_RHILO/24-290-----------------------------------------------------------------EIVAGLKA-T-----
H7C7V3_BRADU/40-302-----------------------------------------------------------------....GIRQ-F-----
L0D7P4_SINAD/6-270-----------------------------------------------------------------....KLFA-S-----
B2JXP4_PARP8/9-270-----------------------------------------------------------------.IRDGLLR-Q-----
K4LCM9_THEPS/9-273-----------------------------------------------------------------QVLERLRK-E-----
Q0RZM6_RHOJR/7-274-----------------------------------------------------------------QVVDRLNT-Q-----
K4LRH4_THEPS/9-277-----------------------------------------------------------------EVLKRLKK-T-----
D6DGJ5_CLOSC/7-273-----------------------------------------------------------------EILRRLRK-N-----
A4FLF5_SACEN/6-272-----------------------------------------------------------------EIVRRLRA-K-----
G7V878_THELD/7-273-----------------------------------------------------------------EILEKLRK-K-----
I0HWG9_RUBGI/8-274-----------------------------------------------------------------QILDTFRA-K-----
Y4OV_SINFN/14-280-----------------------------------------------------------------ELIDRFHS-K-----
Q92YY4_RHIME/8-274-----------------------------------------------------------------TILEKFHG-M-----
D5BMI1_PUNMI/9-274-----------------------------------------------------------------SILKRLRA-K-----
I3TKL1_TISMK/9-274-----------------------------------------------------------------.LMDRFRR-M-----
J7TQW5_MORMO/8-273-----------------------------------------------------------------.LLKKFND-M-----
Q2RQL8_RHORT/9-274-----------------------------------------------------------------.LLETFHE-M-----
Q89PU9_BRADU/9-274-----------------------------------------------------------------.LLRRFRG-M-----
D3VIG2_XENNA/6-272-----------------------------------------------------------------QIIKDIKQ-K-----
Q7N7U1_PHOLL/7-273-----------------------------------------------------------------QIIETLKQ-K-----
L0D8C0_SINAD/27-292-----------------------------------------------------------------EIVKQLRK-K-----
Q7UK17_RHOBA/15-279-----------------------------------------------------------------SILSGFRK-K-----
B2ATL3_PODAN/9-281-----------------------------------------------------------------EILHRLRS-Q-----
M7SDL1_EUTLA/15-281-----------------------------------------------------------------EALEALRA-S-----
G9MDH1_HYPVG/9-275-----------------------------------------------------------------KILASLRA-R-----
T5ADJ6_OPHSC/10-273-----------------------------------------------------------------.ILANLRA-Q-----
M1WHF6_CLAP2/9-277-----------------------------------------------------------------DIVAKLRA-Q-----
M2T3U4_COCSN/9-275-----------------------------------------------------------------SILENLRS-Q-----
C8VLH6_EMENI/9-275-----------------------------------------------------------------EILSRLRA-Q-----
E9F7B6_METRA/5-271-----------------------------------------------------------------EIIQRLRG-Q-----
J4W7A5_BEAB2/10-276-----------------------------------------------------------------EILERLRG-Q-----
F9X0V4_ZYMTI/9-275-----------------------------------------------------------------QILSGFRQ-Q-----
N1PYG8_DOTSN/9-275-----------------------------------------------------------------QILDTFRK-Q-----
B8LW35_TALSN/9-275-----------------------------------------------------------------EILARLRK-V-----
C5GK37_AJEDR/9-275-----------------------------------------------------------------EVLQRLRD-T-----
B8NIT8_ASPFN/9-275-----------------------------------------------------------------EVLDRLRK-T-----
S7ZNB6_PENO1/9-275-----------------------------------------------------------------EVLARLRK-T-----
H6C7I3_EXODN/9-275-----------------------------------------------------------------EVLSHLRE-Q-----
M7TTH7_BOTF1/10-275-----------------------------------------------------------------.VLGRLKN-A-----
M2QNQ6_CERS8/9-277-----------------------------------------------------------------ETLAQLRE-I-----
F8Q7T4_SERL3/8-272-----------------------------------------------------------------..LKHLRE-C-----
D7SP84_VITVI/487-753-----------------------------------------------------------------SIIQRLKD-Q-----
K3XVH5_SETIT/468-734-----------------------------------------------------------------SILNKLKQ-H-----
D8R7X4_SELML/473-739-----------------------------------------------------------------TILANLKK-Q-----
R9NXA1_PSEHS/13-279-----------------------------------------------------------------EAVERLRA-T-----
U4LH42_PYROM/9-281-----------------------------------------------------------------EALARLHA-T-----
A5UWZ1_ROSS1/7-273-----------------------------------------------------------------EILQRLRA-Q-----
B9L5F1_THERP/10-276-----------------------------------------------------------------EALAKLRQ-T-----
I4EWM7_9ACTN/6-271-----------------------------------------------------------------.ARQRLRE-T-----
C5C4B4_BEUC1/7-272-----------------------------------------------------------------ELLDRLNA-K-----
L0DC12_SINAD/11-276-----------------------------------------------------------------EILDRFRR-K-----
B5Y6G1_COPPD/8-273-----------------------------------------------------------------.ALERLQS-Q-----
I4BU20_ANAMD/8-273-----------------------------------------------------------------EALKKLRA-N-----
Q5UWI2_HALMA/21-288-----------------------------------------------------------------.SLLRLRE-T-----
D2R8M3_PIRSD/8-274-----------------------------------------------------------------EILLRLRA-K-----
G8XHR5_STREN/101-367-----------------------------------------------------------------DVLRRLHA-K-----
K7SG60_PROA4/5-271-----------------------------------------------------------------EILDRFRA-Q-----
X4REF3_9ACTO/5-271-----------------------------------------------------------------TILERLHT-Q-----
B2A8A0_NATTJ/6-272-----------------------------------------------------------------DILKHIDE-Q-----
E4RLZ6_HALHG/7-273-----------------------------------------------------------------EVREKLLA-E-----
Q893M3_CLOTE/7-273-----------------------------------------------------------------QIYENLKK-Q-----
H6LDL9_ACEWD/7-273-----------------------------------------------------------------EVLRRLRE-Q-----
R6I4I1_9ACTN/8-274-----------------------------------------------------------------EILDRFRK-S-----

PF15617

H9TH48_SALET/4-300-------------------------------------------------------------SPWNLGATLYMP-A-----
A0A0H3CW75_ENTCC/4-300-------------------------------------------------------------SPWNLGATLYMP-A-----
A0A023YVC9_ECOLX/4-300-------------------------------------------------------------SPWNLGATLYMP-A-----
A7MPV2_CROS8/4-300-------------------------------------------------------------SPWNLGATLYMP-A-----
B5RKC3_KLEP3/4-300-------------------------------------------------------------TPWELGATLYMP-A-----
D0KLU5_PECWW/4-299-------------------------------------------------------------SPWNLGATLYMP-A-----
B4EW80_PROMH/4-300-------------------------------------------------------------SPWNLGATLYMP-A-----
D3V2D7_XENBS/4-302-------------------------------------------------------------SPHQLGATLYIP-A-----
Q7CKQ7_YERPE/4-300-------------------------------------------------------------SAYALGATLYMP-A-----
E1PL56_PANVC/4-300-------------------------------------------------------------SPFMLGATLYMP-A-----
D3VJW5_XENNA/4-307-------------------------------------------------------------SPHQLGATLYMP-A-----
Q888S8_PSESM/3-297-------------------------------------------------------------SPYALGATLYMP-A-----
Q4ZYA8_PSEU2/3-297-------------------------------------------------------------SPYALGATLYMP-A-----
F3K7E7_PSEAJ/3-297-------------------------------------------------------------SPYALGATLYMP-A-----
Q39AX0_BURL3/4-298-------------------------------------------------------------SPFALGATLYMP-A-----
Q6FAX8_ACIAD/1-291-------------------------------------------------------------SALSLGATLYIP-A-----
A5WBK4_PSYWF/17-339-------------------------------------------------------------HPYQLGASLYMP-A-----
Q4FTQ0_PSYA2/59-368-------------------------------------------------------------HPYQLGASLYMP-A-----
Q5NWT6_AROAE/1-291-------------------------------------------------------------DATELGASLYLP-A-----
D3RPA3_ALLVD/1-291-------------------------------------------------------------DAYRLGGSLYVP-V-----
Q1QCR8_PSYCK/1-315-------------------------------------------------------------HPYQLGASLYMP-A-----
Q3JCD2_NITOC/22-310-------------------------------------------------------------HYMELGATLYMP-A-----
A1VWQ0_POLNA/1-291-------------------------------------------------------------EKKMLGASLYVP-A-----
Q2RVZ6_RHORT/5-292-------------------------------------------------------------A.LRLGASLYVP-A-----
Q9RSA7_DEIRA/8-299-------------------------------------------------------------SPWQLGASLYAP-A-----
D5BYR3_NITHN/21-309-------------------------------------------------------------CYMELGATLYMP-A-----
D8K7I6_NITWC/22-310-------------------------------------------------------------HYMELGATLYMP-A-----
E8U9R3_DEIML/2-291-------------------------------------------------------------FPFALGASLYIP-A-----
A8MM95_ALKOO/30-358-------------------------------------------------------------LAYSLGATLYMP-G-----
Q891X5_CLOTE/30-379-------------------------------------------------------------MQYALGATLYMP-G-----
A8F9P5_BACP2/30-369-------------------------------------------------------------LAHALGSTLYMP-A-----
C9RML9_FIBSS/26-364-------------------------------------------------------------LQYCLGATMYMP-G-----
E3IYR0_FRASU/30-378-------------------------------------------------------------VATALGATLYAP-G-----
Q9KY27_STRCO/30-371-------------------------------------------------------------LSAALGATLYSP-A-----
A0A080UMD5_BACIU/30-361-------------------------------------------------------------LEQALGAVLYMP-A-----
Q5YN23_NOCFA/30-368-------------------------------------------------------------LAIALGATLYAP-A-----
B1HUS4_LYSSC/26-371-------------------------------------------------------------LSYALGATLYMP-A-----
F2JGK5_CELLD/30-375-------------------------------------------------------------LSYALGATLYIP-A-----
Q65NP8_BACLD/30-368-------------------------------------------------------------LEYALGAALYVP-G-----
D1BEK0_SANKS/30-368-------------------------------------------------------------LAVGLGATLYSP-G-----
D1A9P4_THECD/30-368-------------------------------------------------------------LAVALGATLYSP-A-----
C9ZE12_STRSW/30-371-------------------------------------------------------------LAAALGATLYSP-A-----
F4H5N5_CELFA/32-371-------------------------------------------------------------LAVALGATLYMP-G-----
B7HBK1_BACC4/30-348-------------------------------------------------------------LAYALGATLYTP-G-----
A0A0B5R5V5_BACTU/30-348-------------------------------------------------------------LAYALGATLYTP-G-----
C8W644_DESAS/30-371-------------------------------------------------------------LSYSLGATLYMP-G-----
Q82B97_STRAW/30-370-------------------------------------------------------------LAAALGATLYSP-A-----
Q0SDY5_RHOJR/44-383-------------------------------------------------------------LAVALGATLYVP-A-----
Q72YD0_BACC1/30-348-------------------------------------------------------------LAYALGATLYTP-G-----
C1B1Z6_RHOOB/52-391-------------------------------------------------------------LAVALGATLYVP-A-----
A4J1D5_DESRM/16-360-------------------------------------------------------------LAHALGATLYMP-G-----
C0ZNQ3_RHOE4/41-379-------------------------------------------------------------LAIALGATLYVP-A-----
C0Z9Y5_BREBN/30-378-------------------------------------------------------------LAHALGATLYMP-A-----
Q186J7_PEPD6/30-345-------------------------------------------------------------LKYALGAFLYVP-A-----
E3EE66_PAEPS/10-368-------------------------------------------------------------LAYAIGAALYMP-A-----
F4D0A7_PSEUX/30-375-------------------------------------------------------------LSVALGATLYMP-G-----
E6UGJ0_RUMA7/26-367-------------------------------------------------------------LQYCLGATMYMP-G-----
D0L8D1_GORB4/35-372-------------------------------------------------------------LALALGATLYVP-G-----
B1VYI2_STRGG/30-395-------------------------------------------------------------LSVALGATLYSP-A-----
C9YLT5_PEPDR/30-345-------------------------------------------------------------LKYALGAFLYVP-A-----
F4EXE4_SELS3/15-331-------------------------------------------------------------LQYKVGGLLYMP-A-----
C8XAU7_NAKMY/30-369-------------------------------------------------------------LAHALGATLYVP-A-----
A8L403_FRASN/30-378-------------------------------------------------------------VATALGATLYAP-G-----
A6WD82_KINRD/30-375-------------------------------------------------------------LAVALGATLYCP-A-----
Q0RDF4_FRAAA/30-378-------------------------------------------------------------LATALGATLYAP-G-----
A2RKY2_LACLM/29-388-------------------------------------------------------------LASSLGASIYCP-L-----
Q2J6S0_FRASC/45-393-------------------------------------------------------------LATALGATLYAP-G-----
E3PRQ7_CLOSD/30-367-------------------------------------------------------------LRYALGATLYLP-A-----

PF03328

Q9RYM1_DEIRA/24-251------------------------------------------------------------------QIGLWLG-L-----
Q8XL94_CLOPE/6-225------------------------------------------------------------------RSMMFVP-G-----
Q9CGA8_LACLA/9-229------------------------------------------------------------------RTMMFVP-G-----
RHMA_ECOLI/19-246------------------------------------------------------------------QIGLWLS-S-----
Q8RDW5_FUSNN/9-227------------------------------------------------------------------RTMMFLP-G-----
GARL_ECOLI/20-246------------------------------------------------------------------QIGCWSA-L-----
Q9KTU0_VIBCH/11-230------------------------------------------------------------------RSMLFVP-G-----
Q93167_CAEEL/26-259------------------------------------------------------------------RALLYVP-A-----
Q9HRM8_HALSA/29-241------------------------------------------------------------------RSVLFSP-G-----
O82487_ARATH/90-322------------------------------------------------------------------LYGLFLL-S-----
CITEL_DEIRA/9-223------------------------------------------------------------------RSVLFAP-G-----
BPHF_RHOJR/18-244------------------------------------------------------------------QIGFWLA-L-----
A4XDW8_NOVAD/18-242------------------------------------------------------------------QLGFWLA-L-----
HPCH_KLEP7/15-240------------------------------------------------------------------QIGLWLG-L-----
C0ZQX9_RHOE4/12-226------------------------------------------------------------------RASLVAP-G-----
CITE_ECOLI/15-234------------------------------------------------------------------RSMLFVP-G-----
Q4DGT6_TRYCC/18-249------------------------------------------------------------------KFGVFLN-S-----
Q8ZRY2_SALTY/5-223------------------------------------------------------------------RSMLFIP-G-----
Q99ZK8_STRP1/6-224------------------------------------------------------------------RTMMFVP-G-----

PF02896

PPDK1_MAIZE/589-947-------------------------------------------------------------MAWVDDVRKLKV-L-----
PT1_STACT/251-543-------------------------------------------------------------ESVTADGHHVEL-A-----
PT1_CUPNH/262-557-------------------------------------------------------------PAVTLDGLEIDL-L-----
PT1_ECOLI/250-542-------------------------------------------------------------PAITLDGHQVEV-C-----
PT1_HAEIN/250-542-------------------------------------------------------------PAITLDGHKVDV-V-----
PT1P_ECOLI/416-708-------------------------------------------------------------PAQLKSGERIKV-M-----
PPSA_PYRFU/496-796-------------------------------------------------------------GAPLVTGTMVKV-.-----
PTFAX_XANCP/521-808-------------------------------------------------------------PAETTDGHHIDI-G-----
PT1_STRMU/252-546-------------------------------------------------------------ETVTADGKHFEL-A-----
PTFX2_ECOLI/362-654-------------------------------------------------------------QARTADGIRIEI-A-----
PPSA_STAMF/504-813-------------------------------------------------------------LLPLYPVTATKI-Y-----
D5AMJ7_RHOCB/521-803-------------------------------------------------------------PALTVDGARVEV-V-----
Q24801_ENTHI/517-878-------------------------------------------------------------LKWANEIKKIGV-F-----
Q5L199_GEOKA/251-541-------------------------------------------------------------PTVTADGVHVEL-A-----
Q6MTX2_MYCMS/252-540-------------------------------------------------------------PSLTKDKIKKLI-E-----

PF01274

MASY_EMENI/11-531.............................................................PAPGLVDRRVEI-T-----
MASZ_CORGL/35-713LDSVVPLDGASHADVEKYNITDGKLAAHIGDSVYRLKNRESYRGFTGNFLDPEAILLETNGLHIELQIDPVHP-I-----
MASY_MYXXD/17-538.............................................................LPADLQDRRVEI-T-----
MASZ_ECOLI/17-697DESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIELQIDANGR-I-----
Q9RYN3_DEIRA/10-521.............................................................LPDALKDRRVEI-T-----
MASY_MAIZE/16-548.............................................................VPPAVADRTVEI-T-----
MASY_ECOLI/11-533.............................................................IPADLEDRRVEI-T-----
MASZ_MYCLE/17-704DQAVPLASDSWTNATGVSIFDGQLQIAIGTNSTGLASPEKFVGYNRQLRSSNWSVLLANHGLHIEVLIDPESP-I-----
MASY_YEAST/18-542.............................................................LAPGLINRSTEI-T-----
B5GRN8_STRC2/12-539.............................................................APPALQDRRVEI-T-----
C5MBE7_CANTT/16-539.............................................................LAPGLIDRRCEI-T-----
M4EJ48_BRARP/22-551.............................................................VPPAVADRRVEI-T-----
W1QBI0_OGAPD/27-543.............................................................THPKLQCRKIEI-T-----

PF00224

KPYK_EMENI/32-379-------------------------------------------------------------FRRTSIICTIGP-K.....
KPYM_FELCA/42-395-------------------------------------------------------------ARNTGIICTIGP-A.....
KPYK_HAEIN/5-350-------------------------------------------------------------LRRTKIVCTMGP-S.....
KPYK_YARLI/29-376-------------------------------------------------------------YRKSSIIGTIGP-N.....
KPYC_SOLTU/19-365-------------------------------------------------------------IPKTKIVCTLGP-S.....
KPYR_HUMAN/85-438-------------------------------------------------------------ARSTSIIATIGP-A.....
KPYK_LACLA/2-375-------------------------------------------------------------NKRVKIVSTLGP-AVEIRG
KPYK1_YEAST/18-365-------------------------------------------------------------LRRTSIIGTIGP-K.....
G0RKV7_HYPJQ/42-387-------------------------------------------------------------.RRTSIICTIGP-K.....
Q1GAL0_LACDA/1-345-------------------------------------------------------------MKKTKIVSTLGP-A.....
Q5KWB2_GEOKA/3-345-------------------------------------------------------------.RKTKIVCTIGP-A.....

PF14010

CAPPA_METHJ/3-484------------------------------------------------------------------IPRTMST-Q-----
D3S0D1_FERPA/2-476------------------------------------------------------------------VPRVMST-Q-----
CAPPA_HALSA/4-492------------------------------------------------------------------VPRLMST-Q-----
CAPPA_METTH/3-483------------------------------------------------------------------VPRCMST-Q-----
CAPPA_METKA/9-532------------------------------------------------------------------IARTLAT-Q-----
A8A9C2_IGNH4/3-488------------------------------------------------------------------VPKLMAT-Q-----
CAPPA_SULTO/4-511------------------------------------------------------------------IPRTMST-Q-----
B1I2W1_DESAP/7-489------------------------------------------------------------------ISRTMST-Q-----
CAPPA_PICTO/6-508------------------------------------------------------------------IPKTMST-Q-----
CAPPA_CALMQ/4-512------------------------------------------------------------------IPRTMCT-Q-----
CAPPA_METS5/4-509------------------------------------------------------------------IPRTMST-Q-----
CAPPA_ARCFU/2-471------------------------------------------------------------------VPRVMST-Q-----
CAPPA_PYRAE/3-460------------------------------------------------------------------IPCLMCT-Q-----
CAPPA_SULAC/4-511------------------------------------------------------------------IPRTMST-Q-----
J9ZD85_LEPFM/19-520------------------------------------------------------------------IPTTMAT-Q-----
CAPPA_CLOPE/3-537------------------------------------------------------------------IPCSMMT-Q-----
CAPPA_SULSO/4-511------------------------------------------------------------------IPRTMST-Q-----

PF00311

C7M9P2_BRAFD/148-942----------------------------------------------------------------SLDVRLVFT-A-----
CAPP_ACTP2/128-879----------------------------------------------------------------KLSIELVLT-A-----
A0ZJ69_NODSP/196-1034----------------------------------------------------------------HLDVRLVFT-A-----
D3VH32_XENNA/127-879----------------------------------------------------------------ELAIELVLT-A-----
Q2KZS8_BORA1/137-936----------------------------------------------------------------EACVMPVLT-A-----
D2QW47_PIRSD/157-942----------------------------------------------------------------KMLIELVFT-A-----
A5GVT4_SYNR3/167-992----------------------------------------------------------------ELDVRLVFT-A-----
C6D470_PAESJ/147-936----------------------------------------------------------------NISLELVMT-A-----
B8HVC9_CYAP4/199-1018----------------------------------------------------------------QLDIKLVFT-A-----
C1F4Y2_ACIC5/161-947----------------------------------------------------------------RIFVVPVFT-A-----
CAPP_SYNY3/193-1034----------------------------------------------------------------HLDIRLVIT-A-----
B1XMB9_SYNP2/163-995----------------------------------------------------------------QLDIRLVFT-A-----
A4S610_OSTLU/183-1007----------------------------------------------------------------VQHVDLVLT-A-----
A9RUR8_PHYPA/162-969----------------------------------------------------------------EQTVDLVFT-A-----
B8GNA5_THISH/143-947----------------------------------------------------------------QLAYVPVFT-A-----
CAPP_HAHCH/132-881----------------------------------------------------------------DLNLEFVLT-A-----
B1Y159_LEPCP/163-950----------------------------------------------------------------HAYISPVLT-A-----
CAPP_THEEB/197-1011----------------------------------------------------------------QLDIKLVFT-A-----
A9S2G6_PHYPA/161-965----------------------------------------------------------------HQTVDLVLT-A-----
Q54JZ3_DICDI/144-931----------------------------------------------------------------QQKIELVLT-A-----
C1MJ77_MICPC/164-991----------------------------------------------------------------EQEVDLVFT-A-----
E0UJ33_CYAP2/184-1020----------------------------------------------------------------QLDVRLVFT-A-----
A5WCX5_PSYWF/133-932----------------------------------------------------------------QLKFIPVFT-A-----
A0JSJ3_ARTS2/161-954----------------------------------------------------------------ELDVRPIFT-A-----
B7G725_PHATC/84-877----------------------------------------------------------------KQKVEIVLT-A-----
CAPP_GLOVI/141-939----------------------------------------------------------------QLDVRLVFT-A-----
D1CE74_THET1/138-931----------------------------------------------------------------RLRARFVFT-A-----
Q117S5_TRIEI/186-1038----------------------------------------------------------------NLDIRLVFT-A-----
C1AE63_GEMAT/147-933----------------------------------------------------------------SALVSPVLT-A-----
A9QPD2_METI4/151-931----------------------------------------------------------------KMEIVLVFT-A-----
B0BZ90_ACAM1/184-1012----------------------------------------------------------------NLDIQLVFT-A-----
A4X3B0_SALTO/171-972----------------------------------------------------------------RLAIRPVFT-A-----
E3JCU0_FRASU/173-968----------------------------------------------------------------RLELRPVFT-A-----
Q2JKJ2_SYNJB/177-978----------------------------------------------------------------QLHIRMVFT-A-----
A9IDM8_BORPD/139-951----------------------------------------------------------------EARVVPVLT-A-----
A4G3V1_HERAR/147-944----------------------------------------------------------------DALISPVLT-A-----
C1DZM5_MICCC/162-982----------------------------------------------------------------EQEVDLVLT-A-----
D3EKG0_GEOS4/142-928----------------------------------------------------------------SLSLELVMT-A-----
B1VUI2_STRGG/125-909----------------------------------------------------------------NLNVRPVFT-A-----
CAPP_SYNPW/180-1003----------------------------------------------------------------ELDIRLVFT-A-----
B0JPY0_MICAN/183-1018----------------------------------------------------------------QLDIRLVFT-A-----
B1WNZ1_CYAA5/187-1020----------------------------------------------------------------QLDIRLVFT-A-----
C8WQK0_ALIAD/133-906----------------------------------------------------------------..GIELVLT-A-----
D4ZQG2_ARTPN/196-1035----------------------------------------------------------------QLDIRLVFT-A-----
M1FKU6_9ALTE/130-889----------------------------------------------------------------.LRVEFVLT-A-----
CAPP_ECOLI/129-883----------------------------------------------------------------.LSLELVLT-A-----
CAPP_HAEIN/129-879----------------------------------------------------------------.LLIELVLT-A-----
Q0K7M4_CUPNH/207-1012----------------------------------------------------------------..LIVPVLT-A-----
Q31KY7_SYNE7/201-1017----------------------------------------------------------------.LDIRLVFT-A-----
Q46IP1_PROMT/168-994----------------------------------------------------------------EMDIRLVFT-A-----
CAPP_PROMP/165-989----------------------------------------------------------------EMDIRLVFT-A-----
CAPP_VIBPA/129-877----------------------------------------------------------------.LNIELVLT-A-----
CAPP_SHEON/129-881----------------------------------------------------------------.LDIDLVLT-A-----
U5GXD4_POPTR/166-968----------------------------------------------------------------.QTVELVFT-A-----

PF00463

ACEA_EMENI/14-536----------K---DSRWRYTKR-P----FTAEQIVAKRGNLK.IEYPSNVQAKKLWGILERNFKNKEASFTY--GCLDP
ACEA_YEAST/22-550----------S---DSRWSKTKR-N----YSARDIAVRRGTFPPIEYPSSVMARKLFKVLEKHHNEGTVSKTF--GALDP
ACEA1_SOYBN/3-534----------N---SERFRLTKR-P----YTARDVVSLRGNLR.QTYASNEMAKKLWRLLKNHQANGTASRTF--GALDP
ACEA_YARLI/10-536----------S---SPRWKHTKR-V----YSPEDIASRRGTIK.VPQASSQQADKLFKLLQEHEKNHTASFTY--GALDP
ACEA_NEUCR/23-547----------S---DSRWRQTKR-P----FTAEQIVSKRGNLK.IEYASNAQAKKLWKILEDRFAKRDASYTY--GCLEP
C5MF59_CANTT/18-543----------S---EPRWRKTKR-I----YSAEDIAKKRGSLK.ISYPSSQQADKLFKLLEQHDAEKSVSFTF--GALDP

PF13714

A0JTC7_ARTS2/12-246----------H...QAP.E....-I----L........................................QVI--NVWDA
A0K276_ARTS2/27-270----------H...DGA.A....-P----L........................................VLV--NVWDV
A0QPJ7_MYCS2/16-251----------H...RPG.D....-P----G........................................VLP--TVWDA
A0R0I0_MYCS2/10-256----------H...AGGNI....-.----.........................................VAP--GAYDA
A1CA54_ASPCL/14-274----------H...TPG.K....-P----L........................................VLT--NVYDA
A1SIA9_NOCSJ/3-233----------H...HAE.L....-P----L........................................LLP--NAWDV
A4F7M3_SACEN/8-232----------H...RAG.D....-P----L........................................LLP--NAWDL
A4FH54_SACEN/26-273----------H...VPK.R....-P----L........................................VLP--NAWDA
A4X5C0_SALTO/32-264----------H...RPG.Q....-P----L........................................VLP--NAWDA
A4X7L5_SALTO/4-223----------H...RTG.D....-P----L........................................VLP--NVWDV
A4XS21_PSEMY/12-254----------H...QRD.E....-L----L........................................VLP--NPWDA
A4YVZ4_BRASO/12-249----------H...ES..G....-C----F........................................VLP--NPFDA
A5G4A7_GEOUR/12-254----------H...QGP.G....-T----L........................................VLP--NAWDV
A5V3Q4_SPHWW/10-252----------H...VAG.D....-P----L........................................RLV--NVWDA
A9WM41_RENSM/9-245----------H...DDL......-.----L........................................ILP--NAWDA
B1VSN1_STRGG/14-249----------H...AEH.R....-P----L........................................VLP--TVWDV
B4RBF1_PHEZH/10-242----------H...TGA.E....-I----L........................................VLP--NAWDA
B5HHA0_STRPR/15-253----------H...HG..E....-M----L........................................VLP--NVWDA
B5HRK0_9ACTN/12-259----------H...RE..G....-C----F........................................LLP--NAWDV
B5HVC7_9ACTN/7-239----------HRGRLPG.D....-P----L........................................VLP--GPWDA
B6HSS2_PENRW/11-259----------H...QPG.N....-P----L........................................ILT--NVYDA
B8MDA8_TALSN/5-285----------K...KN..Q...D-R----V........................................RLL--EAHDH
B9JNZ3_AGRRK/15-273----------E...KR..T....-F----L........................................RFL--DIHNA
B9K4D9_AGRVS/8-247----------H...EGS.G....-T----F........................................IIP--NPWDI
C1D0L9_DEIDV/16-251----------H...EAP.E....-I----L........................................TLA--NVWDV
D5UDN5_CELFN/12-253----------H...ESG......-A----L........................................VLP--NAWDA
C5C673_BEUC1/6-244----------H...RPG.A....-P----L........................................LLP--NAWDL
C5K5X0_PERM5/22-289----------N...TK..APNDG-V----I........................................RAM--EAHSG
D9SPL5_CLOC7/7-255----------N...SK..N....-T----L........................................IMP--DAFDP
C6W6H2_DYAFD/19-261----------H...HSG.K....-M----L........................................VLP--NIWDA
C7Q1F2_CATAD/16-252----------H...AGP.D....-V----F........................................VIA--NAWDA
C7YUL0_NECH7/9-264----------H...KPS.T....-P----I........................................VFP--NVWDV
C7YZU2_NECH7/391-674----------K...AR..Q....-L----IHPCPHLYQHQPQSSSINIAMSATQSKVDILRERLNTAKPAIAM--AAHSP
D6Z4R6_DESAT/153-411----------D...AK..P....-M----V........................................RLM--EAHNG
C9SRU6_VERA1/11-259----------H...KPS.S....-P----L........................................ILP--NIWDY
D1A2J0_THECD/5-232----------H...RAG.D....-P----L........................................VLP--NAWDV
D1BED0_SANKS/11-246----------H...VSG.A....-P----L........................................VLP--NAWDV
D1BI43_SANKS/12-247----------H...DPR.H....-P----L........................................LLS--TVWDV
D9TER7_MICAI/8-239----------H...RPG.D....-P----L........................................LLP--NAWDH
E3J806_FRASU/10-249----------H...TRT.G....-G----L........................................VMP--NAWDG
D2B1P9_STRRD/6-236----------H...HGP.E....-P----L........................................LLP--NAWDH
E3I6J4_RHOVT/30-272----------Q...AR..E....-A----F........................................ILP--EVWDV
D2PR97_KRIFD/29-269----------H...VPG.K....-P----L........................................VLP--NVWDA
D2Q3B1_KRIFD/7-234----------H...HGG.T....-P----L........................................VLP--NAWDP
D2Q4L3_KRIFD/4-243----------H...T...G....-S----F........................................VMP--NAWDA
D3EII1_GEOS4/13-252----------H.....S.N....-F----F........................................ILP--NAWDA
D3V3K7_XENBS/39-278----------H...EEG......-R----L........................................ILA--NSWDV
D4AZN8_ARTBC/10-268----------H...RKG.N....-P----L........................................VLC--NVYDG
D4LCE5_RUMC1/6-261----------K...NG..A....-P----L........................................RIL--EAVNG
Q01YZ5_SOLUE/12-251----------H...DGP.G....-V----F........................................IIP--NPWDV
Q08U27_STIAD/11-246----------H...APG.Q....-L----L........................................VLP--NVWDA
Q0BYP5_HYPNA/11-255----------H...GGA.Q....-P----L........................................VLV--NIWDA
Q0RPX9_FRAAA/13-247----------H...RPG.V....-P----L........................................VMP--NAWDA
Q12Q29_SHEDO/14-259----------L...SP..T....-T----E........................................YLM--EAHNA
Q1GKC0_RUEST/10-253----------H...QKG.D....-P----V........................................VLY--NIWDA
Q1GQT2_SPHAL/9-246----------H...VPG.D....-P----L........................................ILV--NIWDA
Q28RZ5_JANSC/10-249----------H...QSG.C....-.----F........................................VMP--NPWDR
Q2JAX2_FRASC/15-255----------H...EQA.S....-P----F........................................VMA--NAWDA
Q4DNR3_TRYCC/14-261----------R...SK..E....-L----S........................................FLM--EAHNG
Q4KET5_PSEF5/11-270----------R...RK..R....-C----L........................................RVL--EAHSP
Q5E5F2_VIBF1/18-278----------K...SH..G....-C----I........................................RIL--ETHNP
Q5LNA0_RUEPO/10-253----------H...RPG.Q....-P----L........................................ILY--NAWDA
Q5LUG9_RUEPO/10-245----------H...VPG.N....-P----L........................................VMP--NPWDI
Q5WBL4_BACSK/19-257----------H...EQS.S....-T----F........................................VLP--NAWDA
Q65ND9_BACLD/10-248----------H...HQS.D....-P----F........................................VLP--NAWDA
Q7NXV8_CHRVO/33-277----------H...QDE.R....-P----L........................................LLP--TVWDA
Q7P124_CHRVO/3-243----------H...RQA.E....-P----L........................................LLA--NVWDA
Q893V9_CLOTE/153-411----------K...LR..P....-I----V........................................KAI--EVHNG
Q8EI00_SHEON/9-240----------H...QQS.E....-P----L........................................ILT--NAWDA
A6TFP2_KLEP7/3-236----------H...QQN.Q....-P----L........................................LLA--NVWDA
G2J0B0_PSEUL/10-251----------H...RRS.G....-T----F........................................LMP--NAWDA
G8PVS4_PSEUV/10-253----------H...VKG.E....-P----I........................................TIY--NIWDA
D4GMW6_PANAM/3-261----------I...AEK.G....-T----L........................................IFI--EAHNP
Y1998_MYCTU/3-229----------H...HQG.V....-P----F........................................VLP--NAWDV
Q2IK57_ANADE/11-247----------H...QD..G....-C----F........................................VLP--NPWDA
Q2KD40_RHIEC/10-252----------H...RKG.D....-P----I........................................VLY--NIWDA
Q63MP0_BURPS/20-277----------A...TG..R....-A----L........................................RFI--ESHSP
Q8F693_LEPIN/12-250----------H...ER..G....-T----F........................................IMP--NAWDA
Q8YAP2_LISMO/8-250----------H...ELP.T....-P----L........................................ILY--NCWDV
Q98AR7_RHILO/15-259----------I...ASS.E....-L----A........................................FAM--EAHDG
R5T8T3_9CLOT/12-269----------....EKG.E....-Q----V........................................FAP--CVYDC
R5TTB9_9CLOT/13-246----------........G....-Q----L........................................IAP--DTFDG

PF02548

C8XKD1_NAKMY/14-272----------K---RAG.....R-K----I----------------------------------------VMV..TAYDY
A7HMC7_FERNB/3-256----------K---GK......E-P----I----------------------------------------TMI..TAYDY
PANB_NITMU/2-259----------R---DDG.....E-K----I----------------------------------------AIV..TCYDA
E3I2N4_RHOVT/9-264----------K---..G....GD-K----I----------------------------------------VSL..TCYHA
PANB_THEFY/18-275----------K---ERG.....E-R----W----------------------------------------PML..TAYDA
F0NZT0_WEEVC/9-267----------K---FSG.....E-K----I----------------------------------------SML..TAYDF
C5DYQ5_ZYGRC/31-296----------Y---LKG.....I-P----I----------------------------------------TVS..TAHDY
D8RYD4_SELML/4-266----------Y---ARK.....E-P----I----------------------------------------TMV..TAYDY
S9W2M7_SCHCR/5-262----------K---LAK.....E-K----F----------------------------------------SCI..TAYDA
D2PXN9_KRIFD/534-791----------K---NRG.....E-K----W----------------------------------------AML..TAYDQ
H1Z987_MYROD/10-268----------K---ANG.....E-K----I----------------------------------------SML..TCYDY
C5BN63_TERTT/12-267----------K---DRC.....E-K----F----------------------------------------TTV..ALYDA
A8LKB6_DINSH/13-268----------K---..G....AE-P----I----------------------------------------VAL..TASHV
D7BNG1_ARCHD/5-260----------K---AEG.....T-P----I----------------------------------------TML..TSYDA
D7A714_STAND/9-264----------K---..G....GE-P----I----------------------------------------VSL..TSYHA
PANB_BORPD/9-265----------K---..G....PG-K----V----------------------------------------VAL..TAYTA
PANB_MAGSA/9-265----------K---..G....AE-P----L----------------------------------------VVL..TAYTA
E8RFZ1_DESPD/5-262----------K---NG......T-P----I----------------------------------------AEI..TAYDY
PANB_PROMA/4-255----------K---ELG.....N-Q----I----------------------------------------TIL..TAWDS
K9RVA1_SYNP3/11-268----------K---QQG.....R-P----I----------------------------------------TML..TAWDF
D5WZ20_THIK1/22-279----------R---EAG.....E-K----I----------------------------------------AML..TAYDA
B8LYN4_TALSN/78-338----------Y---KKN.....E-P----I----------------------------------------AML..TAHDF
K9RDA0_9CYAN/11-264----------K---QQQ.....R-P----I----------------------------------------VVL..TAWDY
PANB_METRJ/10-267----------K---AEG.....R-K----I----------------------------------------IAL..TAYHA
A9UP51_MONBE/1-268----------R---RQG.....E-P----I----------------------------------------VMV..TAYDY
PANB_PROA2/11-273----------K---SEG.....E-K----I----------------------------------------SML..TAYDY
F2UAL1_SALR5/62-329----------Y---AQG.....T-P----L----------------------------------------SMI..TAYDY
V2XXG0_MONRO/40-299----------K---TKK.....T-P----I----------------------------------------SMI..TAYDY
G2IQV3_9SPHN/23-282----------K---ADG..ETAE-P----L----------------------------------------VVL..TAYTA
PANB_CLONN/2-260----------K---NNG.....E-K----L----------------------------------------TML..TAYDY
PANB_WIGBR/3-260----------K---EQN.....K-K----F----------------------------------------ASI..TAYDA
M1FDT2_9ALTE/4-264----------K---KSG.....D-K----I----------------------------------------VGI..VAWDY
E4TII1_CALNY/9-264----------K---HK......E-K----I----------------------------------------VSL..TAYDY
K0I9Q1_NITGG/2-255----------K---GM......E-K----I----------------------------------------SVL..TAYDY
C7MD29_BRAFD/11-267----------K---VEG.....R-P----F----------------------------------------TML..TAYDQ
G8PQN3_PSEUV/9-264----------K---..G....HH-K----L----------------------------------------VCL..TAYTA
PANB_LEPCP/16-279----------Q---QRG.....E-K----I----------------------------------------AML..TAYES
K1VYW4_TRIAC/1535-1794----------Y---ASG.....T-P----I----------------------------------------SVL..TAYDY
B8I2Z4_CLOCE/9-266----------K---RNG.....D-K----I----------------------------------------SML..TAYDY
I0AFM0_IGNAJ/3-258----------K---QLN.....I-P----I----------------------------------------SMV..TCYDY
I4CAV2_DESTA/3-261----------K---ARK.....E-P----M----------------------------------------TFL..TGYDY
PANB_SULDN/4-259----------K---GV......H-P----L----------------------------------------VMI..TAYDA
S8DNJ0_FOMPI/15-274----------K---KNR.....T-P----I----------------------------------------AML..TAYDF
PANB_METCA/5-260----------K---RRG.....E-K----I----------------------------------------ACL..TAYDA
F3YUG3_DESAF/5-260----------K---GG......E-R----L----------------------------------------AML..TAYDY
PANB_SYNAS/9-267----------K---KKG.....E-K----I----------------------------------------TML..TAYDY
C7LVL7_DESBD/2-259----------K---KNG.....E-K----I----------------------------------------VML..TAYDY
PANB_NOCSJ/34-291----------K---QRG.....E-K----F----------------------------------------AML..TAYEQ
F0SK13_RUBBR/3-257----------K---GQ......K-K----L----------------------------------------TVL..TAYDF
D3E7N3_GEOS4/7-265----------K---KKG.....V-P----I----------------------------------------TML..TAYDY
G7EAQ5_MIXOS/98-357----------K---ERE.....E-P----I----------------------------------------TVI..TAHDY
R7GY01_9FIRM/2-260----------K---QSG.....D-K----I----------------------------------------TML..TAYDY
U9SMK5_RHIID/19-277----------Y---KSK.....E-P----I----------------------------------------TVL..TAHDY
R5GD14_9BACT/11-269----------K---EQG.....R-R----I----------------------------------------AML..TSYDY
R1GLQ8_BOTPV/11-271----------H---RKN.....E-P----I----------------------------------------TVL..TAYDF
PANB_DESAH/4-258----------K---QEG.....K-R----I----------------------------------------TAL..TAYDH
PANB_DEIDV/5-258----------E---........Q-P----L----------------------------------------VMV..TAYDY
S6CEI7_9ACTN/2-260----------K---AEG.....K-K----I----------------------------------------SMI..TAYDY
R5KEY8_9CLOT/2-260----------K---QEG.....R-K----I----------------------------------------SML..TAYDY
K0SSA9_THAOC/101-366----------K---RRN.....Q-K----I----------------------------------------TMV..TAYDY
C6XKS3_HIRBI/9-264----------K---..G....ET-P----I----------------------------------------VCL..TAYDA
J9QSS2_RIEAN/9-267----------K---FSK.....E-K----I----------------------------------------TML..TAYDF
S6BYU9_9GAMM/3-260----------K---GAG.....E-K----I----------------------------------------VAI..TAYDA
D0KZU6_HALNC/20-275----------K---RDQ.....T-P----I----------------------------------------AMI..TAYDA
G0W8X4_NAUDC/30-294----------R---SKD.....I-P----I----------------------------------------TMT..TAYDS
E5AM95_PARRH/11-268----------R---EAG.....E-P----I----------------------------------------AML..TCYDA
I3TFJ1_THEC1/4-259----------K---GA......E-K----I----------------------------------------AAI..TAYDY
PANB_GRABC/9-265----------K---..G....GT-P----I----------------------------------------VAL..TAYTA
G0GCR3_SPITZ/2-257----------K---RQG.....K-K----I----------------------------------------SMV..TCYDA
G1XV43_ARTOA/82-342----------Y---EKG.....E-K----I----------------------------------------TML..TAHDF
D9Q2W0_ACIS3/6-261----------K---GK......K-P----I----------------------------------------VMI..TAYDY
B1ZVH1_OPITP/3-258----------K---AGG.....R-K----I----------------------------------------VMV..TAYDA
R7EXA6_9BACT/11-269----------K---QRG.....E-K----I----------------------------------------SML..TAYDY
F6B538_DESCC/4-262----------K---QEG.....Q-P----I----------------------------------------AML..TAYDY
D5UZ54_ARCNC/10-265----------K---NI......K-K----L----------------------------------------TMI..TAYDA
U1GVM1_ENDPU/59-319----------H---RKK.....I-P----I----------------------------------------TML..TAHDF
G2QRB2_THITE/68-328----------Y---KKG.....E-P----I----------------------------------------TMI..TAHDF
B7FR45_PHATC/3-276----------R---RHG.....K-K----I----------------------------------------SMV..TAYDY
PANB_THEEB/5-261----------K---ALG.....E-P----I----------------------------------------TML..TAWDY
R7D6U7_9ACTN/3-263----------V---DEG.....G-K----V----------------------------------------TMV..TSYDY
E3GPR0_EUBLK/2-261----------A---AEG.....E-K----I----------------------------------------VYL..TGYDY
C1DI17_AZOVD/17-274----------K---AQG.....R-K----W----------------------------------------AML..TAYDM
A5VB06_SPHWW/22-276----------K---..G....KT-P----V----------------------------------------VVL..TAYTI
A4CLQ4_ROBBH/10-268----------K---QQG.....E-K----I----------------------------------------SML..TAYDY
D5BTJ5_PUNMI/4-260----------K---SE......R-K----I----------------------------------------VCL..TAYSA
C9RK32_FIBSS/3-246----------K---SKH.....E-M----I----------------------------------------SMI..TAYDF
C4LHZ4_CORK4/17-275----------K---RES.....K-R----W----------------------------------------AML..TAYDF
W8KF56_HALHR/9-265----------R---EQA.....E-P----I----------------------------------------ASL..TAYDA
G7V5R4_THELD/5-262----------K---QEK.....E-P----I----------------------------------------VMV..TAYNH
I3ZIP5_TERRK/17-275----------K---QAR.....T-P----I----------------------------------------TAL..TAYDY
S6AIG3_9PROT/2-259----------A---GSG.....E-K----I----------------------------------------AVL..TCYDA
F3ZPG7_9BACE/11-269----------K---QNG.....E-K----I----------------------------------------SML..TSYDF
PANB_AQUAE/2-260----------K---REG.....K-K----I----------------------------------------TMV..STYDY
R7ALC5_9ACTN/29-287----------K---QKG.....E-K----I----------------------------------------SML..TCYDY
U5N9B5_9BURK/27-288----------H---TRR.....E-A----I----------------------------------------AML..TAYDA
C6BVH5_DESAD/3-260----------L---KGQ.....R-K----I----------------------------------------SMV..TAYDY
C5KFU4_PERM5/79-341----------H---REG.....D-K----I----------------------------------------TMM..TCYDA
F4H271_CELFA/7-264----------K---TRG.....E-R----L----------------------------------------TML..TAYDA
F8AZ74_FRADG/51-306----------K---DRG.....E-K----W----------------------------------------AML..TAYDA
E4NQR1_HALBP/4-256----------.---AGT.....T-P----I----------------------------------------TML..TAYDA
C6VWE8_DYAFD/10-268----------K---NRG.....E-K----I----------------------------------------TCL..TAYDY
R5KSN9_9FIRM/2-260----------K---KDG.....N-K----I----------------------------------------TML..TCYDY
PANB_NATPD/3-255----------.---AGD.....E-P----I----------------------------------------TML..TAYDA
L0IYN2_9MYCO/17-274----------K---AEG.....H-K----W----------------------------------------AML..TAYDY
PANB_CLOTH/4-262----------K---KQG.....R-K----I----------------------------------------TML..TAYDY
PANB_SPHAL/26-281----------K---..G....GE-P----I----------------------------------------VML..TAYTV
I0A221_FERFK/7-263----------K---ELK.....E-K----I----------------------------------------VMI..TAYDT
T2GAB0_DESGI/5-261----------K---GG......D-P----L----------------------------------------VML..TAYDF
C6WXZ0_METML/2-266----------A---ASG.....E-K----I----------------------------------------AML..TCYDA
F2IID2_FLUTR/9-267----------K---NSG.....A-K----I----------------------------------------SML..TGYDF
D5BNG2_PUNMI/9-267----------M---EKG.....E-P----I----------------------------------------TQL..AAYDY
PANB_ARTAT/40-297----------K---DNG.....E-H----F----------------------------------------AML..TAYEQ
PANB_CARHZ/3-261----------K---EAG.....Q-K----I----------------------------------------AMI..TAYDY
A4G8C6_HERAR/16-272----------R---AKG.....E-K----I----------------------------------------TML..TAYDA
E1QUY6_VULDI/5-260----------K---GK......Q-R----I----------------------------------------AMI..TAYDY
PANB_METFK/3-256----------K---ERG.....E-K----I----------------------------------------AVL..TSYDA
PANB_CHESB/10-264----------K---..G....KA-P----I----------------------------------------VCL..TAYTT
B6GXN5_PENRW/75-335----------H---KKG.....E-P----I----------------------------------------TML..TAHDF
I0GU87_SELRL/2-260----------K---ANG.....E-K----I----------------------------------------SML..TCYDY
R9AIM6_WALI9/451-714----------K---KQH.....M-P----I----------------------------------------TVL..TCYDY
R5BQ58_9FIRM/5-264----------K---EQG.....E-P----I----------------------------------------TMI..TAYDV
F8AC68_THEID/6-263----------K---GR......E-K----I----------------------------------------CAL..TAYDV
PANB_ALKEH/12-269----------K---ADG.....Q-K----V----------------------------------------VAL..TAYDY
F8E6G1_FLESM/9-265----------K---AEG.....E-K----I----------------------------------------SCL..TGYDY
PANB_BORPE/9-264----------T---..P....DE-P----I----------------------------------------VAL..TAYTA
E1VL92_9GAMM/2-258----------K---SQG.....E-K----F----------------------------------------TCL..TTYDA
R6CEN3_9FIRM/2-260----------K---QSG.....E-K----I----------------------------------------TML..TAYDY
PANB_LEPBP/4-261----------Y---DAG.....E-P----I----------------------------------------SVV..TCYDY
D5MI67_9BACT/6-263----------K---REG.....R-K----I----------------------------------------TML..TAYDY
G0EFC1_PYRF1/3-258----------K---GR......E-P----I----------------------------------------VMV..TAYDY
PANB_EXIS2/3-258----------Q---QAG.....E-K----L----------------------------------------VML..TAYDY
I4BB70_TURPD/157-414----------K---LAG.....E-K----I----------------------------------------SVV..TCYDH
PANB_MARHV/2-258----------K---QKG.....E-A----F----------------------------------------SAL..TSYDA
D8J2A6_HALJB/4-255----------.---AAD.....E-P----I----------------------------------------TML..TAYDA
PANB_IGNH4/3-259----------Y---KNG.....E-K----I----------------------------------------VMV..TAYDY
G4RJI6_THETK/5-260----------K---GR......E-K----I----------------------------------------AML..TAYDY
K8GUE9_9CYAN/2-256----------K---QQG.....R-P----I----------------------------------------AVL..TAWDF
W6SJ04_9CLOT/2-259----------K---KRG.....E-K----I----------------------------------------SML..TAYDY
D9SXD7_CLOC7/2-260----------K---ERK.....E-K----I----------------------------------------TML..TAYDY
W5W0X3_9PSEU/35-292----------K---DRG.....E-P----W----------------------------------------PML..TTYDM
F7V601_CLOSS/2-260----------K---AAG.....D-K----I----------------------------------------TMI..TCYDY
PANB_SYNE7/2-256----------K---QQG.....R-P----I----------------------------------------VAL..TAWDF
I2GYS6_TETBL/22-285----------Y---QQH.....V-P----I----------------------------------------TMI..TAHDY
F2N7R6_CORGP/2-260----------K---DEG.....R-K----L----------------------------------------AML..TAYDY
PANB_SODGM/2-257----------K---QQQ.....R-K----F----------------------------------------TSI..TAYDA
PANB_MYXXD/4-262----------K---QIG.....Q-K----I----------------------------------------CMV..TAYDA
W0JJ73_DESAE/2-258----------K---SK......E-K----I----------------------------------------TMI..TAYDY
PANB_SALRD/3-261----------K---EEG.....V-P----I----------------------------------------AAL..TAYDY
H1XSD8_9BACT/9-267----------K---AQG.....E-P----I----------------------------------------AML..TAYDT
K4KI34_SIMAS/15-270----------K---AEG.....E-K----F----------------------------------------VTV..ALYDA
PANB_PHEZH/11-266----------K---..G....GT-P----I----------------------------------------VCL..TAYTA
C1F8U4_ACIC5/19-277----------K---EQK.....Q-P----I----------------------------------------VAL..TAYDY
PANB_BDEBA/2-258----------K---SKK.....Q-K----I----------------------------------------SMI..TCYDY
PANB_PSELT/2-257----------K---GK......K-P----I----------------------------------------VML..TAYDS
PANB_POLSJ/34-294----------H---AQG.....E-K----I----------------------------------------TML..TAYDA
G0A0M7_METMM/10-265----------K---QAG.....E-K----I----------------------------------------TSL..TAYDA
E3E4R6_PAEPS/7-265----------K---QEG.....I-P----L----------------------------------------SML..TAYDY
R7P8R5_9BACT/11-269----------K---EHG.....K-K----I----------------------------------------AML..TSYDY
G8QNM1_DECSP/9-266----------K---AAG.....E-K----I----------------------------------------AML..TCYDA
V6JZL1_STRNV/26-283----------K---RRG.....E-K----W----------------------------------------PML..TAYDA
F4GUY4_PUSST/9-264----------K---..G....QQ-K----I----------------------------------------AAL..TAYTA
R7C4Y8_9BURK/5-261----------K---AAG.....E-P----I----------------------------------------AML..TCYDY
R6EWT4_9BACT/11-269----------K---KCG.....E-K----I----------------------------------------SWL..TAYDY
PANB_PSYA2/2-261----------K---KDG.....T-K----F----------------------------------------TCL..TCYDA
E6UF09_RUMA7/2-260----------K---QSG.....E-K----I----------------------------------------TML..TAYDY
PANB_PROMM/4-256----------K---QDG.....R-A----I----------------------------------------SIL..TAWDG
F8GE64_NITSI/2-259----------L---ENN.....E-K----F----------------------------------------TVL..TCYDA
G8YQ94_PICSO/33-293----------H---RQR.....K-P----I----------------------------------------SMI..TAYDY
R6EER5_9BACT/10-268----------K---AAG.....E-K----V----------------------------------------TMM..TAYDY
R6MV46_9FIRM/2-260----------K---QSG.....E-K----L----------------------------------------TML..TAYDY
E1ZCJ6_CHLVA/23-287----------Y---RRG.....E-P----I----------------------------------------SMV..TAYDY
PANB_NITSB/4-255----------K---NS......N-K----L----------------------------------------VMI..TAYDA
M4VAT0_9DELT/3-258----------K---KSG.....E-K----I----------------------------------------TML..TCYDY
J9ZD86_LEPFM/6-263----------K---KEG.....P-P----L----------------------------------------TMV..TAYDA
L0K4F1_HALHC/4-262----------K---DAG.....K-K----I----------------------------------------TML..TAYDY
E6WZE1_NITSE/11-266----------K---GV......E-P----V----------------------------------------TMI..TAYDA
R7IQM6_9FIRM/7-262----------K---KNG.....E-R----L----------------------------------------AML..TAYDY
R5JJK8_9FIRM/2-260----------K---GTE.....N-K----I----------------------------------------SMI..TAYDY
F8DZN0_CORRG/23-280----------K---AEG.....K-K----F----------------------------------------AML..TAYDY
I4D5R2_DESAJ/3-259----------K---NQR.....K-K----I----------------------------------------VMV..TAYDY
PANB_LEIXX/16-273----------K---EEG.....S-R----F----------------------------------------TGL..TSYDT
PANB_NITMS/2-259----------K---KGK.....K-K----V----------------------------------------SVI..TGYDY
PANB1_PSEAE/9-265----------K---..G....AG-S----L----------------------------------------VAL..TAYST
G8BMS9_TETPH/44-308----------Y---TLK.....Q-P----I----------------------------------------TMC..TAYDY
R5V6Z6_9FIRM/2-260----------K---DKG.....E-K----L----------------------------------------SML..TAYDY
R5U793_9BACE/11-269----------K---QRG.....E-K----I----------------------------------------SML..TAYDY
F6CMZ4_DESK7/5-263----------K---KTG.....R-K----I----------------------------------------TML..TAYDY
B9L8Y5_NAUPA/4-254----------.---........D-K----L----------------------------------------TMI..TAYDA
PANB_DESPS/2-260----------K---AAG.....Q-K----I----------------------------------------SML..TAYDA
L0F2P8_DESDL/3-259----------K---EQG.....Q-K----I----------------------------------------VMV..TAYDY
K9Y6F0_HALP7/3-258----------K---QQQ.....R-P----I----------------------------------------TVL..TAWDY
PANB_NITEU/8-264----------C---EQG.....E-K----I----------------------------------------AVL..TCYDA
M5C834_THACB/15-272----------K---QKG.....T-A----I----------------------------------------TVL..TAYDY
T2KQ61_9FLAO/10-268----------K---AHG.....E-K----I----------------------------------------SML..TAYDY
I1NLG6_ORYGL/83-346----------H---RRG.....E-P----I----------------------------------------SMV..TAYDY
E6TZJ1_BACCJ/3-259----------K---KNG.....D-K----I----------------------------------------TMV..TAYDA
K0B4S7_CLOA9/4-262----------K---RNN.....E-K----I----------------------------------------TVL..TAYDY
R6VBN9_9CLOT/2-260----------K---QQG.....R-K----I----------------------------------------SML..TAYDY
G4QJL3_GLANF/3-259----------K---QKG.....E-K----I----------------------------------------AAL..TAYDA
PANB_RHOBA/10-264----------R---DRG.....E-R----I----------------------------------------TML..TAYDF
R5DYA6_9BURK/9-266----------Y---EAG.....E-P----I----------------------------------------VML..TCYDA
PANB_RHORT/10-268----------K---SPA....AE-P----V----------------------------------------VCL..TAYTA
A5DVU0_LODEL/36-294----------Y---HEK.....K-P----I----------------------------------------TMV..TAFDS
B6JWN4_SCHJY/27-297----------Y---EKG.....E-P----I----------------------------------------ACM..TAHDY
PANB_CORGL/8-265----------K---VNG.....Q-K----V----------------------------------------SVL..TSYDA
PANB_RALSO/12-268----------R---AAG.....E-R----I----------------------------------------AML..TAYDA
R6LXN4_9CLOT/2-260----------K---EKG.....E-K----L----------------------------------------TML..TAYDY
PANB_MOOTA/6-264----------K---ERG.....E-R----I----------------------------------------TMV..TAYDY
F2F6S0_SOLSS/3-258----------K---EQG.....E-K----I----------------------------------------VMI..TAYDY
PANB_AZOSB/9-267----------R---AEG.....R-K----I----------------------------------------AML..TCYDA
D3SC34_THISK/3-258----------K---QAG.....E-P----I----------------------------------------TCL..TAYDA
D4H852_DENA2/9-265----------K---ADG.....E-K----I----------------------------------------TSI..TAYDY
H6L4G9_SAPGL/9-267----------K---QRG.....E-K----I----------------------------------------SML..TAYDF
R6DPQ8_9CLOT/2-260----------K---ENG.....Q-K----I----------------------------------------TML..TAYDY
N0B212_9BACI/3-259----------K---ENN.....E-K----I----------------------------------------VML..TAYDY
R7K0E3_9CLOT/2-260----------K---QDG.....V-K----I----------------------------------------AML..TAYDY
Q6BIM6_DEBHA/33-293----------Y---ETK.....T-P----I----------------------------------------SVV..TAYDF
K0KXD0_WICCF/32-290----------Y---NSN.....T-K----I----------------------------------------SVL..TAHDY
E8RS63_ASTEC/11-266----------K---..G....GT-P----L----------------------------------------VSL..TAYDA
F9X8W4_ZYMTI/67-327----------Y---TRH.....E-P----I----------------------------------------TMI..TAHDF
A4XA35_SALTO/20-277----------K---ERG.....E-R----W----------------------------------------AML..TSYDQ
D5U1C4_THEAM/4-259----------K---NR......E-K----I----------------------------------------AAV..TAYDY
I0ICC5_PHYMF/8-267----------A---RDR.....R-P----F----------------------------------------AML..TCYDA
F4PL25_DICFS/108-366----------F---ESN.....I-P----I----------------------------------------TMV..TAYDY
G4KQR4_OSCVS/3-261----------K---QDG.....E-K----V----------------------------------------SWI..TSYDT
K9YNE4_CYASC/2-257----------K---QEK.....K-P----I----------------------------------------VCL..TAWDY
PANB_WOLSU/3-258----------K---NQ......E-K----I----------------------------------------TMI..TAYDA
E6U5I9_ETHHY/4-262----------K---QNR.....R-K----I----------------------------------------AML..TAYDY
B8BWG2_THAPS/41-307----------K---RRG.....H-K----I----------------------------------------TMV..TAYDY
K9SYS3_9SYNE/2-257----------K---SEG.....R-A----I----------------------------------------AAL..TATEY
PANB_AERPE/5-260----------K---GS......R-P----I----------------------------------------VAV..TAYDY
R7DES0_9PORP/10-268----------K---QRG.....E-K----V----------------------------------------SML..TAYDY
PANB_BAUCH/4-259----------K---QRQ.....Q-K----F----------------------------------------AAI..TAYDA
I5AYL4_9DELT/4-258----------K---QEG.....K-K----I----------------------------------------TAL..TAYDY
PANB_BACSK/2-259----------K---RDG.....E-P----I----------------------------------------AML..TAYDA
R6A0K1_9BACT/11-268----------K---AEG.....K-K----I----------------------------------------AML..TSYDF
B2IDS4_BEII9/7-254----------K---RRG.....E-P----I----------------------------------------AML..TAYDA
K0C447_CYCSP/9-266----------K---KRG.....E-K----I----------------------------------------VSL..TAYDA
PANB_LISMO/5-258----------K---ENG.....E-K----I----------------------------------------TMI..TAYDY
PANB_RHILO/16-267----------K---..G....GV-P----L----------------------------------------VCL..TAYTY
K9VPY0_9CYAN/2-258----------K---QQQ.....R-P----I----------------------------------------VAL..TAYDY
C0ZCH0_BREBN/7-265----------K---ETR.....T-P----I----------------------------------------TMV..TAYDY
A7TTC6_VANPO/36-301----------Y---LAC.....E-P----L----------------------------------------SMC..TAYDY
M4ZY73_9ACTN/20-278----------K---ENG.....I-K----I----------------------------------------TGL..TSYEC
D2U9Y6_XANAP/10-266----------K---RRQ.....Q-K----L----------------------------------------VML..TAYDA
PANB_BACLD/3-259----------K---QEG.....E-P----I----------------------------------------VML..TAYDY
K9ZZ09_DEIPD/3-257----------E---........D-K----L----------------------------------------VMV..TAYDY
D3UG21_HELM1/2-256----------K---NQ......E-K----I----------------------------------------TAI..TAYDA
R5FZT9_9PORP/11-269----------K---GEG.....D-K----I----------------------------------------AML..TAYDF
E0SBL5_DICD3/3-259----------K---QEQ.....K-K----F----------------------------------------ATL..TAYDA
PANB_HALSA/12-261----------.---EET.....D-P----V----------------------------------------TML..TAYDA
PANB_CAMJE/4-258----------K---AKN.....E-K----I----------------------------------------TMV..SAYDY
Q0UNM3_PHANO/57-317----------Y---RKN.....E-P----I----------------------------------------TMI..TAHDF
PANB_SULAC/5-259----------K---.GK.....E-K----I----------------------------------------TML..TAYDY
M4NHU9_9GAMM/13-271----------K---TQG.....R-R----I----------------------------------------VML..TAYDA
C5C4X5_BEUC1/14-271----------K---ERG.....E-R----L----------------------------------------TML..TAYDA
E2SAV3_9ACTN/24-281----------K---ADG.....E-K----W----------------------------------------AML..TAYDQ
I2F2C6_9BACT/2-256----------K---GQ......S-K----L----------------------------------------SVI..SAYSY
PANB_DECAR/9-266----------Y---QAG.....E-K----I----------------------------------------AQF..TCYDA
W1Q8C1_OGAPD/26-284----------Y---KAK.....E-P----L----------------------------------------AVI..TAHDY
PANB_KOSOT/2-256----------K---GK......R-K----L----------------------------------------SMV..TAYSY
PANB2_BRADU/11-267----------K---DKG.....R-R----V----------------------------------------VMT..TAYDA
R7NSE5_9FIRM/2-259----------K---ANG.....E-K----I----------------------------------------SML..TAYDY
A8DWD1_NEMVE/4-260----------K---QSG.....E-K----I----------------------------------------AML..TCYDA
D9SIJ1_GALCS/2-259----------K---SRS.....E-K----I----------------------------------------AVL..TCYDA
PANB2_VIBF1/3-259----------K---EVG.....E-K----F----------------------------------------ASI..TAYDA
C4Y7C6_CLAL4/28-286----------Y---AEN.....T-P----I----------------------------------------SVA..TAWDA
E0UPX6_SULAO/4-259----------K---GV......R-P----L----------------------------------------VMI..TAYDA
C0QS02_PERMH/2-258----------K---EEG.....K-K----I----------------------------------------TMI..STYDY
PANB_PELUB/4-253----------K---NK......T-K----I----------------------------------------ISL..TAYSK
F2LWA6_HIPMA/2-259----------K---DK......E-K----I----------------------------------------SMI..TAYDY
PANB_THICR/2-256----------K---QAG.....E-K----I----------------------------------------VCL..TAYEA
M5DV17_9GAMM/4-263----------K---EQQ.....Q-K----F----------------------------------------AVL..TAYDA
X2HEZ8_9NEIS/2-257----------K---AAG.....E-K----I----------------------------------------AML..TCYDA
I1YKY2_METFJ/3-261----------K---AAH.....D-K----I----------------------------------------AVL..TAYDA
D2NU30_ROTMD/61-319----------K---ATG.....Q-K----F----------------------------------------SML..TCYDA
R5SB00_9GAMM/3-259----------K---ENN.....E-K----I----------------------------------------AML..TAYDY
E1VAR3_HALED/19-275----------K---RAG.....E-A----F----------------------------------------SCL..TAYDT
D3SNL0_THEAH/2-259----------R---EEG.....R-K----I----------------------------------------TMV..STYDY
U3U9E1_9GAMM/4-259----------K---SDG.....C-K----F----------------------------------------AAL..TAYDF
PANB_CLOAB/2-260----------K---FKK.....E-K----L----------------------------------------VML..TAYDY
B7GHT0_ANOFW/22-277----------K---KNH.....E-P----I----------------------------------------VML..TAYDY
B8EK33_METSB/5-251----------K---RRG.....E-P----I----------------------------------------AVL..TAYDA
C8X1K5_DESRD/4-262----------K---TGG.....E-K----L----------------------------------------AMA..TAYDY
G4T0T2_META2/12-267----------K---QRG.....E-K----I----------------------------------------SCL..TAYDA
PANB_ANAMF/4-256----------K---GL......E-K----I----------------------------------------ACL..TAYTF
I4YBJ3_WALMC/10-273----------R---RQN.....H-P----I----------------------------------------TVL..TAYDY
F0S4V2_PSESL/9-267----------K---QKG.....E-R----I----------------------------------------AML..TAYDY
E6SCG6_INTC7/25-282----------K---TEG.....R-R----W----------------------------------------AML..TAYDM
PANB_CORJK/21-279----------K---GTG.....E-P----F----------------------------------------AML..TAYDY
F4PBH9_BATDJ/27-283----------Y---NTK.....T-P----I----------------------------------------TVM..TAHDY
PANB_CYAP4/3-259----------K---RSG.....R-A----I----------------------------------------AVL..TAWDW
U5QGT4_9CYAN/2-258----------K---ERA.....Q-P----I----------------------------------------VAL..TAFEY
E7A9J8_HELFC/3-264----------K---HPKEGASPC-K----I----------------------------------------SAI..TAYDA
PANB_ROSDO/14-264----------K---..G....GE-P----I----------------------------------------VSL..TAYTT
I0H0N1_ACTM4/15-272----------K---ARG.....D-R----W----------------------------------------PML..TSYDM
M2PBF7_CERS8/43-302----------R---RSG.....T-P----I----------------------------------------TML..TAYDY
V4KY10_9DELT/4-261----------K---DEG.....R-K----V----------------------------------------VWV..TAYDY
D4MUX9_ANAHA/2-260----------K---DNG.....E-K----I----------------------------------------TML..TAYDY
K4II33_PSYTT/10-268----------K---ANA.....E-K----I----------------------------------------SML..TSYDF
G2TM93_BACCO/3-259----------K---AQE.....E-K----I----------------------------------------AMV..TAYDY
PANB_NOCFA/22-279----------K---ADG.....E-R----W----------------------------------------AML..TAYDY
PANB_STRMK/10-265----------K---RNG.....Q-K----L----------------------------------------VML..TAYDA
R6Q9M5_9FIRM/3-261----------K---AKG.....E-K----I----------------------------------------SML..TAYDY
PANB_GEOLS/4-261----------K---QEG.....R-K----V----------------------------------------TVL..TAYDY
PANB_STACT/3-256----------K---KNS.....E-K----I----------------------------------------TMV..TSYDY
D3IAK5_9BACT/11-269----------K---KQG.....E-K----I----------------------------------------TML..TAYDY
E3RMD4_PYRTT/56-316----------Y---RKG.....E-P----I----------------------------------------TMI..TAHDF
F8C4E6_THEGP/11-262----------K---GK......E-P