Sequence alignment for CL0151

PF15617

A0A018UEH6_SALET/4-300--------------------------------------------------------------------------------
D5CKQ7_ENTCC/4-300--------------------------------------------------------------------------------
A0A023YEE1_ECOLX/4-300--------------------------------------------------------------------------------
A7MPV2_CROS8/4-300--------------------------------------------------------------------------------
C4XDI3_KLEPN/4-300--------------------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------------------------------------------------------------------------------
D0KLU5_PECWW/4-299--------------------------------------------------------------------------------
B4EW80_PROMH/4-300--------------------------------------------------------------------------------
D3V2D7_XENBS/4-302--------------------------------------------------------------------------------
A0A014LRW3_YERPE/4-300--------------------------------------------------------------------------------
B1JNG5_YERPY/4-300--------------------------------------------------------------------------------
E1PL56_PANVC/4-300--------------------------------------------------------------------------------
D3VJW5_XENNA/4-307--------------------------------------------------------------------------------
E2MHA5_PSEUB/3-297--------------------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------------------------------------------------------------------------------
F3K7E7_PSESZ/3-297--------------------------------------------------------------------------------
Q39AX0_BURS3/4-298--------------------------------------------------------------------------------
N9BC11_ACIBI/1-291--------------------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------------------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------------------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------------------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------------------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------------------------------------------------------------------------------
B6C0F8_9GAMM/22-310--------------------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------------------------------------------------------------------------------
G2TCW8_RHORU/5-292--------------------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------------------------------------------------------------------------------
D5BYR3_NITHN/21-309--------------------------------------------------------------------------------
D8K7I6_NITWC/22-310--------------------------------------------------------------------------------
E8U9R3_DEIML/2-291--------------------------------------------------------------------------------
A8MM95_ALKOO/30-358--------------------------------------------------------------------------------
Q891X5_CLOTE/30-379--------------------------------------------------------------------------------
A8F9P5_BACP2/30-369--------------------------------------------------------------------------------
C9RML9_FIBSS/26-364--------------------------------------------------------------------------------
E3IYR0_FRASU/30-378--------------------------------------------------------------------------------
Q9KY27_STRCO/30-371--------------------------------------------------------------------------------
E3DTS5_BACA1/30-361--------------------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------------------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------------------------------------------------------------------------------
F2JGK5_CELLD/30-375--------------------------------------------------------------------------------
I0UNS1_BACLI/30-368--------------------------------------------------------------------------------
D1BEK0_SANKS/30-368--------------------------------------------------------------------------------
D1A9P4_THECD/30-368--------------------------------------------------------------------------------
C9ZE12_STRSW/30-371--------------------------------------------------------------------------------
F4H5N5_CELFA/32-371--------------------------------------------------------------------------------
B7HBK1_BACC4/30-348--------------------------------------------------------------------------------
A0A011W6K7_BACTI/30-348--------------------------------------------------------------------------------
C8W644_DESAS/30-371--------------------------------------------------------------------------------
Q82B97_STRAW/30-370--------------------------------------------------------------------------------
Q0SDY5_RHOSR/44-383--------------------------------------------------------------------------------
Q72YD0_BACC1/30-348--------------------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------------------------------------------------------------------------------
A4J1D5_DESRM/16-360--------------------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------------------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------------------------------------------------------------------------------
Q186J7_PEPD6/30-345--------------------------------------------------------------------------------
E3EE66_PAEPS/10-368--------------------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------------------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------------------------------------------------------------------------------
D0L8D1_GORB4/35-372--------------------------------------------------------------------------------
B1VYI2_STRGG/30-395--------------------------------------------------------------------------------
C9XQK5_PEPDC/30-345--------------------------------------------------------------------------------
F4EXE4_SELS3/15-331--------------------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------------------------------------------------------------------------------
A8L403_FRASN/30-378--------------------------------------------------------------------------------
A6WD82_KINRD/30-375--------------------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------------------------------------------------------------------------------
A2RKY2_LACLM/29-388--------------------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------------------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------------------------
CAPP_ACTP2/128-879--------------------------------------------------------------------------------
A0ZJ69_NODSP/196-1034--------------------------------------------------------------------------------
D3VH32_XENNA/127-879--------------------------------------------------------------------------------
Q2KZS8_BORA1/137-936--------------------------------------------------------------------------------
D2QW47_PIRSD/157-942--------------------------------------------------------------------------------
A5GVT4_SYNR3/167-992--------------------------------------------------------------------------------
C6D470_PAESJ/147-936--------------------------------------------------------------------------------
B8HVC9_CYAP4/199-1018--------------------------------------------------------------------------------
C1F4Y2_ACIC5/161-947--------------------------------------------------------------------------------
CAPP_SYNY3/193-1034--------------------------------------------------------------------------------
B1XMB9_SYNP2/163-995--------------------------------------------------------------------------------
A4S610_OSTLU/183-1007--------------------------------------------------------------------------------
A9RUR8_PHYPA/162-969--------------------------------------------------------------------------------
B8GNA5_THISH/143-947--------------------------------------------------------------------------------
CAPP_HAHCH/132-881--------------------------------------------------------------------------------
B1Y159_LEPCP/163-950--------------------------------------------------------------------------------
CAPP_THEEB/197-1011--------------------------------------------------------------------------------
A9S2G6_PHYPA/161-965--------------------------------------------------------------------------------
Q54JZ3_DICDI/144-931--------------------------------------------------------------------------------
C1MJ77_MICPC/164-991--------------------------------------------------------------------------------
E0UJ33_CYAP2/184-1020--------------------------------------------------------------------------------
A5WCX5_PSYWF/133-932--------------------------------------------------------------------------------
A0JSJ3_ARTS2/161-954--------------------------------------------------------------------------------
B7G725_PHATC/84-877--------------------------------------------------------------------------------
CAPP_GLOVI/141-939--------------------------------------------------------------------------------
C5Z450_SORBI/157-961--------------------------------------------------------------------------------
D1CE74_THET1/138-931--------------------------------------------------------------------------------
Q117S5_TRIEI/186-1038--------------------------------------------------------------------------------
C1AE63_GEMAT/147-933--------------------------------------------------------------------------------
A9QPD2_METI4/151-931--------------------------------------------------------------------------------
B0BZ90_ACAM1/184-1012--------------------------------------------------------------------------------
A4X3B0_SALTO/171-972--------------------------------------------------------------------------------
E3JCU0_FRASU/173-968--------------------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------------------------
A9IDM8_BORPD/139-951--------------------------------------------------------------------------------
A4G3V1_HERAR/147-944--------------------------------------------------------------------------------
C1DZM5_MICSR/162-982--------------------------------------------------------------------------------
D3EKG0_GEOS4/142-928--------------------------------------------------------------------------------
B1VUI2_STRGG/125-909--------------------------------------------------------------------------------
CAPP_SYNPW/180-1003--------------------------------------------------------------------------------
B0JPY0_MICAN/183-1018--------------------------------------------------------------------------------
B1WNZ1_CYAA5/187-1020--------------------------------------------------------------------------------
C8WQK0_ALIAD/133-906--------------------------------------------------------------------------------
D4ZQG2_ARTPN/196-1035--------------------------------------------------------------------------------
M1FKU6_9ALTE/130-889--------------------------------------------------------------------------------
CAPP_ECOLI/129-883--------------------------------------------------------------------------------
CAPP_HAEIN/129-879--------------------------------------------------------------------------------
Q0K7M4_CUPNH/207-1012--------------------------------------------------------------------------------
Q31KY7_SYNE7/201-1017--------------------------------------------------------------------------------
Q46IP1_PROMT/168-994--------------------------------------------------------------------------------
CAPP_PROMP/165-989--------------------------------------------------------------------------------
CAPP_VIBPA/129-877--------------------------------------------------------------------------------
CAPP_SHEON/129-881--------------------------------------------------------------------------------
U5GXD4_POPTR/166-968--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------------------------
PT1_STACT/251-543--------------------------------------------------------------------------------
PT1_CUPNH/262-557--------------------------------------------------------------------------------
PT1_ECOLI/250-542--------------------------------------------------------------------------------
PT1_HAEIN/250-542--------------------------------------------------------------------------------
PT1P_ECOLI/416-708--------------------------------------------------------------------------------
PPSA_PYRFU/496-796--------------------------------------------------------------------------------
PTFAX_XANCP/521-808--------------------------------------------------------------------------------
PT1_STRMU/252-546--------------------------------------------------------------------------------
PTFX2_ECOLI/362-654--------------------------------------------------------------------------------
PPSA_STAMF/504-813--------------------------------------------------------------------------------
D5AMJ7_RHOCB/521-803--------------------------------------------------------------------------------
Q24801_ENTHI/517-878--------------------------------------------------------------------------------
Q5L199_GEOKA/251-541--------------------------------------------------------------------------------
Q6MTX2_MYCMS/252-540--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_PLABD/3-257--------------------------------------------------------------------------------
I0DRD2_PROSM/4-258--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
W6RP24_9RHIZ/9-265--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_BURRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
M4X4T3_PSEDE/4-260--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
C3AJQ5_BACMY/3-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
U5T1Y9_9GAMM/5-261--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_MYCSM/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
M1M510_9PROT/12-263--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENCW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARAV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_THELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_AZOSU/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
C4XU18_DESMR/3-260--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
E4U2F8_SULKY/3-258--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_MYCGM/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
T0ULG9_9STRE/2-260--------------------------------------------------------------------------------
PANB_ALTMD/3-259--------------------------------------------------------------------------------
PANB_CAMC1/10-265--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
E8T692_THEA1/2-260--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
C5CWU9_VARPS/32-292--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTO/24-281--------------------------------------------------------------------------------
I2F2C6_9THEM/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9BACT/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALSC/10-273--------------------------------------------------------------------------------
F0S4V2_PEDSD/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_9FIRM/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_ARTAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCR/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICSR/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_RALME/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
E9CAY9_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9SPHI/9-267--------------------------------------------------------------------------------
G0JMB6_9GAMM/3-257--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_MYCFI/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
F2KYW8_PREDF/10-268--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_RHISN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTO/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_BURP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_ACISM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_PIRID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
L0B619_9PROT/13-263--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
I3YPM0_ALIFI/9-267--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
W5X9J0_9BACT/4-257--------------------------------------------------------------------------------
D5DBX1_BACMD/3-259--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
PANB_ERWT9/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
C7R7Z0_KANKD/3-259--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
E3HRX5_ACHXA/19-273--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
W0DFL3_9AQUI/2-259--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
PANB_BARHE/9-264--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENCW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CHRO/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGSM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
I3R834_HALMT/2-256--------------------------------------------------------------------------------
C4R687_PICPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_AMYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531VAILGSVSNEARKILTKEACAFLAILHRTFNPTRKALLQRRVDRQAEIDKGH.LP............DFL.PETKHIRDD
MASZ_CORGL/35-713YDFVTEAVLPRVGVDAEKFWSGFAAIARDLTPRNRELLARRDELQMLIDDYHRNNSGTID..QEAYEDFL.KEIGYLVEE
MASY_MYXXD/17-538VVVKGTWHPDYAEVLTPEALEFVAKLARNFGERRLALLERRKTVQAAWSKGA.RP............HFL.PETKAVR.E
MASZ_ECOLI/17-697KRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVK..DKAAYKSFLRELGYLVPQ
Q9RYN3_DEIRA/10-521MTINAPIKPEYAEILTPEALAFVAELHRRFEPRRRELMQKREERQQRLDAGE.LP............DFL.PETAEIR.A
MASY_MAIZE/16-548VDVRGRYDREFAGILTRDALDFVAGLQREFRGAVRYAMEQRREAQRRYDAGE.LP............RFD.PATTLVR.E
MASY_ECOLI/11-533LAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDNGT.LP............DFI.SETASIR.D
MASZ_MYCLE/17-704YDFVNNEALPGTDINPNSFWSGVAKVVADLTPQNQSLLNSRDELQAQIDKWHRHRVIEPF..DVDAYRQFLIDIGYLLPE
MASY_YEAST/18-542EPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQVVQKKLDSGS.YH...........LDFL.PETANIRND
B5GRN8_STRC2/12-539..VTAPAVPRQDEVLTEAALVFLAELHRRFTPRRDELLARRARRRAEISRTG.TL............DFL.PETAHVRAD
C5MBE7_CANTT/16-539.QILGPIPDDAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQKLRDQGF.LP............DFL.PETEYIRND
F2KMB8_PSEBN/18-697.DFVNNEAIPGTGLTADAFWAGADKVIHDLAPKNKALLAKRDDFQARIDAWH.QARAGQAHDAVAYKAFL.QDIGYLLPE
M4EJ48_BRARP/22-551.EVRGRYDQVFAKILTRDALGFVAELQREFRGHVRYAMECRREAKRRYNSGA.VP............GFD.PSTKFIR.D
W1QBI0_OGAPD/27-543........ATPRDILTKDALKFIVLLHRSFNETRKQLLENRQKVQERLDAGE.SL............HFL.EETKYIRED

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOSR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTO/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTO/7-239--------------------------------------------------------------------------------
B6HSS2_PENCW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C0RYY1_PARBP/55-297--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
G9AK98_PANAN/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_BURP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOSR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_RHISN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
E3HW38_ACHXA/8-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METAR/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_MYCGM/9-275--------------------------------------------------------------------------------
N1PYG8_MYCP1/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
J4G6Y7_FIBRA/9-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_MODMB/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF15617

A0A018UEH6_SALET/4-300--------------------------------------------------------------------------------
D5CKQ7_ENTCC/4-300--------------------------------------------------------------------------------
A0A023YEE1_ECOLX/4-300--------------------------------------------------------------------------------
A7MPV2_CROS8/4-300--------------------------------------------------------------------------------
C4XDI3_KLEPN/4-300--------------------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------------------------------------------------------------------------------
D0KLU5_PECWW/4-299--------------------------------------------------------------------------------
B4EW80_PROMH/4-300--------------------------------------------------------------------------------
D3V2D7_XENBS/4-302--------------------------------------------------------------------------------
A0A014LRW3_YERPE/4-300--------------------------------------------------------------------------------
B1JNG5_YERPY/4-300--------------------------------------------------------------------------------
E1PL56_PANVC/4-300--------------------------------------------------------------------------------
D3VJW5_XENNA/4-307--------------------------------------------------------------------------------
E2MHA5_PSEUB/3-297--------------------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------------------------------------------------------------------------------
F3K7E7_PSESZ/3-297--------------------------------------------------------------------------------
Q39AX0_BURS3/4-298--------------------------------------------------------------------------------
N9BC11_ACIBI/1-291--------------------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------------------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------------------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------------------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------------------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------------------------------------------------------------------------------
B6C0F8_9GAMM/22-310--------------------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------------------------------------------------------------------------------
G2TCW8_RHORU/5-292--------------------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------------------------------------------------------------------------------
D5BYR3_NITHN/21-309--------------------------------------------------------------------------------
D8K7I6_NITWC/22-310--------------------------------------------------------------------------------
E8U9R3_DEIML/2-291--------------------------------------------------------------------------------
A8MM95_ALKOO/30-358--------------------------------------------------------------------------------
Q891X5_CLOTE/30-379--------------------------------------------------------------------------------
A8F9P5_BACP2/30-369--------------------------------------------------------------------------------
C9RML9_FIBSS/26-364--------------------------------------------------------------------------------
E3IYR0_FRASU/30-378--------------------------------------------------------------------------------
Q9KY27_STRCO/30-371--------------------------------------------------------------------------------
E3DTS5_BACA1/30-361--------------------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------------------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------------------------------------------------------------------------------
F2JGK5_CELLD/30-375--------------------------------------------------------------------------------
I0UNS1_BACLI/30-368--------------------------------------------------------------------------------
D1BEK0_SANKS/30-368--------------------------------------------------------------------------------
D1A9P4_THECD/30-368--------------------------------------------------------------------------------
C9ZE12_STRSW/30-371--------------------------------------------------------------------------------
F4H5N5_CELFA/32-371--------------------------------------------------------------------------------
B7HBK1_BACC4/30-348--------------------------------------------------------------------------------
A0A011W6K7_BACTI/30-348--------------------------------------------------------------------------------
C8W644_DESAS/30-371--------------------------------------------------------------------------------
Q82B97_STRAW/30-370--------------------------------------------------------------------------------
Q0SDY5_RHOSR/44-383--------------------------------------------------------------------------------
Q72YD0_BACC1/30-348--------------------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------------------------------------------------------------------------------
A4J1D5_DESRM/16-360--------------------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------------------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------------------------------------------------------------------------------
Q186J7_PEPD6/30-345--------------------------------------------------------------------------------
E3EE66_PAEPS/10-368--------------------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------------------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------------------------------------------------------------------------------
D0L8D1_GORB4/35-372--------------------------------------------------------------------------------
B1VYI2_STRGG/30-395--------------------------------------------------------------------------------
C9XQK5_PEPDC/30-345--------------------------------------------------------------------------------
F4EXE4_SELS3/15-331--------------------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------------------------------------------------------------------------------
A8L403_FRASN/30-378--------------------------------------------------------------------------------
A6WD82_KINRD/30-375--------------------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------------------------------------------------------------------------------
A2RKY2_LACLM/29-388--------------------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------------------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942-----------------------------------------SLDVRLVFTAHPTEASRRAVLTKLRRISDILGEDTEEG.
CAPP_ACTP2/128-879-----------------------------------------KLSIELVLTAHPTEVTRRSLVHKHVEINKCLGQLEHDD.
A0ZJ69_NODSP/196-1034-----------------------------------------HLDVRLVFTAHPTEIVRHTIRDKQRQVVNLLQKLDVAE.
D3VH32_XENNA/127-879-----------------------------------------ELAIELVLTAHPTEIARRTLIHKLVEVNGCLAQLDHDD.
Q2KZS8_BORA1/137-936-----------------------------------------EACVMPVLTAHPTEVQRKSTLDAHREIAALLAQRDQ.T.
D2QW47_PIRSD/157-942-----------------------------------------KMLIELVFTAHPSEAKRRSIRAKLRRMRHALQELDRTD.
A5GVT4_SYNR3/167-992-----------------------------------------ELDVRLVFTAHPTEIVRHTVRHKHRRVAHLIQRLEGLN.
C6D470_PAESJ/147-936-----------------------------------------NISLELVMTAHPTEATRRAVLDIHKRIAEDVMELDNPT.
B8HVC9_CYAP4/199-1018-----------------------------------------QLDIKLVFTAHPTEIVRQTIRDKQRRIARILEQLDRVE.
C1F4Y2_ACIC5/161-947-----------------------------------------RIFVVPVFTAHPTEVARRSVLFKRRRIGEFLAHLDSIP.
CAPP_SYNY3/193-1034-----------------------------------------HLDIRLVITAHPTEIVRHTIRRKQRRVDRILRKLDQLQ.
B1XMB9_SYNP2/163-995-----------------------------------------QLDIRLVFTAHPTEIVRHTIRNKQRRIAGILRQLDQTE.
A4S610_OSTLU/183-1007-----------------------------------------VQHVDLVLTAHPTQALRRSMLKSFGIIREKLLQLQRFR.
A9RUR8_PHYPA/162-969-----------------------------------------EQTVDLVFTAHPTQAVRRSLLQKHSRIRNCLSQMYQKD.
B8GNA5_THISH/143-947-----------------------------------------QLAYVPVFTAHPTEARRRTVMEAQRRIFLAADRLNDRR.
CAPP_HAHCH/132-881-----------------------------------------DLNLEFVLTAHPTEITRRTLIQKYDQISECLESLDRSD.
B1Y159_LEPCP/163-950-----------------------------------------HAYISPVLTAHPTEVQRKSILDAERAVAELIGERDD.L.
CAPP_THEEB/197-1011-----------------------------------------QLDIKLVFTAHPTEIVRQTIRDKQRRVARLLEQLDVLE.
A9S2G6_PHYPA/161-965-----------------------------------------HQTVDLVLTAHPTQSVRRSLLQKHTRIRSCLSQLNQVD.
Q54JZ3_DICDI/144-931-----------------------------------------QQKIELVLTAHPTQIMRRTIISKNSAMGEALSSLDNQQ.
C1MJ77_MICPC/164-991-----------------------------------------EQEVDLVFTAHPTQALRRSMLKNFARIRQCLLDLQARR.
E0UJ33_CYAP2/184-1020-----------------------------------------QLDVRLVFTAHPTEIVRHTIRRKQRRIAHILQKLDQAE.
A5WCX5_PSYWF/133-932-----------------------------------------QLKFIPVFTAHPTEARRRTTMNILQTLYAHSTALNDLP.
A0JSJ3_ARTS2/161-954-----------------------------------------ELDVRPIFTAHPTEASRRSVLDKIRRLSDVLAVSTEEG.
B7G725_PHATC/84-877-----------------------------------------KQKVEIVLTAHPTQVQRKSLLRKYRRVSEMLAYLERPD.
CAPP_GLOVI/141-939-----------------------------------------QLDVRLVFTAHPTEIVRRTIRTKHRRIVHLLDDLDNA..
C5Z450_SORBI/157-961-----------------------------------------NQSVDLVFTAHPTQSARRSLLQKNARIRNCLTQLSAKD.
D1CE74_THET1/138-931-----------------------------------------RLRARFVFTAHPTESRRRTTLMHLRHISNLIALLDDAL.
Q117S5_TRIEI/186-1038-----------------------------------------NLDIRLVFTAHPTEIVRRTIRTKQRRIAKILQQLDQVN.
C1AE63_GEMAT/147-933-----------------------------------------SALVSPVLTAHPTEVQRQSTLTVMQQIATLLEQRDRMV.
A9QPD2_METI4/151-931-----------------------------------------KMEIVLVFTAHPTEIKRQTILNKLCEISSYLKKESFNS.
B0BZ90_ACAM1/184-1012-----------------------------------------NLDIQLVFTAHPTEIVRQTIRAKQRRIAKILGKLDEAE.
A4X3B0_SALTO/171-972-----------------------------------------RLAIRPVFTAHPTEAARRSILSKLRAIADELDTETTNA.
E3JCU0_FRASU/173-968-----------------------------------------RLELRPVFTAHPTEASRRSVLDVLRGIAELLDAADDPR.
Q2JKJ2_SYNJB/177-978-----------------------------------------QLHIRMVFTAHPTEIVRHTIREKQRAFSRLLSQLDWAE.
A9IDM8_BORPD/139-951-----------------------------------------EARVVPVLTAHPTEVQRKSTLDVHREISTLLLQREG.P.
A4G3V1_HERAR/147-944-----------------------------------------DALISPVLTAHPTEVQRKSILDAEHDIASLLAARDL.P.
C1DZM5_MICSR/162-982-----------------------------------------EQEVDLVLTAHPTQALRRSMLKNFGTVRQKLLDLQRAR.
D3EKG0_GEOS4/142-928-----------------------------------------SLSLELVMTAHPTEAMRRAILDIHKRIADDVMQLDNPT.
B1VUI2_STRGG/125-909-----------------------------------------NLNVRPVFTAHPTEAARRSVLNKLRRIAALLET....P.
CAPP_SYNPW/180-1003-----------------------------------------ELDIRLVFTAHPTEIVRHTVRHKQRRVASLLQQLEAQT.
B0JPY0_MICAN/183-1018-----------------------------------------QLDIRLVFTAHPTEIVRHTIRIKQRRISGILEKLDQAE.
B1WNZ1_CYAA5/187-1020-----------------------------------------QLDIRLVFTAHPTEIVRHTIRLKQRRIATLLRRLDYAE.
C8WQK0_ALIAD/133-906-----------------------------------------..GIELVLTAHPTEALRRTVLDKHTKIAAFLEDMDDPR.
D4ZQG2_ARTPN/196-1035-----------------------------------------QLDIRLVFTAHPTEIVRHTIRTKQRRIAKILQQLDTVD.
M1FKU6_9ALTE/130-889-----------------------------------------.LRVEFVLTAHPTEVTRRTLIMKYDDMSDCLEQLDHQD.
CAPP_ECOLI/129-883-----------------------------------------.LSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKD.
CAPP_HAEIN/129-879-----------------------------------------.LLIELVLTAHPTETTRRSLIHKHIEINKCLSKLEHHD.
Q0K7M4_CUPNH/207-1012-----------------------------------------..LIVPVLTAHPTEVQRKSILDAEREIARLLAERDL.P.
Q31KY7_SYNE7/201-1017-----------------------------------------.LDIRLVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELE.
Q46IP1_PROMT/168-994-----------------------------------------EMDIRLVFTAHPTEIVRHTVRHKQRRVATLLQQLQSNS.
CAPP_PROMP/165-989-----------------------------------------EMDIRLVFTAHPTEIVRHTIRHKQTRVANLLQKIQVEKF
CAPP_VIBPA/129-877-----------------------------------------.LNIELVLTAHPTEITRRTMINKLVKINECLSKLELSD.
CAPP_SHEON/129-881-----------------------------------------.LDIDLVLTAHPTEISRRTLIQKYAAIVDCLAEQENNQ.
U5GXD4_POPTR/166-968-----------------------------------------.QTVELVFTAHPTQSVRRSLLQKHARIRNCLAQLYAKD.

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------------------------
PT1_STACT/251-543--------------------------------------------------------------------------------
PT1_CUPNH/262-557--------------------------------------------------------------------------------
PT1_ECOLI/250-542--------------------------------------------------------------------------------
PT1_HAEIN/250-542--------------------------------------------------------------------------------
PT1P_ECOLI/416-708--------------------------------------------------------------------------------
PPSA_PYRFU/496-796--------------------------------------------------------------------------------
PTFAX_XANCP/521-808--------------------------------------------------------------------------------
PT1_STRMU/252-546--------------------------------------------------------------------------------
PTFX2_ECOLI/362-654--------------------------------------------------------------------------------
PPSA_STAMF/504-813--------------------------------------------------------------------------------
D5AMJ7_RHOCB/521-803--------------------------------------------------------------------------------
Q24801_ENTHI/517-878--------------------------------------------------------------------------------
Q5L199_GEOKA/251-541--------------------------------------------------------------------------------
Q6MTX2_MYCMS/252-540--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_PLABD/3-257--------------------------------------------------------------------------------
I0DRD2_PROSM/4-258--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
W6RP24_9RHIZ/9-265--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_BURRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
M4X4T3_PSEDE/4-260--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
C3AJQ5_BACMY/3-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
U5T1Y9_9GAMM/5-261--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_MYCSM/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
M1M510_9PROT/12-263--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENCW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARAV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_THELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_AZOSU/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
C4XU18_DESMR/3-260--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
E4U2F8_SULKY/3-258--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_MYCGM/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
T0ULG9_9STRE/2-260--------------------------------------------------------------------------------
PANB_ALTMD/3-259--------------------------------------------------------------------------------
PANB_CAMC1/10-265--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
E8T692_THEA1/2-260--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
C5CWU9_VARPS/32-292--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTO/24-281--------------------------------------------------------------------------------
I2F2C6_9THEM/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9BACT/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALSC/10-273--------------------------------------------------------------------------------
F0S4V2_PEDSD/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_9FIRM/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_ARTAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCR/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICSR/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_RALME/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
E9CAY9_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9SPHI/9-267--------------------------------------------------------------------------------
G0JMB6_9GAMM/3-257--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_MYCFI/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
F2KYW8_PREDF/10-268--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_RHISN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTO/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_BURP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_ACISM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_PIRID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
L0B619_9PROT/13-263--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
I3YPM0_ALIFI/9-267--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
W5X9J0_9BACT/4-257--------------------------------------------------------------------------------
D5DBX1_BACMD/3-259--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
PANB_ERWT9/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
C7R7Z0_KANKD/3-259--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
E3HRX5_ACHXA/19-273--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
W0DFL3_9AQUI/2-259--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
PANB_BARHE/9-264--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENCW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CHRO/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGSM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
I3R834_HALMT/2-256--------------------------------------------------------------------------------
C4R687_PICPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_AMYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531PSWKG.AP........................................................................
MASZ_CORGL/35-713PEAAEIRTQNVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEKGKEYNPVRGQKVI..EWG
MASY_MYXXD/17-538GDWTV.AP........................................................................
MASZ_ECOLI/17-697PERVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIA...WVR
Q9RYN3_DEIRA/10-521GDWKI.SP........................................................................
MASY_MAIZE/16-548GDWTC.AS........................................................................
MASY_ECOLI/11-533ADWKI.RG........................................................................
MASZ_MYCLE/17-704PDDFTISTSGVDDEITMTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDTIPETEGAEKGSEYNKIRGDKVI.AYAR
MASY_YEAST/18-542PTWQG.PI........................................................................
B5GRN8_STRC2/12-539DSWRV.AP........................................................................
C5MBE7_CANTT/16-539PTWTG.PA........................................................................
F2KMB8_PSEBN/18-697AADFQ.ATTQNVDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDAISEADGAEKGKGYNKVRGDKVIAFAR
M4EJ48_BRARP/22-551GEWVC.AS........................................................................
W1QBI0_OGAPD/27-543PNWKC.LP........................................................................

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOSR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTO/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTO/7-239--------------------------------------------------------------------------------
B6HSS2_PENCW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C0RYY1_PARBP/55-297--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
G9AK98_PANAN/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_BURP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOSR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_RHISN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
E3HW38_ACHXA/8-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METAR/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_MYCGM/9-275--------------------------------------------------------------------------------
N1PYG8_MYCP1/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
J4G6Y7_FIBRA/9-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_MODMB/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF15617

A0A018UEH6_SALET/4-300---------------------------------------------------------------------RLSPW----NL
D5CKQ7_ENTCC/4-300---------------------------------------------------------------------RLSPW----NL
A0A023YEE1_ECOLX/4-300---------------------------------------------------------------------RLSPW----NL
A7MPV2_CROS8/4-300---------------------------------------------------------------------RLSPW----NL
C4XDI3_KLEPN/4-300---------------------------------------------------------------------QPTPW----EL
B5RKC3_KLEP3/4-300---------------------------------------------------------------------QPTPW----EL
D0KLU5_PECWW/4-299---------------------------------------------------------------------RLSPW----NL
B4EW80_PROMH/4-300---------------------------------------------------------------------RLSPW----NL
D3V2D7_XENBS/4-302---------------------------------------------------------------------IPSPH----QL
A0A014LRW3_YERPE/4-300---------------------------------------------------------------------TPSAY----AL
B1JNG5_YERPY/4-300---------------------------------------------------------------------TPSAY----AL
E1PL56_PANVC/4-300---------------------------------------------------------------------NISPF----ML
D3VJW5_XENNA/4-307---------------------------------------------------------------------IPSPH----QL
E2MHA5_PSEUB/3-297---------------------------------------------------------------------LFSPY----AL
Q4ZYA8_PSEU2/3-297---------------------------------------------------------------------LFSPY----AL
F3K7E7_PSESZ/3-297---------------------------------------------------------------------LFSPY----AL
Q39AX0_BURS3/4-298---------------------------------------------------------------------TISPF----AL
N9BC11_ACIBI/1-291---------------------------------------------------------------------MLSAL----SL
A5WBK4_PSYWF/17-339---------------------------------------------------------------------PLHPY----QL
Q4FTQ0_PSYA2/59-368---------------------------------------------------------------------MHHPY----QL
Q5NWT6_AROAE/1-291---------------------------------------------------------------------MRDAT----EL
D3RPA3_ALLVD/1-291---------------------------------------------------------------------MLDAY----RL
Q1QCR8_PSYCK/1-315---------------------------------------------------------------------MHHPY----QL
B6C0F8_9GAMM/22-310---------------------------------------------------------------------IPHYM----EL
A1VWQ0_POLNA/1-291---------------------------------------------------------------------MAEKK----ML
G2TCW8_RHORU/5-292---------------------------------------------------------------------ISA.L----RL
Q9RSA7_DEIRA/8-299---------------------------------------------------------------------PLSPW----QL
D5BYR3_NITHN/21-309---------------------------------------------------------------------IPCYM----EL
D8K7I6_NITWC/22-310---------------------------------------------------------------------IPHYM----EL
E8U9R3_DEIML/2-291---------------------------------------------------------------------LNFPF----AL
A8MM95_ALKOO/30-358---------------------------------------------------------------------DKLAY----SL
Q891X5_CLOTE/30-379---------------------------------------------------------------------TYMQY----AL
A8F9P5_BACP2/30-369---------------------------------------------------------------------HVLAH----AL
C9RML9_FIBSS/26-364---------------------------------------------------------------------SLLQY----CL
E3IYR0_FRASU/30-378---------------------------------------------------------------------RLVAT----AL
Q9KY27_STRCO/30-371---------------------------------------------------------------------RLLSA----AL
E3DTS5_BACA1/30-361---------------------------------------------------------------------KLLEQ----AL
Q5YN23_NOCFA/30-368---------------------------------------------------------------------ELLAI----AL
B1HUS4_LYSSC/26-371---------------------------------------------------------------------DILSY----AL
F2JGK5_CELLD/30-375---------------------------------------------------------------------EKLSY----AL
I0UNS1_BACLI/30-368---------------------------------------------------------------------RILEY----AL
D1BEK0_SANKS/30-368---------------------------------------------------------------------GMLAV----GL
D1A9P4_THECD/30-368---------------------------------------------------------------------ALLAV----AL
C9ZE12_STRSW/30-371---------------------------------------------------------------------RILAA----AL
F4H5N5_CELFA/32-371---------------------------------------------------------------------ALLAV----AL
B7HBK1_BACC4/30-348---------------------------------------------------------------------EQLAY----AL
A0A011W6K7_BACTI/30-348---------------------------------------------------------------------EQLAY----AL
C8W644_DESAS/30-371---------------------------------------------------------------------KTLSY----SL
Q82B97_STRAW/30-370---------------------------------------------------------------------RVLAA----AL
Q0SDY5_RHOSR/44-383---------------------------------------------------------------------TVLAV----AL
Q72YD0_BACC1/30-348---------------------------------------------------------------------EQLAY----AL
C1B1Z6_RHOOB/52-391---------------------------------------------------------------------TVLAV----AL
A4J1D5_DESRM/16-360---------------------------------------------------------------------DTLAH----AL
C0ZNQ3_RHOE4/41-379---------------------------------------------------------------------DLLAI----AL
C0Z9Y5_BREBN/30-378---------------------------------------------------------------------EVLAH----AL
Q186J7_PEPD6/30-345---------------------------------------------------------------------DVLKY----AL
E3EE66_PAEPS/10-368---------------------------------------------------------------------SILAY----AI
F4D0A7_PSEUX/30-375---------------------------------------------------------------------ELLSV----AL
E6UGJ0_RUMA7/26-367---------------------------------------------------------------------ELLQY----CL
D0L8D1_GORB4/35-372---------------------------------------------------------------------TQLAL----AL
B1VYI2_STRGG/30-395---------------------------------------------------------------------RMLSV----AL
C9XQK5_PEPDC/30-345---------------------------------------------------------------------DVLKY----AL
F4EXE4_SELS3/15-331---------------------------------------------------------------------EILQY----KV
C8XAU7_NAKMY/30-369---------------------------------------------------------------------SVLAH----AL
A8L403_FRASN/30-378---------------------------------------------------------------------RLVAT----AL
A6WD82_KINRD/30-375---------------------------------------------------------------------DELAV----AL
Q0RDF4_FRAAA/30-378---------------------------------------------------------------------RLLAT----AL
A2RKY2_LACLM/29-388---------------------------------------------------------------------EMLAS----SL
Q2J6S0_FRASC/45-393---------------------------------------------------------------------HLLAT----AL
E3PRQ7_CLOSD/30-367---------------------------------------------------------------------NQLRY----AL

PF00463

ACEA_EMENI/14-536------------------------------------------------------------EVAAVKNWWKDSRW----RY
ACEA_YEAST/22-550------------------------------------------------------------DAAEIEKWWSDSRW----SK
ACEA1_SOYBN/3-534------------------------------------------------------------EVAEVQAWWNSERF----RL
ACEA_YARLI/10-536------------------------------------------------------------EVEEIKKWWSSPRW----KH
ACEA_NEUCR/23-547------------------------------------------------------------EVEEVKKWWSDSRW----RQ
C5MF59_CANTT/18-543------------------------------------------------------------EVAEIKKWWSEPRW----RK

PF00311

C7M9P2_BRAFD/148-942TPE.RRR..................QDRDLAELIETLWQTDELRRQRPTPQDEARNALYYLREIFRHTMPEMLD----DL
CAPP_ACTP2/128-879LTE.AEQ................TKLKRRLMQLIALAWHTNEIRAARPTPVDEAKWGMAIIENSLWKAVPDFCR----EL
A0ZJ69_NODSP/196-1034NRT.ESTLGGY........PWEAADLREQLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYK----RL
D3VH32_XENNA/127-879LAD.YER................NNIMRRLRQLIAQSWHTDEIRKIRPTPIDEAKWGFAVVENSLWEGVPAFLR----EF
Q2KZS8_BORA1/137-936LTA.EEI................ADIDNALLGRVDTLWQTRMLRYTRLTVADEIENALSYYRSTFLPAIPRLYT----GL
D2QW47_PIRSD/157-942LLP.RER................ARLESRIRTELTVLWQTDFLRPSRPTVLEEVERGLS.ITPRLWEVVPQVYA----SM
A5GVT4_SYNR3/167-992DEN.DSFD.............DRQGLRQQLLEEIRVWWRTDELHQFKPSVLDEVDYALHFFQQVLFQAMPLLHE----RI
C6D470_PAESJ/147-936LTY.RER................EILRDKLLNEVLILWQTDELRDRKPTVIDEVRNGLYYFDETLFEVLPNVYE----EL
B8HVC9_CYAP4/199-1018ATL.GSRSG...........VEMQNLHEQLIEEIRLWWRTDELHQFKPQVLDEVEYSLHYFKEVVFEIIPQLYR----RI
C1F4Y2_ACIC5/161-947LPD.EEM................QDLENAVTAEITALWQSDEVRSRRPEVADEIKMGLDYYEVSIFETLPRLYE----EV
CAPP_SYNY3/193-1034GSV.TGRDWLN........TWDAKTAIAQLTEEIRFWWRTDELHQFKPTVLDEVDYSLHYFDEVLFDAVPELSK----RL
B1XMB9_SYNP2/163-995EGL.KSLGTSD........SWEIENIQQQLTEEIRLWWRTDELHQFKPQVLDEVDYALHYFEEVLFDTLPELSV----RL
A4S610_OSTLU/183-1007LSR.YER................AEVLDEIRSKVASAWRTDEIRRTPPKPQDEMRAGLTYFQQTIWDGIPTFMR----RV
A9RUR8_PHYPA/162-969ITA.DEK................KEWDEALQREIQAAFRTDEIRRSQPTPQDEMRAGMSYFHETIWNGLPKFLR----RV
B8GNA5_THISH/143-947LGR.EER................EELTQELETRIQVLWRTNEVRVKKPQVQDEIKYGLFYFEESLFNAVPITYR----FL
CAPP_HAHCH/132-881LLD.EEY................AKIVERLRRLITEAWHTDEIRYERPTAVDEAKWGFAVIENSLWQAVPDFMR----QM
B1Y159_LEPCP/163-950HTA.GQR................ADNEALLRARVTQLWQTRMLRYTKLTVADEIENALSYYRSTFLRQIPRMYR----AV
CAPP_THEEB/197-1011GAS.PHLTD...........WNAQTLRAQLMEEIRLWWRTDELHQFKPEVLDEVEYTLHYFKEVIFAVIPKLYR----RL
A9S2G6_PHYPA/161-965ITS.DER................QELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWNGLPIFLR----RV
Q54JZ3_DICDI/144-931LTM.FER................EDYEKRLIREVGGSWLTDEVRRSKVTVEMEAQGGFSVIEQTLWHALPKFIK----IL
C1MJ77_MICPC/164-991LSG.YER................AEILASMSSAIQAAWRTDEIRRNPPKPQDEMRAGLSYFNDTLFEGLPKFVR----RI
E0UJ33_CYAP2/184-1020ETF.RGMGLTN........SWEAEEAKEQLKEEIRLWWRTDELHQFKPTVLDEVDYSLHYFNEVLFEAIPQLAL----RL
A5WCX5_PSYWF/133-932EGS.LAY................QEAKQKTAETIDLLWSSDEVRTRKPLVYDEINNGLHYFNASLFTAIPQVYR----NI
A0JSJ3_ARTS2/161-954TSA.RRR..................QDRQLAEVIDQMWQTDELRQVRPTPVDEARNAIYYLNSILTDAMPEMLS----DL
B7G725_PHATC/84-877LDG.FEK................SSAQTSLQTILSSIWGADEIRRQKPTPQQEAAGGNAILESVLWDAVPAYLR----KL
CAPP_GLOVI/141-939.......LSE..........WQQQQVHTTMLEEIRIWWRTDELHQVRPTVLDEVAHTVHYFEEVLFEAMPRVRS----EL
C5Z450_SORBI/157-961VTV.EDK................KELDEALHREIQAAFRTDEIRRAQPTPQDEMRYGMSYIHETVWNGVPKFLR----RV
D1CE74_THET1/138-931LTP.TQR................EMVIDRLREVVTALWQTDDFRETRPTPLDEVYNSLYFFQESVFEILPSVYR----EF
Q117S5_TRIEI/186-1038ESL.SESHVDEEQVNSLVSSWKIESLKEQLTEEILLWWRTDELHQFKPSVLDEVETTLHYFNEVLFDATPELHR----RF
C1AE63_GEMAT/147-933LTG.EER................TESDALLTRLVLTLWHTRIVRGERLRVVDEVKNGIAYFRSTFFTEVPRLHA----NL
A9QPD2_METI4/151-931KPS....................PAIHSTVERLIASLWLTERSRSKNPQVLDEVRTGLWYFEHTLWDVIPELHN----EL
B0BZ90_ACAM1/184-1012AGL.ANNTRS.........NWEVDALQAQLTEEVRFWWRTDELHQFRPTVLDEVEYSLHYFREVLFDAIPQLYH----RL
A4X3B0_SALTO/171-972VLY.GASD..............EGPANRRLAELLDLMWQTDELRLDRPDPTDEARNAIYYLRDLYAEAAPQVLD----DL
E3JCU0_FRASU/173-968AQP.SRR................AVVDRRLAEAVDVLWQTDELRVERPKPTDEARSAAYYLTSIATDVLPGLLE----EL
Q2JKJ2_SYNJB/177-978QTQ.PLQ...............AQMIKEQMAEEVLLWWRTDELHQSKPTVLNEVDYTLHYFEEVLFQAIPLLHE----YL
A9IDM8_BORPD/139-951LTA.EEI................ADLDLALLGRVATLWQTRMLRYTRLTVADEIENALSYYRSTFLNVIPRVYG----EL
A4G3V1_HERAR/147-944MTA.KER................AENTERIHSRVTTLWQTRLLRYTKLTVEDEINNALSYYRMTFLRELPALYE----DI
C1DZM5_MICSR/162-982LSG.YER................AELLDSMASAIQSAWRTDEIRRTPPKPQDEMRAGLSYFNETVFEGLPKFCR----RI
D3EKG0_GEOS4/142-928LTF.RER................EQLREKLLNEVITLWQTDELRDRKPTVLDEVRNGMYYFHETLFHILPEVYQ----EL
B1VUI2_STRGG/125-909AIE.ADR................RRLDLRLAENIDLIWQTDELRVVRPEPADEARNAIYYLDELHTGAVGDVLE----DL
CAPP_SYNPW/180-1003ESSTFEA................GTIRLQLEEEIRLWWRTDELHQFKPSVLDEVDYALHYFQQVLFDAMPQLRR----RL
B0JPY0_MICAN/183-1018EIF.RSMGLTN........SREAQTVTKQLKEEIRFWWRTDELHQFKPTVVDEVDYALHYFDEVLFDSLPQLTL----RL
B1WNZ1_CYAA5/187-1020ESF.RGMGLSS........SWEAESIIEQLNEEIRLWWRTDELHQFKPSVLDEVDYTLHYFDEVLCDALPQLSQ----RL
C8WQK0_ALIAD/133-906KTP.REL................DVLRERIRTEIVALWQTRSVRKQRITVLDEVRNGLYFLDQILFDVLPRVHQ----KL
D4ZQG2_ARTPN/196-1035ESY.GKVDNTNPEA.TGLVKTWTGELQEQLTEEIRLWWRTDELHQFKPTVLDEVEYSLHYFQEILFDVIPQLYQ----RI
M1FKU6_9ALTE/130-889LMP.SER................DGIVRRLTRLIAEAWHTDEIRYDRPTAVDEAKWGFAVIENSLWTALPRFLE----SL
CAPP_ECOLI/129-883IAD.YEH................NQLMRRLRQLIAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWQGVPNYLR----EL
CAPP_HAEIN/129-879LTE.KER................NIIERLLLRLIAEAWHTNEIRTVRPTPFDEAKWGFAMLENSLWQAVPEFLR----QL
Q0K7M4_CUPNH/207-1012MTA.RER................DHNTAQLRAKVTTLWQTRMLRDSRLTVADEIENALSYYRTCFLRGIPQLMS----EL
Q31KY7_SYNE7/201-1017TGK.NRGFRE..........LEAQNIRQQLTEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFEAIPLLYQ----RF
Q46IP1_PROMT/168-994LIS.ESE...............KEIFRLQLEEEIRLWWRTDELHQFKPTVLDEVDYALHYFQQVLFDAMPQLRR----RL
CAPP_PROMP/165-989LTI.EDI................KSLKIQLKEEIRLWWRTDELHQFKPSVIDEVDYALHYFQQVLFDAMPQLRG----RI
CAPP_VIBPA/129-877LSS.KER................KKTERRLEQLIAQSWHSDVIRQQRPTPLDEAKWGFAVVENSLWEAVPDFLR----EM
CAPP_SHEON/129-881LSD.RER................QQINLRLRQLIAQIWHTNEIRRERPTPVDEARWGLSTIEESLWHAVPDFLR----QL
U5GXD4_POPTR/166-968ITP.DDK................QELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKGVPKFLR----RV

PF02896

PPDK1_MAIZE/589-947---------------------------------------------------------------------PALSG----DL
PT1_STACT/251-543---------------------------------------------------------------------KQELQ----KL
PT1_CUPNH/262-557---------------------------------------------------------------------KKRLQ----RL
PT1_ECOLI/250-542---------------------------------------------------------------------KAELA----KL
PT1_HAEIN/250-542---------------------------------------------------------------------KAELA----KL
PT1P_ECOLI/416-708---------------------------------------------------------------------SRLAE----DD
PPSA_PYRFU/496-796---------------------------------------------------------------------KAEGG----QV
PTFAX_XANCP/521-808---------------------------------------------------------------------REREA----AQ
PT1_STRMU/252-546---------------------------------------------------------------------KAEWA----LL
PTFX2_ECOLI/362-654---------------------------------------------------------------------REQQR----VW
PPSA_STAMF/504-813---------------------------------------------------------------------VAGVG----IS
D5AMJ7_RHOCB/521-803---------------------------------------------------------------------...EA----RE
Q24801_ENTHI/517-878---------------------------------------------------------------------..GSG----YF
Q5L199_GEOKA/251-541---------------------------------------------------------------------KAEWA----KL
Q6MTX2_MYCMS/252-540---------------------------------------------------------------------.DQLK----KF

PF02548

C8XKD1_NAKMY/14-272---------------------------------------------------------------------.IAIP----DL
A7HMC7_FERNB/3-256---------------------------------------------------------------------..NTK----KI
PANB_NITMU/2-259---------------------------------------------------------------------RITQD----VF
E3I2N4_RHOVT/9-264---------------------------------------------------------------------RVTAP----DI
PANB_THEFY/18-275---------------------------------------------------------------------RVTVQ----DL
F0NZT0_WEEVC/9-267---------------------------------------------------------------------RITTE----TI
C5DYQ5_ZYGRC/31-296---------------------------------------------------------------------SNTIQ----SL
D8RYD4_SELML/4-266---------------------------------------------------------------------KVTMR----YL
S9W2M7_SCHCR/5-262---------------------------------------------------------------------PITTS----VL
D2PXN9_KRIFD/534-791---------------------------------------------------------------------KYRIH----HL
H1Z987_MYROD/10-268---------------------------------------------------------------------KVTTK----SL
C5BN63_TERTT/12-267---------------------------------------------------------------------SVSIK----TL
A8LKB6_DINSH/13-268---------------------------------------------------------------------RLTVP----QI
D7BNG1_ARCHD/5-260---------------------------------------------------------------------RVRAH----HL
D7A714_STAND/9-264---------------------------------------------------------------------RLTAP----DI
PANB_BORPD/9-265---------------------------------------------------------------------RKTTT----AI
PANB_MAGSA/9-265---------------------------------------------------------------------RITTR----DI
E8RFZ1_DESPD/5-262---------------------------------------------------------------------KLTIP----DL
PANB_PROMA/4-255---------------------------------------------------------------------....K----EL
K9RVA1_SYNP3/11-268---------------------------------------------------------------------PVTIP----QL
D5WZ20_THIK1/22-279---------------------------------------------------------------------PLTLH----RL
B8LYN4_TALSN/78-338---------------------------------------------------------------------PVTIS----TL
K9RDA0_9CYAN/11-264---------------------------------------------------------------------AITIQ----KL
PANB_METRJ/10-267---------------------------------------------------------------------.LRAI----DI
A9UP51_MONBE/1-268---------------------------------------------------------------------.VTMN----KL
PANB_PROA2/11-273---------------------------------------------------------------------HVTTR----RL
F2UAL1_SALR5/62-329---------------------------------------------------------------------.VTIP----SI
V2XXG0_MONRO/40-299---------------------------------------------------------------------KVTID----TL
G2IQV3_9SPHN/23-282---------------------------------------------------------------------RLTIP----AL
PANB_CLONN/2-260---------------------------------------------------------------------KNTVT----TF
PANB_WIGBR/3-260---------------------------------------------------------------------KTNIY----DL
M1FDT2_9ALTE/4-264---------------------------------------------------------------------KVTIP----RL
E4TII1_CALNY/9-264---------------------------------------------------------------------KVTVN----QI
K0I9Q1_NITGG/2-255---------------------------------------------------------------------..SVN----DI
C7MD29_BRAFD/11-267---------------------------------------------------------------------KIRLR----HL
G8PQN3_PSEUV/9-264---------------------------------------------------------------------RKTIK----DI
PANB_LEPCP/16-279---------------------------------------------------------------------PLTLP----AL
K1VYW4_TRIAC/1535-1794---------------------------------------------------------------------KLTVG----AL
B8I2Z4_CLOCE/9-266---------------------------------------------------------------------KNTAA----SI
I0AFM0_IGNAJ/3-258---------------------------------------------------------------------..SIL----EF
I4CAV2_DESTA/3-261---------------------------------------------------------------------KITIQ----TL
PANB_SULDN/4-259---------------------------------------------------------------------KMTIT----SI
S8DNJ0_FOMPI/15-274---------------------------------------------------------------------KITIQ----HL
PANB_METCA/5-260---------------------------------------------------------------------.VTLP----DL
F3YUG3_DESAF/5-260---------------------------------------------------------------------.LTAP----DI
PANB_SYNAS/9-267---------------------------------------------------------------------KITTS----VI
C7LVL7_DESBD/2-259---------------------------------------------------------------------.KTIS----DF
PANB_NOCSJ/34-291---------------------------------------------------------------------RIRTH----HL
F0SK13_PLABD/3-257---------------------------------------------------------------------QMTVP----RF
I0DRD2_PROSM/4-258---------------------------------------------------------------------.ISLA----TL
D3E7N3_GEOS4/7-265---------------------------------------------------------------------.LNIV----KL
G7EAQ5_MIXOS/98-357---------------------------------------------------------------------KVTLL----DI
R7GY01_9FIRM/2-260---------------------------------------------------------------------KNTIA----TL
U9SMK5_RHIID/19-277---------------------------------------------------------------------KVTIN----TI
R5GD14_9BACT/11-269---------------------------------------------------------------------KVTTL----RL
R1GLQ8_BOTPV/11-271---------------------------------------------------------------------KVTLN----TL
PANB_DESAH/4-258---------------------------------------------------------------------RVTTT----TL
PANB_DEIDV/5-258---------------------------------------------------------------------...IP----EL
S6CEI7_9ACTN/2-260---------------------------------------------------------------------SVTVS----TF
R5KEY8_9CLOT/2-260---------------------------------------------------------------------KNTVV----TF
K0SSA9_THAOC/101-366---------------------------------------------------------------------KVTTL----TI
C6XKS3_HIRBI/9-264---------------------------------------------------------------------RKTVR----DI
J9QSS2_RIEAN/9-267---------------------------------------------------------------------KVTTE----VL
S6BYU9_9GAMM/3-260---------------------------------------------------------------------KITIT----TL
D0KZU6_HALNC/20-275---------------------------------------------------------------------.KTLT----TL
W6RP24_9RHIZ/9-265---------------------------------------------------------------------RLTTA----SI
G0W8X4_NAUDC/30-294---------------------------------------------------------------------.TTIL----DI
E5AM95_BURRH/11-268---------------------------------------------------------------------AVTVP----RL
I3TFJ1_THEC1/4-259---------------------------------------------------------------------KVTVR----DI
PANB_GRABC/9-265---------------------------------------------------------------------RISVP----AL
G0GCR3_SPITZ/2-257---------------------------------------------------------------------..NVR----SF
G1XV43_ARTOA/82-342---------------------------------------------------------------------KVTIN----TI
D9Q2W0_ACIS3/6-261---------------------------------------------------------------------KVTVR----KI
B1ZVH1_OPITP/3-258---------------------------------------------------------------------..TIR----DL
R7EXA6_9BACT/11-269---------------------------------------------------------------------KVTTR----RL
F6B538_DESCC/4-262---------------------------------------------------------------------RVTTA----DF
D5UZ54_ARCNC/10-265---------------------------------------------------------------------KMNIN----KI
U1GVM1_ENDPU/59-319---------------------------------------------------------------------PVTIQ----TI
G2QRB2_THITE/68-328---------------------------------------------------------------------KVTIG----TL
B7FR45_PHATC/3-276---------------------------------------------------------------------KVSAL----SL
PANB_THEEB/5-261---------------------------------------------------------------------SVTLP----QL
R7D6U7_9ACTN/3-263---------------------------------------------------------------------KNTVL----TL
E3GPR0_EUBLK/2-261---------------------------------------------------------------------KKSII----DF
C1DI17_AZOVD/17-274---------------------------------------------------------------------RVRIP----YL
A5VB06_SPHWW/22-276---------------------------------------------------------------------RLTVP----AI
A4CLQ4_ROBBH/10-268---------------------------------------------------------------------RVTVR----SL
D5BTJ5_PUNMI/4-260---------------------------------------------------------------------KMTVD----TF
C9RK32_FIBSS/3-246---------------------------------------------------------------------..TPE----DI
C4LHZ4_CORK4/17-275---------------------------------------------------------------------KTRIH----HL
M4X4T3_PSEDE/4-260---------------------------------------------------------------------.VTLT----TL
W8KF56_HALHR/9-265---------------------------------------------------------------------RLTLR----DL
G7V5R4_THELD/5-262---------------------------------------------------------------------.LSIP----DF
I3ZIP5_TERRK/17-275---------------------------------------------------------------------KVTPQ----TL
S6AIG3_9PROT/2-259---------------------------------------------------------------------RVTLS----NL
C3AJQ5_BACMY/3-259---------------------------------------------------------------------..TTT----DF
F3ZPG7_9BACE/11-269---------------------------------------------------------------------KVTTH----HL
PANB_AQUAE/2-260---------------------------------------------------------------------AINLQ----TL
R7ALC5_9ACTN/29-287---------------------------------------------------------------------KNTVA----TF
U5N9B5_9BURK/27-288---------------------------------------------------------------------.FTLP----RL
C6BVH5_DESAD/3-260---------------------------------------------------------------------KVTAP----DI
C5KFU4_PERM5/79-341---------------------------------------------------------------------KITLT----QI
U5T1Y9_9GAMM/5-261---------------------------------------------------------------------.VTLA----TL
F4H271_CELFA/7-264---------------------------------------------------------------------RVRVH----HL
F8AZ74_FRADG/51-306---------------------------------------------------------------------RTTVR----EL
E4NQR1_HALBP/4-256---------------------------------------------------------------------...VR----DV
C6VWE8_DYAFD/10-268---------------------------------------------------------------------RITTH----VI
R5KSN9_9FIRM/2-260---------------------------------------------------------------------KNTVN----TL
PANB_NATPD/3-255---------------------------------------------------------------------...AK----DI
L0IYN2_MYCSM/17-274---------------------------------------------------------------------KVRTH----HL
PANB_CLOTH/4-262---------------------------------------------------------------------KFTTA----SF
PANB_SPHAL/26-281---------------------------------------------------------------------RLTVP----RI
I0A221_FERFK/7-263---------------------------------------------------------------------KITMR----KF
T2GAB0_DESGI/5-261---------------------------------------------------------------------.QTAR----SV
C6WXZ0_METML/2-266---------------------------------------------------------------------..TLP----KL
F2IID2_FLUTR/9-267---------------------------------------------------------------------RVTTN----VL
D5BNG2_PUNMI/9-267---------------------------------------------------------------------KVTYK----TL
PANB_ARTAT/40-297---------------------------------------------------------------------RVRIH----HL
PANB_CARHZ/3-261---------------------------------------------------------------------RVTVS----SL
A4G8C6_HERAR/16-272---------------------------------------------------------------------AVTVP----AL
E1QUY6_VULDI/5-260---------------------------------------------------------------------KVTVQ----TI
M1M510_9PROT/12-263---------------------------------------------------------------------.....----VI
PANB_METFK/3-256---------------------------------------------------------------------...LL----TL
PANB_CHESB/10-264---------------------------------------------------------------------.FTPP----DI
B6GXN5_PENCW/75-335---------------------------------------------------------------------KVTIQ----TL
I0GU87_SELRL/2-260---------------------------------------------------------------------KNTVA----TF
R9AIM6_WALI9/451-714---------------------------------------------------------------------KVTIS----SL
R5BQ58_9FIRM/5-264---------------------------------------------------------------------PKTIT----TI
F8AC68_THEID/6-263---------------------------------------------------------------------KITVP----EL
PANB_ALKEH/12-269---------------------------------------------------------------------PVTVG----RL
F8E6G1_FLESM/9-265---------------------------------------------------------------------KITVS----HF
PANB_BORPE/9-264---------------------------------------------------------------------RITTR----QL
E1VL92_9GAMM/2-258---------------------------------------------------------------------AVTLS----TI
R6CEN3_9FIRM/2-260---------------------------------------------------------------------KNTAA----TL
PANB_LEPBP/4-261---------------------------------------------------------------------..IIL----QY
D5MI67_9BACT/6-263---------------------------------------------------------------------.VRTV----TL
G0EFC1_PYRF1/3-258---------------------------------------------------------------------RISVR----DI
PANB_EXIS2/3-258---------------------------------------------------------------------..TMT----PL
I4BB70_TURPD/157-414---------------------------------------------------------------------.MNIH----DF
PANB_MARAV/2-258---------------------------------------------------------------------AVTIN----TL
D8J2A6_HALJB/4-255---------------------------------------------------------------------...VA----DI
PANB_IGNH4/3-259---------------------------------------------------------------------KVTIR----DI
G4RJI6_THETK/5-260---------------------------------------------------------------------KITVQ----TF
K8GUE9_9CYAN/2-256---------------------------------------------------------------------PVTTQ----QI
W6SJ04_9CLOT/2-259---------------------------------------------------------------------KNTSA----TF
D9SXD7_CLOC7/2-260---------------------------------------------------------------------KNTVI----TF
W5W0X3_9PSEU/35-292---------------------------------------------------------------------RVRIH----HL
F7V601_CLOSS/2-260---------------------------------------------------------------------SKTLN----TF
PANB_SYNE7/2-256---------------------------------------------------------------------PITPR----HL
I2GYS6_TETBL/22-285---------------------------------------------------------------------.LTIP----DL
F2N7R6_CORGP/2-260---------------------------------------------------------------------KTTVT----TF
PANB_SODGM/2-257---------------------------------------------------------------------.TTIS----HL
PANB_MYXXD/4-262---------------------------------------------------------------------KVTIH----TL
W0JJ73_DESAE/2-258---------------------------------------------------------------------KMTVP----KF
PANB_SALRD/3-261---------------------------------------------------------------------RVTTK----TV
H1XSD8_9BACT/9-267---------------------------------------------------------------------RITVP----VI
K4KI34_SIMAS/15-270---------------------------------------------------------------------AVTVN----TL
PANB_PHEZH/11-266---------------------------------------------------------------------RIAAP----DI
C1F8U4_ACIC5/19-277---------------------------------------------------------------------KVTLA----TL
PANB_BDEBA/2-258---------------------------------------------------------------------.KTIL----DF
PANB_THELT/2-257---------------------------------------------------------------------..NVN----KF
PANB_POLSJ/34-294---------------------------------------------------------------------.LSLP----RL
G0A0M7_METMM/10-265---------------------------------------------------------------------TLSIA----DL
E3E4R6_PAEPS/7-265---------------------------------------------------------------------.LNIV----KM
R7P8R5_9BACT/11-269---------------------------------------------------------------------KVTTH----RL
G8QNM1_AZOSU/9-266---------------------------------------------------------------------RLTIT----DM
V6JZL1_STRNV/26-283---------------------------------------------------------------------RVTVH----DI
F4GUY4_PUSST/9-264---------------------------------------------------------------------RISVP----QL
R7C4Y8_9BURK/5-261---------------------------------------------------------------------..KVT----DF
R6EWT4_9BACT/11-269---------------------------------------------------------------------KVTAP----LF
PANB_PSYA2/2-261---------------------------------------------------------------------.TTLS----TL
E6UF09_RUMA7/2-260---------------------------------------------------------------------KNTVS----TL
PANB_PROMM/4-256---------------------------------------------------------------------....S----EL
F8GE64_NITSI/2-259---------------------------------------------------------------------RITQT----TL
G8YQ94_PICSO/33-293---------------------------------------------------------------------RYSIA----DI
R6EER5_9BACT/10-268---------------------------------------------------------------------KVTVK----TF
R6MV46_9FIRM/2-260---------------------------------------------------------------------KKTVT----TF
E1ZCJ6_CHLVA/23-287---------------------------------------------------------------------RVTLR----TL
PANB_NITSB/4-255---------------------------------------------------------------------RHTVN----TI
M4VAT0_9DELT/3-258---------------------------------------------------------------------..SIL----DF
C4XU18_DESMR/3-260---------------------------------------------------------------------RTTAP----DV
J9ZD86_LEPFM/6-263---------------------------------------------------------------------.MTID----QF
L0K4F1_HALHC/4-262---------------------------------------------------------------------QVTIK----TL
E6WZE1_NITSE/11-266---------------------------------------------------------------------KVTVR----TV
R7IQM6_9FIRM/7-262---------------------------------------------------------------------...AV----TF
R5JJK8_9FIRM/2-260---------------------------------------------------------------------KNTTT----TI
F8DZN0_CORRG/23-280---------------------------------------------------------------------QVRIS----DF
I4D5R2_DESAJ/3-259---------------------------------------------------------------------..STK----DF
PANB_LEIXX/16-273---------------------------------------------------------------------RVRTR----HF
E4U2F8_SULKY/3-258---------------------------------------------------------------------KLSIG----SI
PANB_NITMS/2-259---------------------------------------------------------------------HKSVQ----DI
PANB1_PSEAE/9-265---------------------------------------------------------------------RLSVP----DI
G8BMS9_TETPH/44-308---------------------------------------------------------------------.KTIL----DI
R5V6Z6_9FIRM/2-260---------------------------------------------------------------------KNTVV----TF
R5U793_9BACE/11-269---------------------------------------------------------------------KVTTH----RL
F6CMZ4_DESK7/5-263---------------------------------------------------------------------QVTTA----YF
B9L8Y5_NAUPA/4-254---------------------------------------------------------------------..TLK----TL
PANB_DESPS/2-260---------------------------------------------------------------------RKTVV----DI
L0F2P8_DESDL/3-259---------------------------------------------------------------------..TTT----DF
K9Y6F0_HALP7/3-258---------------------------------------------------------------------.VTTA----QL
PANB_NITEU/8-264---------------------------------------------------------------------RMTIT----TL
M5C834_THACB/15-272---------------------------------------------------------------------KVTIQ----KL
T2KQ61_9FLAO/10-268---------------------------------------------------------------------KVTVK----TL
I1NLG6_ORYGL/83-346---------------------------------------------------------------------RVTLA----TL
E6TZJ1_BACCJ/3-259---------------------------------------------------------------------..TTT----DF
K0B4S7_CLOA9/4-262---------------------------------------------------------------------KFTVN----SF
R6VBN9_9CLOT/2-260---------------------------------------------------------------------KNTII----TF
G4QJL3_GLANF/3-259---------------------------------------------------------------------KVTTS----TL
PANB_RHOBA/10-264---------------------------------------------------------------------RITTR----TL
R5DYA6_9BURK/9-266---------------------------------------------------------------------PVRLS----TI
PANB_RHORT/10-268---------------------------------------------------------------------RLTVR----DI
A5DVU0_LODEL/36-294---------------------------------------------------------------------KKTIS----YI
B6JWN4_SCHJY/27-297---------------------------------------------------------------------..TVR----SI
PANB_CORGL/8-265---------------------------------------------------------------------KIRTR----HF
PANB_RALSO/12-268---------------------------------------------------------------------AVTVT----SL
R6LXN4_9CLOT/2-260---------------------------------------------------------------------KNTVR----TF
PANB_MOOTA/6-264---------------------------------------------------------------------RVTLP----QL
F2F6S0_SOLSS/3-258---------------------------------------------------------------------..TTA----QF
PANB_AZOSB/9-267---------------------------------------------------------------------PVTLF----EL
D3SC34_THISK/3-258---------------------------------------------------------------------PITVN----TL
D4H852_DENA2/9-265---------------------------------------------------------------------KINLN----TF
H6L4G9_SAPGL/9-267---------------------------------------------------------------------KVTTH----VL
R6DPQ8_9CLOT/2-260---------------------------------------------------------------------KKTVS----TL
N0B212_9BACI/3-259---------------------------------------------------------------------..QTT----NF
R7K0E3_9CLOT/2-260---------------------------------------------------------------------KNTVQ----TW
Q6BIM6_DEBHA/33-293---------------------------------------------------------------------RKTLL----DI
K0KXD0_WICCF/32-290---------------------------------------------------------------------RKSLN----DI
E8RS63_ASTEC/11-266---------------------------------------------------------------------RLTAP----EI
F9X8W4_MYCGM/67-327---------------------------------------------------------------------KITLQ----TL
A4XA35_SALTO/20-277---------------------------------------------------------------------RVRAR----DL
D5U1C4_THEAM/4-259---------------------------------------------------------------------KVNVK----TI
T0ULG9_9STRE/2-260---------------------------------------------------------------------KNTVL----SF
PANB_ALTMD/3-259---------------------------------------------------------------------KVTVS----GL
PANB_CAMC1/10-265---------------------------------------------------------------------KLTIN----DI
I0ICC5_PHYMF/8-267---------------------------------------------------------------------RTTLR----DL
F4PL25_DICFS/108-366---------------------------------------------------------------------KTTIL----DI
G4KQR4_OSCVS/3-261---------------------------------------------------------------------KKTVI----DL
K9YNE4_CYASC/2-257---------------------------------------------------------------------KVTIQ----KL
PANB_WOLSU/3-258---------------------------------------------------------------------NITVS----SI
E6U5I9_ETHHY/4-262---------------------------------------------------------------------TVTTQ----SF
B8BWG2_THAPS/41-307---------------------------------------------------------------------KVTTL----TI
K9SYS3_9SYNE/2-257---------------------------------------------------------------------PVTIS----QL
PANB_AERPE/5-260---------------------------------------------------------------------KVTAR----RI
R7DES0_9PORP/10-268---------------------------------------------------------------------KVTTR----RL
PANB_BAUCH/4-259---------------------------------------------------------------------.TTIS----HL
I5AYL4_9DELT/4-258---------------------------------------------------------------------KITTS----SL
PANB_BACSK/2-259---------------------------------------------------------------------.KTTK----TF
R6A0K1_9BACT/11-268---------------------------------------------------------------------KVTTH----RL
B2IDS4_BEII9/7-254---------------------------------------------------------------------...AA----RF
K0C447_CYCSP/9-266---------------------------------------------------------------------KITNT----DL
PANB_LISMO/5-258---------------------------------------------------------------------....V----DF
PANB_RHILO/16-267---------------------------------------------------------------------.....----LI
K9VPY0_9CYAN/2-258---------------------------------------------------------------------SVTTH----QL
C0ZCH0_BREBN/7-265---------------------------------------------------------------------PITTS----SI
A7TTC6_VANPO/36-301---------------------------------------------------------------------RKSIL----DL
M4ZY73_9ACTN/20-278---------------------------------------------------------------------RVRTR----HF
D2U9Y6_XANAP/10-266---------------------------------------------------------------------.WTVP----AL
PANB_BACLD/3-259---------------------------------------------------------------------..TKT----DF
K9ZZ09_DEIPD/3-257---------------------------------------------------------------------.KTVP----DL
E8T692_THEA1/2-260---------------------------------------------------------------------RVTVA----TL
D3UG21_HELM1/2-256---------------------------------------------------------------------KTTIT----SL
R5FZT9_9PORP/11-269---------------------------------------------------------------------KITAT----RF
E0SBL5_DICD3/3-259---------------------------------------------------------------------ATTIS----HL
PANB_HALSA/12-261---------------------------------------------------------------------.....----..
PANB_CAMJE/4-258---------------------------------------------------------------------..SMI----SF
C5CWU9_VARPS/32-292---------------------------------------------------------------------.LSLP----RL
Q0UNM3_PHANO/57-317---------------------------------------------------------------------PVTIN----TL
PANB_SULAC/5-259---------------------------------------------------------------------KVSIR----DF
M4NHU9_9GAMM/13-271---------------------------------------------------------------------PVTVP----GL
C5C4X5_BEUC1/14-271---------------------------------------------------------------------RVRVQ----HL
E2SAV3_9ACTO/24-281---------------------------------------------------------------------RVRTH----HL
I2F2C6_9THEM/2-256---------------------------------------------------------------------..NVR----EI
PANB_DECAR/9-266---------------------------------------------------------------------RLTQA----DL
W1Q8C1_OGAPD/26-284---------------------------------------------------------------------QKTLT----DI
PANB_KOSOT/2-256---------------------------------------------------------------------..NIR----QI
PANB2_BRADU/11-267---------------------------------------------------------------------RVTIP----AL
R7NSE5_9FIRM/2-259---------------------------------------------------------------------KNNVS----TF
A8DWD1_NEMVE/4-260---------------------------------------------------------------------.VTLT----TL
D9SIJ1_GALCS/2-259---------------------------------------------------------------------RTTLT----TL
PANB2_VIBF1/3-259---------------------------------------------------------------------KITIS----DL
C4Y7C6_CLAL4/28-286---------------------------------------------------------------------RTTLT----DL
E0UPX6_SULAO/4-259---------------------------------------------------------------------KLTIS----TI
C0QS02_PERMH/2-258---------------------------------------------------------------------.KTIH----DF
PANB_PELUB/4-253---------------------------------------------------------------------..KIL----NF
F2LWA6_HIPMA/2-259---------------------------------------------------------------------AITVP----KI
PANB_THICR/2-256---------------------------------------------------------------------..TLT----KL
M5DV17_9GAMM/4-263---------------------------------------------------------------------.ISIR----SL
X2HEZ8_9NEIS/2-257---------------------------------------------------------------------.HTIH----TL
I1YKY2_METFJ/3-261---------------------------------------------------------------------RLSLS----HL
D2NU30_ROTMD/61-319---------------------------------------------------------------------KVRTV----HL
R5SB00_9GAMM/3-259---------------------------------------------------------------------..TVT----SF
E1VAR3_HALED/19-275---------------------------------------------------------------------TVTLS----TL
D3SNL0_THEAH/2-259---------------------------------------------------------------------KVTLR----TL
U3U9E1_9BACT/4-259---------------------------------------------------------------------.TTIS----YL
PANB_CLOAB/2-260---------------------------------------------------------------------KNTTE----TF
B7GHT0_ANOFW/22-277---------------------------------------------------------------------..TKL----DF
B8EK33_METSB/5-251---------------------------------------------------------------------....A----RF
C8X1K5_DESRD/4-262---------------------------------------------------------------------KLSVH----TL
G4T0T2_META2/12-267---------------------------------------------------------------------PLTIT----DL
PANB_ANAMF/4-256---------------------------------------------------------------------..NIL----DI
I4YBJ3_WALSC/10-273---------------------------------------------------------------------KVTIA----KL
F0S4V2_PEDSD/9-267---------------------------------------------------------------------RVTTF----SL
E6SCG6_INTC7/25-282---------------------------------------------------------------------RVRIP----HL
PANB_CORJK/21-279---------------------------------------------------------------------KVRIA----DL
F4PBH9_BATDJ/27-283---------------------------------------------------------------------KVTIT----AL
PANB_CYAP4/3-259---------------------------------------------------------------------.VTIP----QL
U5QGT4_9CYAN/2-258---------------------------------------------------------------------AVSIH----HL
E7A9J8_HELFC/3-264---------------------------------------------------------------------KITLD----SL
PANB_ROSDO/14-264---------------------------------------------------------------------.....----DI
I0H0N1_ACTM4/15-272---------------------------------------------------------------------RVRTR----DL
M2PBF7_CERS8/43-302---------------------------------------------------------------------KVTIH----HL
V4KY10_9DELT/4-261---------------------------------------------------------------------KLTRF----DL
D4MUX9_9FIRM/2-260---------------------------------------------------------------------KTTVS----TV
K4II33_PSYTT/10-268---------------------------------------------------------------------RITVK----SL
G2TM93_BACCO/3-259---------------------------------------------------------------------..QTT----DF
PANB_NOCFA/22-279---------------------------------------------------------------------KTRIP----HL
PANB_STRMK/10-265---------------------------------------------------------------------.WTVP----AL
R6Q9M5_9FIRM/3-261---------------------------------------------------------------------KNTVS----TF
PANB_GEOLS/4-261---------------------------------------------------------------------KITIP----EI
PANB_STACT/3-256---------------------------------------------------------------------..QLS----NL
D3IAK5_9BACT/11-269---------------------------------------------------------------------KITTQ----KF
E3RMD4_PYRTT/56-316---------------------------------------------------------------------PVTIN----TL
F8C4E6_THEGP/11-262---------------------------------------------------------------------.....----.L
PANB_RHOCS/9-265---------------------------------------------------------------------RLAVP----DI
G8LWQ2_CLOCD/4-262---------------------------------------------------------------------KITVS----NF
Q6CLY9_KLULA/32-295---------------------------------------------------------------------QLTVK----DI
PANB_SYNR3/10-261---------------------------------------------------------------------....E----QL
R5J4T6_9FIRM/2-260---------------------------------------------------------------------KNTVL----TF
R5CPJ0_9BACT/11-269---------------------------------------------------------------------KVTTH----RF
PANB2_ZYMMO/10-265---------------------------------------------------------------------RRTIP----EL
PANB_UNCTG/3-261---------------------------------------------------------------------KKTVL----TI
A9SWR9_PHYPA/44-307---------------------------------------------------------------------RVTLR----HL
PANB_PSYWF/2-265---------------------------------------------------------------------.ITLS----TL
E1VXC6_ARTAR/15-272---------------------------------------------------------------------RIRLH----HL
F2J6X3_POLGS/33-294---------------------------------------------------------------------RTTLS----TL
PANB_GEOSW/3-259---------------------------------------------------------------------..TKT----DF
D3PCJ6_DEFDS/9-265---------------------------------------------------------------------KITVN----HL
F5XK06_MICPN/12-270---------------------------------------------------------------------RIRIP----DL
R5PEY0_9BACT/11-269---------------------------------------------------------------------KVTAP----AF
D1BFU9_SANKS/24-281---------------------------------------------------------------------RFRVH----HL
I3VRB5_THESW/4-262---------------------------------------------------------------------KITVS----TL
PANB_AGRVS/9-265---------------------------------------------------------------------RLTPT----TI
PANB_XYLFA/10-265---------------------------------------------------------------------.WTVP----AL
M4SFZ5_9SPHN/23-277---------------------------------------------------------------------RMTVP----QI
G0RQ21_HYPJQ/11-271---------------------------------------------------------------------KVTMS----TI
R7FC11_9FIRM/2-261---------------------------------------------------------------------KQTVQ----TI
C1MW11_MICPC/19-288---------------------------------------------------------------------RFTLR----KL
W5XWQ3_9CORY/8-265---------------------------------------------------------------------RVRTR----HF
L0EU60_LIBCB/3-258---------------------------------------------------------------------TTTIE----TL
L0E1F4_THIND/2-256---------------------------------------------------------------------RTTIR----TL
K9Z7J6_CYAAP/2-257---------------------------------------------------------------------KVTIQ----NL
I4A0H9_ORNRL/9-266---------------------------------------------------------------------KITTE----TL
A5HYW9_CLOBH/2-260---------------------------------------------------------------------RNTVS----TF
I3U7Q6_ADVKW/24-279---------------------------------------------------------------------RITVP----QL
PANB1_PSEF5/9-264---------------------------------------------------------------------RLSVP----QL
E8UZX7_TERSS/17-275---------------------------------------------------------------------KTTPQ----SL
PANB_CHLTE/11-273---------------------------------------------------------------------HVTTR----RM
F4CPV3_PSEUX/31-288---------------------------------------------------------------------RTRIH----HL
PANB_MARMM/13-268---------------------------------------------------------------------RITAP----DI
K9WEF5_9CYAN/2-259---------------------------------------------------------------------AVTTQ----QL
K9SKS8_9CYAN/2-258---------------------------------------------------------------------TVTTA----NL
R4VYJ3_9EURY/3-265---------------------------------------------------------------------RTTIR----DL
K5WY16_AGABU/47-306---------------------------------------------------------------------KVTIQ----GL
A8NR68_COPC7/47-306---------------------------------------------------------------------KVTIQ----TL
S5SZ30_9CORY/8-265---------------------------------------------------------------------RVRTR----HF
E3H7X2_ILYPC/2-260---------------------------------------------------------------------KNTVV----SF
B8D3I6_DESK1/7-262---------------------------------------------------------------------RVTVR----DI
I2BCN0_SHIBC/38-294---------------------------------------------------------------------PTTVA----NL
D8PBH0_9BACT/1-257---------------------------------------------------------------------.MTVP----DL
A7I1C3_CAMHC/4-259---------------------------------------------------------------------.ITPN----AI
D3Q8M5_STANL/19-275---------------------------------------------------------------------RVRTR----DL
V5UCI0_9BURK/11-268---------------------------------------------------------------------AVTVP----GL
L0H3K5_9GAMM/8-264---------------------------------------------------------------------.IGIS----TL
L0JL26_NATP1/3-257---------------------------------------------------------------------..TVR----DV
A8IKB7_CHLRE/113-377---------------------------------------------------------------------RVTLR----TI
PANB_HELPY/10-265---------------------------------------------------------------------KITLN----HL
R7BQ71_9ACTN/2-260---------------------------------------------------------------------KNTVT----TF
D5V951_MORCR/17-276---------------------------------------------------------------------.ITLS----TL
U7PLW4_SPOS1/41-301---------------------------------------------------------------------KVTVG----TL
R7LEZ2_9BACT/2-258---------------------------------------------------------------------KKSIK----TI
D3FBP3_CONWI/22-279---------------------------------------------------------------------.VSLP----QL
C5CCN7_MICLC/23-281---------------------------------------------------------------------RYRTV----HL
F8PSJ9_SERL3/44-301---------------------------------------------------------------------KVTIQ----SL
PANB_PELCD/4-262---------------------------------------------------------------------RKTVL----DI
D7CJ47_SYNLT/3-261---------------------------------------------------------------------RVTTT----LL
Q6FJH7_CANGA/29-292---------------------------------------------------------------------.KTIL----DL
D8M6X1_BLAHO/33-296---------------------------------------------------------------------KVTVS----TI
E1SVW3_FERBD/3-259---------------------------------------------------------------------RITTS----TL
PANB_METS5/3-254---------------------------------------------------------------------RLTIR----DF
C1EBW8_MICSR/72-335---------------------------------------------------------------------RMTLK----RL
J7S291_KAZNA/30-296---------------------------------------------------------------------RTTLS----DI
B8MWV2_ASPFN/53-313---------------------------------------------------------------------KVTIQ----TL
PANB_GLUDA/2-258---------------------------------------------------------------------RITLF----DV
PANB3_BRADU/9-264---------------------------------------------------------------------RKTAP----DL
PANB_HALMA/3-256---------------------------------------------------------------------..TVR----DL
PANB_STAA8/2-256---------------------------------------------------------------------.KTVS----QL
G4RCR9_PELHB/16-265---------------------------------------------------------------------.....----.I
F7YY72_9THEM/2-258---------------------------------------------------------------------.ITLQ----KL
D2W044_NAEGR/75-331---------------------------------------------------------------------.VTLQ----CI
F4C347_SPHS2/9-267---------------------------------------------------------------------KVTVN----SI
B1I1N7_DESAP/5-263---------------------------------------------------------------------RLTTL----DI
A8NPY9_COPC7/58-317---------------------------------------------------------------------KVTIQ----TL
R5E9H5_9CLOT/2-260---------------------------------------------------------------------KNTVL----TF
B8J200_DESDA/2-259---------------------------------------------------------------------KNTVV----TF
V4IHK4_9GAMM/6-262---------------------------------------------------------------------.ITSA----SL
PANB_RALME/11-266---------------------------------------------------------------------TVTIP----KL
PANB_SYNJB/4-259---------------------------------------------------------------------.LSIH----HF
PANB_SACEN/31-288---------------------------------------------------------------------RVRTR----HL
G0VBF0_NAUCC/42-307---------------------------------------------------------------------PITIP----DI
D2SAW9_GEOOG/14-271---------------------------------------------------------------------RVRVH----HL
A5FWA4_ACICJ/13-269---------------------------------------------------------------------.KSIG----SW
N0B2M6_9RHIZ/10-264---------------------------------------------------------------------.LMAP----DI
H9UMW1_SPIAZ/3-258---------------------------------------------------------------------..RLA----DF
PANB_CAMFF/3-258---------------------------------------------------------------------KVTIN----DL
G7USF2_PSEUP/10-266---------------------------------------------------------------------.WTVP----AL
E9CAY9_CAPO3/54-312---------------------------------------------------------------------KRTII----DL
A8ZX35_DESOH/4-253---------------------------------------------------------------------...LS----VF
PANB_CAUCR/12-266---------------------------------------------------------------------.LAAP----DI
D5WPY7_KYRT2/8-259---------------------------------------------------------------------.....----..
I0JN82_HALH3/5-258---------------------------------------------------------------------....S----QF
E4T2P1_PALPW/10-268---------------------------------------------------------------------RVTTQ----RL
E4U845_OCEP5/3-257---------------------------------------------------------------------KLTIP----EL
B8IX11_METNO/22-279---------------------------------------------------------------------KRTIT----DI
PANB_PARL1/9-264---------------------------------------------------------------------RVTVP----EI
C1D7E8_LARHH/49-306---------------------------------------------------------------------KVTVS----TL
PANB_YEAST/26-290---------------------------------------------------------------------.NTIQ----DI
I1XL09_METNJ/3-260---------------------------------------------------------------------RTSLN----QL
PANB_TRIEI/2-260---------------------------------------------------------------------AVTTK----QL
K7AE29_9ALTE/3-259---------------------------------------------------------------------KVTTS----SL
S2J9Z0_MUCC1/36-294---------------------------------------------------------------------KVSIK----TI
W0EVM7_9SPHI/9-267---------------------------------------------------------------------RVTTH----TL
G0JMB6_9GAMM/3-257---------------------------------------------------------------------.KKIA----RW
PANB_CALMQ/5-260---------------------------------------------------------------------KVTIR----YF
S0EZ89_CHTCT/9-267---------------------------------------------------------------------RITVP----EL
Q6CE35_YARLI/40-298---------------------------------------------------------------------KVTIP----EL
R5ACL8_9FIRM/2-260---------------------------------------------------------------------KNTVA----TL
G8R5C5_OWEHD/10-268---------------------------------------------------------------------KVTTN----SV
PANB_TOLAT/3-259---------------------------------------------------------------------KISLT----QV
B3QT33_CHLT3/14-276---------------------------------------------------------------------QVTTR----KL
B0VG23_CLOAI/8-266---------------------------------------------------------------------KTDIA----VF
G8B7V6_CANPC/30-291---------------------------------------------------------------------RKTVA----DI
D5UXM6_TSUPD/25-282---------------------------------------------------------------------KVRIH----HL
W0DU54_9GAMM/2-258---------------------------------------------------------------------KKTLK----QL
F0YK17_AURAN/2-266---------------------------------------------------------------------.TTAM----SL
N1QBK2_MYCFI/41-301---------------------------------------------------------------------KTSLQ----TL
G8TR11_NIAKG/11-269---------------------------------------------------------------------KITTH----TL
K0NQW1_DESTT/4-258---------------------------------------------------------------------RVTTS----TL
C5DIL6_LACTC/24-292---------------------------------------------------------------------.KTLA----DL
F4B4G2_ACIHW/4-258---------------------------------------------------------------------KITVK----SF
PANB_DESAG/9-266---------------------------------------------------------------------AITAA----DI
E1QGK1_DESB2/5-263---------------------------------------------------------------------KVTIS----DL
F9Z613_ODOSD/10-267---------------------------------------------------------------------.VTTH----VL
R6QG64_9CLOT/9-267---------------------------------------------------------------------DVTVN----TF
PANB_NEIG1/2-257---------------------------------------------------------------------.ITVN----TL
PANB_ALKMQ/4-261---------------------------------------------------------------------KKSIL----DL
F0LTK0_VIBFN/3-259---------------------------------------------------------------------KITIN----DL
A5D5T4_PELTS/5-263---------------------------------------------------------------------KVTTA----TI
PANB_TROWT/13-267---------------------------------------------------------------------RTRIH----RF
J7IT73_DESMD/3-259---------------------------------------------------------------------..STK----DF
D4KZZ1_9FIRM/4-262---------------------------------------------------------------------KNTVV----TL
PANB_SACD2/11-266---------------------------------------------------------------------KVTVN----TL
PANB_CYAP8/2-257---------------------------------------------------------------------AMTLP----YL
PANB1_ZYMMO/33-296---------------------------------------------------------------------KTTTA----RI
PANB1_HAHCH/9-265---------------------------------------------------------------------RITIP----QI
B4U641_HYDS0/4-261---------------------------------------------------------------------KLNIE----LL
C7PAE1_CHIPD/9-267---------------------------------------------------------------------RITTH----IL
PANB_EXISA/3-259---------------------------------------------------------------------..TMT----TL
PANB_FRAAA/42-298---------------------------------------------------------------------RFTVR----DV
A8GIZ6_SERP5/25-281---------------------------------------------------------------------PTTVT----HL
PANB_MARMS/13-269---------------------------------------------------------------------AVTLS----TL
B9I8Q3_POPTR/46-310---------------------------------------------------------------------RVTLT----HL
F2KYW8_PREDF/10-268---------------------------------------------------------------------KVTAK----TL
W8X8F9_CASDE/9-264---------------------------------------------------------------------RVTVP----QL
C7MWE6_SACVD/37-294---------------------------------------------------------------------RVRIH----HL
W8TJC5_EUBAC/5-263---------------------------------------------------------------------KFTVS----SF
R6MRV8_9FIRM/2-260---------------------------------------------------------------------KNTTV----TF
E1R683_SPISS/12-255---------------------------------------------------------------------KVT..----..
E0TIB5_PARBH/9-264---------------------------------------------------------------------RQTAA----SI
C9R9H9_AMMDK/3-261---------------------------------------------------------------------KVTTA----DF
L0ECE9_THECK/4-262---------------------------------------------------------------------.LTVT----KW
PANB_RHIEC/9-265---------------------------------------------------------------------RLTPP----RI
PANB_RHOS4/11-264---------------------------------------------------------------------..MAA----DI
C8W3T9_DESAS/5-263---------------------------------------------------------------------KVTTA----TF
H8GHP8_METAL/6-259---------------------------------------------------------------------.LSIH----DL
R6FWR6_9CLOT/2-260---------------------------------------------------------------------KNTVV----TF
Q7NSX9_CHRVO/10-253---------------------------------------------------------------------RVTVP----AI
PANB_DESVH/21-277---------------------------------------------------------------------.LTTA----DI
PANB_RHISN/11-264---------------------------------------------------------------------..SPA----SI
K9SDR5_9CYAN/2-259---------------------------------------------------------------------AVTVR----QL
R6FYY2_9FIRM/2-260---------------------------------------------------------------------KNTVT----TF
PANB_THIDA/2-258---------------------------------------------------------------------PVTLS----TL
PANB2_METPP/16-274---------------------------------------------------------------------PVTLH----TL
PANB_ROSS1/2-259---------------------------------------------------------------------RKTIT----DI
H6C1C9_EXODN/62-322---------------------------------------------------------------------PVTIQ----TL
F2NLZ2_MARHT/3-259---------------------------------------------------------------------KLTVL----DL
F0R8P2_BACSH/11-269---------------------------------------------------------------------KVTTH----RL
D5SWW3_PLAL2/21-276---------------------------------------------------------------------RMTVP----RF
R5EQ78_9GAMM/2-259---------------------------------------------------------------------KVTVA----TF
E8U6D3_DEIML/3-257---------------------------------------------------------------------.LTVP----DI
B3PI46_CELJU/20-275---------------------------------------------------------------------SVTIN----TL
PANB_SYNFM/4-261---------------------------------------------------------------------RVTVP----EI
H2J7Z9_MARPK/2-256---------------------------------------------------------------------..SIR----KF
PANB_CHRSD/3-259---------------------------------------------------------------------TVTLS----RL
H8L6Y3_FRAAD/13-270---------------------------------------------------------------------PVTAP----GL
PANB_DEHM1/2-259---------------------------------------------------------------------RTTIS----QL
PANB_HELHP/5-260---------------------------------------------------------------------KMSIA----TL
B2GG07_KOCRD/16-273---------------------------------------------------------------------RVRTV----HL
J3YT69_9ENTR/2-257---------------------------------------------------------------------.TTIS----HL
PANB_RUTMC/2-256---------------------------------------------------------------------..NIE----AL
F4KKJ6_PORAD/11-269---------------------------------------------------------------------KVTTR----RL
E4TNZ1_MARTH/10-268---------------------------------------------------------------------KITTH----QL
PANB_ACIAD/3-261---------------------------------------------------------------------..SLS----DL
M1E8E9_9FIRM/4-260---------------------------------------------------------------------KLYAP----DI
H2FZS0_OCESG/3-259---------------------------------------------------------------------KITTA----RL
E3D016_9BACT/4-262---------------------------------------------------------------------RMTLP----RL
R7Y0I9_9ACTO/27-284---------------------------------------------------------------------KIRTH----HL
C7R4W8_JONDD/10-267---------------------------------------------------------------------RFRVH----DF
B3DYC2_METI4/5-256---------------------------------------------------------------------KITPD----WI
PANB_BURP8/11-267---------------------------------------------------------------------AVTVP----KL
PANB_OCEIH/3-256---------------------------------------------------------------------..ALK----DF
K4LJP4_9FIRM/4-262---------------------------------------------------------------------KVNIN----AL
C7M6V0_CAPOD/10-268---------------------------------------------------------------------RVTTK----SI
E6SG79_THEM7/29-287---------------------------------------------------------------------RVTVR----TV
H0UKG2_9BACT/4-262---------------------------------------------------------------------KMSVL----DF
G0AG10_COLFT/18-274---------------------------------------------------------------------PITIP----AL
D0MKC7_RHOM4/15-273---------------------------------------------------------------------RVTTQ----TL
K9TFZ3_9CYAN/2-258---------------------------------------------------------------------PITPQ----QL
PANB_SYNY3/2-258---------------------------------------------------------------------AITPT----QL
PANB_CHRVO/2-258---------------------------------------------------------------------KITVN----TL
PANB_PYRAE/11-257---------------------------------------------------------------------.....----..
D3G0K7_BACPE/3-259---------------------------------------------------------------------..TTA----TF
G8ZML5_TORDC/45-310---------------------------------------------------------------------SNTIH----DM
B8GNA9_THISH/9-265---------------------------------------------------------------------RITTR----RL
PANB_YERPE/3-260---------------------------------------------------------------------TTTMS----QL
PANB_HALHL/14-269---------------------------------------------------------------------.VTVS----RM
I7H5U9_9HELI/5-260---------------------------------------------------------------------KMSIT----DL
PANB_FLAJ1/10-268---------------------------------------------------------------------RITTK----SL
H2AZP6_KAZAF/28-293---------------------------------------------------------------------RITIQ----DI
PANB_HYPNA/9-263---------------------------------------------------------------------RKTVK----DI
F0T218_SYNGF/3-260---------------------------------------------------------------------KKTIL----DF
K0J2M4_AMPXN/5-260---------------------------------------------------------------------....F----EF
PANB_PELPD/7-264---------------------------------------------------------------------KVTIP----DI
PANB_ACAM1/2-259---------------------------------------------------------------------AVTIH----QL
R5HLC5_9SPIR/4-262---------------------------------------------------------------------KVTVN----TI
E6W3R1_DESIS/9-267---------------------------------------------------------------------KITTT----AV
E8WV64_ACISM/17-275---------------------------------------------------------------------KVTPQ----TL
B0RBZ8_CLAMS/26-283---------------------------------------------------------------------RVRIR----HF
R7J318_9BACT/11-269---------------------------------------------------------------------KVTTA----RL
D1C1L8_SPHTD/5-263---------------------------------------------------------------------RVTIA----DL
D5CQ24_SIDLE/3-260---------------------------------------------------------------------RKTLS----TL
K9U8V4_9CYAN/2-257---------------------------------------------------------------------PITTQ----QL
R7Z1Y2_CONA1/60-319---------------------------------------------------------------------KVTLG----TL
A3GFD5_PICST/27-288---------------------------------------------------------------------RKTVA----DI
PANB_GEOMG/4-262---------------------------------------------------------------------KKTII----DI
D1B8U6_THEAS/5-263---------------------------------------------------------------------KVTIP----AL
D1AZH1_SULD5/18-272---------------------------------------------------------------------.KTIT----SI
K9V2Q3_9CYAN/2-257---------------------------------------------------------------------PVTIQ----QL
G4TES8_PIRID/16-274---------------------------------------------------------------------KVTLA----RL
PANB_AERHH/3-259---------------------------------------------------------------------KITTT----NL
B5Y864_COPPD/3-251---------------------------------------------------------------------...AT----QF
E6VV69_DESAO/18-273---------------------------------------------------------------------.VTAP----DI
D0LB03_GORB4/26-283---------------------------------------------------------------------KTRVH----HL
R4XB88_TAPDE/13-270---------------------------------------------------------------------.LNLG----TI
C5XKA7_SORBI/74-338---------------------------------------------------------------------RVTLA----TL
PANB_HELMI/4-262---------------------------------------------------------------------KITLP----QC
D4ZUG3_ARTPN/2-258---------------------------------------------------------------------AVTTQ----QL
D3AXV1_POLPA/114-372---------------------------------------------------------------------KTTIL----DI
W5Y2G7_9CORY/15-272---------------------------------------------------------------------KIRVS----DL
W0IZ08_9BACT/4-264---------------------------------------------------------------------...VL----DF
G3AZ68_CANTC/24-285---------------------------------------------------------------------RNTIA----DI
E8R215_ISOPI/23-275---------------------------------------------------------------------..QPP----DL
R4KP81_9FIRM/5-263---------------------------------------------------------------------KANIL----TF
K5W3S2_PHACS/44-303---------------------------------------------------------------------KVTIQ----HL
A9WS61_RENSM/30-287---------------------------------------------------------------------KIRVH----HL
PANB_ANADF/10-272---------------------------------------------------------------------RVTIH----EL
PANB_THEM4/1-256---------------------------------------------------------------------.MTIQ----KF
PANB_SULSO/3-259---------------------------------------------------------------------KVTIR----DF
F0S244_DESTD/2-259---------------------------------------------------------------------AITTA----TF
B9L4S0_THERP/5-263---------------------------------------------------------------------RVTVA----DL
C8WT97_ALIAD/4-262---------------------------------------------------------------------TVTVR----TL
PANB_STAEQ/2-256---------------------------------------------------------------------.KTLN----HL
PANB_OLICO/9-264---------------------------------------------------------------------RKTAP----EI
F6FX13_ISOV2/15-272---------------------------------------------------------------------RVRVH----HL
PANB_GEODF/4-262---------------------------------------------------------------------ATTIL----DI
D9QPL3_ACEAZ/4-262---------------------------------------------------------------------KKSIL----DF
F2JV64_MARM1/12-268---------------------------------------------------------------------PVTLS----KL
E0UCI4_CYAP2/2-257---------------------------------------------------------------------AVTTG----QI
D5EMA1_CORAD/2-258---------------------------------------------------------------------SISTQ----TI
G2IWQ8_PSEUL/2-259---------------------------------------------------------------------KINVN----TL
X2GVH3_9BACI/3-258---------------------------------------------------------------------..TTS----DF
D6XUX0_BACIE/3-260---------------------------------------------------------------------..TTS----DF
D6Z2X7_DESAT/7-263---------------------------------------------------------------------..TVC----DL
PANB_KORVE/11-269---------------------------------------------------------------------KVTSS----TL
A6QC29_SULNB/11-266---------------------------------------------------------------------KITLS----TI
D3V561_XENBS/3-258---------------------------------------------------------------------PTTLT----DL
L0B619_9PROT/13-263---------------------------------------------------------------------.....----.I
C6X7E4_METGS/1-265---------------------------------------------------------------------.MTVH----DL
D7WER9_9CORY/10-268---------------------------------------------------------------------KVRVA----DL
I3YPM0_ALIFI/9-267---------------------------------------------------------------------AVTTY----RL
R5HUC8_9FIRM/3-261---------------------------------------------------------------------QNNVV----TL
R5U8N9_9FIRM/2-260---------------------------------------------------------------------KTTVS----TL
PANB_HYPBU/6-262---------------------------------------------------------------------KVTVR----DI
B8P6R4_POSPM/2-261---------------------------------------------------------------------KVTIQ----HL
PANB_SHELP/3-259---------------------------------------------------------------------KITSS----TL
PANB_CHLAA/2-258---------------------------------------------------------------------RITIR----DI
PANB_PHOLL/3-258---------------------------------------------------------------------PMTMT----DL
PANB_CLOK5/3-261---------------------------------------------------------------------KNNVS----TF
I0HQJ4_RUBGI/17-276---------------------------------------------------------------------.LNLV----RL
R5ZHJ8_9FIRM/2-260---------------------------------------------------------------------KTTVT----TL
U5MUW3_CLOSA/2-260---------------------------------------------------------------------KNTIL----TF
W5X9J0_9BACT/4-257---------------------------------------------------------------------RVTVP----HI
D5DBX1_BACMD/3-259---------------------------------------------------------------------..TKL----DF
K9T7C7_9CYAN/2-258---------------------------------------------------------------------AVTIQ----QL
PANB_AZOPC/10-268---------------------------------------------------------------------KITIQ----HL
K3W4X2_PYTUL/57-320---------------------------------------------------------------------KVTTL----DL
A1CTJ0_ASPCL/72-332---------------------------------------------------------------------KVTMQ----TL
A6WW04_OCHA4/18-274---------------------------------------------------------------------RLTPK----AI
V5SAA2_9RHIZ/10-264---------------------------------------------------------------------.LMAP----DI
D3HPA3_LEGLN/2-258---------------------------------------------------------------------..KIQ----DF
R5BRB9_9FIRM/4-262---------------------------------------------------------------------KKCIH----DL
B1VGE7_CORU7/16-274---------------------------------------------------------------------QVRIS----DL
W0RJ42_9BACT/5-261---------------------------------------------------------------------.VTTG----DL
PANB_PARDP/15-266---------------------------------------------------------------------.....----DI
D5QI36_KOMHA/9-263---------------------------------------------------------------------RRTIR----DV
D1BSH7_XYLCX/21-280---------------------------------------------------------------------RVTPP----SL
L0DD73_SINAD/8-261---------------------------------------------------------------------.VTPP----DF
PANB_PEPD6/2-260---------------------------------------------------------------------KNTIQ----TF
PANB_THEMA/2-256---------------------------------------------------------------------..NVE----KL
C7N2J4_SLAHD/19-269---------------------------------------------------------------------..NLA----YL
A4SZR6_POLSQ/9-266---------------------------------------------------------------------PITIT----KL
D7B2F6_NOCDD/27-283---------------------------------------------------------------------RVTIR----DL
H3ZNX9_THELN/3-257---------------------------------------------------------------------EITPK----KI
M4UAA2_9GAMM/3-259---------------------------------------------------------------------RISVS----HL
K9QBM1_9NOSO/2-258---------------------------------------------------------------------PVTTQ----QL
PANB_SALTY/3-258---------------------------------------------------------------------PTTIS----LL
W0E2Q1_MARPU/6-262---------------------------------------------------------------------.TTVA----SL
I1YQZ3_PREI7/10-268---------------------------------------------------------------------KITAK----TL
L0A954_CALLD/5-260---------------------------------------------------------------------KLTIR----DI
D4Z3Z8_SPHJU/23-282---------------------------------------------------------------------RLTVP----AI
E6WRV2_PSEUU/10-266---------------------------------------------------------------------.WTVP----AL
F9ZNB5_ACICS/4-257---------------------------------------------------------------------..KLE----VW
R5AXG3_9BACT/10-268---------------------------------------------------------------------KVTTR----RL
R6QI65_9FIRM/2-260---------------------------------------------------------------------KNTVS----TF
F4L4T8_HALH1/9-267---------------------------------------------------------------------RITTH----VL
PANB_COLP3/3-259---------------------------------------------------------------------KITTA----SL
PANB_ERWT9/3-259---------------------------------------------------------------------PTTVS----TL
D2B380_STRRD/20-276---------------------------------------------------------------------RITVR----DI
Q54LH3_DICDI/91-349---------------------------------------------------------------------KKTVL----DI
R6RU48_9CLOT/2-260---------------------------------------------------------------------KNTAV----TF
C7QBN8_CATAD/33-291---------------------------------------------------------------------RVTVR----DL
E8NFW7_MICTS/5-263---------------------------------------------------------------------RVTLR----RL
PANB_THET8/2-257---------------------------------------------------------------------RRTVK----DF
M1PUL5_DESSD/4-262---------------------------------------------------------------------RKTVA----GI
PANB_HERA2/2-258---------------------------------------------------------------------RTQLS----DI
PANB_CORDI/5-259---------------------------------------------------------------------.VRLQ----DL
G8P0T0_GRAMM/17-275---------------------------------------------------------------------RVTAD----VL
B0JGU8_MICAN/2-253---------------------------------------------------------------------AVTTS----KL
A4RSY4_OSTLU/35-299---------------------------------------------------------------------RFTLG----EL
G0VMJ3_MEGEL/4-263---------------------------------------------------------------------KVTNL----TI
G8JVR3_ERECY/22-285---------------------------------------------------------------------QKTIP----DL
D4ALU8_ARTBC/69-329---------------------------------------------------------------------KVTIK----SL
D8IYH6_HERSS/15-271---------------------------------------------------------------------PVTTH----TL
D5EGN8_AMICL/9-262---------------------------------------------------------------------.....----EF
K0CGS1_ALCDB/3-252---------------------------------------------------------------------KKHAQ----AL
M3HH38_CANMX/30-289---------------------------------------------------------------------RKTIE----DI
C7R7Z0_KANKD/3-259---------------------------------------------------------------------TLTIS----DI
H8KSY4_SOLCM/9-267---------------------------------------------------------------------RITTN----TV
Q75D37_ASHGO/24-287---------------------------------------------------------------------QKTIP----DI
E4RTA9_LEAB4/5-263---------------------------------------------------------------------RITTN----TL
E3HRX5_ACHXA/19-273---------------------------------------------------------------------.LSVP----AF
PANB_DESAA/4-258---------------------------------------------------------------------KVTVT----VL
D3DI50_HYDTT/5-262---------------------------------------------------------------------.ITIR----HL
T1KER8_TETUR/72-325---------------------------------------------------------------------KVRTI----DI
W0DFL3_9AQUI/2-259---------------------------------------------------------------------KTTIR----TL
D9QLF2_BRESC/11-266---------------------------------------------------------------------RLAAP----DI
F8I3G8_SULAT/4-259---------------------------------------------------------------------KLTAP----EL
E8SI87_STAPH/2-256---------------------------------------------------------------------.KTLN----HI
D5BZ31_NITHN/3-259---------------------------------------------------------------------RLTLT----KL
PANB_ACIC1/10-267---------------------------------------------------------------------RVTIH----DL
PANB_BUCAI/3-259---------------------------------------------------------------------SITIS----QL
D8RRV3_SELML/38-302---------------------------------------------------------------------RVTLR----HL
R5IEN0_9BACT/10-267---------------------------------------------------------------------.MTTH----RL
PANB_BARHE/9-264---------------------------------------------------------------------RITAS----EI
R5LDT0_9FIRM/2-259---------------------------------------------------------------------.TTVT----TL
D6ZCH0_SEGRD/15-271---------------------------------------------------------------------RVRIS----HL
PANB_LEPIN/9-261---------------------------------------------------------------------.....----..
PANB_FRATT/7-257---------------------------------------------------------------------.....----.F
W0EB65_9FIRM/2-259---------------------------------------------------------------------RKTVP----YF
PANB_IDILO/5-261---------------------------------------------------------------------KTSIA----TL
PANB2_HAHCH/2-258---------------------------------------------------------------------SITLS----TL
PANB_CHLPD/11-273---------------------------------------------------------------------HVTTR----KL
F0VHK9_NEOCL/2-249---------------------------------------------------------------------....A----DL
W5X1Y4_BDEBC/3-258---------------------------------------------------------------------..SIL----EF
PANB_ACISJ/26-287---------------------------------------------------------------------.VSLP----RL
PANB_SULTO/3-259---------------------------------------------------------------------KVTIR----DF
U4KYW8_PYROM/61-321---------------------------------------------------------------------KVTIN----TL
G8M4H3_9BURK/11-267---------------------------------------------------------------------TITVP----KL
R7I0S5_9CLOT/17-275---------------------------------------------------------------------KHTVL----TL
PANB_LEGPH/2-258---------------------------------------------------------------------..KIH----DF
PANB_PSYIN/3-259---------------------------------------------------------------------KISVS----RL
B4EJY2_BURCJ/9-265---------------------------------------------------------------------RKTVT----AI
C3PI15_CORA7/10-267---------------------------------------------------------------------RLRTR----HF
D4G919_RIEPU/9-267---------------------------------------------------------------------.TTIE----DI
I7A1E3_MELRP/3-258---------------------------------------------------------------------..TVS----EF
R6HBG1_9ACTN/2-260---------------------------------------------------------------------KNTVA----TF
C5ZWV0_9HELI/9-263---------------------------------------------------------------------QTTIT----QI
PANB_STAMF/3-258---------------------------------------------------------------------KITIR----DI
PANB_CYTH3/10-268---------------------------------------------------------------------KVTTH----QL
H5WJ91_9BURK/17-281---------------------------------------------------------------------...LV----RL
PANB_ALCBS/2-258---------------------------------------------------------------------SITIR----TL
B2V9F5_SULSY/3-258---------------------------------------------------------------------..SIN----EF
I4ANF3_FLELS/11-269---------------------------------------------------------------------RITTH----SL
B6H969_PENCW/50-309---------------------------------------------------------------------KVTIQ----TI
X2GXI3_9GAMM/2-259---------------------------------------------------------------------KKTIL----TL
G4V1E0_NEUT9/11-271---------------------------------------------------------------------KVTLN----TL
C5ME17_CANTT/28-287---------------------------------------------------------------------RKTLA----DI
K9UIR8_9CHRO/3-253---------------------------------------------------------------------..TVR----QL
A9GRC2_SORC5/21-278---------------------------------------------------------------------KVTVP----EI
R5NDJ7_9BACT/11-269---------------------------------------------------------------------KVTTH----RL
D2QWS1_PIRSD/7-261---------------------------------------------------------------------RVTVP----EF
C7RR60_ACCPU/9-266---------------------------------------------------------------------RLTQL----DL
PANB_MAGSM/4-262---------------------------------------------------------------------RVRVP----DL
PANB_SYNWW/3-261---------------------------------------------------------------------RVTVS----VL
D5AMQ4_RHOCB/10-264---------------------------------------------------------------------.LMPS----DI
PANB_BACHD/3-259---------------------------------------------------------------------..TTA----SF
D0LJC1_HALO1/5-263---------------------------------------------------------------------KVTIH----TL
PANB_METS4/17-272---------------------------------------------------------------------.VTIP----ML
B2UME9_AKKM8/9-253---------------------------------------------------------------------....E----RI
R5BAJ9_9BACE/11-269---------------------------------------------------------------------KVTTA----LL
PANB_EDWI9/4-259---------------------------------------------------------------------.TTLS----HL
R4KDW0_CLOPA/2-260---------------------------------------------------------------------KNTSS----TF
PANB_CALS8/3-260---------------------------------------------------------------------KVTTK----TL
D8QAA7_SCHCM/53-309---------------------------------------------------------------------KVTVA----DL
R5KL99_9CLOT/2-260---------------------------------------------------------------------KNTTT----SI
E3JA95_FRASU/46-302---------------------------------------------------------------------RPTVR----DL
D6ZI06_MOBCV/16-270---------------------------------------------------------------------.FRVQ----HV
I3Y5B5_THIV6/6-262---------------------------------------------------------------------.ISVT----AL
U5Q4L3_9BACT/10-267---------------------------------------------------------------------.ITTQ----RL
B8DSD1_DESVM/24-276---------------------------------------------------------------------.....----DV
PANB_PROMH/3-258---------------------------------------------------------------------PVTLS----TL
R7JBN8_9FUSO/4-262---------------------------------------------------------------------KVTVN----TI
M1WKJ2_DESPC/25-280---------------------------------------------------------------------.VTAP----SV
W0BBT9_9GAMM/2-258---------------------------------------------------------------------..KIH----DF
R5IDU3_9FIRM/17-266---------------------------------------------------------------------.KTIN----YL
A6RA45_AJECN/56-315---------------------------------------------------------------------KVTIK----SL
PANB_SYNP2/2-257---------------------------------------------------------------------RVTPR----TL
E4NAD9_KITSK/28-286---------------------------------------------------------------------RVTVR----DL
I3Z4N3_BELBD/11-269---------------------------------------------------------------------RITTH----TL
D5X9N1_THEPJ/5-263---------------------------------------------------------------------KVTTL----TL
D8JZZ5_DEHLB/2-260---------------------------------------------------------------------RTTIQ----AV
C7NW69_HALMD/3-255---------------------------------------------------------------------...AN----DI
K4LLM0_THEPS/3-261---------------------------------------------------------------------RVTTA----TL
PANB_XANP2/9-264---------------------------------------------------------------------RITAP----QI
PANB_GEOBB/4-262---------------------------------------------------------------------QRTIL----DF
PANB_GLOVI/3-254---------------------------------------------------------------------.LSIH----SL
A6WD73_KINRD/16-272---------------------------------------------------------------------RTRVH----HF
B5YIG6_THEYD/2-260---------------------------------------------------------------------RFTVT----DL
H1XZL4_9SPHI/9-267---------------------------------------------------------------------KITTN----TL
C6CUG2_PAESJ/4-263---------------------------------------------------------------------RLTIT----NL
PANB_ERYLH/23-282---------------------------------------------------------------------RLTVP----KI
PANB_SCHPO/5-262---------------------------------------------------------------------QITIS----TL
D1CBZ3_THET1/7-265---------------------------------------------------------------------KVTIQ----DL
K9XAD9_9CHRO/2-257---------------------------------------------------------------------AVTIQ----QL
PANB_PSEHT/3-259---------------------------------------------------------------------KITVS----TL
PANB_RUEST/10-264---------------------------------------------------------------------.LTAE----DI
V6JUX0_STRRC/32-289---------------------------------------------------------------------RITVR----DI
R6BVU7_9BACT/10-268---------------------------------------------------------------------KITTK----TF
I3R834_HALMT/2-256---------------------------------------------------------------------.VTVR----AL
C4R687_PICPG/26-284---------------------------------------------------------------------QSTLR----TL
K9XXG3_STAC7/2-258---------------------------------------------------------------------AITIQ----QL
A5DHH9_PICGU/32-292---------------------------------------------------------------------RKTLA----DI
I2ESX7_EMTOG/9-267---------------------------------------------------------------------RVTTH----TL
PANB_COXBU/4-260---------------------------------------------------------------------.MNTP----DF
B1X124_CYAA5/10-265---------------------------------------------------------------------.LTTQ----QL
D5EWH2_PRER2/2-259---------------------------------------------------------------------RKSIF----DL
G2LF65_CHLTF/5-263---------------------------------------------------------------------RVTPG----DL
F6EEK6_AMYSD/18-275---------------------------------------------------------------------KTRIH----HL
G8RMJ4_MYCRN/4-264---------------------------------------------------------------------KVKLA----DL
G8AKD6_AZOBR/9-265---------------------------------------------------------------------RVSVP----AL

PF00224

KPYK_EMENI/32-379---------------------------------------FRRTSIICTIGPK.................TNSVE....KI
KPYM_FELCA/42-395---------------------------------------ARNTGIICTIGPA.................SRSVE....IL
KPYK_HAEIN/5-350---------------------------------------LRRTKIVCTMGPS.................TDRDN....NL
KPYK_YARLI/29-376---------------------------------------YRKSSIIGTIGPN.................TNSAE....MI
KPYC_SOLTU/19-365---------------------------------------IPKTKIVCTLGPS.................SRTVP....ML
KPYR_HUMAN/85-438---------------------------------------ARSTSIIATIGPA.................SRSVE....RL
KPYK_LACLA/2-375---------------------------------------NKRVKIVSTLGPAVEIRGGKKFGESGYWGESLDVEASAKNI
KPYK1_YEAST/18-365---------------------------------------LRRTSIIGTIGPK.................TNNPE....TL
G0RKV7_HYPJQ/42-387---------------------------------------.RRTSIICTIGPK.................TNSVE....AL
Q1GAL0_LACDA/1-345---------------------------------------MKKTKIVSTLGPA.................SDDIE....TI
Q5KWB2_GEOKA/3-345---------------------------------------.RKTKIVCTIGPA.................SESVD....KL

PF14010

CAPPA_METHJ/3-484-----------------------------------------------IPRTMSTQHPDNVHTPFF..TENIELT----GE
D3S0D1_FERPA/2-476-----------------------------------------------VPRVMSTQHPDNANVPFF..ARGEYLN----GE
CAPPA_HALSA/4-492-----------------------------------------------VPRLMSTQHPDNATLPFF..TAGDVIE----GE
CAPPA_METTH/3-483-----------------------------------------------VPRCMSTQHPDNVNPPFF..AEEPELG----GE
CAPPA_METKA/9-532-----------------------------------------------IARTLATQHPD..........ATKFVR----VQ
A8A9C2_IGNH4/3-488-----------------------------------------------VPKLMATQHPD..........STVVLM----PQ
CAPPA_SULTO/4-511-----------------------------------------------IPRTMSTQHPDNARVPEW..SRSEVIS----GE
B1I2W1_DESAP/7-489-----------------------------------------------ISRTMSTQHPDNVTVPFF..ANSQDMS----GE
CAPPA_PICTO/6-508-----------------------------------------------IPKTMSTQHPDNAKMPAW.ASEKSMIR----ND
CAPPA_CALMQ/4-512-----------------------------------------------IPRTMCTQHPDYANVPQW..VVNDFIK----GD
CAPPA_METS5/4-509-----------------------------------------------IPRTMSTQHPDNATVPEW..AKGDVIE----GE
CAPPA_ARCFU/2-471-----------------------------------------------VPRVMSTQHPDNARIPFF..AASEVLN----GE
CAPPA_PYRAE/3-460-----------------------------------------------IPCLMCTQHPD..........STVKIT----AG
CAPPA_SULAC/4-511-----------------------------------------------IPRTMSTQHPDNAKVPEW..NQGEAIS----GE
J9ZD85_LEPFM/19-520-----------------------------------------------IPTTMATQHPDNARAPYWKTNNDPFIS----TL
CAPPA_CLOPE/3-537-----------------------------------------------IPCSMMTQHPDN.........VETYIS----IQ
CAPPA_SULSO/4-511-----------------------------------------------IPRTMSTQHPDNAKVPEW..AKSEVIE----GE

PF01274

MASY_EMENI/11-531................................................................PAPGLVDRRV----EI
MASZ_CORGL/35-713REFLDSVVPLDGASHADVEKYNITDGKLAAHIGDSVYRLKNRESYRGFTGNFLDPEAILLETNGLHIELQIDPV----HP
MASY_MYXXD/17-538................................................................LPADLQDRRV----EI
MASZ_ECOLI/17-697RFLDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIELQIDAN----GR
Q9RYN3_DEIRA/10-521................................................................LPDALKDRRV----EI
MASY_MAIZE/16-548................................................................VPPAVADRTV----EI
MASY_ECOLI/11-533................................................................IPADLEDRRV----EI
MASZ_MYCLE/17-704KFMDQAVPLASDSWTNATGVSIFDGQLQIAIGTNSTGLASPEKFVGYNRQLRSSNWSVLLANHGLHIEVLIDPE----SP
MASY_YEAST/18-542................................................................LAPGLINRST----EI
B5GRN8_STRC2/12-539................................................................APPALQDRRV----EI
C5MBE7_CANTT/16-539................................................................LAPGLIDRRC----EI
F2KMB8_PSEBN/18-697AFLDEAAPLAAGSHVDSTAYKIVDGKLVVTLKGGSNSGLRDDAQLIGFQGDASAPTTVLLKHNGLHFEIQIDAS----TP
M4EJ48_BRARP/22-551................................................................VPPAVADRRV----EI
W1QBI0_OGAPD/27-543................................................................THPKLQCRKI----EI

PF03328

Q9RYM1_DEIRA/24-251------------------------------------------------------------------------QI----GL
Q8XL94_CLOPE/6-225------------------------------------------------------------------------RS----MM
Q9CGA8_LACLA/9-229------------------------------------------------------------------------RT----MM
RHMA_ECOLI/19-246------------------------------------------------------------------------QI----GL
Q8RDW5_FUSNN/9-227------------------------------------------------------------------------RT----MM
GARL_ECOLI/20-246------------------------------------------------------------------------QI----GC
Q9KTU0_VIBCH/11-230------------------------------------------------------------------------RS----ML
Q93167_CAEEL/26-259------------------------------------------------------------------------RA----LL
Q9HRM8_HALSA/29-241------------------------------------------------------------------------RS----VL
O82487_ARATH/90-322------------------------------------------------------------------------LY----GL
CITEL_DEIRA/9-223------------------------------------------------------------------------RS----VL
BPHF_RHOSR/18-244------------------------------------------------------------------------QI----GF
A4XDW8_NOVAD/18-242------------------------------------------------------------------------QL----GF
HPCH_KLEP7/15-240------------------------------------------------------------------------QI----GL
C0ZQX9_RHOE4/12-226------------------------------------------------------------------------RA----SL
CITE_ECOLI/15-234------------------------------------------------------------------------RS----ML
Q4DGT6_TRYCC/18-249------------------------------------------------------------------------KF----GV
Q8ZRY2_SALTY/5-223------------------------------------------------------------------------RS----ML
Q99ZK8_STRP1/6-224------------------------------------------------------------------------RT----MM

PF13714

A0JTC7_ARTS2/12-246-----------------------------------------------------------------------LLR----.L
A0K276_ARTS2/27-270-----------------------------------------------------------------------FHA----.L
A0QPJ7_MYCS2/16-251-----------------------------------------------------------------------LLA----.L
A0R0I0_MYCS2/10-256-----------------------------------------------------------------------FAE----RL
A1CA54_ASPCL/14-274-----------------------------------------------------------------------LCR----.L
A1SIA9_NOCSJ/3-233-----------------------------------------------------------------------FRA----.L
A4F7M3_SACEN/8-232-----------------------------------------------------------------------FRA----.L
A4FH54_SACEN/26-273-----------------------------------------------------------------------LRD----.L
A4X5C0_SALTO/32-264-----------------------------------------------------------------------FRS----.L
A4X7L5_SALTO/4-223-----------------------------------------------------------------------FAA----.L
A4XS21_PSEMY/12-254-----------------------------------------------------------------------FQA----.L
A4YVZ4_BRASO/12-249-----------------------------------------------------------------------FRK----.L
A5G4A7_GEOUR/12-254-----------------------------------------------------------------------FLR----.L
A5V3Q4_SPHWW/10-252-----------------------------------------------------------------------FSK----.L
A9WM41_RENSM/9-245-----------------------------------------------------------------------FRS----.L
B1VSN1_STRGG/14-249-----------------------------------------------------------------------LKH----.L
B4RBF1_PHEZH/10-242-----------------------------------------------------------------------FRK----.L
B5HHA0_STRPR/15-253-----------------------------------------------------------------------LRE----.L
B5HRK0_9ACTO/12-259-----------------------------------------------------------------------FAE----.L
B5HVC7_9ACTO/7-239-----------------------------------------------------------------------FRA----.L
B6HSS2_PENCW/11-259-----------------------------------------------------------------------FRA----.L
B8MDA8_TALSN/5-285-----------------------------------------------------------------------IKS----VL
B9JNZ3_AGRRK/15-273-----------------------------------------------------------------------LRA----LL
B9K4D9_AGRVS/8-247-----------------------------------------------------------------------FRQ----.L
C0RYY1_PARBP/55-297-----------------------------------------------------------------------LRN----.L
C1D0L9_DEIDV/16-251-----------------------------------------------------------------------LLD----.L
D5UDN5_CELFN/12-253-----------------------------------------------------------------------LRS----.F
C5C673_BEUC1/6-244-----------------------------------------------------------------------FRR----.R
C5K5X0_PERM5/22-289-----------------------------------------------------------------------LRQ----LI
D9SPL5_CLOC7/7-255-----------------------------------------------------------------------LKK----LL
C6W6H2_DYAFD/19-261-----------------------------------------------------------------------LKK----.L
C7Q1F2_CATAD/16-252-----------------------------------------------------------------------FAS----.L
C7YUL0_NECH7/9-264-----------------------------------------------------------------------LKA----.L
C7YZU2_NECH7/391-674-----------------------------------------------------------------------IRA----AF
D6Z4R6_DESAT/153-411-----------------------------------------------------------------------LRR----LI
C9SRU6_VERA1/11-259-----------------------------------------------------------------------LKA----.L
D1A2J0_THECD/5-232-----------------------------------------------------------------------FGE----.L
D1BED0_SANKS/11-246-----------------------------------------------------------------------FAS----.L
D1BI43_SANKS/12-247-----------------------------------------------------------------------FRS----.L
D9TER7_MICAI/8-239-----------------------------------------------------------------------FRE----.L
E3J806_FRASU/10-249-----------------------------------------------------------------------FLA----.L
D2B1P9_STRRD/6-236-----------------------------------------------------------------------FRA----.L
E3I6J4_RHOVT/30-272-----------------------------------------------------------------------FRK----RL
D2PR97_KRIFD/29-269-----------------------------------------------------------------------LRA----.L
D2Q3B1_KRIFD/7-234-----------------------------------------------------------------------FRA----.L
D2Q4L3_KRIFD/4-243-----------------------------------------------------------------------FRD----.L
D3EII1_GEOS4/13-252-----------------------------------------------------------------------FKK----.L
D3V3K7_XENBS/39-278-----------------------------------------------------------------------FRQ----.L
D4AZN8_ARTBC/10-268-----------------------------------------------------------------------LRS----.L
D4LCE5_RUMC1/6-261-----------------------------------------------------------------------LGS----LL
Q01YZ5_SOLUE/12-251-----------------------------------------------------------------------FRA----.L
Q08U27_STIAD/11-246-----------------------------------------------------------------------FRA----.L
Q0BYP5_HYPNA/11-255-----------------------------------------------------------------------FAS----.L
Q0RPX9_FRAAA/13-247-----------------------------------------------------------------------FRE----.L
Q12Q29_SHEDO/14-259-----------------------------------------------------------------------LKD----IL
Q1GKC0_RUEST/10-253-----------------------------------------------------------------------FAA----.L
Q1GQT2_SPHAL/9-246-----------------------------------------------------------------------FRA----.L
Q28RZ5_JANSC/10-249-----------------------------------------------------------------------FAR----.L
Q2JAX2_FRASC/15-255-----------------------------------------------------------------------FRE----.L
Q4DNR3_TRYCC/14-261-----------------------------------------------------------------------LKS----ML
Q4KET5_PSEF5/11-270-----------------------------------------------------------------------LSQ----LL
Q5E5F2_VIBF1/18-278-----------------------------------------------------------------------LIN----VI
Q5LNA0_RUEPO/10-253-----------------------------------------------------------------------FAA----.L
Q5LUG9_RUEPO/10-245-----------------------------------------------------------------------FRT----.L
Q5WBL4_BACSK/19-257-----------------------------------------------------------------------FRC----.L
Q65ND9_BACLD/10-248-----------------------------------------------------------------------FLD----.L
Q7NXV8_CHRVO/33-277-----------------------------------------------------------------------FRR----.L
Q7P124_CHRVO/3-243-----------------------------------------------------------------------FAQ----.L
Q893V9_CLOTE/153-411-----------------------------------------------------------------------LRQ----LL
Q8EI00_SHEON/9-240-----------------------------------------------------------------------FKA----.L
A6TFP2_KLEP7/3-236-----------------------------------------------------------------------FNA----.L
G2J0B0_PSEUL/10-251-----------------------------------------------------------------------FKE----.L
G8PVS4_PSEUV/10-253-----------------------------------------------------------------------FAA----.L
G9AK98_PANAN/3-261-----------------------------------------------------------------------.KK----.L
Y1998_MYCTU/3-229-----------------------------------------------------------------------FHD----.L
Q2IK57_ANADE/11-247-----------------------------------------------------------------------FRA----.L
Q2KD40_RHIEC/10-252-----------------------------------------------------------------------FGA----.L
Q63MP0_BURPS/20-277-----------------------------------------------------------------------FKE----KL
Q8F693_LEPIN/12-250-----------------------------------------------------------------------FRS----.L
Q8YAP2_LISMO/8-250-----------------------------------------------------------------------LKS----.L
Q98AR7_RHILO/15-259-----------------------------------------------------------------------.RR----.M
R5T8T3_9CLOT/12-269-----------------------------------------------------------------------...----..
R5TTB9_9CLOT/13-246-----------------------------------------------------------------------...----..

PF09370

I0GM51_SELRL/8-273----------------------------------------------------------------------DILA----GL
A8MIW7_ALKOO/5-271----------------------------------------------------------------------EILA----NF
U5RTA7_9CLOT/8-273----------------------------------------------------------------------EIIA----GF
D3EFW8_GEOS4/8-274----------------------------------------------------------------------EVLA----KL
A0Q268_CLONN/3-268----------------------------------------------------------------------DILD----KL
I0GM52_SELRL/9-273----------------------------------------------------------------------.ILR----RL
R5TZH9_9CLOT/6-271----------------------------------------------------------------------EILK----RL
A5I210_CLOBH/5-270----------------------------------------------------------------------KILE----NL
B2TMB2_CLOBB/6-270----------------------------------------------------------------------EIIK----NL
E3GQA3_EUBLK/6-271----------------------------------------------------------------------AFLE----KL
D3EFX0_GEOS4/19-284----------------------------------------------------------------------QVLD----RL
K8END7_CARML/5-271----------------------------------------------------------------------KITK----KI
E3DLS5_HALPG/3-268----------------------------------------------------------------------.IQN----RI
Q893M0_CLOTE/5-270----------------------------------------------------------------------VILK----TM
H6LDM1_ACEWD/6-271----------------------------------------------------------------------AIEK----MI
G8AJD8_AZOBR/12-277----------------------------------------------------------------------QLLD----DL
Q981G5_RHILO/24-290----------------------------------------------------------------------EIVA----GL
H7C7V3_BRADU/40-302----------------------------------------------------------------------....----GI
L0D7P4_SINAD/6-270----------------------------------------------------------------------....----KL
B2JXP4_BURP8/9-270----------------------------------------------------------------------.IRD----GL
K4LCM9_THEPS/9-273----------------------------------------------------------------------QVLE----RL
Q0RZM6_RHOSR/7-274----------------------------------------------------------------------QVVD----RL
K4LRH4_THEPS/9-277----------------------------------------------------------------------EVLK----RL
D6DGJ5_CLOSC/7-273----------------------------------------------------------------------EILR----RL
A4FLF5_SACEN/6-272----------------------------------------------------------------------EIVR----RL
G7V878_THELD/7-273----------------------------------------------------------------------EILE----KL
I0HWG9_RUBGI/8-274----------------------------------------------------------------------QILD----TF
Y4OV_RHISN/14-280----------------------------------------------------------------------ELID----RF
Q92YY4_RHIME/8-274----------------------------------------------------------------------TILE----KF
D5BMI1_PUNMI/9-274----------------------------------------------------------------------SILK----RL
E3HW38_ACHXA/8-274----------------------------------------------------------------------ELLD----KY
I3TKL1_TISMK/9-274----------------------------------------------------------------------.LMD----RF
J7TQW5_MORMO/8-273----------------------------------------------------------------------.LLK----KF
Q2RQL8_RHORT/9-274----------------------------------------------------------------------.LLE----TF
Q89PU9_BRADU/9-274----------------------------------------------------------------------.LLR----RF
D3VIG2_XENNA/6-272----------------------------------------------------------------------QIIK----DI
Q7N7U1_PHOLL/7-273----------------------------------------------------------------------QIIE----TL
L0D8C0_SINAD/27-292----------------------------------------------------------------------EIVK----QL
Q7UK17_RHOBA/15-279----------------------------------------------------------------------SILS----GF
B2ATL3_PODAN/9-281----------------------------------------------------------------------EILH----RL
M7SDL1_EUTLA/15-281----------------------------------------------------------------------EALE----AL
G9MDH1_HYPVG/9-275----------------------------------------------------------------------KILA----SL
T5ADJ6_OPHSC/10-273----------------------------------------------------------------------.ILA----NL
M1WHF6_CLAP2/9-277----------------------------------------------------------------------DIVA----KL
M2T3U4_COCSN/9-275----------------------------------------------------------------------SILE----NL
C8VLH6_EMENI/9-275----------------------------------------------------------------------EILS----RL
E9F7B6_METAR/5-271----------------------------------------------------------------------EIIQ----RL
J4W7A5_BEAB2/10-276----------------------------------------------------------------------EILE----RL
F9X0V4_MYCGM/9-275----------------------------------------------------------------------QILS----GF
N1PYG8_MYCP1/9-275----------------------------------------------------------------------QILD----TF
B8LW35_TALSN/9-275----------------------------------------------------------------------EILA----RL
C5GK37_AJEDR/9-275----------------------------------------------------------------------EVLQ----RL
B8NIT8_ASPFN/9-275----------------------------------------------------------------------EVLD----RL
S7ZNB6_PENO1/9-275----------------------------------------------------------------------EVLA----RL
H6C7I3_EXODN/9-275----------------------------------------------------------------------EVLS----HL
M7TTH7_BOTF1/10-275----------------------------------------------------------------------.VLG----RL
J4G6Y7_FIBRA/9-275----------------------------------------------------------------------EALQ----HL
M2QNQ6_CERS8/9-277----------------------------------------------------------------------ETLA----QL
F8Q7T4_SERL3/8-272----------------------------------------------------------------------..LK----HL
D7SP84_VITVI/487-753----------------------------------------------------------------------SIIQ----RL
K3XVH5_SETIT/468-734----------------------------------------------------------------------SILN----KL
D8R7X4_SELML/473-739----------------------------------------------------------------------TILA----NL
R9NXA1_PSEHS/13-279----------------------------------------------------------------------EAVE----RL
U4LH42_PYROM/9-281----------------------------------------------------------------------EALA----RL
A5UWZ1_ROSS1/7-273----------------------------------------------------------------------EILQ----RL
B9L5F1_THERP/10-276----------------------------------------------------------------------EALA----KL
I4EWM7_MODMB/6-271----------------------------------------------------------------------.ARQ----RL
C5C4B4_BEUC1/7-272----------------------------------------------------------------------ELLD----RL
L0DC12_SINAD/11-276----------------------------------------------------------------------EILD----RF
B5Y6G1_COPPD/8-273----------------------------------------------------------------------.ALE----RL
I4BU20_ANAMD/8-273----------------------------------------------------------------------EALK----KL
Q5UWI2_HALMA/21-288----------------------------------------------------------------------.SLL----RL
D2R8M3_PIRSD/8-274----------------------------------------------------------------------EILL----RL
G8XHR5_STREN/101-367----------------------------------------------------------------------DVLR----RL
K7SG60_PROA4/5-271----------------------------------------------------------------------EILD----RF
X4REF3_9ACTO/5-271----------------------------------------------------------------------TILE----RL
B2A8A0_NATTJ/6-272----------------------------------------------------------------------DILK----HI
E4RLZ6_HALHG/7-273----------------------------------------------------------------------EVRE----KL
Q893M3_CLOTE/7-273----------------------------------------------------------------------QIYE----NL
H6LDL9_ACEWD/7-273----------------------------------------------------------------------EVLR----RL
R6I4I1_9ACTN/8-274----------------------------------------------------------------------EILD----RF

PF15617

A0A018UEH6_SALET/4-300GATL---------------------------------YMP---ATRED--------IADAVLH-----GKI---------
D5CKQ7_ENTCC/4-300GATL---------------------------------YMP---ATRED--------IADAVLH-----GKI---------
A0A023YEE1_ECOLX/4-300GATL---------------------------------YMP---ATRED--------IADAVLH-----GKI---------
A7MPV2_CROS8/4-300GATL---------------------------------YMP---ATRED--------IADAVLN-----GKI---------
C4XDI3_KLEPN/4-300GATL---------------------------------YMP---ATRKD--------IAEVVLE-----GKI---------
B5RKC3_KLEP3/4-300GATL---------------------------------YMP---ATRKD--------IAEVVLE-----GKI---------
D0KLU5_PECWW/4-299GATL---------------------------------YMP---ATRTD--------IADVILT-----DKI---------
B4EW80_PROMH/4-300GATL---------------------------------YMP---ATRTD--------IAATIID-----QKI---------
D3V2D7_XENBS/4-302GATL---------------------------------YIP---ATRQG--------IAEIVLH-----NKI---------
A0A014LRW3_YERPE/4-300GATL---------------------------------YMP---ATRTD--------IADIIIH-----NKI---------
B1JNG5_YERPY/4-300GATL---------------------------------YMP---ATRTD--------IADIIIH-----NKI---------
E1PL56_PANVC/4-300GATL---------------------------------YMP---ATRTD--------LAEVILH-----GKI---------
D3VJW5_XENNA/4-307GATL---------------------------------YMP---ATRQD--------IAEIVLQ-----NKI---------
E2MHA5_PSEUB/3-297GATL---------------------------------YMP---ATRDD--------IVDVVFG-----EKI---------
Q4ZYA8_PSEU2/3-297GATL---------------------------------YMP---ATRDD--------IVDVVFG-----EKI---------
F3K7E7_PSESZ/3-297GATL---------------------------------YMP---ATRDD--------IVDVVFG-----EKI---------
Q39AX0_BURS3/4-298GATL---------------------------------YMP---ATRSD--------ILEVVSG-----ARI---------
N9BC11_ACIBI/1-291GATL---------------------------------YIP---ATRPD--------LWPIVTG-----EKY---------
A5WBK4_PSYWF/17-339GASL---------------------------------YMP---ATRED--------IWAVISR-----SKL---------
Q4FTQ0_PSYA2/59-368GASL---------------------------------YMP---ATRQD--------IWQVIKR-----DKL---------
Q5NWT6_AROAE/1-291GASL---------------------------------YLP---ATRLD--------LLEVVRG-----ERL---------
D3RPA3_ALLVD/1-291GGSL---------------------------------YVP---VTHRD--------VLRIANG-----LKW---------
Q1QCR8_PSYCK/1-315GASL---------------------------------YMP---ATRQD--------IWQVIKR-----DKL---------
B6C0F8_9GAMM/22-310GATL---------------------------------YMP---ATRKD--------IARVLNQ-----QKL---------
A1VWQ0_POLNA/1-291GASL---------------------------------YVP---ATHKD--------LSQIANG-----CLL---------
G2TCW8_RHORU/5-292GASL---------------------------------YVP---ATRSD--------LAAIANG-----HRH---------
Q9RSA7_DEIRA/8-299GASL---------------------------------YAP---ATRPD--------LVALGSG-----.KH---------
D5BYR3_NITHN/21-309GATL---------------------------------YMP---ATRQD--------VGKILNQ-----QKL---------
D8K7I6_NITWC/22-310GATL---------------------------------YMP---ATRKD--------IARILNQ-----QKL---------
E8U9R3_DEIML/2-291GASL---------------------------------YIP---ATRDD--------LTDLVSG-----AKP---------
A8MM95_ALKOO/30-358GATL---------------------------------YMP---GIRDR--------IGEDIVH-----GRI---------
Q891X5_CLOTE/30-379GATL---------------------------------YMP---GVRDD--------IFEIIYK-----NKY---------
A8F9P5_BACP2/30-369GSTL---------------------------------YMP---ATRED--------IADMLLS-----QKY---------
C9RML9_FIBSS/26-364GATM---------------------------------YMP---GTK.D--------FAQAIID-----KKY---------
E3IYR0_FRASU/30-378GATL---------------------------------YAP---GTRPK--------LADDVRR-----QSA---------
Q9KY27_STRCO/30-371GATL---------------------------------YSP---ATRPS--------LADDILK-----QSA---------
E3DTS5_BACA1/30-361GAVL---------------------------------YMP---ATRHD--------IEAVITN-----QKY---------
Q5YN23_NOCFA/30-368GATL---------------------------------YAP---ATRAD--------LADTIRR-----RAE---------
B1HUS4_LYSSC/26-371GATL---------------------------------YMP---ASMPN--------IVGLIQS-----QKY---------
F2JGK5_CELLD/30-375GATL---------------------------------YIP---AIHEK--------LYDYLVT-----RKY---------
I0UNS1_BACLI/30-368GAAL---------------------------------YVP---GNRKD--------IADVIIN-----NKY---------
D1BEK0_SANKS/30-368GATL---------------------------------YSP---GTRPN--------LAADIAK-----RAA---------
D1A9P4_THECD/30-368GATL---------------------------------YSP---ATRPT--------LAHDIVK-----AVR---------
C9ZE12_STRSW/30-371GATL---------------------------------YSP---ATRER--------LADDVVK-----QAG---------
F4H5N5_CELFA/32-371GATL---------------------------------YMP---GTRPR--------LAHDLAR-----QAA---------
B7HBK1_BACC4/30-348GATL---------------------------------YTP---GTKET--------IAEDIIR-----KKH---------
A0A011W6K7_BACTI/30-348GATL---------------------------------YTP---GTKET--------IAEDIIR-----KKH---------
C8W644_DESAS/30-371GATL---------------------------------YMP---GSSIQ--------AVNKLIE-----NKI---------
Q82B97_STRAW/30-370GATL---------------------------------YSP---ATRPQ--------LADDVVK-----QAG---------
Q0SDY5_RHOSR/44-383GATL---------------------------------YVP---ATRSD--------LADTILR-----RSG---------
Q72YD0_BACC1/30-348GATL---------------------------------YTP---GTKET--------IAEDIIR-----KKH---------
C1B1Z6_RHOOB/52-391GATL---------------------------------YVP---ATRSD--------LADTILR-----RSA---------
A4J1D5_DESRM/16-360GATL---------------------------------YMP---GTANR--------AIDKVIN-----NEI---------
C0ZNQ3_RHOE4/41-379GATL---------------------------------YVP---ATRAG--------LADIVVK-----RAS---------
C0Z9Y5_BREBN/30-378GATL---------------------------------YMP---AIRTT--------ISHDVMT-----QKH---------
Q186J7_PEPD6/30-345GAFL---------------------------------YVP---ATQYN--------MIYKSII-----GDV---------
E3EE66_PAEPS/10-368GAAL---------------------------------YMP---ATRLE--------VAEEIKN-----GKH---------
F4D0A7_PSEUX/30-375GATL---------------------------------YMP---GDRPA--------LAADIAK-----QAT---------
E6UGJ0_RUMA7/26-367GATM---------------------------------YMP---GTK.D--------FTPKILS-----GAM---------
D0L8D1_GORB4/35-372GATL---------------------------------YVP---GTRPD--------LADTITH-----RHA---------
B1VYI2_STRGG/30-395GATL---------------------------------YSP---ATRPS--------LADDVLK-----QAA---------
C9XQK5_PEPDC/30-345GAFL---------------------------------YVP---ATQYN--------MIYKSII-----GDV---------
F4EXE4_SELS3/15-331GGLL---------------------------------YMP---AYQEN--------IVEKIRR-----QKN---------
C8XAU7_NAKMY/30-369GATL---------------------------------YVP---ATRSD--------LATTVRR-----RAA---------
A8L403_FRASN/30-378GATL---------------------------------YAP---GTRPR--------LASDVRR-----QVA---------
A6WD82_KINRD/30-375GATL---------------------------------YCP---ATRER--------LAGDLLR-----LAR---------
Q0RDF4_FRAAA/30-378GATL---------------------------------YAP---GTRPH--------LAFDVRR-----QTA---------
A2RKY2_LACLM/29-388GASI---------------------------------YCP---LDSDN--------VIERLKK-----LEK---------
Q2J6S0_FRASC/45-393GATL---------------------------------YAP---GTRPR--------LASDVCR-----QTA---------
E3PRQ7_CLOSD/30-367GATL---------------------------------YLP---ATK.Y--------IAPYLLE-----KRY---------

PF00463

ACEA_EMENI/14-536TKRP---------------------------------FTAEQIVAKRG--------NLK.IEY-----PSN---------
ACEA_YEAST/22-550TKRN---------------------------------YSARDIAVRRG--------TFPPIEY-----PSS---------
ACEA1_SOYBN/3-534TKRP---------------------------------YTARDVVSLRG--------NLR.QTY-----ASN---------
ACEA_YARLI/10-536TKRV---------------------------------YSPEDIASRRG--------TIK.VPQ-----ASS---------
ACEA_NEUCR/23-547TKRP---------------------------------FTAEQIVSKRG--------NLK.IEY-----ASN---------
C5MF59_CANTT/18-543TKRI---------------------------------YSAEDIAKKRG--------SLK.ISY-----PSS---------

PF00311

C7M9P2_BRAFD/148-942REEL....RAHGANLRDDQ...........VPLRFGSWIG---GDRDGNPFVTAQVTREVLKL-----QAE---------
CAPP_ACTP2/128-879NFQL....EKHFD.VQYEV.........ALSPVRFSSWMG---GDRDGNPFVTAEITQKVLRM-----NRW---------
A0ZJ69_NODSP/196-1034KYAL....GKTFTWLEPPH..........KNFCSFGSWVG---SDRDGNPSVTPEITWQTACY-----QRK---------
D3VH32_XENNA/127-879NEQL....EESIG.YSLPV.........EAVPVRFTSWMG---GDRDGNPNVTADITRHVLLL-----SRW---------
Q2KZS8_BORA1/137-936SKLLR..PESSFSAAPEPL..........VPFLRMGSWIG---GDRDGNPNVDAGTLELAMLR-----QAA---------
D2QW47_PIRSD/157-942RLAL....DTHYPGEGIRP..........GLFLRFGSWMG---GDRDGNPNVTAPITKQTLVW-----LRE---------
A5GVT4_SYNR3/167-992RKAL....KDSYPDVTPPE..........DGFCTFGSWVG---SDRDGNPSVTPEITWRTACY-----QRQ---------
C6D470_PAESJ/147-936ERNL....TKYYPGESWHV..........PSYLRFGSWIG---GDRDGNPSVTAKVTWETLTL-----NRQ---------
B8HVC9_CYAP4/199-1018TQSL....QQSFPNLRPPR..........HNFCKFGSWVG---ADRDGNPSVTPEVTWETACY-----QRD---------
C1F4Y2_ACIC5/161-947SAAL....ASEYGLTLDAAS........LPLMLGFGSWIG---GDRDGNPFVTPQVTREAIHE-----ART---------
CAPP_SYNY3/193-1034GQAI....KETFPHLRAPR..........ANFCYFGSWVG---GDRDGNPSVTPEVTWQTACY-----QRG---------
B1XMB9_SYNP2/163-995QQAL....KASFPTLKVPT..........TNFCNFGSWVG---GDRDGNPSVTPDVTWKTACY-----QRG---------
A4S610_OSTLU/183-1007DTSL....LANGC.PRLPL.........DRSIVTFGSWMG---GDRDGNPYVTASCTRDVVLL-----ARV---------
A9RUR8_PHYPA/162-969DTAL....KSIGVKERLPH.........NVKLIHFSSWMG---GDRDGNPRVTPEVTRDVCLL-----ARL---------
B8GNA5_THISH/143-947EKAI....RRTYGNDEAGNPR.....VRVPSFLRFGSWIG---GDRDGNPNVTPAVTELACRL-----AME---------
CAPP_HAHCH/132-881DAAL....LERFG.EGLPI.........NVNPVRFASWMG---GDRDGNPNVTSEVTREVFLL-----SRW---------
B1Y159_LEPCP/163-950EQAL........PGHDIGN............FFRMGNWIG---GDRDGNPFVTADTLKLALSR-----QSE---------
CAPP_THEEB/197-1011EQSL....HETFPALQPPR..........HRFCRFGSWVG---GDRDGNPYVKPEVTWQTACY-----QRN---------
A9S2G6_PHYPA/161-965DTAL....KAIGVEERLPY.........DVPLIQFSSWMG---GDRDGNPRVTPEVTRDVCLL-----ARL---------
Q54JZ3_DICDI/144-931NRCC....VKYLG.KELPP.........TFANIHVASWVG---GDRDGNHNVTAEVTRQVSYF-----SRW---------
C1MJ77_MICPC/164-991DTAL....INQGL.PRIPL.........DKSIMKFSSWMG---GDRDGNPNVDSHCTKDAVYL-----ARS---------
E0UJ33_CYAP2/184-1020KRTL....KSAFPRLRPPK..........NNFCYFGSWVG---GDRDGNPFVTPEVTWATACY-----QRN---------
A5WCX5_PSYWF/133-932KNAI....VDVYPELSDYA.........LPAFLSFGSWIG---GDRDGNPFVTHETTEMAVLL-----HAN---------
A0JSJ3_ARTS2/161-954SELL....GEHGVTLPSQK...........APIRFGSWIG---GDRDGNPNVTAGVTREILQI-----QNQ---------
B7G725_PHATC/84-877DQQC....RLTLG.QSLPV.........DVCPIKFASWIG---GDRDGNPNVTPEVTREVVLQ-----QRL---------
CAPP_GLOVI/141-939VRCL....DMFHPSLTRSL..........GTFCRFGSWVG---SDRDGNPSVNALVTWKTACH-----QRS---------
C5Z450_SORBI/157-961DTAL....KNIGINERLPY.........DVPLIKFCSWMG---GDRDGNPRVTPEVTRDVCLL-----SRM---------
D1CE74_THET1/138-931SDAL....KSVYKDWNFQI..........PPVIQFGTWMG---GDRDGNPNVTPEVTIRTARL-----QKG---------
Q117S5_TRIEI/186-1038KQAL....HSSFPYLKPPS..........YNFCKFGSWVG---SDRDGNPFCTPAVTWQTACY-----QRQ---------
C1AE63_GEMAT/147-933EDLL....SAQFPGSTWQL..........TPFLQPGSWIG---GDRDGNPFVTADVLHETLRL-----QAS---------
A9QPD2_METI4/151-931QRVL....DIYYPGVTLKP...........KWISFGSWIG---GDRDGNFQVTTKTTATTFIL-----QRN---------
B0BZ90_ACAM1/184-1012SLNL....KQAFPKLQPPR..........YNFCKFGSWVG---SDRDGNPAVTPDITWQTSCY-----QRN---------
A4X3B0_SALTO/171-972ADTL....RTLGVETSPTA...........RPLTFGTWIG---GDRDGNPFVTPTVTREVLAI-----AHE---------
E3JCU0_FRASU/173-968DGAL....AQVGAGLPITA...........RPLRFGTWAG---GDRDGNPNVTPTVTLDVLTL-----QHE---------
Q2JKJ2_SYNJB/177-978SRSL....KKAFPSVEPPP..........AGFCNFGSWVG---GDRDGNPSVTADVTWQTARY-----QRN---------
A9IDM8_BORPD/139-951SRLLGRDSAKPFAAPPAPL..........EPFLRMGSWIG---GDRDGNPNVDASTLELALLR-----QAT---------
A4G3V1_HERAR/147-944ESEI....AERFPQRASSASR......EQPLYIQMGSWIG---GDRDGNPNVNGDTMQLALAR-----QST---------
C1DZM5_MICSR/162-982DSAL....INQGL.PRIPM.........EHSIMRFSSWMG---GDRDGNPFVTATCTRDVVYL-----ARI---------
D3EKG0_GEOS4/142-928ERCL....TKYYPGHHWHV..........PTYLRFGSWIG---GDRDGNPSVTADVTWRTLEM-----QRK---------
B1VUI2_STRGG/125-909AAEL....ERVGVELPAGT...........RPLTFGTWIG---GDRDGNPNVTPAVTWDVLIL-----QHE---------
CAPP_SYNPW/180-1003SSAL....ASSYPDVQLPP..........SSFCTFGSWVG---SDRDGNPSVTTDITWRTACY-----QRQ---------
B0JPY0_MICAN/183-1018QQSL....QSSFPRLQAPK..........NNFCRFGSWVG---GDRDGNPSVTPEVTWKTCCY-----QRN---------
B1WNZ1_CYAA5/187-1020QQAL....KANFPRIKPPH..........NTFCRFGSWVG---GDRDGNPFVTPEVTWRTACY-----QRN---------
C8WQK0_ALIAD/133-906EQAV....EEQFGRQLLEL..........PPLIRFGSWMG---GDRDGNPNVTSDITWQTLVL-----HCD---------
D4ZQG2_ARTPN/196-1035KQTL....QPHFPHLKPPN..........YDFCKFGSWVG---ADRDGNPSVTPEVTWKTACY-----QRG---------
M1FKU6_9ALTE/130-889DTAL....VEATGKGLPLQ..........ATPVRVASWMG---GDRDGNPNVTHQVTREVFLL-----GRW---------
CAPP_ECOLI/129-883NEQL....EENLG.YKLPV.........EFVPVRFTSWMG---GDRDGNPNVTADITRHVLLL-----SRW---------
CAPP_HAEIN/129-879NETA....REFLG.YDLSV.........GLKPVRISSWMG---GDRDGNPFVTAQITKKVLYF-----ARW---------
Q0K7M4_CUPNH/207-1012EEDI....AAVFPTTRKRKGTPGAQPAPLAPFLQMGSWIG---GDRDGNPNVTAETLEHAASQ-----QGQ---------
Q31KY7_SYNE7/201-1017RLAL....QGTFPDLQPPR..........YNFCQFGSWVG---SDRDGNPSVTSAVTWQTACY-----QRS---------
Q46IP1_PROMT/168-994TTAL....ASSYPDVEIPN..........EAFCTFGSWVG---SDRDGNPSVTPEITWRTACY-----QRQ---------
CAPP_PROMP/165-989SSAL....TENYPDVQMPT..........ESFCTFGSWVG---SDRDGNPSVTPEITWRTACY-----QRQ---------
CAPP_VIBPA/129-877NDRL....KSYLG.EGLPI.........DARPVHFSSWMG---GDRDGNPFVTHSVTREVLLL-----SRW---------
CAPP_SHEON/129-881NDQV....QERTG.QQLPI.........DIAPVRFSSWMG---GDRDGNPFVTAKVTQEVLDR-----NRH---------
U5GXD4_POPTR/166-968DTAL....KNIGINERVPY.........NAPLIQFSSWMG---GDRDGNPRVTPEVTRDVCLL-----ARM---------

PF02896

PPDK1_MAIZE/589-947GTFM--------------------------------AWVD---DVRK---------LKVLANA-----DTP---------
PT1_STACT/251-543RDAE--------------------------------SVTA---DGHH---------VELAANI-----GTP---------
PT1_CUPNH/262-557RHTP--------------------------------AVTL---DGLE---------IDLLANI-----EMA---------
PT1_ECOLI/250-542KDLP--------------------------------AITL---DGHQ---------VEVCANI-----GTV---------
PT1_HAEIN/250-542KDLP--------------------------------AITL---DGHK---------VDVVANI-----GTI---------
PT1P_ECOLI/416-708VNLP--------------------------------AQLK---SGER---------IKVMLNA-----GLS---------
PPSA_PYRFU/496-796VVAG--------------------------------APLV---TGTM---------VKV..NV-----SMP---------
PTFAX_XANCP/521-808RALP--------------------------------AETT---DGHH---------IDIGANV-----NLP---------
PT1_STRMU/252-546KDAE--------------------------------TVTA---DGKH---------FELAANI-----GTP---------
PTFX2_ECOLI/362-654LTQQ--------------------------------ARTA---DGIR---------IEIAANI-----AHS---------
PPSA_STAMF/504-813PEQL--------------------------------LPLY---PVTA---------TKIYMNL-----GEP---------
D5AMJ7_RHOCB/521-803RYKP--------------------------------ALTV---DGAR---------VEVVANI-----SDV---------
Q24801_ENTHI/517-878GTIL--------------------------------KWAN---EIKK---------IGVFANA-----DLP---------
Q5L199_GEOKA/251-541VDQP--------------------------------TVTA---DGVH---------VELAANI-----GTP---------
Q6MTX2_MYCMS/252-540KDKP--------------------------------SLTK---DKIK---------KLIEANI-----GST---------

PF02548

C8XKD1_NAKMY/14-272FELK--------------------------------------------------------RAG.....RKI---------
A7HMC7_FERNB/3-256IDMK--------------------------------------------------------GK......EPI---------
PANB_NITMU/2-259QKMR--------------------------------------------------------DDG.....EKI---------
E3I2N4_RHOVT/9-264RAKK--------------------------------------------------------..G....GDKI---------
PANB_THEFY/18-275AAAK--------------------------------------------------------ERG.....ERW---------
F0NZT0_WEEVC/9-267RKMK--------------------------------------------------------FSG.....EKI---------
C5DYQ5_ZYGRC/31-296HEKY--------------------------------------------------------LKG.....IPI---------
D8RYD4_SELML/4-266QSKY--------------------------------------------------------ARK.....EPI---------
S9W2M7_SCHCR/5-262RQWK--------------------------------------------------------LAK.....EKF---------
D2PXN9_KRIFD/534-791RDLK--------------------------------------------------------NRG.....EKW---------
H1Z987_MYROD/10-268IDMK--------------------------------------------------------ANG.....EKI---------
C5BN63_TERTT/12-267QAMK--------------------------------------------------------DRC.....EKF---------
A8LKB6_DINSH/13-268AARK--------------------------------------------------------..G....AEPI---------
D7BNG1_ARCHD/5-260AQMK--------------------------------------------------------AEG.....TPI---------
D7A714_STAND/9-264RAKK--------------------------------------------------------..G....GEPI---------
PANB_BORPD/9-265RQAK--------------------------------------------------------..G....PGKV---------
PANB_MAGSA/9-265RARK--------------------------------------------------------..G....AEPL---------
E8RFZ1_DESPD/5-262RNRK--------------------------------------------------------NG......TPI---------
PANB_PROMA/4-255VRFK--------------------------------------------------------ELG.....NQI---------
K9RVA1_SYNP3/11-268QHWK--------------------------------------------------------QQG.....RPI---------
D5WZ20_THIK1/22-279RAMR--------------------------------------------------------EAG.....EKI---------
B8LYN4_TALSN/78-338RNMY--------------------------------------------------------KKN.....EPI---------
K9RDA0_9CYAN/11-264IQYK--------------------------------------------------------QQQ.....RPI---------
PANB_METRJ/10-267GKRK--------------------------------------------------------AEG.....RKI---------
A9UP51_MONBE/1-268KRKR--------------------------------------------------------RQG.....EPI---------
PANB_PROA2/11-273HDMK--------------------------------------------------------SEG.....EKI---------
F2UAL1_SALR5/62-329HAAY--------------------------------------------------------AQG.....TPL---------
V2XXG0_MONRO/40-299QAMK--------------------------------------------------------TKK.....TPI---------
G2IQV3_9SPHN/23-282RARK--------------------------------------------------------ADG..ETAEPL---------
PANB_CLONN/2-260QKAK--------------------------------------------------------NNG.....EKL---------
PANB_WIGBR/3-260YKLK--------------------------------------------------------EQN.....KKF---------
M1FDT2_9ALTE/4-264QQMK--------------------------------------------------------KSG.....DKI---------
E4TII1_CALNY/9-264KNMK--------------------------------------------------------HK......EKI---------
K0I9Q1_NITGG/2-255VAMK--------------------------------------------------------GM......EKI---------
C7MD29_BRAFD/11-267QQAK--------------------------------------------------------VEG.....RPF---------
G8PQN3_PSEUV/9-264MKAK--------------------------------------------------------..G....HHKL---------
PANB_LEPCP/16-279RAMQ--------------------------------------------------------QRG.....EKI---------
K1VYW4_TRIAC/1535-1794QKQY--------------------------------------------------------ASG.....TPI---------
B8I2Z4_CLOCE/9-266QNQK--------------------------------------------------------RNG.....DKI---------
I0AFM0_IGNAJ/3-258QKKK--------------------------------------------------------QLN.....IPI---------
I4CAV2_DESTA/3-261REKK--------------------------------------------------------ARK.....EPM---------
PANB_SULDN/4-259KKSK--------------------------------------------------------GV......HPL---------
S8DNJ0_FOMPI/15-274HAMK--------------------------------------------------------KNR.....TPI---------
PANB_METCA/5-260LAMK--------------------------------------------------------RRG.....EKI---------
F3YUG3_DESAF/5-260ASRK--------------------------------------------------------GG......ERL---------
PANB_SYNAS/9-267RGMK--------------------------------------------------------KKG.....EKI---------
C7LVL7_DESBD/2-259LQMK--------------------------------------------------------KNG.....EKI---------
PANB_NOCSJ/34-291REMK--------------------------------------------------------QRG.....EKF---------
F0SK13_PLABD/3-257VAAK--------------------------------------------------------GQ......KKL---------
I0DRD2_PROSM/4-258GQFK--------------------------------------------------------KDK.....HKF---------
D3E7N3_GEOS4/7-265KNMK--------------------------------------------------------KKG.....VPI---------
G7EAQ5_MIXOS/98-357AKAK--------------------------------------------------------ERE.....EPI---------
R7GY01_9FIRM/2-260QQQK--------------------------------------------------------QSG.....DKI---------
U9SMK5_RHIID/19-277QKLY--------------------------------------------------------KSK.....EPI---------
R5GD14_9BACT/11-269KEMK--------------------------------------------------------EQG.....RRI---------
R1GLQ8_BOTPV/11-271HSLH--------------------------------------------------------RKN.....EPI---------
PANB_DESAH/4-258FKMK--------------------------------------------------------QEG.....KRI---------
PANB_DEIDV/5-258LQSE--------------------------------------------------------........QPL---------
S6CEI7_9ACTN/2-260LKMK--------------------------------------------------------AEG.....KKI---------
R5KEY8_9CLOT/2-260QKAK--------------------------------------------------------QEG.....RKI---------
K0SSA9_THAOC/101-366RAKK--------------------------------------------------------RRN.....QKI---------
C6XKS3_HIRBI/9-264AKAK--------------------------------------------------------..G....ETPI---------
J9QSS2_RIEAN/9-267RKMK--------------------------------------------------------FSK.....EKI---------
S6BYU9_9GAMM/3-260ERMK--------------------------------------------------------GAG.....EKI---------
D0KZU6_HALNC/20-275QNAK--------------------------------------------------------RDQ.....TPI---------
W6RP24_9RHIZ/9-265RAMK--------------------------------------------------------..G....KDRV---------
G0W8X4_NAUDC/30-294QSKR--------------------------------------------------------SKD.....IPI---------
E5AM95_BURRH/11-268QQMR--------------------------------------------------------EAG.....EPI---------
I3TFJ1_THEC1/4-259IKKK--------------------------------------------------------GA......EKI---------
PANB_GRABC/9-265RARK--------------------------------------------------------..G....GTPI---------
G0GCR3_SPITZ/2-257LARK--------------------------------------------------------RQG.....KKI---------
G1XV43_ARTOA/82-342RKMY--------------------------------------------------------EKG.....EKI---------
D9Q2W0_ACIS3/6-261VNLK--------------------------------------------------------GK......KPI---------
B1ZVH1_OPITP/3-258AAAK--------------------------------------------------------AGG.....RKI---------
R7EXA6_9BACT/11-269VEMK--------------------------------------------------------QRG.....EKI---------
F6B538_DESCC/4-262RRMK--------------------------------------------------------QEG.....QPI---------
D5UZ54_ARCNC/10-265KKAK--------------------------------------------------------NI......KKL---------
U1GVM1_ENDPU/59-319RDLH--------------------------------------------------------RKK.....IPI---------
G2QRB2_THITE/68-328RALY--------------------------------------------------------KKG.....EPI---------
B7FR45_PHATC/3-276TSKR--------------------------------------------------------RHG.....KKI---------
PANB_THEEB/5-261QAKK--------------------------------------------------------ALG.....EPI---------
R7D6U7_9ACTN/3-263KKKV--------------------------------------------------------DEG.....GKV---------
E3GPR0_EUBLK/2-261RRMA--------------------------------------------------------AEG.....EKI---------
C1DI17_AZOVD/17-274KELK--------------------------------------------------------AQG.....RKW---------
A5VB06_SPHWW/22-276RAAK--------------------------------------------------------..G....KTPV---------
A4CLQ4_ROBBH/10-268VEMK--------------------------------------------------------QQG.....EKI---------
D5BTJ5_PUNMI/4-260TALK--------------------------------------------------------SE......RKI---------
C9RK32_FIBSS/3-246KAKK--------------------------------------------------------SKH.....EMI---------
C4LHZ4_CORK4/17-275DQFK--------------------------------------------------------RES.....KRW---------
M4X4T3_PSEDE/4-260QGLK--------------------------------------------------------QSG.....EKI---------
W8KF56_HALHR/9-265QGLR--------------------------------------------------------EQA.....EPI---------
G7V5R4_THELD/5-262MRMK--------------------------------------------------------QEK.....EPI---------
I3ZIP5_TERRK/17-275LQSK--------------------------------------------------------QAR.....TPI---------
S6AIG3_9PROT/2-259QKMA--------------------------------------------------------GSG.....EKI---------
C3AJQ5_BACMY/3-259LKMK--------------------------------------------------------EKG.....EPI---------
F3ZPG7_9BACE/11-269AEMK--------------------------------------------------------QNG.....EKI---------
PANB_AQUAE/2-260FKKK--------------------------------------------------------REG.....KKI---------
R7ALC5_9ACTN/29-287QEMK--------------------------------------------------------QKG.....EKI---------
U5N9B5_9BURK/27-288REMH--------------------------------------------------------TRR.....EAI---------
C6BVH5_DESAD/3-260TA.L--------------------------------------------------------KGQ.....RKI---------
C5KFU4_PERM5/79-341KKLH--------------------------------------------------------REG.....DKI---------
U5T1Y9_9GAMM/5-261RRMK--------------------------------------------------------TEQ.....SPI---------
F4H271_CELFA/7-264REAK--------------------------------------------------------TRG.....ERL---------
F8AZ74_FRADG/51-306QAAK--------------------------------------------------------DRG.....EKW---------
E4NQR1_HALBP/4-256REK.--------------------------------------------------------AGT.....TPI---------
C6VWE8_DYAFD/10-268QEMK--------------------------------------------------------NRG.....EKI---------
R5KSN9_9FIRM/2-260LQQK--------------------------------------------------------KDG.....NKI---------
PANB_NATPD/3-255RAK.--------------------------------------------------------AGD.....EPI---------
L0IYN2_MYCSM/17-274QKWK--------------------------------------------------------AEG.....HKW---------
PANB_CLOTH/4-262LESK--------------------------------------------------------KQG.....RKI---------
PANB_SPHAL/26-281RQRK--------------------------------------------------------..G....GEPI---------
I0A221_FERFK/7-263IKKK--------------------------------------------------------ELK.....EKI---------
T2GAB0_DESGI/5-261SARK--------------------------------------------------------GG......DPL---------
C6WXZ0_METML/2-266HEMA--------------------------------------------------------ASG.....EKI---------
F2IID2_FLUTR/9-267QEMK--------------------------------------------------------NSG.....AKI---------
D5BNG2_PUNMI/9-267LKKM--------------------------------------------------------EKG.....EPI---------
PANB_ARTAT/40-297QQAK--------------------------------------------------------DNG.....EHF---------
PANB_CARHZ/3-261KEMK--------------------------------------------------------EAG.....QKI---------
A4G8C6_HERAR/16-272FALR--------------------------------------------------------AKG.....EKI---------
E1QUY6_VULDI/5-260MSMK--------------------------------------------------------GK......QRI---------
M1M510_9PROT/12-263KNSK--------------------------------------------------------..G....KQKI---------
PANB_METFK/3-256QQMK--------------------------------------------------------ERG.....EKI---------
PANB_CHESB/10-264AKAK--------------------------------------------------------..G....KAPI---------
B6GXN5_PENCW/75-335QNMH--------------------------------------------------------KKG.....EPI---------
I0GU87_SELRL/2-260AKMK--------------------------------------------------------ANG.....EKI---------
R9AIM6_WALI9/451-714NKLK--------------------------------------------------------KQH.....MPI---------
R5BQ58_9FIRM/5-264KQMK--------------------------------------------------------EQG.....EPI---------
F8AC68_THEID/6-263IAKK--------------------------------------------------------GR......EKI---------
PANB_ALKEH/12-269QRMK--------------------------------------------------------ADG.....QKV---------
F8E6G1_FLESM/9-265KKMK--------------------------------------------------------AEG.....EKI---------
PANB_BORPE/9-264RMRT--------------------------------------------------------..P....DEPI---------
E1VL92_9GAMM/2-258NKIK--------------------------------------------------------SQG.....EKF---------
R6CEN3_9FIRM/2-260MSQK--------------------------------------------------------QSG.....EKI---------
PANB_LEPBP/4-261KKKY--------------------------------------------------------DAG.....EPI---------
D5MI67_9BACT/6-263QQMK--------------------------------------------------------REG.....RKI---------
G0EFC1_PYRF1/3-258LAKK--------------------------------------------------------GR......EPI---------
PANB_EXIS2/3-258LKKQ--------------------------------------------------------QAG.....EKL---------
I4BB70_TURPD/157-414TKKK--------------------------------------------------------LAG.....EKI---------
PANB_MARAV/2-258REYK--------------------------------------------------------QKG.....EAF---------
D8J2A6_HALJB/4-255R...--------------------------------------------------------AAD.....EPI---------
PANB_IGNH4/3-259MKKY--------------------------------------------------------KNG.....EKI---------
G4RJI6_THETK/5-260LNMK--------------------------------------------------------GR......EKI---------
K8GUE9_9CYAN/2-256VQWK--------------------------------------------------------QQG.....RPI---------
W6SJ04_9CLOT/2-259IEMK--------------------------------------------------------KRG.....EKI---------
D9SXD7_CLOC7/2-260KEMK--------------------------------------------------------ERK.....EKI---------
W5W0X3_9PSEU/35-292QELK--------------------------------------------------------DRG.....EPW---------
F7V601_CLOSS/2-260RKMK--------------------------------------------------------AAG.....DKI---------
PANB_SYNE7/2-256RQWK--------------------------------------------------------QQG.....RPI---------
I2GYS6_TETBL/22-285LRKY--------------------------------------------------------QQH.....VPI---------
F2N7R6_CORGP/2-260QQAK--------------------------------------------------------DEG.....RKL---------
PANB_SODGM/2-257RKWK--------------------------------------------------------QQQ.....RKF---------
PANB_MYXXD/4-262KRFK--------------------------------------------------------QIG.....QKI---------
W0JJ73_DESAE/2-258VSMK--------------------------------------------------------SK......EKI---------
PANB_SALRD/3-261QEMK--------------------------------------------------------EEG.....VPI---------
H1XSD8_9BACT/9-267KRMK--------------------------------------------------------AQG.....EPI---------
K4KI34_SIMAS/15-270RKMK--------------------------------------------------------AEG.....EKF---------
PANB_PHEZH/11-266AARK--------------------------------------------------------..G....GTPI---------
C1F8U4_ACIC5/19-277QEKK--------------------------------------------------------EQK.....QPI---------
PANB_BDEBA/2-258HDKK--------------------------------------------------------SKK.....QKI---------
PANB_THELT/2-257KSMK--------------------------------------------------------GK......KPI---------
PANB_POLSJ/34-294REMH--------------------------------------------------------AQG.....EKI---------
G0A0M7_METMM/10-265RAMK--------------------------------------------------------QAG.....EKI---------
E3E4R6_PAEPS/7-265RKMK--------------------------------------------------------QEG.....IPL---------
R7P8R5_9BACT/11-269QEMK--------------------------------------------------------EHG.....KKI---------
G8QNM1_AZOSU/9-266AKLK--------------------------------------------------------AAG.....EKI---------
V6JZL1_STRNV/26-283AAAK--------------------------------------------------------RRG.....EKW---------
F4GUY4_PUSST/9-264MQYK--------------------------------------------------------..G....QQKI---------
R7C4Y8_9BURK/5-261ARMK--------------------------------------------------------AAG.....EPI---------
R6EWT4_9BACT/11-269FEMK--------------------------------------------------------KCG.....EKI---------
PANB_PSYA2/2-261NKFK--------------------------------------------------------KDG.....TKF---------
E6UF09_RUMA7/2-260LKQK--------------------------------------------------------QSG.....EKI---------
PANB_PROMM/4-256TQLK--------------------------------------------------------QDG.....RAI---------
F8GE64_NITSI/2-259QKML--------------------------------------------------------ENN.....EKF---------
G8YQ94_PICSO/33-293QELH--------------------------------------------------------RQR.....KPI---------
R6EER5_9BACT/10-268AEMK--------------------------------------------------------AAG.....EKV---------
R6MV46_9FIRM/2-260AKAK--------------------------------------------------------QSG.....EKL---------
E1ZCJ6_CHLVA/23-287RDKY--------------------------------------------------------RRG.....EPI---------
PANB_NITSB/4-255KSAK--------------------------------------------------------NS......NKL---------
M4VAT0_9DELT/3-258QKRK--------------------------------------------------------KSG.....EKI---------
C4XU18_DESMR/3-260AAAK--------------------------------------------------------GV......RKI---------
J9ZD86_LEPFM/6-263PIRK--------------------------------------------------------KEG.....PPL---------
L0K4F1_HALHC/4-262QQKK--------------------------------------------------------DAG.....KKI---------
E6WZE1_NITSE/11-266QKLK--------------------------------------------------------GV......EPV---------
R7IQM6_9FIRM/7-262KNAK--------------------------------------------------------KNG.....ERL---------
R5JJK8_9FIRM/2-260KAQK--------------------------------------------------------GTE.....NKI---------
F8DZN0_CORRG/23-280HRYK--------------------------------------------------------AEG.....KKF---------
I4D5R2_DESAJ/3-259LEMK--------------------------------------------------------NQR.....KKI---------
PANB_LEIXX/16-273QAAK--------------------------------------------------------EEG.....SRF---------
E4U2F8_SULKY/3-258LKRK--------------------------------------------------------GA......LPL---------
PANB_NITMS/2-259VNMK--------------------------------------------------------KGK.....KKV---------
PANB1_PSEAE/9-265QRRK--------------------------------------------------------..G....AGSL---------
G8BMS9_TETPH/44-308QRKY--------------------------------------------------------TLK.....QPI---------
R5V6Z6_9FIRM/2-260QEAK--------------------------------------------------------DKG.....EKL---------
R5U793_9BACE/11-269VEMK--------------------------------------------------------QRG.....EKI---------
F6CMZ4_DESK7/5-263REAK--------------------------------------------------------KTG.....RKI---------
B9L8Y5_NAUPA/4-254YKK.--------------------------------------------------------........DKL---------
PANB_DESPS/2-260IAMK--------------------------------------------------------AAG.....QKI---------
L0F2P8_DESDL/3-259LAMK--------------------------------------------------------EQG.....QKI---------
K9Y6F0_HALP7/3-258LKWK--------------------------------------------------------QQQ.....RPI---------
PANB_NITEU/8-264QNAC--------------------------------------------------------EQG.....EKI---------
M5C834_THACB/15-272HALK--------------------------------------------------------QKG.....TAI---------
T2KQ61_9FLAO/10-268SDMK--------------------------------------------------------AHG.....EKI---------
I1NLG6_ORYGL/83-346RGKH--------------------------------------------------------RRG.....EPI---------
E6TZJ1_BACCJ/3-259FNMK--------------------------------------------------------KNG.....DKI---------
K0B4S7_CLOA9/4-262LESK--------------------------------------------------------RNN.....EKI---------
R6VBN9_9CLOT/2-260KQSK--------------------------------------------------------QQG.....RKI---------
G4QJL3_GLANF/3-259MQLK--------------------------------------------------------QKG.....EKI---------
PANB_RHOBA/10-264QRMR--------------------------------------------------------DRG.....ERI---------
R5DYA6_9BURK/9-266KKMY--------------------------------------------------------EAG.....EPI---------
PANB_RHORT/10-268ASRK--------------------------------------------------------SPA....AEPV---------
A5DVU0_LODEL/36-294QNLY--------------------------------------------------------HEK.....KPI---------
B6JWN4_SCHJY/27-297RKLY--------------------------------------------------------EKG.....EPI---------
PANB_CORGL/8-265REAK--------------------------------------------------------VNG.....QKV---------
PANB_RALSO/12-268QGMR--------------------------------------------------------AAG.....ERI---------
R6LXN4_9CLOT/2-260QMAK--------------------------------------------------------EKG.....EKL---------
PANB_MOOTA/6-264QAMK--------------------------------------------------------ERG.....ERI---------
F2F6S0_SOLSS/3-258LKMK--------------------------------------------------------EQG.....EKI---------
PANB_AZOSB/9-267GKMR--------------------------------------------------------AEG.....RKI---------
D3SC34_THISK/3-258ARRK--------------------------------------------------------QAG.....EPI---------
D4H852_DENA2/9-265KKMK--------------------------------------------------------ADG.....EKI---------
H6L4G9_SAPGL/9-267HAMK--------------------------------------------------------QRG.....EKI---------
R6DPQ8_9CLOT/2-260QQAK--------------------------------------------------------ENG.....QKI---------
N0B212_9BACI/3-259LKMK--------------------------------------------------------ENN.....EKI---------
R7K0E3_9CLOT/2-260RQAK--------------------------------------------------------QDG.....VKI---------
Q6BIM6_DEBHA/33-293QRLY--------------------------------------------------------ETK.....TPI---------
K0KXD0_WICCF/32-290RQLY--------------------------------------------------------NSN.....TKI---------
E8RS63_ASTEC/11-266YARK--------------------------------------------------------..G....GTPL---------
F9X8W4_MYCGM/67-327QAMY--------------------------------------------------------TRH.....EPI---------
A4XA35_SALTO/20-277LAAK--------------------------------------------------------ERG.....ERW---------
D5U1C4_THEAM/4-259MKMK--------------------------------------------------------NR......EKI---------
T0ULG9_9STRE/2-260QKAK--------------------------------------------------------KDG.....QKL---------
PANB_ALTMD/3-259LKKK--------------------------------------------------------QAG.....EKI---------
PANB_CAMC1/10-265KNKK--------------------------------------------------------GAE......PI---------
I0ICC5_PHYMF/8-267RHRA--------------------------------------------------------RDR.....RPF---------
F4PL25_DICFS/108-366KKKF--------------------------------------------------------ESN.....IPI---------
G4KQR4_OSCVS/3-261YKMK--------------------------------------------------------QDG.....EKV---------
K9YNE4_CYASC/2-257CQWK--------------------------------------------------------QEK.....KPI---------
PANB_WOLSU/3-258KKKK--------------------------------------------------------NQ......EKI---------
E6U5I9_ETHHY/4-262LDAK--------------------------------------------------------QNR.....RKI---------
B8BWG2_THAPS/41-307AAKK--------------------------------------------------------RRG.....HKI---------
K9SYS3_9SYNE/2-257LTWK--------------------------------------------------------SEG.....RAI---------
PANB_AERPE/5-260LKMK--------------------------------------------------------GS......RPI---------
R7DES0_9PORP/10-268AEMK--------------------------------------------------------QRG.....EKV---------
PANB_BAUCH/4-259RKYK--------------------------------------------------------QRQ.....QKF---------
I5AYL4_9DELT/4-258MKMK--------------------------------------------------------QEG.....KKI---------
PANB_BACSK/2-259KQMK--------------------------------------------------------RDG.....EPI---------
R6A0K1_9BACT/11-268KEMK--------------------------------------------------------AEG.....KKI---------
B2IDS4_BEII9/7-254AEMK--------------------------------------------------------RRG.....EPI---------
K0C447_CYCSP/9-266LTMK--------------------------------------------------------KRG.....EKI---------
PANB_LISMO/5-258FAMK--------------------------------------------------------ENG.....EKI---------
PANB_RHILO/16-267RRRK--------------------------------------------------------..G....GVPL---------
K9VPY0_9CYAN/2-258IQWK--------------------------------------------------------QQQ.....RPI---------
C0ZCH0_BREBN/7-265RKKK--------------------------------------------------------ETR.....TPI---------
A7TTC6_VANPO/36-301NKKY--------------------------------------------------------LAC.....EPL---------
M4ZY73_9ACTN/20-278QQAK--------------------------------------------------------ENG.....IKI---------
D2U9Y6_XANAP/10-266ADAK--------------------------------------------------------RRQ.....QKL---------
PANB_BACLD/3-259LKMK--------------------------------------------------------QEG.....EPI---------
K9ZZ09_DEIPD/3-257VRSE--------------------------------------------------------........DKL---------
E8T692_THEA1/2-260AEKK--------------------------------------------------------RKG.....EKI---------
D3UG21_HELM1/2-256QKKK--------------------------------------------------------NQ......EKI---------
R5FZT9_9PORP/11-269MAMK--------------------------------------------------------GEG.....DKI---------
E0SBL5_DICD3/3-259RQWK--------------------------------------------------------QEQ.....KKF---------
PANB_HALSA/12-261NTD.--------------------------------------------------------EET.....DPV---------
PANB_CAMJE/4-258LEKK--------------------------------------------------------AKN.....EKI---------
C5CWU9_VARPS/32-292ADMH--------------------------------------------------------ARG.....EKI---------
Q0UNM3_PHANO/57-317QALY--------------------------------------------------------RKN.....EPI---------
PANB_SULAC/5-259LKKK--------------------------------------------------------.GK.....EKI---------
M4NHU9_9GAMM/13-271LAMK--------------------------------------------------------TQG.....RRI---------
C5C4X5_BEUC1/14-271RAAK--------------------------------------------------------ERG.....ERL---------
E2SAV3_9ACTO/24-281RQWK--------------------------------------------------------ADG.....EKW---------
I2F2C6_9THEM/2-256VQMK--------------------------------------------------------GQ......SKL---------
PANB_DECAR/9-266AKLY--------------------------------------------------------QAG.....EKI---------
W1Q8C1_OGAPD/26-284KKLY--------------------------------------------------------KAK.....EPL---------
PANB_KOSOT/2-256INSK--------------------------------------------------------GK......RKL---------
PANB2_BRADU/11-267QQWK--------------------------------------------------------DKG.....RRV---------
R7NSE5_9FIRM/2-259AKMK--------------------------------------------------------ANG.....EKI---------
A8DWD1_NEMVE/4-260QSLK--------------------------------------------------------QSG.....EKI---------
D9SIJ1_GALCS/2-259KAMK--------------------------------------------------------SRS.....EKI---------
PANB2_VIBF1/3-259NNWK--------------------------------------------------------EVG.....EKF---------
C4Y7C6_CLAL4/28-286RKLY--------------------------------------------------------AEN.....TPI---------
E0UPX6_SULAO/4-259KKSK--------------------------------------------------------GV......RPL---------
C0QS02_PERMH/2-258LRAK--------------------------------------------------------EEG.....KKI---------
PANB_PELUB/4-253IKKK--------------------------------------------------------NK......TKI---------
F2LWA6_HIPMA/2-259KDMK--------------------------------------------------------DK......EKI---------
PANB_THICR/2-256HKMK--------------------------------------------------------QAG.....EKI---------
M5DV17_9GAMM/4-263QTMK--------------------------------------------------------EQQ.....QKF---------
X2HEZ8_9NEIS/2-257RKMK--------------------------------------------------------AAG.....EKI---------
I1YKY2_METFJ/3-261RKMK--------------------------------------------------------AAH.....DKI---------
D2NU30_ROTMD/61-319AQAK--------------------------------------------------------ATG.....QKF---------
R5SB00_9GAMM/3-259QRLK--------------------------------------------------------ENN.....EKI---------
E1VAR3_HALED/19-275QAHK--------------------------------------------------------RAG.....EAF---------
D3SNL0_THEAH/2-259FRKR--------------------------------------------------------EEG.....RKI---------
U3U9E1_9BACT/4-259NQLK--------------------------------------------------------SDG.....CKF---------
PANB_CLOAB/2-260KNSK--------------------------------------------------------FKK.....EKL---------
B7GHT0_ANOFW/22-277LNMK--------------------------------------------------------KNH.....EPI---------
B8EK33_METSB/5-251FEMK--------------------------------------------------------RRG.....EPI---------
C8X1K5_DESRD/4-262QGLK--------------------------------------------------------TGG.....EKL---------
G4T0T2_META2/12-267QSMK--------------------------------------------------------QRG.....EKI---------
PANB_ANAMF/4-256QAKK--------------------------------------------------------GL......EKI---------
I4YBJ3_WALSC/10-273NKMR--------------------------------------------------------RQN.....HPI---------
F0S4V2_PEDSD/9-267QEMK--------------------------------------------------------QKG.....ERI---------
E6SCG6_INTC7/25-282QAMK--------------------------------------------------------TEG.....RRW---------
PANB_CORJK/21-279KARK--------------------------------------------------------GTG.....EPF---------
F4PBH9_BATDJ/27-283RKLY--------------------------------------------------------NTK.....TPI---------
PANB_CYAP4/3-259QQWK--------------------------------------------------------RSG.....RAI---------
U5QGT4_9CYAN/2-258RRLK--------------------------------------------------------ERA.....QPI---------
E7A9J8_HELFC/3-264YRKK--------------------------------------------------------HPKEGASPCKI---------
PANB_ROSDO/14-264KSRK--------------------------------------------------------..G....GEPI---------
I0H0N1_ACTM4/15-272INAK--------------------------------------------------------ARG.....DRW---------
M2PBF7_CERS8/43-302QAMR--------------------------------------------------------RSG.....TPI---------
V4KY10_9DELT/4-261QTMK--------------------------------------------------------DEG.....RKV---------
D4MUX9_9FIRM/2-260QKMK--------------------------------------------------------DNG.....EKI---------
K4II33_PSYTT/10-268IEMK--------------------------------------------------------ANA.....EKI---------
G2TM93_BACCO/3-259VKMK--------------------------------------------------------AQE.....EKI---------
PANB_NOCFA/22-279RQMK--------------------------------------------------------ADG.....ERW---------
PANB_STRMK/10-265AEAK--------------------------------------------------------RNG.....QKL---------
R6Q9M5_9FIRM/3-261REQK--------------------------------------------------------AKG.....EKI---------
PANB_GEOLS/4-261LLMK--------------------------------------------------------QEG.....RKV---------
PANB_STACT/3-256FDMK--------------------------------------------------------KNS.....EKI---------
D3IAK5_9BACT/11-269IELK--------------------------------------------------------KQG.....EKI---------
E3RMD4_PYRTT/56-316QSMY--------------------------------------------------------RKG.....EPI---------
F8C4E6_THEGP/11-262IEKK--------------------------------------------------------GK......EPI---------
PANB_RHOCS/9-265AARK--------------------------------------------------------..G....REPV---------
G8LWQ2_CLOCD/4-262RESK--------------------------------------------------------RTG.....RKI---------
Q6CLY9_KLULA/32-295MAKY--------------------------------------------------------HRR.....NPI---------
PANB_SYNR3/10-261RQRK--------------------------------------------------------QRR.....QPI---------
R5J4T6_9FIRM/2-260KEAK--------------------------------------------------------KNK.....DKL---------
R5CPJ0_9BACT/11-269IEMK--------------------------------------------------------QRG.....EKI---------
PANB2_ZYMMO/10-265RARK--------------------------------------------------------..G....KSPI---------
PANB_UNCTG/3-261LKKK--------------------------------------------------------QSG.....EKI---------
A9SWR9_PHYPA/44-307EAKY--------------------------------------------------------QTN.....QPI---------
PANB_PSYWF/2-265KKYK--------------------------------------------------------KEG.....RKF---------
E1VXC6_ARTAR/15-272QQAK--------------------------------------------------------DNG.....EKF---------
F2J6X3_POLGS/33-294DRIK--------------------------------------------------------AQG.....ERF---------
PANB_GEOSW/3-259FKMK--------------------------------------------------------QEN.....EPI---------
D3PCJ6_DEFDS/9-265KKMK--------------------------------------------------------KDG.....EKI---------
F5XK06_MICPN/12-270QQAK--------------------------------------------------------QRH.....ERW---------
R5PEY0_9BACT/11-269FKMK--------------------------------------------------------QAG.....EKI---------
D1BFU9_SANKS/24-281AEHK--------------------------------------------------------EAG.....RKI---------
I3VRB5_THESW/4-262KRLK--------------------------------------------------------KDG.....IKI---------
PANB_AGRVS/9-265AALK--------------------------------------------------------..H....QRPI---------
PANB_XYLFA/10-265AEAK--------------------------------------------------------RNG.....SKI---------
M4SFZ5_9SPHN/23-277QARK--------------------------------------------------------..G....KEPI---------
G0RQ21_HYPJQ/11-271KSLY--------------------------------------------------------QKG.....EPI---------
R7FC11_9FIRM/2-261QAKK--------------------------------------------------------QRG.....EKI---------
C1MW11_MICPC/19-288AAKY--------------------------------------------------------RRG.....ERI---------
W5XWQ3_9CORY/8-265FEAK--------------------------------------------------------AAG.....SPI---------
L0EU60_LIBCB/3-258NQLK--------------------------------------------------------KCN.....TKF---------
L0E1F4_THIND/2-256EKYK--------------------------------------------------------REG.....RPI---------
K9Z7J6_CYAAP/2-257QQWK--------------------------------------------------------GEK.....RPI---------
I4A0H9_ORNRL/9-266RNLK--------------------------------------------------------GKG......KI---------
A5HYW9_CLOBH/2-260QELK--------------------------------------------------------NKG.....EKI---------
I3U7Q6_ADVKW/24-279RAYK--------------------------------------------------------..N....QKKI---------
PANB1_PSEF5/9-264VAMK--------------------------------------------------------..G....RQKI---------
E8UZX7_TERSS/17-275QDQK--------------------------------------------------------RRQ.....TPI---------
PANB_CHLTE/11-273LDMK--------------------------------------------------------ERG.....EKI---------
F4CPV3_PSEUX/31-288AEMK--------------------------------------------------------QRG.....ERW---------
PANB_MARMM/13-268RARK--------------------------------------------------------..G....GEPL---------
K9WEF5_9CYAN/2-259IQWK--------------------------------------------------------QQG.....RPI---------
K9SKS8_9CYAN/2-258QTFK--------------------------------------------------------ERG.....QPI---------
R4VYJ3_9EURY/3-265QTRY--------------------------------------------------------ESG.....EPI---------
K5WY16_AGABU/47-306HALR--------------------------------------------------------SSK.....TPI---------
A8NR68_COPC7/47-306HSMR--------------------------------------------------------KAN.....KPI---------
S5SZ30_9CORY/8-265AQAK--------------------------------------------------------AEG.....RRI---------
E3H7X2_ILYPC/2-260RNSK--------------------------------------------------------EKG.....KKL---------
B8D3I6_DESK1/7-262VKMK--------------------------------------------------------GK......EKI---------
I2BCN0_SHIBC/38-294RQLK--------------------------------------------------------QQH.....KKF---------
D8PBH0_9BACT/1-257QKCK--------------------------------------------------------RDR.....RKI---------
A7I1C3_CAMHC/4-259IAKK--------------------------------------------------------NM......EKI---------
D3Q8M5_STANL/19-275KLAK--------------------------------------------------------ERG.....EKW---------
V5UCI0_9BURK/11-268AQMR--------------------------------------------------------ERG.....EKI---------
L0H3K5_9GAMM/8-264AAMK--------------------------------------------------------QRR.....EPI---------
L0JL26_NATP1/3-257RSK.--------------------------------------------------------AGE.....EPI---------
A8IKB7_CHLRE/113-377RKKY--------------------------------------------------------EQG.....EQL---------
PANB_HELPY/10-265QAKK--------------------------------------------------------NQ......EKI---------
R7BQ71_9ACTN/2-260KDAK--------------------------------------------------------KQG.....KKL---------
D5V951_MORCR/17-276NKLK--------------------------------------------------------AEG.....KTF---------
U7PLW4_SPOS1/41-301RSLY--------------------------------------------------------AKN.....EPI---------
R7LEZ2_9BACT/2-258FKKK--------------------------------------------------------GV......EKI---------
D3FBP3_CONWI/22-279AEKK--------------------------------------------------------RLG.....EPI---------
C5CCN7_MICLC/23-281QRAK--------------------------------------------------------DED.....RRF---------
F8PSJ9_SERL3/44-301YNQH--------------------------------------------------------ATG.....IPI---------
PANB_PELCD/4-262QRMK--------------------------------------------------------AEG.....EKI---------
D7CJ47_SYNLT/3-261REKK--------------------------------------------------------ARK.....EKI---------
Q6FJH7_CANGA/29-292QRKY--------------------------------------------------------VER.....KPL---------
D8M6X1_BLAHO/33-296ASKY--------------------------------------------------------RKG.....EKI---------
E1SVW3_FERBD/3-259NRYK--------------------------------------------------------REG.....RKF---------
PANB_METS5/3-254LKKK--------------------------------------------------------.GK.....EKI---------
C1EBW8_MICSR/72-335RAKY--------------------------------------------------------DAG.....ERI---------
J7S291_KAZNA/30-296TGRY--------------------------------------------------------AQR.....EPL---------
B8MWV2_ASPFN/53-313QSLH--------------------------------------------------------KKG.....EPI---------
PANB_GLUDA/2-258QAMK--------------------------------------------------------PAG.....QRI---------
PANB3_BRADU/9-264RIRK--------------------------------------------------------..N....GEPI---------
PANB_HALMA/3-256QAM.--------------------------------------------------------AGE.....EPI---------
PANB_STAA8/2-256IDMK--------------------------------------------------------QKQ.....TKI---------
G4RCR9_PELHB/16-265LARK--------------------------------------------------------..G....GQPI---------
F7YY72_9THEM/2-258ISMK--------------------------------------------------------GK......EPI---------
D2W044_NAEGR/75-331NYKY--------------------------------------------------------QNQ.....IPL---------
F4C347_SPHS2/9-267LEMK--------------------------------------------------------ATG.....EKI---------
B1I1N7_DESAP/5-263RRKK--------------------------------------------------------EEG.....RPI---------
A8NPY9_COPC7/58-317HSLR--------------------------------------------------------QSK.....TPI---------
R5E9H5_9CLOT/2-260KQAK--------------------------------------------------------EKG.....EKL---------
B8J200_DESDA/2-259RAAK--------------------------------------------------------GQ......DKL---------
V4IHK4_9GAMM/6-262VRMK--------------------------------------------------------KKG.....ERI---------
PANB_RALME/11-266QAMR--------------------------------------------------------EAG.....EKI---------
PANB_SYNJB/4-259RQAK--------------------------------------------------------QAG.....QPL---------
PANB_SACEN/31-288LELK--------------------------------------------------------QRG.....EAW---------
G0VBF0_NAUCC/42-307HSKY--------------------------------------------------------AKG.....VPI---------
D2SAW9_GEOOG/14-271QQAK--------------------------------------------------------ERG.....EKW---------
A5FWA4_ACICJ/13-269ERAK--------------------------------------------------------RNG.....ERR---------
N0B2M6_9RHIZ/10-264TARK--------------------------------------------------------..G....GEPI---------
H9UMW1_SPIAZ/3-258PVRK--------------------------------------------------------AAG.....TRL---------
PANB_CAMFF/3-258FMMK--------------------------------------------------------NR......EKI---------
G7USF2_PSEUP/10-266RQAK--------------------------------------------------------QAG.....QKL---------
E9CAY9_CAPO3/54-312KKMH--------------------------------------------------------KQN.....EPI---------
A8ZX35_DESOH/4-253RDYK--------------------------------------------------------KQG.....RKI---------
PANB_CAUCR/12-266AARK--------------------------------------------------------..G....GVPI---------
D5WPY7_KYRT2/8-259FRKR--------------------------------------------------------KGG.....LPL---------
I0JN82_HALH3/5-258IKMK--------------------------------------------------------QEK.....DKI---------
E4T2P1_PALPW/10-268LEMK--------------------------------------------------------QRG.....EKI---------
E4U845_OCEP5/3-257KSRK--------------------------------------------------------GRG......SL---------
B8IX11_METNO/22-279RNSK--------------------------------------------------------RTG.....EKM---------
PANB_PARL1/9-264RARK--------------------------------------------------------..G....AEPI---------
C1D7E8_LARHH/49-306ARLK--------------------------------------------------------ADG.....QKI---------
PANB_YEAST/26-290RNKY--------------------------------------------------------FTG.....TPL---------
I1XL09_METNJ/3-260RKMK--------------------------------------------------------AEH.....KKI---------
PANB_TRIEI/2-260IQWK--------------------------------------------------------QKG.....RPI---------
K7AE29_9ALTE/3-259LKMK--------------------------------------------------------QES.....TKI---------
S2J9Z0_MUCC1/36-294QSLY--------------------------------------------------------KRK.....EAI---------
W0EVM7_9SPHI/9-267AKMK--------------------------------------------------------QAG.....EKI---------
G0JMB6_9GAMM/3-257VQDK--------------------------------------------------------QNG.....IKR---------
PANB_CALMQ/5-260LESK--------------------------------------------------------GK......RRI---------
S0EZ89_CHTCT/9-267RARK--------------------------------------------------------AQN.....EKI---------
Q6CE35_YARLI/40-298AKMR--------------------------------------------------------RNK.....EKI---------
R5ACL8_9FIRM/2-260QQQK--------------------------------------------------------LDG.....DKI---------
G8R5C5_OWEHD/10-268QEMK--------------------------------------------------------QNG.....EKI---------
PANB_TOLAT/3-259QKMK--------------------------------------------------------QSG.....EKI---------
B3QT33_CHLT3/14-276VEMK--------------------------------------------------------AQG.....EKI---------
B0VG23_CLOAI/8-266KEMK--------------------------------------------------------HHQ.....EKI---------
G8B7V6_CANPC/30-291HQFH--------------------------------------------------------QSQ.....KPI---------
D5UXM6_TSUPD/25-282ADLK--------------------------------------------------------ARG.....EKW---------
W0DU54_9GAMM/2-258YKMA--------------------------------------------------------AAQ.....EPI---------
F0YK17_AURAN/2-266LRMK--------------------------------------------------------RLG.....EKI---------
N1QBK2_MYCFI/41-301KSMY--------------------------------------------------------RNH.....DPI---------
G8TR11_NIAKG/11-269QKMK--------------------------------------------------------SVG.....EKI---------
K0NQW1_DESTT/4-258IKMK--------------------------------------------------------QEG.....QKI---------
C5DIL6_LACTC/24-292FSKH--------------------------------------------------------VSR.....EPI---------
F4B4G2_ACIHW/4-258LKKK--------------------------------------------------------ERK.....EKI---------
PANB_DESAG/9-266RAAK--------------------------------------------------------NT......RRL---------
E1QGK1_DESB2/5-263YQKK--------------------------------------------------------AEG.....RKV---------
F9Z613_ODOSD/10-267SEMK--------------------------------------------------------LKG.....EKI---------
R6QG64_9CLOT/9-267FKKK--------------------------------------------------------ENN.....EKI---------
PANB_NEIG1/2-257QKMK--------------------------------------------------------AAG.....EKI---------
PANB_ALKMQ/4-261MKMK--------------------------------------------------------KAE.....EQV---------
F0LTK0_VIBFN/3-259MKWK--------------------------------------------------------QEG.....RKV---------
A5D5T4_PELTS/5-263KQMK--------------------------------------------------------AEG.....RPV---------
PANB_TROWT/13-267HK.G--------------------------------------------------------SCG.....RKL---------
J7IT73_DESMD/3-259WVQK--------------------------------------------------------SEG.....KKI---------
D4KZZ1_9FIRM/4-262QKQK--------------------------------------------------------HEH.....DKI---------
PANB_SACD2/11-266RKMK--------------------------------------------------------ADK.....EKF---------
PANB_CYAP8/2-257IQAK--------------------------------------------------------QQG.....RPL---------
PANB1_ZYMMO/33-296SQMR--------------------------------------------------------VDG.....EKI---------
PANB1_HAHCH/9-265RSMK--------------------------------------------------------..G....KGSI---------
B4U641_HYDS0/4-261FKKK--------------------------------------------------------KNK.....QKI---------
C7PAE1_CHIPD/9-267QKMK--------------------------------------------------------NDG.....EKI---------
PANB_EXISA/3-259LKKM--------------------------------------------------------NEQ.....EKL---------
PANB_FRAAA/42-298AAAK--------------------------------------------------------SRG.....ERW---------
A8GIZ6_SERP5/25-281HQWK--------------------------------------------------------QEQ.....RKF---------
PANB_MARMS/13-269KKMK--------------------------------------------------------ADK.....EKI---------
B9I8Q3_POPTR/46-310KQKH--------------------------------------------------------KKG.....DPI---------
F2KYW8_PREDF/10-268LQMK--------------------------------------------------------AAG.....EKI---------
W8X8F9_CASDE/9-264VSFK--------------------------------------------------------..G....ERKI---------
C7MWE6_SACVD/37-294RELK--------------------------------------------------------ERG.....EPW---------
W8TJC5_EUBAC/5-263MESK--------------------------------------------------------KKG.....RKI---------
R6MRV8_9FIRM/2-260KNKK--------------------------------------------------------TDG.....EKI---------
E1R683_SPISS/12-255....--------------------------------------------------------ESK.....TPI---------
E0TIB5_PARBH/9-264TARK--------------------------------------------------------..G....GEPI---------
C9R9H9_AMMDK/3-261RRWK--------------------------------------------------------MEK.....RPI---------
L0ECE9_THECK/4-262LKMK--------------------------------------------------------RDG.....IPI---------
PANB_RHIEC/9-265SAMK--------------------------------------------------------..G....GKPI---------
PANB_RHOS4/11-264LARK--------------------------------------------------------..G....GEPI---------
C8W3T9_DESAS/5-263RNMK--------------------------------------------------------QEK.....RPV---------
H8GHP8_METAL/6-259AAMK--------------------------------------------------------RQG.....EKI---------
R6FWR6_9CLOT/2-260KQAK--------------------------------------------------------EKG.....ERI---------
Q7NSX9_CHRVO/10-253RNSK--------------------------------------------------------GR......RKL---------
PANB_DESVH/21-277RKAK--------------------------------------------------------GR......QRL---------
PANB_RHISN/11-264EALK--------------------------------------------------------..G....ERPI---------
K9SDR5_9CYAN/2-259MQRK--------------------------------------------------------QQS.....QPI---------
R6FYY2_9FIRM/2-260QAMK--------------------------------------------------------DKG.....EKI---------
PANB_THIDA/2-258KALR--------------------------------------------------------QKG.....EKI---------
PANB2_METPP/16-274REMH--------------------------------------------------------ARG.....EKI---------
PANB_ROSS1/2-259QQMK--------------------------------------------------------VRG.....EPI---------
H6C1C9_EXODN/62-322QKMY--------------------------------------------------------AEK.....TPI---------
F2NLZ2_MARHT/3-259KAKK--------------------------------------------------------GPG......SL---------
F0R8P2_BACSH/11-269MEMK--------------------------------------------------------ERG.....EKI---------
D5SWW3_PLAL2/21-276QGAK--------------------------------------------------------ARG.....EKL---------
R5EQ78_9GAMM/2-259AKMK--------------------------------------------------------QEK.....QKI---------
E8U6D3_DEIML/3-257VRAE--------------------------------------------------------........T<