Sequence alignment for CL0151

PF01274

MASY_EMENI/11-531VAILGSVSNEARKILTKEACAFLAIL.HRTFNPTRKALLQRRVDRQAEIDKGH.LP..........DFL.PETKHIRDDP
MASZ_CORGL/35-713YDFVTEAVLPRVGVDAEKFWSGFAAI.ARDLTPRNRELLARRDELQMLIDDYHRNNSGTIDQEAYEDFL.KEIGYLVEEP
MASY_MYXXD/17-538VVVKGTWHPDYAEVLTPEALEFVAKL.ARNFGERRLALLERRKTVQAAWSKGA.RP..........HFL.PETKAVR.EG
MASZ_ECOLI/17-697KRFVDEEVLPGTGLDAAAFWRNFDEI.VHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQP
Q9RYN3_DEIRA/10-521MTINAPIKPEYAEILTPEALAFVAEL.HRRFEPRRRELMQKREERQQRLDAGE.LP..........DFL.PETAEIR.AG
MASY_PICAN/21-543KPLL..SKATPRDILTKDALKFIVLL.HRSFNETRKQLLENRQKVQERLDAGE.SL..........HFL.EETKYIREDP
MASZ_PSEFL/17-697FDFVNNEAIPGTGITADQFWAGADKV.IHDLAPKNKALLAKRDDFQARIDTWHQTHAGQAHDPVAYKAFLQDIGYLLPEA
MASY_MAIZE/16-548VDVRGRYDREFAGILTRDALDFVAGL.QREFRGAVRYAMEQRREAQRRYDAGE.LP..........RFD.PATTLVR.EG
MASY_STRAE/10-542AIVDAEPLPRQEEVLTDAALAFVAELLHRRFTRAVTNSSPRRADAAREIARTS.TL..........DFL.PETAAVRADD
MASY_NEUCR/11-531VTISGPIEEHQRKILTPQALSFVALL.HRSFNQTRKNLLERRQLRQAEIDRGV.LP..........DFL.PETKHIRENP
MASY_STRCL/10-540AVVTAPAVPRQDEVLTEAALVFLAEL.HRRFTPRRDELLARRARRRAEISRTG.TL..........DFL.PETAHVRADD
MASY_BRANA/21-551VEVRGRYDQVFAKILTRDALGFVAEL.QREFRGHVRYAMECRREVKRRYNSGA.VP..........GFD.PSTKFIR.DG
MASY_ECOLI/11-533LAFTRPYGEQEKQILTAEAVEFLTEL.VTHFTPQRNKLLAARIQQQQDIDNGT.LP..........DFI.SETASIR.DA
MASZ_MYCLE/17-704YDFVNNEALPGTDINPNSFWSGVAKV.VADLTPQNQSLLNSRDELQAQIDKWHRHRVIEPFDVDAYRQFLIDIGYLLPEP
MASY_CANTR/15-540VQILGPIPDEAKHIFNQETLAFVATL.HRGFEARRQELLNNRKEQQKLRDQGF.LP..........DFL.PETEYIRNDS
MASY_YEAST/18-542EPFFKPSSTTVGDILTKDALEFIVLL.HRTFNNKRKQLLENRQVVQKKLDSGS.YH.........LDFL.PETANIRNDP

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
BPHF_SPHAR/18-244--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
O22982_ARATH/17-240--------------------------------------------------------------------------------
Q8Z9M3_SALTI/5-223--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
Q8XBS2_ECO57/20-239--------------------------------------------------------------------------------
Q9UVD4_9ASCO/43-283--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
HPCH_ECOLX/15-242--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
Q8K7F2_STRP3/6-224--------------------------------------------------------------------------------
Q8VQP0_RHOER/12-226--------------------------------------------------------------------------------
BPHF_RHOSR/18-244--------------------------------------------------------------------------------
Q9XY64_TRYCR/18-251--------------------------------------------------------------------------------
Q9RLT5_WEIPA/10-229--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0NXG4_9RHOB/11-252--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A2VJA9_MYCTU/3-230--------------------------------------------------------------------------------
A3I8T3_9BACI/7-245--------------------------------------------------------------------------------
A3NHT8_BURP6/20-277--------------------------------------------------------------------------------
A3TPN1_9MICO/3-233--------------------------------------------------------------------------------
A3UJ38_9RHOB/7-249--------------------------------------------------------------------------------
A3WAP9_9SPHN/6-247--------------------------------------------------------------------------------
A3Y7J5_9GAMM/4-243--------------------------------------------------------------------------------
A4AEG4_9ACTN/15-253--------------------------------------------------------------------------------
A4ET25_9RHOB/10-247--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5LD69_STRPN/2-260--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A8LYX8_SALAI/6-252--------------------------------------------------------------------------------
A8TK14_9PROT/10-251--------------------------------------------------------------------------------
A9DYN3_9FLAO/3-242--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1IHA0_CLOBK/33-275--------------------------------------------------------------------------------
B1T3E7_9BURK/12-255--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B4SLQ1_STRM5/8-241--------------------------------------------------------------------------------
B4WCU0_9CAUL/11-249--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTO/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTO/7-239--------------------------------------------------------------------------------
B6HSS2_PENCW/11-259--------------------------------------------------------------------------------
B6YYQ6_9RHOB/10-253--------------------------------------------------------------------------------
B8H7Q2_ARTCA/13-246--------------------------------------------------------------------------------
B8J5T4_ANAD2/11-248--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
B9NN70_9RHOB/11-254--------------------------------------------------------------------------------
B9YYY5_9NEIS/10-252--------------------------------------------------------------------------------
C0CW09_9CLOT/6-270--------------------------------------------------------------------------------
C0D909_9CLOT/255-518--------------------------------------------------------------------------------
C0RYY1_PARBP/55-297--------------------------------------------------------------------------------
D7W5Q1_9FLAO/4-244--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C2G595_9SPHI/6-241--------------------------------------------------------------------------------
C2SBC8_BACCE/6-244--------------------------------------------------------------------------------
C3K8Q8_PSEFS/8-242--------------------------------------------------------------------------------
OADC_PSEFS/13-253--------------------------------------------------------------------------------
C4RQC1_9ACTO/15-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5ERW5_9FIRM/6-250--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6CCM3_DICDC/20-260--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C8TDE8_KLEPR/3-239--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D5VJX4_CAUST/12-246--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D1RNP5_SEROD/10-245--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
F0QAJ3_ACIAP/21-266--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2MU75_CAMJU/150-410--------------------------------------------------------------------------------
D2NZY3_LISM1/8-251--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D2SNG0_STRFR/150-408--------------------------------------------------------------------------------
D2YH96_VIBMI/2-242--------------------------------------------------------------------------------
D3AHD3_9CLOT/10-248--------------------------------------------------------------------------------
D3AHD4_9CLOT/10-270--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4GMW6_PANAM/2-261--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
PEPM_STRHY/22-268--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
OADC_RHOP5/10-250--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q0ZQ45_9ACTO/7-253--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_SILST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q1MM68_RHIL3/10-253--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2CCZ7_9RHOB/9-248--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q3KEA6_PSEPF/8-242--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q4ZV58_PSEU2/7-249--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_SILPO/10-253--------------------------------------------------------------------------------
Q5LUG9_SILPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q72PY6_LEPIC/12-252--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
Q8KJ74_RHILI/14-259--------------------------------------------------------------------------------
Q9LPL2_ARATH/39-259--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942SLDVRLVFTAHPTEASRRAVLTKLRRISDILGEDTEEGTPERRR...................QDRDLAELIETLWQTDE
A8YCL3_MICAE/183-1018QLDIRLVFTAHPTEIVRHTIRIKQRRISGILEKLDQAEEIFRSM.........GLTNSREAQTVTKQLKEEIRFWWRTDE
CAPP_ACTP2/128-879KLSIELVLTAHPTEVTRRSLVHKHVEINKCLGQLEHDDLTEAEQ.................TKLKRRLMQLIALAWHTNE
A0ZJ69_NODSP/196-1034HLDVRLVFTAHPTEIVRHTIRDKQRQVVNLLQKLDVAENRTEST.........LGGYPWEAADLREQLLEEIRLWWRTDE
CAPP_SYNP6/236-1053RLDIRLVFTAHPTEIVRHTIRDKQRRIAYLLRQLDELETGKNRG...........FRELEAQNIRQQLTEEIRLWWRTDE
D3VH32_XENNA/127-879ELAIELVLTAHPTEIARRTLIHKLVEVNGCLAQLDHDDLADYER.................NNIMRRLRQLIAQSWHTDE
Q474V2_CUPPJ/200-1006EALIVPVLTAHPTEVQRKSILDAEREIARLLAERDL.PMTARER.................DRNTAQLRAKVTTLWQTRM
A0N072_CITSI/164-967NQTVDLVLTAHPTQSVRRSLLQKHARIRNCLAQLYAKDITPDDK.................QELDEALQREIQAAFRTDE
Q2KZS8_BORA1/137-936EACVMPVLTAHPTEVQRKSTLDAHREIAALLAQRDQ.TLTAEEI.................ADIDNALLGRVDTLWQTRM
B5W9X1_SPIMA/196-1035QLDIRLVFTAHPTEIVRHTIRTKQRRIAKILQQLDTVDESYGKV.DNKDPEATGLVKTWTGE.LQEQLTEEIRLWWRTDE
D2QW47_PIRSD/157-942KMLIELVFTAHPSEAKRRSIRAKLRRMRHALQELDRTDLLPRER.................ARLESRIRTELTVLWQTDF
A5GVT4_SYNR3/167-992ELDVRLVFTAHPTEIVRHTVRHKHRRVAHLIQRLEGLNDENDSF..............DDRQGLRQQLLEEIRVWWRTDE
C6D470_PAESJ/147-936NISLELVMTAHPTEATRRAVLDIHKRIAEDVMELDNPTLTYRER.................EILRDKLLNEVLILWQTDE
A3IQQ1_9CHRO/183-1016QLDIRLVFTAHPTEIVRHTIRLKQRRIATLLRRLDQAEEAFRGM.........GLSSSWEAESIIEQLNEEIRLWWRTDE
A3JFS1_9ALTE/116-876NLRVEFVLTAHPTEVTRRTLIMKYDDMSDCLEQLDHQDLMPSER.................DGIVRRLTRLIAEAWHTDE
B8HVC9_CYAP4/199-1018QLDIKLVFTAHPTEIVRQTIRDKQRRIARILEQLDRVEATLGSR............SGVEMQNLHEQLIEEIRLWWRTDE
C1F4Y2_ACIC5/161-947RIFVVPVFTAHPTEVARRSVLFKRRRIGEFLAHLDSIPLPDEEM.................QDLENAVTAEITALWQSDE
CAPP_SYNY3/193-1034HLDIRLVITAHPTEIVRHTIRRKQRRVDRILRKLDQLQGSVTGR.........DWLNTWDAKTAIAQLTEEIRFWWRTDE
CAPP_ECOK1/128-883SLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIADYEH.................NQLMRRLRQLIAQSWHTDE
B1XMB9_SYNP2/163-995QLDIRLVFTAHPTEIVRHTIRNKQRRIAGILRQLDQTEEGLKSL.........GTSDSWEIENIQQQLTEEIRLWWRTDE
A4S610_OSTLU/183-1007VQHVDLVLTAHPTQALRRSMLKSFGIIREKLLQLQRFRLSRYER.................AEVLDEIRSKVASAWRTDE
A9RUR8_PHYPA/162-969EQTVDLVFTAHPTQAVRRSLLQKHSRIRNCLSQMYQKDITADEK.................KEWDEALQREIQAAFRTDE
C6J5X1_9BACL/143-933GMSLELVMTAHPTEAMRRAILDIHKRIADDVMQLDNPTLTFRER.................EQLREKLLNEVITLWQTDE
B8GNA5_THISH/143-947QLAYVPVFTAHPTEARRRTVMEAQRRIFLAADRLNDRRLGREER.................EELTQELETRIQVLWRTNE
CAPP_HAHCH/132-881DLNLEFVLTAHPTEITRRTLIQKYDQISECLESLDRSDLLDEEY.................AKIVERLRRLITEAWHTDE
B1Y159_LEPCP/163-950HAYISPVLTAHPTEVQRKSILDAERAVAELIGERDD.LHTAGQR.................ADNEALLRARVTQLWQTRM
CAPP_THEEB/197-1011QLDIKLVFTAHPTEIVRQTIRDKQRRVARLLEQLDVLEGASPHL............TDWNAQTLRAQLMEEIRLWWRTDE
A4NFT0_HAEIF/128-879KLLIELVLTAHPTETTRRSLIHKHIEINKCLSKLEHHDLTEKER.................NIIERLLLRLIAEAWHTNE
A9S2G6_PHYPA/161-965HQTVDLVLTAHPTQSVRRSLLQKHTRIRSCLSQLNQVDITSDER.................QELDEALHREIQAAFRTDE
Q54JZ3_DICDI/144-931QQKIELVLTAHPTQIMRRTIISKNSAMGEALSSLDNQQLTMFER.................EDYEKRLIREVGGSWLTDE
CAPP_ACIBT/133-894DLKIELVLTAHPTEVSRRTLIQKYDDINACLSQLDQQKLTPRER.................QNALANLKQQISSAWQTDE
B4VT20_9CYAN/197-1034NLDIRLVFTAHPTEIVRHTIRQKQRRISTILQQLDQAEEASRAL.........GLNSSWEVEDYTEQLREEIRLWWRTDE
C1MJ77_MICPC/164-991EQEVDLVFTAHPTQALRRSMLKNFARIRQCLLDLQARRLSGYER.................AEILASMSSAIQAAWRTDE
A2C517_PROM1/168-994EMDIRLVFTAHPTEIVRHTVRHKQRRVATLLQQLQSNSLISESE................KEIFRLQLEEEIRLWWRTDE
E0UJ33_CYAP2/184-1020QLDVRLVFTAHPTEIVRHTIRRKQRRIAHILQKLDQAEETFRGM.........GLTNSWEAEEAKEQLKEEIRLWWRTDE
B7DNZ9_9BACL/131-906EVGIELVLTAHPTEALRRTVLDKHTKIAAFLEDMDDPRKTPREL.................DVLRERIRTEIVALWQTRS
B4WPD5_9SYNE/199-1032QLDVRLVFTAHPTEIVRHTIRDKQRRISEILRQLDREEEGARAL.........SLASSWEIQALQKQLVEEIRLWWRTDE
A4CSJ4_SYNPV/168-991ELDIRLVFTAHPTEIVRHTIRHKQRRVASLLQQLETKSDSSAVE................AGTIRLQLEEEIRLWWRTDE
A5WCX5_PSYWF/133-932QLKFIPVFTAHPTEARRRTTMNILQTLYAHSTALNDLPEGSLAY.................QEAKQKTAETIDLLWSSDE
A0JSJ3_ARTS2/161-954ELDVRPIFTAHPTEASRRSVLDKIRRLSDVLAVSTEEGTSARRR...................QDRQLAEVIDQMWQTDE
B7G725_PHATC/84-877KQKVEIVLTAHPTQVQRKSLLRKYRRVSEMLAYLERPDLDGFEK.................SSAQTSLQTILSSIWGADE
B8KBA6_VIBPA/130-880ELNIELVLTAHPTEITRRTMINKLVKINECLSKLELGDLSVKER.................AKTERRLEQLIAQSWHSDT
CAPP_GLOVI/141-939QLDVRLVFTAHPTEIVRRTIRTKHRRIVHLLDDLDNA..................LSEWQQQQVHTTMLEEIRIWWRTDE
C5Z450_SORBI/157-961NQSVDLVFTAHPTQSARRSLLQKNARIRNCLTQLSAKDVTVEDK.................KELDEALHREIQAAFRTDE
C3X714_OXAFO/147-957ETFISPVLTAHPTEVQRKSTLDSEREIARLLAEHGT.DLTPKER.................KHNTEMLSARIAGLWQTRL
C8PZR0_9GAMM/162-956DTYISAVLTAHPTEVQRQTILSLRRQIRALLEQYH..TAIGYQR.................QRIEQQLEATLLSQWQTNE
D1CE74_THET1/138-931RLRARFVFTAHPTESRRRTTLMHLRHISNLIALLDDALLTPTQR.................EMVIDRLREVVTALWQTDD
Q117S5_TRIEI/186-1038NLDIRLVFTAHPTEIVRRTIRTKQRRIAKILQQLDQVNESLSES.HVDEEQVNSLVSSWKIESLKEQLTEEILLWWRTDE
C1AE63_GEMAT/147-933SALVSPVLTAHPTEVQRQSTLTVMQQIATLLEQRDRMVLTGEER.................TESDALLTRLVLTLWHTRI
A9QPD2_METI4/151-931KMEIVLVFTAHPTEIKRQTILNKLCEISSYLKKESFNSKPS....................PAIHSTVERLIASLWLTER
B0BZ90_ACAM1/184-1012NLDIQLVFTAHPTEIVRQTIRAKQRRIAKILGKLDEAEAGLANN..........TRSNWEVDALQAQLTEEVRFWWRTDE
A4X3B0_SALTO/171-972RLAIRPVFTAHPTEAARRSILSKLRAIADELDTETTNAVLYGAS...............DEGPANRRLAELLDLMWQTDE
E3JCU0_FRASU/173-968RLELRPVFTAHPTEASRRSVLDVLRGIAELLDAADDPRAQPSRR.................AVVDRRLAEAVDVLWQTDE
Q2JKJ2_SYNJB/177-978QLHIRMVFTAHPTEIVRHTIREKQRAFSRLLSQLDWAEQTQPLQ................AQMIKEQMAEEVLLWWRTDE
CAPP_PROMS/165-989EMDIRLVFTAHPTEIVRHTIRHKQTRVANLLKKIQIEQFLTKEE................KNSLKTQLKEEVRLWWRTDE
A9IDM8_BORPD/139-951EARVVPVLTAHPTEVQRKSTLDVHREISTLLLQREG.PLTAEEI.................ADLDLALLGRVATLWQTRM
A0L255_SHESA/136-889TLDIDLVLTAHPTEISRRTLIQKYAAIVDCLAEQENNQLSDRER.................RQINLRLRQLIAQIWHTNE
A4G3V1_HERAR/147-944DALISPVLTAHPTEVQRKSILDAEHDIASLLAARDL.PMTAKER.................AENTERIHSRVTTLWQTRL
C1DZM5_MICSR/162-982EQEVDLVLTAHPTQALRRSMLKNFGTVRQKLLDLQRARLSGYER.................AELLDSMASAIQSAWRTDE
D0CKG9_9SYNE/185-1009ELDIRLVFTAHPTEIVRHTVRHKQRRVANLLQQLQSDAPLAHQL................REECRDQLEEEIRLWWRTDE
D3EKG0_GEOS4/142-928SLSLELVMTAHPTEAMRRAILDIHKRIADDVMQLDNPTLTFRER.................EQLREKLLNEVITLWQTDE
A3YUN9_9SYNE/171-1002ELDIRLVFTAHPTEIVRHTVRHKQRRVAALIHRLQQDNPTELQD................ERSLRLQLEEEIRLWWRTDE
A0YPE3_LYNSP/196-1038NLDVRLVFTAHPTEIVRHTIRTKQRRIAKVLQQLDNVDQNTSSLSENKTHDQTSTLSSWTDE.LYEQLTEEIRLWWRTDE
B1VUI2_STRGG/125-909NLNVRPVFTAHPTEAARRSVLNKLRRIAALLET....PAIEADR.................RRLDLRLAENIDLIWQTDE
CAPP1_CHLRE/154-974SQTVELVLTAHPTQALRASLLKKYAIVRRELDTLHSKRMSEYEK.................IETLEAIRAAVQAAWRTDE

PF15617

H4XEK7_ECOLX/4-311--------------------------------------------------------------------------------
D5CKQ7_ENTCC/4-311--------------------------------------------------------------------------------
B2NP51_ECO57/4-311--------------------------------------------------------------------------------
A7MPV2_CROS8/4-311--------------------------------------------------------------------------------
C4XDI3_KLEPN/4-311--------------------------------------------------------------------------------
B5RKC3_KLEP3/4-311--------------------------------------------------------------------------------
D0KLU5_PECWW/4-310--------------------------------------------------------------------------------
B4EW80_PROMH/4-311--------------------------------------------------------------------------------
D3V2D7_XENBS/4-313--------------------------------------------------------------------------------
A4TRW8_YERPP/4-311--------------------------------------------------------------------------------
B1JNG5_YERPY/4-311--------------------------------------------------------------------------------
E1PL56_PANVC/4-311--------------------------------------------------------------------------------
D3VJW5_XENNA/4-312--------------------------------------------------------------------------------
E2MHA5_PSEUB/3-308--------------------------------------------------------------------------------
Q4ZYA8_PSEU2/3-308--------------------------------------------------------------------------------
F3K7E7_PSESZ/3-308--------------------------------------------------------------------------------
Q39AX0_BURS3/4-309--------------------------------------------------------------------------------
Q6FAX8_ACIAD/1-293--------------------------------------------------------------------------------
A5WBK4_PSYWF/17-345--------------------------------------------------------------------------------
Q4FTQ0_PSYA2/59-379--------------------------------------------------------------------------------
Q5NWT6_AROAE/1-302--------------------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------------------------------------------------------------------------------
Q1QCR8_PSYCK/1-326--------------------------------------------------------------------------------
B6C0F8_9GAMM/22-320--------------------------------------------------------------------------------
A1VWQ0_POLNA/1-302--------------------------------------------------------------------------------
G2TCW8_RHORU/5-304--------------------------------------------------------------------------------
Q9RSA7_DEIRA/8-310--------------------------------------------------------------------------------
D5BYR3_NITHN/21-319--------------------------------------------------------------------------------
D8K7I6_NITWC/22-320--------------------------------------------------------------------------------
E8U9R3_DEIML/2-300--------------------------------------------------------------------------------
A8MM95_ALKOO/30-369--------------------------------------------------------------------------------
Q891X5_CLOTE/30-390--------------------------------------------------------------------------------
A8F9P5_BACP2/30-380--------------------------------------------------------------------------------
C9RML9_FIBSS/26-375--------------------------------------------------------------------------------
E3IYR0_FRASU/30-389--------------------------------------------------------------------------------
Q9KY27_STRCO/30-382--------------------------------------------------------------------------------
E3DTS5_BACA1/30-372--------------------------------------------------------------------------------
Q5YN23_NOCFA/30-379--------------------------------------------------------------------------------
B1HUS4_LYSSC/26-382--------------------------------------------------------------------------------
F2JGK5_CELLD/30-386--------------------------------------------------------------------------------
I0UNS1_BACLI/30-379--------------------------------------------------------------------------------
D1BEK0_SANKS/30-379--------------------------------------------------------------------------------
D1A9P4_THECD/30-379--------------------------------------------------------------------------------
C9ZE12_STRSW/30-382--------------------------------------------------------------------------------
F4H5N5_CELFA/32-382--------------------------------------------------------------------------------
B7HBK1_BACC4/30-359--------------------------------------------------------------------------------
B7IMX8_BACC2/30-359--------------------------------------------------------------------------------
C8W644_DESAS/30-382--------------------------------------------------------------------------------
Q82B97_STRAW/30-381--------------------------------------------------------------------------------
Q0SDY5_RHOSR/44-394--------------------------------------------------------------------------------
Q72YD0_BACC1/30-359--------------------------------------------------------------------------------
C1B1Z6_RHOOB/52-402--------------------------------------------------------------------------------
A4J1D5_DESRM/16-371--------------------------------------------------------------------------------
C0ZNQ3_RHOE4/41-390--------------------------------------------------------------------------------
C0Z9Y5_BREBN/30-389--------------------------------------------------------------------------------
Q186J7_CLOD6/30-356--------------------------------------------------------------------------------
E3EE66_PAEPS/10-379--------------------------------------------------------------------------------
F4D0A7_PSEUX/30-386--------------------------------------------------------------------------------
E6UGJ0_RUMA7/26-378--------------------------------------------------------------------------------
D0L8D1_GORB4/35-383--------------------------------------------------------------------------------
B1VYI2_STRGG/30-406--------------------------------------------------------------------------------
C9XQK5_CLODC/30-356--------------------------------------------------------------------------------
F4EXE4_9FIRM/15-342--------------------------------------------------------------------------------
C8XAU7_NAKMY/30-380--------------------------------------------------------------------------------
A8L403_FRASN/30-389--------------------------------------------------------------------------------
A6WD82_KINRD/30-386--------------------------------------------------------------------------------
Q0RDF4_FRAAA/30-389--------------------------------------------------------------------------------
A2RKY2_LACLM/29-399--------------------------------------------------------------------------------
Q2J6S0_FRASC/45-404--------------------------------------------------------------------------------
E3PRQ7_CLOSD/30-378--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA_CANTR/18-543--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_ECOLI/7-434--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------------------------
PT1_STACT/251-543--------------------------------------------------------------------------------
PT1_CUPNH/262-557--------------------------------------------------------------------------------
PPDK_CLOSY/515-871--------------------------------------------------------------------------------
PPDK_FLATR/595-953--------------------------------------------------------------------------------
PPDK_ENTHI/515-879--------------------------------------------------------------------------------
PT1_ECOLI/250-542--------------------------------------------------------------------------------
PT1_HAEIN/250-542--------------------------------------------------------------------------------
PT1P_ECOLI/416-708--------------------------------------------------------------------------------
PPSA_PYRFU/496-796--------------------------------------------------------------------------------
PT1_MYCCT/251-542--------------------------------------------------------------------------------
PTFAX_RHOCA/518-804--------------------------------------------------------------------------------
PT1_GEOSE/256-548--------------------------------------------------------------------------------
PTFAX_XANCP/521-808--------------------------------------------------------------------------------
PT1_STRMU/252-546--------------------------------------------------------------------------------
PTFX2_ECOLI/362-654--------------------------------------------------------------------------------
PPSA_STAMF/504-813--------------------------------------------------------------------------------

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK2_ECOLI/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYK1_TRYBB/19-364--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_GEOSE/2-346--------------------------------------------------------------------------------
KPYK_HYPJE/41-388--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK_LACDE/1-346--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------

PF02548

Q6BIM6_DEBHA/32-295--------------------------------------------------------------------------------
PANB_HALHL/12-270--------------------------------------------------------------------------------
PANB_SACD2/10-267--------------------------------------------------------------------------------
PANB_ECOUT/2-260--------------------------------------------------------------------------------
PANB2_METPP/15-275--------------------------------------------------------------------------------
PANB_AERPE/4-261--------------------------------------------------------------------------------
A6DLB6_9BACT/1-261--------------------------------------------------------------------------------
PANB_OCEIH/1-257--------------------------------------------------------------------------------
A3W152_9RHOB/5-264--------------------------------------------------------------------------------
PANB_THEP3/3-263--------------------------------------------------------------------------------
PANB_DESPS/1-261--------------------------------------------------------------------------------
A0XYQ5_9GAMM/2-260--------------------------------------------------------------------------------
PANB_ROSDO/8-265--------------------------------------------------------------------------------
C5B0Y2_METEA/8-268--------------------------------------------------------------------------------
PANB_PSEPF/2-261--------------------------------------------------------------------------------
PANB_ALCBS/1-259--------------------------------------------------------------------------------
PANB_GEOLS/3-262--------------------------------------------------------------------------------
PANB_ALKMQ/4-262--------------------------------------------------------------------------------
Q0FZZ2_9RHIZ/8-265--------------------------------------------------------------------------------
Q5UF70_9PROT/3-264--------------------------------------------------------------------------------
A3F328_BACIU/1-260--------------------------------------------------------------------------------
PANB_CHRSD/2-260--------------------------------------------------------------------------------
A4A9Z8_9GAMM/3-260--------------------------------------------------------------------------------
PANB_SALRD/2-262--------------------------------------------------------------------------------
PANB_METCA/3-261--------------------------------------------------------------------------------
A4BLN5_9GAMM/12-271--------------------------------------------------------------------------------
PANB_PYRAR/4-259--------------------------------------------------------------------------------
PANB_HELHP/4-261--------------------------------------------------------------------------------
PANB_NITEC/7-266--------------------------------------------------------------------------------
PANB_CAMJR/2-259--------------------------------------------------------------------------------
A4TBM9_MYCGI/21-280--------------------------------------------------------------------------------
A4SZR6_POLSQ/8-267--------------------------------------------------------------------------------
A5DHH9_PICGU/31-293--------------------------------------------------------------------------------
A3EWD3_9BACT/4-264--------------------------------------------------------------------------------
PANB_PYRAB/2-259--------------------------------------------------------------------------------
A6GSM9_9BURK/14-273--------------------------------------------------------------------------------
Q75D37_ASHGO/23-289--------------------------------------------------------------------------------
PANB_AQUAE/1-261--------------------------------------------------------------------------------
PANB_XANOR/8-266--------------------------------------------------------------------------------
A7G0V7_CLOBH/1-261--------------------------------------------------------------------------------
PANB_CORDI/3-260--------------------------------------------------------------------------------
PANB_NITMS/1-260--------------------------------------------------------------------------------
PANB_ANAMM/1-257--------------------------------------------------------------------------------
A8DJM8_9BACT/4-264--------------------------------------------------------------------------------
PANB_BUCAP/2-260--------------------------------------------------------------------------------
A8ZX35_DESOH/1-254--------------------------------------------------------------------------------
PANB_ROSCS/1-260--------------------------------------------------------------------------------
PANB_THIDA/1-259--------------------------------------------------------------------------------
PANB_TRIEI/1-261--------------------------------------------------------------------------------
Q1YYG7_PHOPR/2-260--------------------------------------------------------------------------------
PANB_SYNFM/1-262--------------------------------------------------------------------------------
A4BJA6_9GAMM/3-261--------------------------------------------------------------------------------
A5DVU0_LODEL/35-295--------------------------------------------------------------------------------
PANB_LEPBJ/1-262--------------------------------------------------------------------------------
PANB_METS4/15-273--------------------------------------------------------------------------------
PANB_CHRVO/1-259--------------------------------------------------------------------------------
PANB_HALMA/1-257--------------------------------------------------------------------------------
O82357_ARATH/40-306--------------------------------------------------------------------------------
PANB_CAMC1/9-266--------------------------------------------------------------------------------
PANB_RALSO/11-269--------------------------------------------------------------------------------
PANB_COXBU/3-262--------------------------------------------------------------------------------
A4ET65_9RHOB/36-279--------------------------------------------------------------------------------
A3ZKV5_9PLAN/9-265--------------------------------------------------------------------------------
PANB_MAGSA/8-266--------------------------------------------------------------------------------
PANB_ANADE/9-273--------------------------------------------------------------------------------
PANB_YEAST/24-291--------------------------------------------------------------------------------
A3JDV2_9ALTE/1-259--------------------------------------------------------------------------------
A5P8F6_9SPHN/22-283--------------------------------------------------------------------------------
PANB1_ZYMMO/32-297--------------------------------------------------------------------------------
A4RSY4_OSTLU/34-300--------------------------------------------------------------------------------
PANB_ACIC1/9-268--------------------------------------------------------------------------------
PANB_BDEBA/1-259--------------------------------------------------------------------------------
PANB_DECAR/8-267--------------------------------------------------------------------------------
PANB1_METPP/12-271--------------------------------------------------------------------------------
A7BVR3_9GAMM/2-261--------------------------------------------------------------------------------
Q54LH3_DICDI/90-350--------------------------------------------------------------------------------
PANB_HELPJ/9-266--------------------------------------------------------------------------------
Q6CE35_YARLI/39-299--------------------------------------------------------------------------------
PANB_RHOBA/9-265--------------------------------------------------------------------------------
PANB_DEHE1/1-261--------------------------------------------------------------------------------
PANB_MAGSM/3-263--------------------------------------------------------------------------------
Q6CLY9_KLULA/31-297--------------------------------------------------------------------------------
PANB_THET2/1-258--------------------------------------------------------------------------------
Q7NSX9_CHRVO/9-255--------------------------------------------------------------------------------
PANB_KORVE/10-270--------------------------------------------------------------------------------
Q841Y3_CAMFE/9-266--------------------------------------------------------------------------------
PANB_HERA2/1-259--------------------------------------------------------------------------------
PANB_CAUCR/10-267--------------------------------------------------------------------------------
PANB_NOCSJ/33-292--------------------------------------------------------------------------------
Q2UMW5_ASPOR/70-332--------------------------------------------------------------------------------
PANB_FRATO/1-259--------------------------------------------------------------------------------
A4GIZ2_9DELT/4-264--------------------------------------------------------------------------------
PANB_CHLCH/10-274--------------------------------------------------------------------------------
PANB_LEGPL/1-259--------------------------------------------------------------------------------
A7TTC6_VANPO/35-302--------------------------------------------------------------------------------
B4U641_HYDS0/3-262--------------------------------------------------------------------------------
A7I1C3_CAMHC/2-260--------------------------------------------------------------------------------
A5L777_9GAMM/1-252--------------------------------------------------------------------------------
PANB_BACSK/1-260--------------------------------------------------------------------------------
PANB_SULSO/2-260--------------------------------------------------------------------------------
Q5ABB3_CANAL/27-288--------------------------------------------------------------------------------
A3D6H9_SHEB5/8-266--------------------------------------------------------------------------------
PANB1_PSEF5/6-266--------------------------------------------------------------------------------
A5FWA4_ACICJ/8-270--------------------------------------------------------------------------------
PANB_NITSB/3-256--------------------------------------------------------------------------------
PANB_MARMS/12-270--------------------------------------------------------------------------------
A7BDA4_9ACTO/24-281--------------------------------------------------------------------------------
Q8GDR8_HELMO/3-263--------------------------------------------------------------------------------
PANB_STAMF/2-259--------------------------------------------------------------------------------
PANB_TROWT/12-268--------------------------------------------------------------------------------
A4GK01_9BACT/1-254--------------------------------------------------------------------------------
PANB_DEIGD/1-259--------------------------------------------------------------------------------
B1K6U2_BURCC/8-266--------------------------------------------------------------------------------
PANB_WIGBR/2-261--------------------------------------------------------------------------------
PANB_DESVH/19-278--------------------------------------------------------------------------------
A3WLA3_9GAMM/2-260--------------------------------------------------------------------------------
PANB_CORGB/9-268--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
B1V5L0_CLOPF/3-537--------------------------------------------------------------------------------
D2PDY7_SULID/4-511--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
B5YCF7_DICT6/5-497--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
C6HVN3_9BACT/19-520--------------------------------------------------------------------------------
A3EQI3_9BACT/19-520--------------------------------------------------------------------------------
CAPPA_PYRCJ/3-459--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_PYRAB/2-469--------------------------------------------------------------------------------
CAPPA_METMA/7-526--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
F0LK16_THEBM/2-476--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
B1YBY2_THENV/2-461--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
Q1PXR4_9BACT/4-490--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAR/4-460--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
C6A2T7_THESM/11-485--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531SWKG.AP.........................................................................
MASZ_CORGL/35-713EAAEIRTQNVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEKGKEYNPVRGQKVI.EWGRE
MASY_MYXXD/17-538DWTV.AP.........................................................................
MASZ_ECOLI/17-697ERVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIA..WVRRF
Q9RYN3_DEIRA/10-521DWKI.SP.........................................................................
MASY_PICAN/21-543NWKC.LP.........................................................................
MASZ_PSEFL/17-697ADFQASTQNVDDEIARMAGPQLVVPVMNARFALNASNARWGSLYDALYGTDAISEADGAEKGKGYNKVRGDKVIAFARAF
MASY_MAIZE/16-548DWTC.AS.........................................................................
MASY_STRAE/10-542SWRV.AG.........................................................................
MASY_NEUCR/11-531TWKG.AP.........................................................................
MASY_STRCL/10-540SWRV.AP.........................................................................
MASY_BRANA/21-551EWVC.AS.........................................................................
MASY_ECOLI/11-533DWKI.RG.........................................................................
MASZ_MYCLE/17-704DDFTISTSGVDDEITMTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDTIPETEGAEKGSEYNKIRGDKVIAYARKF
MASY_CANTR/15-540TWTG.PA.........................................................................
MASY_YEAST/18-542TWQG.PI.........................................................................

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
BPHF_SPHAR/18-244--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
O22982_ARATH/17-240--------------------------------------------------------------------------------
Q8Z9M3_SALTI/5-223--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
Q8XBS2_ECO57/20-239--------------------------------------------------------------------------------
Q9UVD4_9ASCO/43-283--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
HPCH_ECOLX/15-242--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
Q8K7F2_STRP3/6-224--------------------------------------------------------------------------------
Q8VQP0_RHOER/12-226--------------------------------------------------------------------------------
BPHF_RHOSR/18-244--------------------------------------------------------------------------------
Q9XY64_TRYCR/18-251--------------------------------------------------------------------------------
Q9RLT5_WEIPA/10-229--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0NXG4_9RHOB/11-252--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A2VJA9_MYCTU/3-230--------------------------------------------------------------------------------
A3I8T3_9BACI/7-245--------------------------------------------------------------------------------
A3NHT8_BURP6/20-277--------------------------------------------------------------------------------
A3TPN1_9MICO/3-233--------------------------------------------------------------------------------
A3UJ38_9RHOB/7-249--------------------------------------------------------------------------------
A3WAP9_9SPHN/6-247--------------------------------------------------------------------------------
A3Y7J5_9GAMM/4-243--------------------------------------------------------------------------------
A4AEG4_9ACTN/15-253--------------------------------------------------------------------------------
A4ET25_9RHOB/10-247--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5LD69_STRPN/2-260--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A8LYX8_SALAI/6-252--------------------------------------------------------------------------------
A8TK14_9PROT/10-251--------------------------------------------------------------------------------
A9DYN3_9FLAO/3-242--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1IHA0_CLOBK/33-275--------------------------------------------------------------------------------
B1T3E7_9BURK/12-255--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B4SLQ1_STRM5/8-241--------------------------------------------------------------------------------
B4WCU0_9CAUL/11-249--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTO/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTO/7-239--------------------------------------------------------------------------------
B6HSS2_PENCW/11-259--------------------------------------------------------------------------------
B6YYQ6_9RHOB/10-253--------------------------------------------------------------------------------
B8H7Q2_ARTCA/13-246--------------------------------------------------------------------------------
B8J5T4_ANAD2/11-248--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
B9NN70_9RHOB/11-254--------------------------------------------------------------------------------
B9YYY5_9NEIS/10-252--------------------------------------------------------------------------------
C0CW09_9CLOT/6-270--------------------------------------------------------------------------------
C0D909_9CLOT/255-518--------------------------------------------------------------------------------
C0RYY1_PARBP/55-297--------------------------------------------------------------------------------
D7W5Q1_9FLAO/4-244--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C2G595_9SPHI/6-241--------------------------------------------------------------------------------
C2SBC8_BACCE/6-244--------------------------------------------------------------------------------
C3K8Q8_PSEFS/8-242--------------------------------------------------------------------------------
OADC_PSEFS/13-253--------------------------------------------------------------------------------
C4RQC1_9ACTO/15-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5ERW5_9FIRM/6-250--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6CCM3_DICDC/20-260--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C8TDE8_KLEPR/3-239--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D5VJX4_CAUST/12-246--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D1RNP5_SEROD/10-245--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
F0QAJ3_ACIAP/21-266--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2MU75_CAMJU/150-410--------------------------------------------------------------------------------
D2NZY3_LISM1/8-251--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D2SNG0_STRFR/150-408--------------------------------------------------------------------------------
D2YH96_VIBMI/2-242--------------------------------------------------------------------------------
D3AHD3_9CLOT/10-248--------------------------------------------------------------------------------
D3AHD4_9CLOT/10-270--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4GMW6_PANAM/2-261--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
PEPM_STRHY/22-268--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
OADC_RHOP5/10-250--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q0ZQ45_9ACTO/7-253--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_SILST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q1MM68_RHIL3/10-253--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2CCZ7_9RHOB/9-248--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q3KEA6_PSEPF/8-242--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q4ZV58_PSEU2/7-249--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_SILPO/10-253--------------------------------------------------------------------------------
Q5LUG9_SILPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q72PY6_LEPIC/12-252--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
Q8KJ74_RHILI/14-259--------------------------------------------------------------------------------
Q9LPL2_ARATH/39-259--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942LRRQRPTPQDE---------------------------------------------------------------------
A8YCL3_MICAE/183-1018LHQFKPTVVDE---------------------------------------------------------------------
CAPP_ACTP2/128-879IRAARPTPVDE---------------------------------------------------------------------
A0ZJ69_NODSP/196-1034LHQFKPTVLDE---------------------------------------------------------------------
CAPP_SYNP6/236-1053LHQFKPTVLDE---------------------------------------------------------------------
D3VH32_XENNA/127-879IRKIRPTPIDE---------------------------------------------------------------------
Q474V2_CUPPJ/200-1006LRDSRLTVADE---------------------------------------------------------------------
A0N072_CITSI/164-967IRRTQPTPQDE---------------------------------------------------------------------
Q2KZS8_BORA1/137-936LRYTRLTVADE---------------------------------------------------------------------
B5W9X1_SPIMA/196-1035LHQFKPTVLDE---------------------------------------------------------------------
D2QW47_PIRSD/157-942LRPSRPTVLEE---------------------------------------------------------------------
A5GVT4_SYNR3/167-992LHQFKPSVLDE---------------------------------------------------------------------
C6D470_PAESJ/147-936LRDRKPTVIDE---------------------------------------------------------------------
A3IQQ1_9CHRO/183-1016LHQFKPSVLDE---------------------------------------------------------------------
A3JFS1_9ALTE/116-876IRYDRPTAVDE---------------------------------------------------------------------
B8HVC9_CYAP4/199-1018LHQFKPQVLDE---------------------------------------------------------------------
C1F4Y2_ACIC5/161-947VRSRRPEVADE---------------------------------------------------------------------
CAPP_SYNY3/193-1034LHQFKPTVLDE---------------------------------------------------------------------
CAPP_ECOK1/128-883IRKLRPSPVDE---------------------------------------------------------------------
B1XMB9_SYNP2/163-995LHQFKPQVLDE---------------------------------------------------------------------
A4S610_OSTLU/183-1007IRRTPPKPQDE---------------------------------------------------------------------
A9RUR8_PHYPA/162-969IRRSQPTPQDE---------------------------------------------------------------------
C6J5X1_9BACL/143-933LRDRKPTVLDE---------------------------------------------------------------------
B8GNA5_THISH/143-947VRVKKPQVQDE---------------------------------------------------------------------
CAPP_HAHCH/132-881IRYERPTAVDE---------------------------------------------------------------------
B1Y159_LEPCP/163-950LRYTKLTVADE---------------------------------------------------------------------
CAPP_THEEB/197-1011LHQFKPEVLDE---------------------------------------------------------------------
A4NFT0_HAEIF/128-879IRTVRPTPFDE---------------------------------------------------------------------
A9S2G6_PHYPA/161-965IRRTPPTPQDE---------------------------------------------------------------------
Q54JZ3_DICDI/144-931VRRSKVTVEME---------------------------------------------------------------------
CAPP_ACIBT/133-894IRQHRPTPVDE---------------------------------------------------------------------
B4VT20_9CYAN/197-1034LHQFKPTVLDE---------------------------------------------------------------------
C1MJ77_MICPC/164-991IRRNPPKPQDE---------------------------------------------------------------------
A2C517_PROM1/168-994LHQFKPTVLDE---------------------------------------------------------------------
E0UJ33_CYAP2/184-1020LHQFKPTVLDE---------------------------------------------------------------------
B7DNZ9_9BACL/131-906VRKQRITVLDE---------------------------------------------------------------------
B4WPD5_9SYNE/199-1032LHQFKPSVLDE---------------------------------------------------------------------
A4CSJ4_SYNPV/168-991LHQFKPSVLDE---------------------------------------------------------------------
A5WCX5_PSYWF/133-932VRTRKPLVYDE---------------------------------------------------------------------
A0JSJ3_ARTS2/161-954LRQVRPTPVDE---------------------------------------------------------------------
B7G725_PHATC/84-877IRRQKPTPQQE---------------------------------------------------------------------
B8KBA6_VIBPA/130-880IRKQRPTPLDE---------------------------------------------------------------------
CAPP_GLOVI/141-939LHQVRPTVLDE---------------------------------------------------------------------
C5Z450_SORBI/157-961IRRAQPTPQDE---------------------------------------------------------------------
C3X714_OXAFO/147-957LRYTRLSVADE---------------------------------------------------------------------
C8PZR0_9GAMM/162-956TRHFKITVKDE---------------------------------------------------------------------
D1CE74_THET1/138-931FRETRPTPLDE---------------------------------------------------------------------
Q117S5_TRIEI/186-1038LHQFKPSVLDE---------------------------------------------------------------------
C1AE63_GEMAT/147-933VRGERLRVVDE---------------------------------------------------------------------
A9QPD2_METI4/151-931SRSKNPQVLDE---------------------------------------------------------------------
B0BZ90_ACAM1/184-1012LHQFRPTVLDE---------------------------------------------------------------------
A4X3B0_SALTO/171-972LRLDRPDPTDE---------------------------------------------------------------------
E3JCU0_FRASU/173-968LRVERPKPTDE---------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978LHQSKPTVLNE---------------------------------------------------------------------
CAPP_PROMS/165-989LHQFKPSVLDE---------------------------------------------------------------------
A9IDM8_BORPD/139-951LRYTRLTVADE---------------------------------------------------------------------
A0L255_SHESA/136-889IRRERPTPVDE---------------------------------------------------------------------
A4G3V1_HERAR/147-944LRYTKLTVEDE---------------------------------------------------------------------
C1DZM5_MICSR/162-982IRRTPPKPQDE---------------------------------------------------------------------
D0CKG9_9SYNE/185-1009LHQFKPTVIDE---------------------------------------------------------------------
D3EKG0_GEOS4/142-928LRDRKPTVLDE---------------------------------------------------------------------
A3YUN9_9SYNE/171-1002LHQFKPSVLDE---------------------------------------------------------------------
A0YPE3_LYNSP/196-1038LHQFKPTVLDE---------------------------------------------------------------------
B1VUI2_STRGG/125-909LRVVRPEPADE---------------------------------------------------------------------
CAPP1_CHLRE/154-974IRRSKPTPQDE---------------------------------------------------------------------

PF15617

H4XEK7_ECOLX/4-311--------------------------------------------------------------------------------
D5CKQ7_ENTCC/4-311--------------------------------------------------------------------------------
B2NP51_ECO57/4-311--------------------------------------------------------------------------------
A7MPV2_CROS8/4-311--------------------------------------------------------------------------------
C4XDI3_KLEPN/4-311--------------------------------------------------------------------------------
B5RKC3_KLEP3/4-311--------------------------------------------------------------------------------
D0KLU5_PECWW/4-310--------------------------------------------------------------------------------
B4EW80_PROMH/4-311--------------------------------------------------------------------------------
D3V2D7_XENBS/4-313--------------------------------------------------------------------------------
A4TRW8_YERPP/4-311--------------------------------------------------------------------------------
B1JNG5_YERPY/4-311--------------------------------------------------------------------------------
E1PL56_PANVC/4-311--------------------------------------------------------------------------------
D3VJW5_XENNA/4-312--------------------------------------------------------------------------------
E2MHA5_PSEUB/3-308--------------------------------------------------------------------------------
Q4ZYA8_PSEU2/3-308--------------------------------------------------------------------------------
F3K7E7_PSESZ/3-308--------------------------------------------------------------------------------
Q39AX0_BURS3/4-309--------------------------------------------------------------------------------
Q6FAX8_ACIAD/1-293--------------------------------------------------------------------------------
A5WBK4_PSYWF/17-345--------------------------------------------------------------------------------
Q4FTQ0_PSYA2/59-379--------------------------------------------------------------------------------
Q5NWT6_AROAE/1-302--------------------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------------------------------------------------------------------------------
Q1QCR8_PSYCK/1-326--------------------------------------------------------------------------------
B6C0F8_9GAMM/22-320--------------------------------------------------------------------------------
A1VWQ0_POLNA/1-302--------------------------------------------------------------------------------
G2TCW8_RHORU/5-304--------------------------------------------------------------------------------
Q9RSA7_DEIRA/8-310--------------------------------------------------------------------------------
D5BYR3_NITHN/21-319--------------------------------------------------------------------------------
D8K7I6_NITWC/22-320--------------------------------------------------------------------------------
E8U9R3_DEIML/2-300--------------------------------------------------------------------------------
A8MM95_ALKOO/30-369--------------------------------------------------------------------------------
Q891X5_CLOTE/30-390--------------------------------------------------------------------------------
A8F9P5_BACP2/30-380--------------------------------------------------------------------------------
C9RML9_FIBSS/26-375--------------------------------------------------------------------------------
E3IYR0_FRASU/30-389--------------------------------------------------------------------------------
Q9KY27_STRCO/30-382--------------------------------------------------------------------------------
E3DTS5_BACA1/30-372--------------------------------------------------------------------------------
Q5YN23_NOCFA/30-379--------------------------------------------------------------------------------
B1HUS4_LYSSC/26-382--------------------------------------------------------------------------------
F2JGK5_CELLD/30-386--------------------------------------------------------------------------------
I0UNS1_BACLI/30-379--------------------------------------------------------------------------------
D1BEK0_SANKS/30-379--------------------------------------------------------------------------------
D1A9P4_THECD/30-379--------------------------------------------------------------------------------
C9ZE12_STRSW/30-382--------------------------------------------------------------------------------
F4H5N5_CELFA/32-382--------------------------------------------------------------------------------
B7HBK1_BACC4/30-359--------------------------------------------------------------------------------
B7IMX8_BACC2/30-359--------------------------------------------------------------------------------
C8W644_DESAS/30-382--------------------------------------------------------------------------------
Q82B97_STRAW/30-381--------------------------------------------------------------------------------
Q0SDY5_RHOSR/44-394--------------------------------------------------------------------------------
Q72YD0_BACC1/30-359--------------------------------------------------------------------------------
C1B1Z6_RHOOB/52-402--------------------------------------------------------------------------------
A4J1D5_DESRM/16-371--------------------------------------------------------------------------------
C0ZNQ3_RHOE4/41-390--------------------------------------------------------------------------------
C0Z9Y5_BREBN/30-389--------------------------------------------------------------------------------
Q186J7_CLOD6/30-356--------------------------------------------------------------------------------
E3EE66_PAEPS/10-379--------------------------------------------------------------------------------
F4D0A7_PSEUX/30-386--------------------------------------------------------------------------------
E6UGJ0_RUMA7/26-378--------------------------------------------------------------------------------
D0L8D1_GORB4/35-383--------------------------------------------------------------------------------
B1VYI2_STRGG/30-406--------------------------------------------------------------------------------
C9XQK5_CLODC/30-356--------------------------------------------------------------------------------
F4EXE4_9FIRM/15-342--------------------------------------------------------------------------------
C8XAU7_NAKMY/30-380--------------------------------------------------------------------------------
A8L403_FRASN/30-389--------------------------------------------------------------------------------
A6WD82_KINRD/30-386--------------------------------------------------------------------------------
Q0RDF4_FRAAA/30-389--------------------------------------------------------------------------------
A2RKY2_LACLM/29-399--------------------------------------------------------------------------------
Q2J6S0_FRASC/45-404--------------------------------------------------------------------------------
E3PRQ7_CLOSD/30-378--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA_CANTR/18-543--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_ECOLI/7-434--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------------------------
PT1_STACT/251-543--------------------------------------------------------------------------------
PT1_CUPNH/262-557--------------------------------------------------------------------------------
PPDK_CLOSY/515-871--------------------------------------------------------------------------------
PPDK_FLATR/595-953--------------------------------------------------------------------------------
PPDK_ENTHI/515-879--------------------------------------------------------------------------------
PT1_ECOLI/250-542--------------------------------------------------------------------------------
PT1_HAEIN/250-542--------------------------------------------------------------------------------
PT1P_ECOLI/416-708--------------------------------------------------------------------------------
PPSA_PYRFU/496-796--------------------------------------------------------------------------------
PT1_MYCCT/251-542--------------------------------------------------------------------------------
PTFAX_RHOCA/518-804--------------------------------------------------------------------------------
PT1_GEOSE/256-548--------------------------------------------------------------------------------
PTFAX_XANCP/521-808--------------------------------------------------------------------------------
PT1_STRMU/252-546--------------------------------------------------------------------------------
PTFX2_ECOLI/362-654--------------------------------------------------------------------------------
PPSA_STAMF/504-813--------------------------------------------------------------------------------

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK2_ECOLI/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYK1_TRYBB/19-364--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_GEOSE/2-346--------------------------------------------------------------------------------
KPYK_HYPJE/41-388--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK_LACDE/1-346--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------

PF02548

Q6BIM6_DEBHA/32-295--------------------------------------------------------------------------------
PANB_HALHL/12-270--------------------------------------------------------------------------------
PANB_SACD2/10-267--------------------------------------------------------------------------------
PANB_ECOUT/2-260--------------------------------------------------------------------------------
PANB2_METPP/15-275--------------------------------------------------------------------------------
PANB_AERPE/4-261--------------------------------------------------------------------------------
A6DLB6_9BACT/1-261--------------------------------------------------------------------------------
PANB_OCEIH/1-257--------------------------------------------------------------------------------
A3W152_9RHOB/5-264--------------------------------------------------------------------------------
PANB_THEP3/3-263--------------------------------------------------------------------------------
PANB_DESPS/1-261--------------------------------------------------------------------------------
A0XYQ5_9GAMM/2-260--------------------------------------------------------------------------------
PANB_ROSDO/8-265--------------------------------------------------------------------------------
C5B0Y2_METEA/8-268--------------------------------------------------------------------------------
PANB_PSEPF/2-261--------------------------------------------------------------------------------
PANB_ALCBS/1-259--------------------------------------------------------------------------------
PANB_GEOLS/3-262--------------------------------------------------------------------------------
PANB_ALKMQ/4-262--------------------------------------------------------------------------------
Q0FZZ2_9RHIZ/8-265--------------------------------------------------------------------------------
Q5UF70_9PROT/3-264--------------------------------------------------------------------------------
A3F328_BACIU/1-260--------------------------------------------------------------------------------
PANB_CHRSD/2-260--------------------------------------------------------------------------------
A4A9Z8_9GAMM/3-260--------------------------------------------------------------------------------
PANB_SALRD/2-262--------------------------------------------------------------------------------
PANB_METCA/3-261--------------------------------------------------------------------------------
A4BLN5_9GAMM/12-271--------------------------------------------------------------------------------
PANB_PYRAR/4-259--------------------------------------------------------------------------------
PANB_HELHP/4-261--------------------------------------------------------------------------------
PANB_NITEC/7-266--------------------------------------------------------------------------------
PANB_CAMJR/2-259--------------------------------------------------------------------------------
A4TBM9_MYCGI/21-280--------------------------------------------------------------------------------
A4SZR6_POLSQ/8-267--------------------------------------------------------------------------------
A5DHH9_PICGU/31-293--------------------------------------------------------------------------------
A3EWD3_9BACT/4-264--------------------------------------------------------------------------------
PANB_PYRAB/2-259--------------------------------------------------------------------------------
A6GSM9_9BURK/14-273--------------------------------------------------------------------------------
Q75D37_ASHGO/23-289--------------------------------------------------------------------------------
PANB_AQUAE/1-261--------------------------------------------------------------------------------
PANB_XANOR/8-266--------------------------------------------------------------------------------
A7G0V7_CLOBH/1-261--------------------------------------------------------------------------------
PANB_CORDI/3-260--------------------------------------------------------------------------------
PANB_NITMS/1-260--------------------------------------------------------------------------------
PANB_ANAMM/1-257--------------------------------------------------------------------------------
A8DJM8_9BACT/4-264--------------------------------------------------------------------------------
PANB_BUCAP/2-260--------------------------------------------------------------------------------
A8ZX35_DESOH/1-254--------------------------------------------------------------------------------
PANB_ROSCS/1-260--------------------------------------------------------------------------------
PANB_THIDA/1-259--------------------------------------------------------------------------------
PANB_TRIEI/1-261--------------------------------------------------------------------------------
Q1YYG7_PHOPR/2-260--------------------------------------------------------------------------------
PANB_SYNFM/1-262--------------------------------------------------------------------------------
A4BJA6_9GAMM/3-261--------------------------------------------------------------------------------
A5DVU0_LODEL/35-295--------------------------------------------------------------------------------
PANB_LEPBJ/1-262--------------------------------------------------------------------------------
PANB_METS4/15-273--------------------------------------------------------------------------------
PANB_CHRVO/1-259--------------------------------------------------------------------------------
PANB_HALMA/1-257--------------------------------------------------------------------------------
O82357_ARATH/40-306--------------------------------------------------------------------------------
PANB_CAMC1/9-266--------------------------------------------------------------------------------
PANB_RALSO/11-269--------------------------------------------------------------------------------
PANB_COXBU/3-262--------------------------------------------------------------------------------
A4ET65_9RHOB/36-279--------------------------------------------------------------------------------
A3ZKV5_9PLAN/9-265--------------------------------------------------------------------------------
PANB_MAGSA/8-266--------------------------------------------------------------------------------
PANB_ANADE/9-273--------------------------------------------------------------------------------
PANB_YEAST/24-291--------------------------------------------------------------------------------
A3JDV2_9ALTE/1-259--------------------------------------------------------------------------------
A5P8F6_9SPHN/22-283--------------------------------------------------------------------------------
PANB1_ZYMMO/32-297--------------------------------------------------------------------------------
A4RSY4_OSTLU/34-300--------------------------------------------------------------------------------
PANB_ACIC1/9-268--------------------------------------------------------------------------------
PANB_BDEBA/1-259--------------------------------------------------------------------------------
PANB_DECAR/8-267--------------------------------------------------------------------------------
PANB1_METPP/12-271--------------------------------------------------------------------------------
A7BVR3_9GAMM/2-261--------------------------------------------------------------------------------
Q54LH3_DICDI/90-350--------------------------------------------------------------------------------
PANB_HELPJ/9-266--------------------------------------------------------------------------------
Q6CE35_YARLI/39-299--------------------------------------------------------------------------------
PANB_RHOBA/9-265--------------------------------------------------------------------------------
PANB_DEHE1/1-261--------------------------------------------------------------------------------
PANB_MAGSM/3-263--------------------------------------------------------------------------------
Q6CLY9_KLULA/31-297--------------------------------------------------------------------------------
PANB_THET2/1-258--------------------------------------------------------------------------------
Q7NSX9_CHRVO/9-255--------------------------------------------------------------------------------
PANB_KORVE/10-270--------------------------------------------------------------------------------
Q841Y3_CAMFE/9-266--------------------------------------------------------------------------------
PANB_HERA2/1-259--------------------------------------------------------------------------------
PANB_CAUCR/10-267--------------------------------------------------------------------------------
PANB_NOCSJ/33-292--------------------------------------------------------------------------------
Q2UMW5_ASPOR/70-332--------------------------------------------------------------------------------
PANB_FRATO/1-259--------------------------------------------------------------------------------
A4GIZ2_9DELT/4-264--------------------------------------------------------------------------------
PANB_CHLCH/10-274--------------------------------------------------------------------------------
PANB_LEGPL/1-259--------------------------------------------------------------------------------
A7TTC6_VANPO/35-302--------------------------------------------------------------------------------
B4U641_HYDS0/3-262--------------------------------------------------------------------------------
A7I1C3_CAMHC/2-260--------------------------------------------------------------------------------
A5L777_9GAMM/1-252--------------------------------------------------------------------------------
PANB_BACSK/1-260--------------------------------------------------------------------------------
PANB_SULSO/2-260--------------------------------------------------------------------------------
Q5ABB3_CANAL/27-288--------------------------------------------------------------------------------
A3D6H9_SHEB5/8-266--------------------------------------------------------------------------------
PANB1_PSEF5/6-266--------------------------------------------------------------------------------
A5FWA4_ACICJ/8-270--------------------------------------------------------------------------------
PANB_NITSB/3-256--------------------------------------------------------------------------------
PANB_MARMS/12-270--------------------------------------------------------------------------------
A7BDA4_9ACTO/24-281--------------------------------------------------------------------------------
Q8GDR8_HELMO/3-263--------------------------------------------------------------------------------
PANB_STAMF/2-259--------------------------------------------------------------------------------
PANB_TROWT/12-268--------------------------------------------------------------------------------
A4GK01_9BACT/1-254--------------------------------------------------------------------------------
PANB_DEIGD/1-259--------------------------------------------------------------------------------
B1K6U2_BURCC/8-266--------------------------------------------------------------------------------
PANB_WIGBR/2-261--------------------------------------------------------------------------------
PANB_DESVH/19-278--------------------------------------------------------------------------------
A3WLA3_9GAMM/2-260--------------------------------------------------------------------------------
PANB_CORGB/9-268--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
B1V5L0_CLOPF/3-537--------------------------------------------------------------------------------
D2PDY7_SULID/4-511--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
B5YCF7_DICT6/5-497--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
C6HVN3_9BACT/19-520--------------------------------------------------------------------------------
A3EQI3_9BACT/19-520--------------------------------------------------------------------------------
CAPPA_PYRCJ/3-459--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_PYRAB/2-469--------------------------------------------------------------------------------
CAPPA_METMA/7-526--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
F0LK16_THEBM/2-476--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
B1YBY2_THENV/2-461--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
Q1PXR4_9BACT/4-490--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAR/4-460--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
C6A2T7_THESM/11-485--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531..............................................................PAPGL---V---DRRVE-
MASZ_CORGL/35-713FLDSVVPLDGASHADVEKYNITDGKLAAHIGDSVYRLKNRESYRGFTGNFLDPEAILLETNGLHIEL---Q---IDPVH-
MASY_MYXXD/17-538..............................................................LPADL---Q---DRRVE-
MASZ_ECOLI/17-697LDESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL---Q---IDANG-
Q9RYN3_DEIRA/10-521..............................................................LPDAL---K---DRRVE-
MASY_PICAN/21-543..............................................................THPKL---Q---CRKIE-
MASZ_PSEFL/17-697LDEAAPLSAGSHVDSTGYKIADGKLIVSLKGGSNSGLRDDAQLIGFQGPAAQPIAILLKHNGLHFEI---Q---IDAST-
MASY_MAIZE/16-548..............................................................VPPAV---A---DRTVE-
MASY_STRAE/10-542...............................................................PAAL---N---DRRVE-
MASY_NEUCR/11-531..............................................................PAPGL---V---DRRVE-
MASY_STRCL/10-540..............................................................APPAL---Q---DRRVE-
MASY_BRANA/21-551..............................................................VPPAV---A---DRRVE-
MASY_ECOLI/11-533..............................................................IPADL---E---DRRVE-
MASZ_MYCLE/17-704MDQAVPLASDSWTNATGVSIFDGQLQIAIGTNSTGLASPEKFVGYNRQLRSSNWSVLLANHGLHIEV---L---IDPES-
MASY_CANTR/15-540..............................................................LAPGL---I---DRRCE-
MASY_YEAST/18-542..............................................................LAPGL---I---NRSTE-

PF03328

Q9RYM1_DEIRA/24-251----------------------------------------------------------------------------QIG-
Q8XL94_CLOPE/6-225----------------------------------------------------------------------------RSM-
BPHF_SPHAR/18-244----------------------------------------------------------------------------QLG-
Q9CGA8_LACLA/9-229----------------------------------------------------------------------------RTM-
O22982_ARATH/17-240----------------------------------------------------------------------------LLG-
Q8Z9M3_SALTI/5-223----------------------------------------------------------------------------RSM-
RHMA_ECOLI/19-246----------------------------------------------------------------------------QIG-
Q8RDW5_FUSNN/9-227----------------------------------------------------------------------------RTM-
GARL_ECOLI/20-246----------------------------------------------------------------------------QIG-
Q9KTU0_VIBCH/11-230----------------------------------------------------------------------------RSM-
Q93167_CAEEL/26-259----------------------------------------------------------------------------RAL-
Q9HRM8_HALSA/29-241----------------------------------------------------------------------------RSV-
Q8XBS2_ECO57/20-239----------------------------------------------------------------------------RSM-
Q9UVD4_9ASCO/43-283----------------------------------------------------------------------------LMG-
O82487_ARATH/90-322----------------------------------------------------------------------------LYG-
HPCH_ECOLX/15-242----------------------------------------------------------------------------QIG-
CITEL_DEIRA/9-223----------------------------------------------------------------------------RSV-
Q8K7F2_STRP3/6-224----------------------------------------------------------------------------RTM-
Q8VQP0_RHOER/12-226----------------------------------------------------------------------------RAS-
BPHF_RHOSR/18-244----------------------------------------------------------------------------QIG-
Q9XY64_TRYCR/18-251----------------------------------------------------------------------------KFG-
Q9RLT5_WEIPA/10-229----------------------------------------------------------------------------RTM-

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------LLR.L---H...QAP.E.
A0K276_ARTS2/27-270--------------------------------------------------------------FHA.L---H...DGA.A.
A0NXG4_9RHOB/11-252--------------------------------------------------------------FKA.L---H...EKG.R.
A0QPJ7_MYCS2/16-251--------------------------------------------------------------LLA.L---H...RPG.D.
A0R0I0_MYCS2/10-256--------------------------------------------------------------FAERL---H...AGGNI.
A1CA54_ASPCL/14-274--------------------------------------------------------------LCR.L---H...TPG.K.
A1SIA9_NOCSJ/3-233--------------------------------------------------------------FRA.L---H...HAE.L.
A2VJA9_MYCTU/3-230--------------------------------------------------------------FHD.L---H...HQG.V.
A3I8T3_9BACI/7-245--------------------------------------------------------------FND.L---H...ESQ.E.
A3NHT8_BURP6/20-277--------------------------------------------------------------FKEKL---A...TG..R.
A3TPN1_9MICO/3-233--------------------------------------------------------------FAE.L---H...ES..D.
A3UJ38_9RHOB/7-249--------------------------------------------------------------FAA.L---H...APG.S.
A3WAP9_9SPHN/6-247--------------------------------------------------------------FAA.L---H...WAG.D.
A3Y7J5_9GAMM/4-243--------------------------------------------------------------FKK.L---H...QNA.K.
A4AEG4_9ACTN/15-253--------------------------------------------------------------LRS.F---H...VPG.T.
A4ET25_9RHOB/10-247--------------------------------------------------------------FAQ.R---H...QPG.D.
A4F7M3_SACEN/8-232--------------------------------------------------------------FRA.L---H...RAG.D.
A4FH54_SACEN/26-273--------------------------------------------------------------LRD.L---H...VPK.R.
A4X5C0_SALTO/32-264--------------------------------------------------------------FRS.L---H...RPG.Q.
A4X7L5_SALTO/4-223--------------------------------------------------------------FAA.L---H...RTG.D.
A4XS21_PSEMY/12-254--------------------------------------------------------------FQA.L---H...QRD.E.
A4YVZ4_BRASO/12-249--------------------------------------------------------------FRK.L---H...ES..G.
A5G4A7_GEOUR/12-254--------------------------------------------------------------FLR.L---H...QGP.G.
A5LD69_STRPN/2-260--------------------------------------------------------------FIDIL---K...KK....
A5V3Q4_SPHWW/10-252--------------------------------------------------------------FSK.L---H...VAG.D.
A8LYX8_SALAI/6-252--------------------------------------------------------------LRRAL---T...AG..T.
A8TK14_9PROT/10-251--------------------------------------------------------------FRAVL---S.....GNQ.
A9DYN3_9FLAO/3-242--------------------------------------------------------------FKN.L---H...QQE.K.
A9WM41_RENSM/9-245--------------------------------------------------------------FRS.L---H...DDL...
B1IHA0_CLOBK/33-275--------------------------------------------------------------FQE.I---H...HRN.K.
B1T3E7_9BURK/12-255--------------------------------------------------------------FRS.L---H...RAG.E.
B1VSN1_STRGG/14-249--------------------------------------------------------------LKH.L---H...AEH.R.
B4RBF1_PHEZH/10-242--------------------------------------------------------------FRK.L---H...TGA.E.
B4SLQ1_STRM5/8-241--------------------------------------------------------------FVQ.L---H...QGA.N.
B4WCU0_9CAUL/11-249--------------------------------------------------------------FRE.R---H....RS.G.
B5HHA0_STRPR/15-253--------------------------------------------------------------LRE.L---H...HG..E.
B5HRK0_9ACTO/12-259--------------------------------------------------------------FAE.L---H...RE..G.
B5HVC7_9ACTO/7-239--------------------------------------------------------------FRA.L---HRGRLPG.D.
B6HSS2_PENCW/11-259--------------------------------------------------------------FRA.L---H...QPG.N.
B6YYQ6_9RHOB/10-253--------------------------------------------------------------FAA.L---H...VKG.E.
B8H7Q2_ARTCA/13-246--------------------------------------------------------------LKA.L---H...EAP.E.
B8J5T4_ANAD2/11-248--------------------------------------------------------------FRA.L---H...QQ..G.
B8MDA8_TALSN/5-285--------------------------------------------------------------IKSVL---K...KN..Q.
B9JNZ3_AGRRK/15-273--------------------------------------------------------------LRALL---E...KR..T.
B9K4D9_AGRVS/8-247--------------------------------------------------------------FRQ.L---H...EGS.G.
B9NN70_9RHOB/11-254--------------------------------------------------------------FAA.L---H...KKG.D.
B9YYY5_9NEIS/10-252--------------------------------------------------------------FKE.L---H...RRS.G.
C0CW09_9CLOT/6-270--------------------------------------------------------------LKQKL---A...NNEMV.
C0D909_9CLOT/255-518--------------------------------------------------------------IRQML---E...AG..E.
C0RYY1_PARBP/55-297--------------------------------------------------------------LRN.L---H...VPG.N.
D7W5Q1_9FLAO/4-244--------------------------------------------------------------FKQ.L---H...HGE.E.
C1D0L9_DEIDV/16-251--------------------------------------------------------------LLD.L---H...EAP.E.
D5UDN5_CELFN/12-253--------------------------------------------------------------LRS.F---H...ESG...
C2G595_9SPHI/6-241--------------------------------------------------------------FKQ.L---H...QQS.T.
C2SBC8_BACCE/6-244--------------------------------------------------------------FND.Y---H...HDS.S.
C3K8Q8_PSEFS/8-242--------------------------------------------------------------FRN.L---H...QD..N.
OADC_PSEFS/13-253--------------------------------------------------------------FRELL---A.....TPT.
C4RQC1_9ACTO/15-253--------------------------------------------------------------LRA.L---H...KSG.D.
C5C673_BEUC1/6-244--------------------------------------------------------------FRR.R---H...RPG.A.
C5ERW5_9FIRM/6-250--------------------------------------------------------------LREYM---D...QNEFF.
C5K5X0_PERM5/22-289--------------------------------------------------------------LRQLI---N...TK..AP
D9SPL5_CLOC7/7-255--------------------------------------------------------------LKKLL---N...SK..N.
C6CCM3_DICDC/20-260--------------------------------------------------------------FKK.L---H...TGG.T.
C6W6H2_DYAFD/19-261--------------------------------------------------------------LKK.L---H...HSG.K.
C7Q1F2_CATAD/16-252--------------------------------------------------------------FAS.L---H...AGP.D.
C7YUL0_NECH7/9-264--------------------------------------------------------------LKA.L---H...KPS.T.
C7YZU2_NECH7/391-674--------------------------------------------------------------IRAAF---K...AR..Q.
D6Z4R6_DESAT/153-411--------------------------------------------------------------LRRLI---D...AK..P.
C8TDE8_KLEPR/3-239--------------------------------------------------------------FNA.L---H...QQN.Q.
C9SRU6_VERA1/11-259--------------------------------------------------------------LKA.L---H...KPS.S.
D5VJX4_CAUST/12-246--------------------------------------------------------------FRA.L---H...AE..G.
D1A2J0_THECD/5-232--------------------------------------------------------------FGE.L---H...RAG.D.
D1BED0_SANKS/11-246--------------------------------------------------------------FAS.L---H...VSG.A.
D1BI43_SANKS/12-247--------------------------------------------------------------FRS.L---H...DPR.H.
D1RNP5_SEROD/10-245--------------------------------------------------------------FAN.L---H...RQP.H.
D9TER7_MICAI/8-239--------------------------------------------------------------FRE.L---H...RPG.D.
F0QAJ3_ACIAP/21-266--------------------------------------------------------------LRALI---S...GP..Q.
E3J806_FRASU/10-249--------------------------------------------------------------FLA.L---H...TRT.G.
D2B1P9_STRRD/6-236--------------------------------------------------------------FRA.L---H...HGP.E.
E3I6J4_RHOVT/30-272--------------------------------------------------------------FRKRL---Q...AR..E.
D2MU75_CAMJU/150-410--------------------------------------------------------------LRKCM---N...AK..S.
D2NZY3_LISM1/8-251--------------------------------------------------------------LKS.L---H...ELP.T.
D2PR97_KRIFD/29-269--------------------------------------------------------------LRA.L---H...VPG.K.
D2Q3B1_KRIFD/7-234--------------------------------------------------------------FRA.L---H...HGG.T.
D2Q4L3_KRIFD/4-243--------------------------------------------------------------FRD.L---H...T...G.
D2SNG0_STRFR/150-408--------------------------------------------------------------LRRLL---D...SK..E.
D2YH96_VIBMI/2-242--------------------------------------------------------------FKN.M---H...KME.D.
D3AHD3_9CLOT/10-248--------------------------------------------------------------LAE..---........G.
D3AHD4_9CLOT/10-270--------------------------------------------------------------LFEKG---E.........
D3EII1_GEOS4/13-252--------------------------------------------------------------FKK.L---H.....S.N.
D3V3K7_XENBS/39-278--------------------------------------------------------------FRQ.L---H...EEG...
D4AZN8_ARTBC/10-268--------------------------------------------------------------LRS.L---H...RKG.N.
D4GMW6_PANAM/2-261--------------------------------------------------------------IKKLI---A...EK..G.
D4LCE5_RUMC1/6-261--------------------------------------------------------------LGSLL---K...NG..A.
PEPM_STRHY/22-268--------------------------------------------------------------LRYLL---H...AP..G.
Q01YZ5_SOLUE/12-251--------------------------------------------------------------FRA.L---H...DGP.G.
OADC_RHOP5/10-250--------------------------------------------------------------LRAIL---S.....GSH.
Q08U27_STIAD/11-246--------------------------------------------------------------FRA.L---H...APG.Q.
Q0BYP5_HYPNA/11-255--------------------------------------------------------------FAS.L---H...GGA.Q.
Q0RPX9_FRAAA/13-247--------------------------------------------------------------FRE.L---H...RPG.V.
Q0ZQ45_9ACTO/7-253--------------------------------------------------------------LRRAI---A...RG..G.
Q12Q29_SHEDO/14-259--------------------------------------------------------------LKDIL---L...SP..T.
Q1GKC0_SILST/10-253--------------------------------------------------------------FAA.L---H...QKG.D.
Q1GQT2_SPHAL/9-246--------------------------------------------------------------FRA.L---H...VPG.D.
Q1MM68_RHIL3/10-253--------------------------------------------------------------FGA.L---H...RKG.D.
Q28RZ5_JANSC/10-249--------------------------------------------------------------FAR.L---H...QSG.C.
Q2CCZ7_9RHOB/9-248--------------------------------------------------------------FRA.L---H...KPG.A.
Q2JAX2_FRASC/15-255--------------------------------------------------------------FRE.L---H...EQA.S.
Q3KEA6_PSEPF/8-242--------------------------------------------------------------FHQ.L---H...HD..D.
Q4DNR3_TRYCC/14-261--------------------------------------------------------------LKSML---R...SK..E.
Q4KET5_PSEF5/11-270--------------------------------------------------------------LSQLL---R...RK..R.
Q4ZV58_PSEU2/7-249--------------------------------------------------------------FRK.L---H...EHD.E.
Q5E5F2_VIBF1/18-278--------------------------------------------------------------LINVI---K...SH..G.
Q5LNA0_SILPO/10-253--------------------------------------------------------------FAA.L---H...RPG.Q.
Q5LUG9_SILPO/10-245--------------------------------------------------------------FRT.L---H...VPG.N.
Q5WBL4_BACSK/19-257--------------------------------------------------------------FRC.L---H...EQS.S.
Q65ND9_BACLD/10-248--------------------------------------------------------------FLD.L---H...HQS.D.
Q72PY6_LEPIC/12-252--------------------------------------------------------------FRS.L---H...ER..G.
Q7NXV8_CHRVO/33-277--------------------------------------------------------------FRR.L---H...QDE.R.
Q7P124_CHRVO/3-243--------------------------------------------------------------FAQ.L---H...RQA.E.
Q893V9_CLOTE/153-411--------------------------------------------------------------LRQLL---K...LR..P.
Q8EI00_SHEON/9-240--------------------------------------------------------------FKA.L---H...QQS.E.
Q8KJ74_RHILI/14-259--------------------------------------------------------------LRRMI---A...SS..E.
Q9LPL2_ARATH/39-259--------------------------------------------------------------MQSRV---H...RL..IE

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------ARNAL---YYLREIFRH-
A8YCL3_MICAE/183-1018--------------------------------------------------------------VDYAL---HYFDEVLFD-
CAPP_ACTP2/128-879--------------------------------------------------------------AKWGM---AIIENSLWK-
A0ZJ69_NODSP/196-1034--------------------------------------------------------------VDYAL---HYFQEVLFD-
CAPP_SYNP6/236-1053--------------------------------------------------------------VDYAL---HYFQEVLFE-
D3VH32_XENNA/127-879--------------------------------------------------------------AKWGF---AVVENSLWE-
Q474V2_CUPPJ/200-1006--------------------------------------------------------------IDNAL---SYYRTTFLH-
A0N072_CITSI/164-967--------------------------------------------------------------MRAGM---SYFHETIWK-
Q2KZS8_BORA1/137-936--------------------------------------------------------------IENAL---SYYRSTFLP-
B5W9X1_SPIMA/196-1035--------------------------------------------------------------VEYSL---HYFQEILFD-
D2QW47_PIRSD/157-942--------------------------------------------------------------VERGL---S.ITPRLWE-
A5GVT4_SYNR3/167-992--------------------------------------------------------------VDYAL---HFFQQVLFQ-
C6D470_PAESJ/147-936--------------------------------------------------------------VRNGL---YYFDETLFE-
A3IQQ1_9CHRO/183-1016--------------------------------------------------------------VDYTL---HYFDEVLCD-
A3JFS1_9ALTE/116-876--------------------------------------------------------------AKWGF---AVIENSLWS-
B8HVC9_CYAP4/199-1018--------------------------------------------------------------VEYSL---HYFKEVVFE-
C1F4Y2_ACIC5/161-947--------------------------------------------------------------IKMGL---DYYEVSIFE-
CAPP_SYNY3/193-1034--------------------------------------------------------------VDYSL---HYFDEVLFD-
CAPP_ECOK1/128-883--------------------------------------------------------------AKWGF---AVVENSLWQ-
B1XMB9_SYNP2/163-995--------------------------------------------------------------VDYAL---HYFEEVLFD-
A4S610_OSTLU/183-1007--------------------------------------------------------------MRAGL---TYFQQTIWD-
A9RUR8_PHYPA/162-969--------------------------------------------------------------MRAGM---SYFHETIWN-
C6J5X1_9BACL/143-933--------------------------------------------------------------VRNGM---YYFHETLFH-
B8GNA5_THISH/143-947--------------------------------------------------------------IKYGL---FYFEESLFN-
CAPP_HAHCH/132-881--------------------------------------------------------------AKWGF---AVIENSLWQ-
B1Y159_LEPCP/163-950--------------------------------------------------------------IENAL---SYYRSTFLR-
CAPP_THEEB/197-1011--------------------------------------------------------------VEYTL---HYFKEVIFA-
A4NFT0_HAEIF/128-879--------------------------------------------------------------AKWGF---AMLENSLWQ-
A9S2G6_PHYPA/161-965--------------------------------------------------------------MRAGM---SYFHETIWN-
Q54JZ3_DICDI/144-931--------------------------------------------------------------AQGGF---SVIEQTLWH-
CAPP_ACIBT/133-894--------------------------------------------------------------AKWGF---ATIEQTLWN-
B4VT20_9CYAN/197-1034--------------------------------------------------------------VDYTL---HYFQEVLFD-
C1MJ77_MICPC/164-991--------------------------------------------------------------MRAGL---SYFNDTLFE-
A2C517_PROM1/168-994--------------------------------------------------------------VDYAL---HYFQQVLFD-
E0UJ33_CYAP2/184-1020--------------------------------------------------------------VDYSL---HYFNEVLFE-
B7DNZ9_9BACL/131-906--------------------------------------------------------------VRNGL---YFLDQILFD-
B4WPD5_9SYNE/199-1032--------------------------------------------------------------VEFTL---HYFDVVLFD-
A4CSJ4_SYNPV/168-991--------------------------------------------------------------VDYAL---HYFQQVLFG-
A5WCX5_PSYWF/133-932--------------------------------------------------------------INNGL---HYFNASLFT-
A0JSJ3_ARTS2/161-954--------------------------------------------------------------ARNAI---YYLNSILTD-
B7G725_PHATC/84-877--------------------------------------------------------------AAGGN---AILESVLWD-
B8KBA6_VIBPA/130-880--------------------------------------------------------------AKWGF---AVVENSLWE-
CAPP_GLOVI/141-939--------------------------------------------------------------VAHTV---HYFEEVLFE-
C5Z450_SORBI/157-961--------------------------------------------------------------MRYGM---SYIHETVWN-
C3X714_OXAFO/147-957--------------------------------------------------------------INNAL---SYYRITFLR-
C8PZR0_9GAMM/162-956--------------------------------------------------------------IDNGI---AYFDLSFFE-
D1CE74_THET1/138-931--------------------------------------------------------------VYNSL---YFFQESVFE-
Q117S5_TRIEI/186-1038--------------------------------------------------------------VETTL---HYFNEVLFD-
C1AE63_GEMAT/147-933--------------------------------------------------------------VKNGI---AYFRSTFFT-
A9QPD2_METI4/151-931--------------------------------------------------------------VRTGL---WYFEHTLWD-
B0BZ90_ACAM1/184-1012--------------------------------------------------------------VEYSL---HYFREVLFD-
A4X3B0_SALTO/171-972--------------------------------------------------------------ARNAI---YYLRDLYAE-
E3JCU0_FRASU/173-968--------------------------------------------------------------ARSAA---YYLTSIATD-
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------VDYTL---HYFEEVLFQ-
CAPP_PROMS/165-989--------------------------------------------------------------VDYAL---HYFQQVLFN-
A9IDM8_BORPD/139-951--------------------------------------------------------------IENAL---SYYRSTFLN-
A0L255_SHESA/136-889--------------------------------------------------------------ARWGL---STIEESLWH-
A4G3V1_HERAR/147-944--------------------------------------------------------------INNAL---SYYRMTFLR-
C1DZM5_MICSR/162-982--------------------------------------------------------------MRAGL---SYFNETVFE-
D0CKG9_9SYNE/185-1009--------------------------------------------------------------VDSTL---HYFQQVLFD-
D3EKG0_GEOS4/142-928--------------------------------------------------------------VRNGM---YYFHETLFH-
A3YUN9_9SYNE/171-1002--------------------------------------------------------------VDYAL---HYFQQVLFD-
A0YPE3_LYNSP/196-1038--------------------------------------------------------------VDYTL---HYFQEVLFD-
B1VUI2_STRGG/125-909--------------------------------------------------------------ARNAI---YYLDELHTG-
CAPP1_CHLRE/154-974--------------------------------------------------------------MRSGL---SYFSTVIFD-

PF15617

H4XEK7_ECOLX/4-311----------------------------------------------------------------RLS---PWNLGATLYM
D5CKQ7_ENTCC/4-311----------------------------------------------------------------RLS---PWNLGATLYM
B2NP51_ECO57/4-311----------------------------------------------------------------RLS---PWNLGATLYM
A7MPV2_CROS8/4-311----------------------------------------------------------------RLS---PWNLGATLYM
C4XDI3_KLEPN/4-311----------------------------------------------------------------QPT---PWELGATLYM
B5RKC3_KLEP3/4-311----------------------------------------------------------------QPT---PWELGATLYM
D0KLU5_PECWW/4-310----------------------------------------------------------------RLS---PWNLGATLYM
B4EW80_PROMH/4-311----------------------------------------------------------------RLS---PWNLGATLYM
D3V2D7_XENBS/4-313----------------------------------------------------------------IPS---PHQLGATLYI
A4TRW8_YERPP/4-311----------------------------------------------------------------TPS---AYALGATLYM
B1JNG5_YERPY/4-311----------------------------------------------------------------TPS---AYALGATLYM
E1PL56_PANVC/4-311----------------------------------------------------------------NIS---PFMLGATLYM
D3VJW5_XENNA/4-312----------------------------------------------------------------IPS---PHQLGATLYM
E2MHA5_PSEUB/3-308----------------------------------------------------------------LFS---PYALGATLYM
Q4ZYA8_PSEU2/3-308----------------------------------------------------------------LFS---PYALGATLYM
F3K7E7_PSESZ/3-308----------------------------------------------------------------LFS---PYALGATLYM
Q39AX0_BURS3/4-309----------------------------------------------------------------TIS---PFALGATLYM
Q6FAX8_ACIAD/1-293----------------------------------------------------------------MLS---ALSLGATLYI
A5WBK4_PSYWF/17-345----------------------------------------------------------------PLH---PYQLGASLYM
Q4FTQ0_PSYA2/59-379----------------------------------------------------------------MHH---PYQLGASLYM
Q5NWT6_AROAE/1-302----------------------------------------------------------------MRD---ATELGASLYL
D3RPA3_ALLVD/1-291----------------------------------------------------------------MLD---AYRLGGSLYV
Q1QCR8_PSYCK/1-326----------------------------------------------------------------MHH---PYQLGASLYM
B6C0F8_9GAMM/22-320----------------------------------------------------------------IPH---YMELGATLYM
A1VWQ0_POLNA/1-302----------------------------------------------------------------MAE---KKMLGASLYV
G2TCW8_RHORU/5-304----------------------------------------------------------------ISA---.LRLGASLYV
Q9RSA7_DEIRA/8-310----------------------------------------------------------------PLS---PWQLGASLYA
D5BYR3_NITHN/21-319----------------------------------------------------------------IPC---YMELGATLYM
D8K7I6_NITWC/22-320----------------------------------------------------------------IPH---YMELGATLYM
E8U9R3_DEIML/2-300----------------------------------------------------------------LNF---PFALGASLYI
A8MM95_ALKOO/30-369----------------------------------------------------------------DKL---AYSLGATLYM
Q891X5_CLOTE/30-390----------------------------------------------------------------TYM---QYALGATLYM
A8F9P5_BACP2/30-380----------------------------------------------------------------HVL---AHALGSTLYM
C9RML9_FIBSS/26-375----------------------------------------------------------------SLL---QYCLGATMYM
E3IYR0_FRASU/30-389----------------------------------------------------------------RLV---ATALGATLYA
Q9KY27_STRCO/30-382----------------------------------------------------------------RLL---SAALGATLYS
E3DTS5_BACA1/30-372----------------------------------------------------------------KLL---EQALGAVLYM
Q5YN23_NOCFA/30-379----------------------------------------------------------------ELL---AIALGATLYA
B1HUS4_LYSSC/26-382----------------------------------------------------------------DIL---SYALGATLYM
F2JGK5_CELLD/30-386----------------------------------------------------------------EKL---SYALGATLYI
I0UNS1_BACLI/30-379----------------------------------------------------------------RIL---EYALGAALYV
D1BEK0_SANKS/30-379----------------------------------------------------------------GML---AVGLGATLYS
D1A9P4_THECD/30-379----------------------------------------------------------------ALL---AVALGATLYS
C9ZE12_STRSW/30-382----------------------------------------------------------------RIL---AAALGATLYS
F4H5N5_CELFA/32-382----------------------------------------------------------------ALL---AVALGATLYM
B7HBK1_BACC4/30-359----------------------------------------------------------------EQL---AYALGATLYT
B7IMX8_BACC2/30-359----------------------------------------------------------------EQL---AYALGATLYT
C8W644_DESAS/30-382----------------------------------------------------------------KTL---SYSLGATLYM
Q82B97_STRAW/30-381----------------------------------------------------------------RVL---AAALGATLYS
Q0SDY5_RHOSR/44-394----------------------------------------------------------------TVL---AVALGATLYV
Q72YD0_BACC1/30-359----------------------------------------------------------------EQL---AYALGATLYT
C1B1Z6_RHOOB/52-402----------------------------------------------------------------TVL---AVALGATLYV
A4J1D5_DESRM/16-371----------------------------------------------------------------DTL---AHALGATLYM
C0ZNQ3_RHOE4/41-390----------------------------------------------------------------DLL---AIALGATLYV
C0Z9Y5_BREBN/30-389----------------------------------------------------------------EVL---AHALGATLYM
Q186J7_CLOD6/30-356----------------------------------------------------------------DVL---KYALGAFLYV
E3EE66_PAEPS/10-379----------------------------------------------------------------SIL---AYAIGAALYM
F4D0A7_PSEUX/30-386----------------------------------------------------------------ELL---SVALGATLYM
E6UGJ0_RUMA7/26-378----------------------------------------------------------------ELL---QYCLGATMYM
D0L8D1_GORB4/35-383----------------------------------------------------------------TQL---ALALGATLYV
B1VYI2_STRGG/30-406----------------------------------------------------------------RML---SVALGATLYS
C9XQK5_CLODC/30-356----------------------------------------------------------------DVL---KYALGAFLYV
F4EXE4_9FIRM/15-342----------------------------------------------------------------EIL---QYKVGGLLYM
C8XAU7_NAKMY/30-380----------------------------------------------------------------SVL---AHALGATLYV
A8L403_FRASN/30-389----------------------------------------------------------------RLV---ATALGATLYA
A6WD82_KINRD/30-386----------------------------------------------------------------DEL---AVALGATLYC
Q0RDF4_FRAAA/30-389----------------------------------------------------------------RLL---ATALGATLYA
A2RKY2_LACLM/29-399----------------------------------------------------------------EML---ASSLGASIYC
Q2J6S0_FRASC/45-404----------------------------------------------------------------HLL---ATALGATLYA
E3PRQ7_CLOSD/30-378----------------------------------------------------------------NQL---RYALGATLYL

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------EVAAV---KNWWKDSRWR
ACEA_YEAST/22-550--------------------------------------------------------------DAAEI---EKWWSDSRWS
ACEA_CANTR/18-543--------------------------------------------------------------EVAEI---KKWWSEPRWR
ACEA1_SOYBN/3-534--------------------------------------------------------------EVAEV---QAWWNSERFR
ACEA_YARLI/10-536--------------------------------------------------------------EVEEI---KKWWSSPRWK
ACEA_ECOLI/7-434--------------------------------------------------------------QIEEL---QKEWTQPRWE
ACEA_NEUCR/23-547--------------------------------------------------------------EVEEV---KKWWSDSRWR

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------PALSG---DLGTFMAWVD
PT1_STACT/251-543--------------------------------------------------------------KQELQ---KLRDAESVTA
PT1_CUPNH/262-557--------------------------------------------------------------KKRLQ---RLRHTPAVTL
PPDK_CLOSY/515-871--------------------------------------------------------------ASVSG---SFERIMVWAD
PPDK_FLATR/595-953--------------------------------------------------------------PAMSN---DLEIFMSWAD
PPDK_ENTHI/515-879--------------------------------------------------------------QVGSG---YFGTILKWAN
PT1_ECOLI/250-542--------------------------------------------------------------KAELA---KLKDLPAITL
PT1_HAEIN/250-542--------------------------------------------------------------KAELA---KLKDLPAITL
PT1P_ECOLI/416-708--------------------------------------------------------------SRLAE---DDVNLPAQLK
PPSA_PYRFU/496-796--------------------------------------------------------------KAEGG---QVVVAGAPLV
PT1_MYCCT/251-542--------------------------------------------------------------KEQLK---KFKDEPSLTK
PTFAX_RHOCA/518-804--------------------------------------------------------------RELEA---RERYKPALTV
PT1_GEOSE/256-548--------------------------------------------------------------KAEWA---KLVHEATVTA
PTFAX_XANCP/521-808--------------------------------------------------------------REREA---AQRALPAETT
PT1_STRMU/252-546--------------------------------------------------------------KAEWA---LLKDAETVTA
PTFX2_ECOLI/362-654--------------------------------------------------------------REQQR---VWLTQQARTA
PPSA_STAMF/504-813--------------------------------------------------------------VAGVG---ISPEQLLPLY

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK2_ECOLI/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYK1_TRYBB/19-364--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_GEOSE/2-346--------------------------------------------------------------------------------
KPYK_HYPJE/41-388--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK_LACDE/1-346--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------

PF02548

Q6BIM6_DEBHA/32-295--------------------------------------------------------------K..RK...TLLDIQRLYE
PANB_HALHL/12-270--------------------------------------------------------------G..AV...TVSRMRAMKR
PANB_SACD2/10-267--------------------------------------------------------------K..KV...TVNTLRKMKA
PANB_ECOUT/2-260--------------------------------------------------------------K..PT...TIASLQKCKQ
PANB2_METPP/15-275--------------------------------------------------------------K..PV...TLHTLREMHA
PANB_AERPE/4-261--------------------------------------------------------------D..KV...TARRILKMKG
A6DLB6_9BACT/1-261--------------------------------------------------------------M..RN...TVSDIWKLYK
PANB_OCEIH/1-257--------------------------------------------------------------M..K....ALKDFMRMKH
A3W152_9RHOB/5-264--------------------------------------------------------------R..KT...RLKHLAEKVQ
PANB_THEP3/3-263--------------------------------------------------------------E..KV...STLTLRKFKK
PANB_DESPS/1-261--------------------------------------------------------------M..RK...TVVDIIAMKA
A0XYQ5_9GAMM/2-260--------------------------------------------------------------S..KI...TVSTLNKMKA
PANB_ROSDO/8-265--------------------------------------------------------------T..AP...MPVDIKSRKG
C5B0Y2_METEA/8-268--------------------------------------------------------------R..RL...QAVDLIKRKA
PANB_PSEPF/2-261--------------------------------------------------------------P..AI...TLTTLQSLKQ
PANB_ALCBS/1-259--------------------------------------------------------------M..SI...TIRTLQKRKQ
PANB_GEOLS/3-262--------------------------------------------------------------K..KI...TIPEILLMKQ
PANB_ALKMQ/4-262--------------------------------------------------------------K..K....SILDLMKMKK
Q0FZZ2_9RHIZ/8-265--------------------------------------------------------------K..RR...TAPDIRAMKG
Q5UF70_9PROT/3-264--------------------------------------------------------------K..SI...TIEDFRNHKK
A3F328_BACIU/1-260--------------------------------------------------------------M..K....TKLDFLKMKE
PANB_CHRSD/2-260--------------------------------------------------------------K..TV...TLSRLNAFKH
A4A9Z8_9GAMM/3-260--------------------------------------------------------------K..KV...TISTLDKMKA
PANB_SALRD/2-262--------------------------------------------------------------P..RV...TTKTVQEMKE
PANB_METCA/3-261--------------------------------------------------------------D..PV...TLPDLLAMKR
A4BLN5_9GAMM/12-271--------------------------------------------------------------P..SV...NVTRLLQMKA
PANB_PYRAR/4-259--------------------------------------------------------------K..KR...RVTDFVKGGG
PANB_HELHP/4-261--------------------------------------------------------------K..KM...SIATLKAKKG
PANB_NITEC/7-266--------------------------------------------------------------K..RI...TVLTLQNIYR
PANB_CAMJR/2-259--------------------------------------------------------------R..K....SILSFLEKKG
A4TBM9_MYCGI/21-280--------------------------------------------------------------V..KV...RTHHLHKWKS
A4SZR6_POLSQ/8-267--------------------------------------------------------------K..PI...TITKLLAMHA
A5DHH9_PICGU/31-293--------------------------------------------------------------T..RK...TLADIKQLYE
A3EWD3_9BACT/4-264--------------------------------------------------------------Q..PM...TIDQFPVRKK
PANB_PYRAB/2-259--------------------------------------------------------------R..EI...TPRKIIEMKG
A6GSM9_9BURK/14-273--------------------------------------------------------------K..AV...TLPALLEMKK
Q75D37_ASHGO/23-289--------------------------------------------------------------K..QK...TIPDIFKKYH
PANB_AQUAE/1-261--------------------------------------------------------------M..AI...NLQTLFKKKR
PANB_XANOR/8-266--------------------------------------------------------------N..PW...TVPALAQAKR
A7G0V7_CLOBH/1-261--------------------------------------------------------------M..RN...TVSTFQELKN
PANB_CORDI/3-260--------------------------------------------------------------R..PV...RLQDLRDYKK
PANB_NITMS/1-260--------------------------------------------------------------M..HK...SVQDIVNMKK
PANB_ANAMM/1-257--------------------------------------------------------------M..LL...NILDIQAKKG
A8DJM8_9BACT/4-264--------------------------------------------------------------S..RV...TPGDLTRIKA
PANB_BUCAP/2-260--------------------------------------------------------------E..SI...TISKIQNWKK
A8ZX35_DESOH/1-254--------------------------------------------------------------M..K....ALSVFRDYKK
PANB_ROSCS/1-260--------------------------------------------------------------M..RK...TITDIQQMKV
PANB_THIDA/1-259--------------------------------------------------------------M..PV...TLSTLKALRQ
PANB_TRIEI/1-261--------------------------------------------------------------M..AV...TTKQLIQWKQ
Q1YYG7_PHOPR/2-260--------------------------------------------------------------K..KI...TISDLNNWKA
PANB_SYNFM/1-262--------------------------------------------------------------MKNRV...TVPEIIASKG
A4BJA6_9GAMM/3-261--------------------------------------------------------------K..TI...TVSQIKQLVS
A5DVU0_LODEL/35-295--------------------------------------------------------------V..KK...TISYIQNLYH
PANB_LEPBJ/1-262--------------------------------------------------------------M..KN...IHKIFSPEKK
PANB_METS4/15-273--------------------------------------------------------------P..PV...TIPMLQAWRA
PANB_CHRVO/1-259--------------------------------------------------------------M..KI...TVNTLHKLAE
PANB_HALMA/1-257--------------------------------------------------------------M..P....TVRDLQAMAG
O82357_ARATH/40-306--------------------------------------------------------------Q..RV...TLTHLRQKHR
PANB_CAMC1/9-266--------------------------------------------------------------K..KL...TINDIKNKKG
PANB_RALSO/11-269--------------------------------------------------------------K..AV...TVTSLQGMRA
PANB_COXBU/3-262--------------------------------------------------------------A..M....NTPDFQRMKK
A4ET65_9RHOB/36-279--------------------------------------------------------------R..NY...TIADLKALKG
A3ZKV5_9PLAN/9-265--------------------------------------------------------------D..RI...TVPKFVAMKR
PANB_MAGSA/8-266--------------------------------------------------------------K..RI...TTRDIRARKG
PANB_ANADE/9-273--------------------------------------------------------------K..HV...NIHELRRMKE
PANB_YEAST/24-291--------------------------------------------------------------K..YN...TIQDIRNKYF
A3JDV2_9ALTE/1-259--------------------------------------------------------------M..AV...TINTLREYKQ
A5P8F6_9SPHN/22-283--------------------------------------------------------------K..RL...TVPKIRAHKA
PANB1_ZYMMO/32-297--------------------------------------------------------------K..KT...TTARISQMRV
A4RSY4_OSTLU/34-300--------------------------------------------------------------T..RF...TLGELRKKYQ
PANB_ACIC1/9-268--------------------------------------------------------------R..RV...TIHDLQLRKR
PANB_BDEBA/1-259--------------------------------------------------------------M..K....TILDFHDKKS
PANB_DECAR/8-267--------------------------------------------------------------R..RL...TQADLAKLYQ
PANB1_METPP/12-271--------------------------------------------------------------K..KR...TITEIRDSKK
A7BVR3_9GAMM/2-261--------------------------------------------------------------S..RI...TLTQLRKLKA
Q54LH3_DICDI/90-350--------------------------------------------------------------K..KK...TVLDILKKYK
PANB_HELPJ/9-266--------------------------------------------------------------K..KI...TLSHLQAKKN
Q6CE35_YARLI/39-299--------------------------------------------------------------K..KV...TIPELAKMRR
PANB_RHOBA/9-265--------------------------------------------------------------S..RI...TTRTLQRMRD
PANB_DEHE1/1-261--------------------------------------------------------------M..RT...TISQLKEMKQ
PANB_MAGSM/3-263--------------------------------------------------------------K..RV...RVPDLVRMKQ
Q6CLY9_KLULA/31-297--------------------------------------------------------------H..QL...TVKDIMAKYH
PANB_THET2/1-258--------------------------------------------------------------M..RR...TVKDFRNAK.
Q7NSX9_CHRVO/9-255--------------------------------------------------------------R..RV...TVPAIRNSKG
PANB_KORVE/10-270--------------------------------------------------------------S..KV...TSSTLLDKKS
Q841Y3_CAMFE/9-266--------------------------------------------------------------K..KV...TINDLFMMKN
PANB_HERA2/1-259--------------------------------------------------------------M..RT...QLSDIQRMKD
PANB_CAUCR/10-267--------------------------------------------------------------R..RL...AAPDIAARKG
PANB_NOCSJ/33-292--------------------------------------------------------------K..RI...RTHHLREMKQ
Q2UMW5_ASPOR/70-332--------------------------------------------------------------K..KV...TLQTLRNLHK
PANB_FRATO/1-259--------------------------------------------------------------M..K....SVLGFKKAKV
A4GIZ2_9DELT/4-264--------------------------------------------------------------R..PV...TTPEILGRKK
PANB_CHLCH/10-274--------------------------------------------------------------A..HV...TTRRLLDMKQ
PANB_LEGPL/1-259--------------------------------------------------------------M..K.....IHDFKIKKQ
A7TTC6_VANPO/35-302--------------------------------------------------------------K..RK...SILDLNKKYL
B4U641_HYDS0/3-262--------------------------------------------------------------N..KL...NIELLFKKKK
A7I1C3_CAMHC/2-260--------------------------------------------------------------K..TI...TPNAIIAKKN
A5L777_9GAMM/1-252--------------------------------------------------------------M..KH...TPSSFVEMKG
PANB_BACSK/1-260--------------------------------------------------------------M..K....TTKTFKQMKR
PANB_SULSO/2-260--------------------------------------------------------------K..KV...TIRDFIKKKS
Q5ABB3_CANAL/27-288--------------------------------------------------------------A..RK...TIADIHELYK
A3D6H9_SHEB5/8-266--------------------------------------------------------------N..RV...TPVTLQKMKG
PANB1_PSEF5/6-266--------------------------------------------------------------RTQRL...SVPQLVAMKG
A5FWA4_ACICJ/8-270--------------------------------------------------------------R..KADRKSIGSWERAKR
PANB_NITSB/3-256--------------------------------------------------------------K..RH...TVNTIKSAKN
PANB_MARMS/12-270--------------------------------------------------------------K..AV...TLSTLKKMKA
A7BDA4_9ACTO/24-281--------------------------------------------------------------Q..RV...RIQHIARAKA
Q8GDR8_HELMO/3-263--------------------------------------------------------------K..KI...TLPQFKVRKE
PANB_STAMF/2-259--------------------------------------------------------------K..KI...TIRDILKMKG
PANB_TROWT/12-268--------------------------------------------------------------R..RT...RIHRFHKGSC
A4GK01_9BACT/1-254--------------------------------------------------------------M..K....KIKKIINKKN
PANB_DEIGD/1-259--------------------------------------------------------------M..KR...SVPDLMNAS.
B1K6U2_BURCC/8-266--------------------------------------------------------------T..RK...TVTAIRSTKG
PANB_WIGBR/2-261--------------------------------------------------------------K..KT...NIYDLYKLKE
PANB_DESVH/19-278--------------------------------------------------------------R..PL...TTADIRKAKG
A3WLA3_9GAMM/2-260--------------------------------------------------------------V..AM...TIAKLQKKKQ
PANB_CORGB/9-268--------------------------------------------------------------K..KI...RTRHFREAKV

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------IPRTM---STQHPDNVHT
B1V5L0_CLOPF/3-537--------------------------------------------------------------IPCSM---MTQHPDN...
D2PDY7_SULID/4-511--------------------------------------------------------------IPRTM---STQHPDNAKV
D3S0D1_FERPA/2-476--------------------------------------------------------------VPRVM---STQHPDNANV
B5YCF7_DICT6/5-497--------------------------------------------------------------IPRTM---STQHPDNANV
CAPPA_HALSA/4-492--------------------------------------------------------------VPRLM---STQHPDNATL
C6HVN3_9BACT/19-520--------------------------------------------------------------IPTTM---ATQHPDNAAP
A3EQI3_9BACT/19-520--------------------------------------------------------------IPTTM---ATQHPDNARA
CAPPA_PYRCJ/3-459--------------------------------------------------------------IPRLM---CTQHPD....
CAPPA_METTH/3-483--------------------------------------------------------------VPRCM---STQHPDNVNP
CAPPA_PYRAB/2-469--------------------------------------------------------------IPRIM---STQHPDNYSI
CAPPA_METMA/7-526--------------------------------------------------------------YPKVM---CTQHPDS...
CAPPA_METKA/9-532--------------------------------------------------------------IARTL---ATQHPD....
F0LK16_THEBM/2-476--------------------------------------------------------------IPKTM---STQHPDNVYI
A8A9C2_IGNH4/3-488--------------------------------------------------------------VPKLM---ATQHPD....
CAPPA_SULTO/4-511--------------------------------------------------------------IPRTM---STQHPDNARV
B1I2W1_DESAP/7-489--------------------------------------------------------------ISRTM---STQHPDNVTV
B1YBY2_THENV/2-461--------------------------------------------------------------IPRLM---CTQHPD....
CAPPA_PICTO/6-508--------------------------------------------------------------IPKTM---STQHPDNAKM
CAPPA_CALMQ/4-512--------------------------------------------------------------IPRTM---CTQHPDYANV
CAPPA_METS5/4-509--------------------------------------------------------------IPRTM---STQHPDNATV
Q1PXR4_9BACT/4-490--------------------------------------------------------------IPRTM---STQHPDNVIM
CAPPA_ARCFU/2-471--------------------------------------------------------------VPRVM---STQHPDNARI
CAPPA_PYRAR/4-460--------------------------------------------------------------IPRLM---CTQHPD....
CAPPA_PYRAE/3-460--------------------------------------------------------------IPCLM---CTQHPD....
C6A2T7_THESM/11-485--------------------------------------------------------------IPRTM---STQHPDNVYI
CAPPA_SULAC/4-511--------------------------------------------------------------IPRTM---STQHPDNAKV

PF01274

MASY_EMENI/11-531------------------------------------------------ITGPTD.RK-----------------------
MASZ_CORGL/35-713------------------------------------------------PIGKAD.KT-----------------------
MASY_MYXXD/17-538------------------------------------------------ITGPVD.RK-----------------------
MASZ_ECOLI/17-697------------------------------------------------RIGKDD.PA-----------------------
Q9RYN3_DEIRA/10-521------------------------------------------------ITGPVD.RK-----------------------
MASY_PICAN/21-543------------------------------------------------ITGPPD.AK-----------------------
MASZ_PSEFL/17-697------------------------------------------------PVGQTD.AA-----------------------
MASY_MAIZE/16-548------------------------------------------------ITGPAEPRK-----------------------
MASY_STRAE/10-542------------------------------------------------ITGPTD.RK-----------------------
MASY_NEUCR/11-531------------------------------------------------ITGPTD.RK-----------------------
MASY_STRCL/10-540------------------------------------------------ITGPAD.RR-----------------------
MASY_BRANA/21-551------------------------------------------------ITGPVE.RK-----------------------
MASY_ECOLI/11-533------------------------------------------------ITGPVE.RK-----------------------
MASZ_MYCLE/17-704------------------------------------------------PIGKTD.PV-----------------------
MASY_CANTR/15-540------------------------------------------------ITGPTD.RK-----------------------
MASY_YEAST/18-542------------------------------------------------ITGPPL.RN-----------------------

PF03328

Q9RYM1_DEIRA/24-251------------------------------------------------LWLGLADPY-----------------------
Q8XL94_CLOPE/6-225------------------------------------------------MFVPGSKPA-----------------------
BPHF_SPHAR/18-244------------------------------------------------FWLALAHPD-----------------------
Q9CGA8_LACLA/9-229------------------------------------------------MFVPGNNPA-----------------------
O22982_ARATH/17-240------------------------------------------------HFLLSFSPE-----------------------
Q8Z9M3_SALTI/5-223------------------------------------------------LFIPGANAA-----------------------
RHMA_ECOLI/19-246------------------------------------------------LWLSSTTAY-----------------------
Q8RDW5_FUSNN/9-227------------------------------------------------MFLPGNNPS-----------------------
GARL_ECOLI/20-246------------------------------------------------CWSALSNPI-----------------------
Q9KTU0_VIBCH/11-230------------------------------------------------LFVPGANAA-----------------------
Q93167_CAEEL/26-259------------------------------------------------LYVPASNQK-----------------------
Q9HRM8_HALSA/29-241------------------------------------------------LFSPGDQPS-----------------------
Q8XBS2_ECO57/20-239------------------------------------------------LFVPGANAA-----------------------
Q9UVD4_9ASCO/43-283------------------------------------------------VAHGIPSTF-----------------------
O82487_ARATH/90-322------------------------------------------------LFLLSFSPT-----------------------
HPCH_ECOLX/15-242------------------------------------------------LWLGLSSSY-----------------------
CITEL_DEIRA/9-223------------------------------------------------LFAPGNRAD-----------------------
Q8K7F2_STRP3/6-224------------------------------------------------MFVPGANAA-----------------------
Q8VQP0_RHOER/12-226------------------------------------------------LVAPGSDER-----------------------
BPHF_RHOSR/18-244------------------------------------------------FWLALGDAY-----------------------
Q9XY64_TRYCR/18-251------------------------------------------------VFLNSASHL-----------------------
Q9RLT5_WEIPA/10-229------------------------------------------------MFVPGNNPA-----------------------

PF13714

A0JTC7_ARTS2/12-246.---..IL........................................QVINVWDAI-----------------------
A0K276_ARTS2/27-270.---..PL........................................VLVNVWDVA-----------------------
A0NXG4_9RHOB/11-252.---..AF........................................LMPNPFDIG-----------------------
A0QPJ7_MYCS2/16-251.---..PG........................................VLPTVWDAW-----------------------
A0R0I0_MYCS2/10-256.---............................................VAPGAYDAL-----------------------
A1CA54_ASPCL/14-274.---..PL........................................VLTNVYDAA-----------------------
A1SIA9_NOCSJ/3-233.---..PL........................................LLPNAWDVP-----------------------
A2VJA9_MYCTU/3-230.---..PF........................................VLPNAWDVP-----------------------
A3I8T3_9BACI/7-245.---..LL........................................FLGNAWDVL-----------------------
A3NHT8_BURP6/20-277.---..AL........................................RFIESHSPI-----------------------
A3TPN1_9MICO/3-233.---..LF........................................VMPNAFDAG-----------------------
A3UJ38_9RHOB/7-249.---..PL........................................VLFNAWDAG-----------------------
A3WAP9_9SPHN/6-247.---..PL........................................VLFNVWDAG-----------------------
A3Y7J5_9GAMM/4-243.---..PL........................................LLANVWDAV-----------------------
A4AEG4_9ACTN/15-253.---..PL........................................IVTNVWDAV-----------------------
A4ET25_9RHOB/10-247.---..PI........................................VLYNIWDAG-----------------------
A4F7M3_SACEN/8-232.---..PL........................................LLPNAWDLA-----------------------
A4FH54_SACEN/26-273.---..PL........................................VLPNAWDAV-----------------------
A4X5C0_SALTO/32-264.---..PL........................................VLPNAWDAA-----------------------
A4X7L5_SALTO/4-223.---..PL........................................VLPNVWDVA-----------------------
A4XS21_PSEMY/12-254.---..LL........................................VLPNPWDAG-----------------------
A4YVZ4_BRASO/12-249.---..CF........................................VLPNPFDAG-----------------------
A5G4A7_GEOUR/12-254.---..TL........................................VLPNAWDVA-----------------------
A5LD69_STRPN/2-260.---..KM........................................KIIEAHDAL-----------------------
A5V3Q4_SPHWW/10-252.---..PL........................................RLVNVWDAG-----------------------
A8LYX8_SALAI/6-252.---GAPV........................................RAVGASNAL-----------------------
A8TK14_9PROT/10-251.---..CV........................................YPGSVYDPI-----------------------
A9DYN3_9FLAO/3-242.---..PL........................................LIANVWDVP-----------------------
A9WM41_RENSM/9-245.---...L........................................ILPNAWDAA-----------------------
B1IHA0_CLOBK/33-275.---..MF........................................ILPNAWDIG-----------------------
B1T3E7_9BURK/12-255.---..PL........................................ALFNVWDAG-----------------------
B1VSN1_STRGG/14-249.---..PL........................................VLPTVWDVW-----------------------
B4RBF1_PHEZH/10-242.---..IL........................................VLPNAWDAA-----------------------
B4SLQ1_STRM5/8-241.---..FY........................................VLPNVWDAG-----------------------
B4WCU0_9CAUL/11-249.---..GL........................................ILPNCWDAA-----------------------
B5HHA0_STRPR/15-253.---..ML........................................VLPNVWDAA-----------------------
B5HRK0_9ACTO/12-259.---..CF........................................LLPNAWDVG-----------------------
B5HVC7_9ACTO/7-239.---..PL........................................VLPGPWDAL-----------------------
B6HSS2_PENCW/11-259.---..PL........................................ILTNVYDAA-----------------------
B6YYQ6_9RHOB/10-253.---..PI........................................TIYNIWDAG-----------------------
B8H7Q2_ARTCA/13-246.---..IL........................................QVVNVWDAI-----------------------
B8J5T4_ANAD2/11-248.---..CF........................................VLPNPWDAG-----------------------
B8MDA8_TALSN/5-285.---.DRV........................................RLLEAHDHA-----------------------
B9JNZ3_AGRRK/15-273.---..FL........................................RFLDIHNAL-----------------------
B9K4D9_AGRVS/8-247.---..TF........................................IIPNPWDIG-----------------------
B9NN70_9RHOB/11-254.---..PV........................................ILYNIWDAG-----------------------
B9YYY5_9NEIS/10-252.---..AF........................................LMPNAWDAG-----------------------
C0CW09_9CLOT/6-270.---............................................LCGGVWDSL-----------------------
C0D909_9CLOT/255-518.---..FI........................................WAPCVYDCT-----------------------
C0RYY1_PARBP/55-297.---..PL........................................VLANIYDPT-----------------------
D7W5Q1_9FLAO/4-244.---..PL........................................LLGNVWNVE-----------------------
C1D0L9_DEIDV/16-251.---..IL........................................TLANVWDVV-----------------------
D5UDN5_CELFN/12-253.---..AL........................................VLPNAWDAA-----------------------
C2G595_9SPHI/6-241.---..PL........................................LLGNVWDAH-----------------------
C2SBC8_BACCE/6-244.---..IL........................................ILPNAWDVM-----------------------
C3K8Q8_PSEFS/8-242.---..LL........................................VLANVSDAG-----------------------
OADC_PSEFS/13-253.---..CV........................................ETASVFDPM-----------------------
C4RQC1_9ACTO/15-253.---..PL........................................VLPNAWDAG-----------------------
C5C673_BEUC1/6-244.---..PL........................................LLPNAWDLA-----------------------
C5ERW5_9FIRM/6-250.---............................................YVPEIYDCI-----------------------
C5K5X0_PERM5/22-289N---DGVI........................................RAMEAHSGL-----------------------
D9SPL5_CLOC7/7-255.---..TL........................................IMPDAFDPI-----------------------
C6CCM3_DICDC/20-260.---..PF........................................VMPNPWDCG-----------------------
C6W6H2_DYAFD/19-261.---..ML........................................VLPNIWDAA-----------------------
C7Q1F2_CATAD/16-252.---..VF........................................VIANAWDAG-----------------------
C7YUL0_NECH7/9-264.---..PI........................................VFPNVWDVA-----------------------
C7YZU2_NECH7/391-674.---..LIHPCPHLYQHQPQSSSINIAMSATQSKVDILRERLNTAKPAIAMAAHSPL-----------------------
D6Z4R6_DESAT/153-411.---..MV........................................RLMEAHNGL-----------------------
C8TDE8_KLEPR/3-239.---..PL........................................LLANVWDAS-----------------------
C9SRU6_VERA1/11-259.---..PL........................................ILPNIWDYA-----------------------
D5VJX4_CAUST/12-246.---..CF........................................ALPNPWDAG-----------------------
D1A2J0_THECD/5-232.---..PL........................................VLPNAWDVA-----------------------
D1BED0_SANKS/11-246.---..PL........................................VLPNAWDVA-----------------------
D1BI43_SANKS/12-247.---..PL........................................LLSTVWDVA-----------------------
D1RNP5_SEROD/10-245.---..PL........................................RLPNAWDAG-----------------------
D9TER7_MICAI/8-239.---..PL........................................LLPNAWDHA-----------------------
F0QAJ3_ACIAP/21-266.---..TG........................................FLMEAHNGL-----------------------
E3J806_FRASU/10-249.---..GL........................................VMPNAWDGL-----------------------
D2B1P9_STRRD/6-236.---..PL........................................LLPNAWDHA-----------------------
E3I6J4_RHOVT/30-272.---..AF........................................ILPEVWDVI-----------------------
D2MU75_CAMJU/150-410.---..LI........................................RGIESHSGI-----------------------
D2NZY3_LISM1/8-251.---..PL........................................ILYNCWDVA-----------------------
D2PR97_KRIFD/29-269.---..PL........................................VLPNVWDAA-----------------------
D2Q3B1_KRIFD/7-234.---..PL........................................VLPNAWDPV-----------------------
D2Q4L3_KRIFD/4-243.---..SF........................................VMPNAWDAG-----------------------
D2SNG0_STRFR/150-408.---..IV........................................RILEVHNGL-----------------------
D2YH96_VIBMI/2-242.---..PL........................................VICNVWDVP-----------------------
D3AHD3_9CLOT/10-248.---..QL........................................IAPDTFDGI-----------------------
D3AHD4_9CLOT/10-270.---..QV........................................FAPCVYDCM-----------------------
D3EII1_GEOS4/13-252.---..FF........................................ILPNAWDAA-----------------------
D3V3K7_XENBS/39-278.---..RL........................................ILANSWDVM-----------------------
D4AZN8_ARTBC/10-268.---..PL........................................VLCNVYDGR-----------------------
D4GMW6_PANAM/2-261.---..TL........................................IFIEAHNPL-----------------------
D4LCE5_RUMC1/6-261.---..PL........................................RILEAVNGL-----------------------
PEPM_STRHY/22-268.---..AC........................................QLMGVHDGL-----------------------
Q01YZ5_SOLUE/12-251.---..VF........................................IIPNPWDVG-----------------------
OADC_RHOP5/10-250.---..CT........................................RPASVYDPI-----------------------
Q08U27_STIAD/11-246.---..LL........................................VLPNVWDAM-----------------------
Q0BYP5_HYPNA/11-255.---..PL........................................VLVNIWDAG-----------------------
Q0RPX9_FRAAA/13-247.---..PL........................................VMPNAWDAG-----------------------
Q0ZQ45_9ACTO/7-253.---..MS........................................IAAGVHDGL-----------------------
Q12Q29_SHEDO/14-259.---..TE........................................YLMEAHNAI-----------------------
Q1GKC0_SILST/10-253.---..PV........................................VLYNIWDAA-----------------------
Q1GQT2_SPHAL/9-246.---..PL........................................ILVNIWDAG-----------------------
Q1MM68_RHIL3/10-253.---..PV........................................VLYNIWDAG-----------------------
Q28RZ5_JANSC/10-249.---...F........................................VMPNPWDRG-----------------------
Q2CCZ7_9RHOB/9-248.---..PF........................................ILANAWDIG-----------------------
Q2JAX2_FRASC/15-255.---..PF........................................VMANAWDAG-----------------------
Q3KEA6_PSEPF/8-242.---..LL........................................ILTNVADAT-----------------------
Q4DNR3_TRYCC/14-261.---..LS........................................FLMEAHNGL-----------------------
Q4KET5_PSEF5/11-270.---..CL........................................RVLEAHSPI-----------------------
Q4ZV58_PSEU2/7-249.---..LF........................................VMPNAWCEG-----------------------
Q5E5F2_VIBF1/18-278.---..CI........................................RILETHNPI-----------------------
Q5LNA0_SILPO/10-253.---..PL........................................ILYNAWDAG-----------------------
Q5LUG9_SILPO/10-245.---..PL........................................VMPNPWDIG-----------------------
Q5WBL4_BACSK/19-257.---..TF........................................VLPNAWDAM-----------------------
Q65ND9_BACLD/10-248.---..PF........................................VLPNAWDAA-----------------------
Q72PY6_LEPIC/12-252.---..TF........................................IMPNAWDAG-----------------------
Q7NXV8_CHRVO/33-277.---..PL........................................LLPTVWDAL-----------------------
Q7P124_CHRVO/3-243.---..PL........................................LLANVWDAA-----------------------
Q893V9_CLOTE/153-411.---..IV........................................KAIEVHNGI-----------------------
Q8EI00_SHEON/9-240.---..PL........................................ILTNAWDAA-----------------------
Q8KJ74_RHILI/14-259.---..LA........................................FAMEAHDGL-----------------------
Q9LPL2_ARATH/39-259E---QGAV........................................LIPGVYDAL-----------------------

PF00311

C7M9P2_BRAFD/148-942------------------------------------------------TMPEMLDDL-----------------------
A8YCL3_MICAE/183-1018------------------------------------------------SLPQLTLRL-----------------------
CAPP_ACTP2/128-879------------------------------------------------AVPDFCREL-----------------------
A0ZJ69_NODSP/196-1034------------------------------------------------GIPQLYKRL-----------------------
CAPP_SYNP6/236-1053------------------------------------------------AIPLLYQRF-----------------------
D3VH32_XENNA/127-879------------------------------------------------GVPAFLREF-----------------------
Q474V2_CUPPJ/200-1006------------------------------------------------GIPQLMSEL-----------------------
A0N072_CITSI/164-967------------------------------------------------GVPKFLRRV-----------------------
Q2KZS8_BORA1/137-936------------------------------------------------AIPRLYTGL-----------------------
B5W9X1_SPIMA/196-1035------------------------------------------------VIPQLYQRI-----------------------
D2QW47_PIRSD/157-942------------------------------------------------VVPQVYASM-----------------------
A5GVT4_SYNR3/167-992------------------------------------------------AMPLLHERI-----------------------
C6D470_PAESJ/147-936------------------------------------------------VLPNVYEEL-----------------------
A3IQQ1_9CHRO/183-1016------------------------------------------------ALPQLSKRL-----------------------
A3JFS1_9ALTE/116-876------------------------------------------------ALPRFLESL-----------------------
B8HVC9_CYAP4/199-1018------------------------------------------------IIPQLYRRI-----------------------
C1F4Y2_ACIC5/161-947------------------------------------------------TLPRLYEEV-----------------------
CAPP_SYNY3/193-1034------------------------------------------------AVPELSKRL-----------------------
CAPP_ECOK1/128-883------------------------------------------------GVPNYLREL-----------------------
B1XMB9_SYNP2/163-995------------------------------------------------TLPELSVRL-----------------------
A4S610_OSTLU/183-1007------------------------------------------------GIPTFMRRV-----------------------
A9RUR8_PHYPA/162-969------------------------------------------------GLPKFLRRV-----------------------
C6J5X1_9BACL/143-933------------------------------------------------VLPEVYQEL-----------------------
B8GNA5_THISH/143-947------------------------------------------------AVPITYRFL-----------------------
CAPP_HAHCH/132-881------------------------------------------------AVPDFMRQM-----------------------
B1Y159_LEPCP/163-950------------------------------------------------QIPRMYRAV-----------------------
CAPP_THEEB/197-1011------------------------------------------------VIPKLYRRL-----------------------
A4NFT0_HAEIF/128-879------------------------------------------------AVPEFLRQL-----------------------
A9S2G6_PHYPA/161-965------------------------------------------------GLPIFLRRV-----------------------
Q54JZ3_DICDI/144-931------------------------------------------------ALPKFIKIL-----------------------
CAPP_ACIBT/133-894------------------------------------------------AVPKFIREL-----------------------
B4VT20_9CYAN/197-1034------------------------------------------------AIPQLYHRL-----------------------
C1MJ77_MICPC/164-991------------------------------------------------GLPKFVRRI-----------------------
A2C517_PROM1/168-994------------------------------------------------AMPQLRRRL-----------------------
E0UJ33_CYAP2/184-1020------------------------------------------------AIPQLALRL-----------------------
B7DNZ9_9BACL/131-906------------------------------------------------VLPRVHQKL-----------------------
B4WPD5_9SYNE/199-1032------------------------------------------------TLPQLRQRI-----------------------
A4CSJ4_SYNPV/168-991------------------------------------------------AMPQLRRRL-----------------------
A5WCX5_PSYWF/133-932------------------------------------------------AIPQVYRNI-----------------------
A0JSJ3_ARTS2/161-954------------------------------------------------AMPEMLSDL-----------------------
B7G725_PHATC/84-877------------------------------------------------AVPAYLRKL-----------------------
B8KBA6_VIBPA/130-880------------------------------------------------AVPDFLREM-----------------------
CAPP_GLOVI/141-939------------------------------------------------AMPRVRSEL-----------------------
C5Z450_SORBI/157-961------------------------------------------------GVPKFLRRV-----------------------
C3X714_OXAFO/147-957------------------------------------------------ELPELYHSI-----------------------
C8PZR0_9GAMM/162-956------------------------------------------------ALPSLYRKL-----------------------
D1CE74_THET1/138-931------------------------------------------------ILPSVYREF-----------------------
Q117S5_TRIEI/186-1038------------------------------------------------ATPELHRRF-----------------------
C1AE63_GEMAT/147-933------------------------------------------------EVPRLHANL-----------------------
A9QPD2_METI4/151-931------------------------------------------------VIPELHNEL-----------------------
B0BZ90_ACAM1/184-1012------------------------------------------------AIPQLYHRL-----------------------
A4X3B0_SALTO/171-972------------------------------------------------AAPQVLDDL-----------------------
E3JCU0_FRASU/173-968------------------------------------------------VLPGLLEEL-----------------------
Q2JKJ2_SYNJB/177-978------------------------------------------------AIPLLHEYL-----------------------
CAPP_PROMS/165-989------------------------------------------------AMPQLRGRI-----------------------
A9IDM8_BORPD/139-951------------------------------------------------VIPRVYGEL-----------------------
A0L255_SHESA/136-889------------------------------------------------AVPDFLRQL-----------------------
A4G3V1_HERAR/147-944------------------------------------------------ELPALYEDI-----------------------
C1DZM5_MICSR/162-982------------------------------------------------GLPKFCRRI-----------------------
D0CKG9_9SYNE/185-1009------------------------------------------------AMPQLRRRL-----------------------
D3EKG0_GEOS4/142-928------------------------------------------------ILPEVYQEL-----------------------
A3YUN9_9SYNE/171-1002------------------------------------------------AMPLLRQRI-----------------------
A0YPE3_LYNSP/196-1038------------------------------------------------AIPQLYQRI-----------------------
B1VUI2_STRGG/125-909------------------------------------------------AVGDVLEDL-----------------------
CAPP1_CHLRE/154-974------------------------------------------------VVPVFHRRV-----------------------

PF15617

H4XEK7_ECOLX/4-311P---ATRE----------------------------------------DIADAVLHG------K----------IPGLR-
D5CKQ7_ENTCC/4-311P---ATRE----------------------------------------DIADAVLHG------K----------IPGLR-
B2NP51_ECO57/4-311P---ATRE----------------------------------------DIADAVLHG------K----------IPGLR-
A7MPV2_CROS8/4-311P---ATRE----------------------------------------DIADAVLNG------K----------IPGLR-
C4XDI3_KLEPN/4-311P---ATRK----------------------------------------DIAEVVLEG------K----------IPGLR-
B5RKC3_KLEP3/4-311P---ATRK----------------------------------------DIAEVVLEG------K----------IPGLR-
D0KLU5_PECWW/4-310P---ATRT----------------------------------------DIADVILTD------K----------ISGLR-
B4EW80_PROMH/4-311P---ATRT----------------------------------------DIAATIIDQ------K----------IDGLR-
D3V2D7_XENBS/4-313P---ATRQ----------------------------------------GIAEIVLHN------K----------IPGLR-
A4TRW8_YERPP/4-311P---ATRT----------------------------------------DIADIIIHN------K----------ISGLR-
B1JNG5_YERPY/4-311P---ATRT----------------------------------------DIADIIIHN------K----------ISGLR-
E1PL56_PANVC/4-311P---ATRT----------------------------------------DLAEVILHG------K----------IPELR-
D3VJW5_XENNA/4-312P---ATRQ----------------------------------------DIAEIVLQN------K----------IVGLR-
E2MHA5_PSEUB/3-308P---ATRD----------------------------------------DIVDVVFGE------K----------IPELR-
Q4ZYA8_PSEU2/3-308P---ATRD----------------------------------------DIVDVVFGE------K----------IPELR-
F3K7E7_PSESZ/3-308P---ATRD----------------------------------------DIVDVVFGE------K----------IPELR-
Q39AX0_BURS3/4-309P---ATRS----------------------------------------DILEVVSGA------R----------IPELR-
Q6FAX8_ACIAD/1-293P---ATRP----------------------------------------DLWPIVTGE------K----------YPELR-
A5WBK4_PSYWF/17-345P---ATRE----------------------------------------DIWAVISRS------K----------LPNLD-
Q4FTQ0_PSYA2/59-379P---ATRQ----------------------------------------DIWQVIKRD------K----------LPTIN-
Q5NWT6_AROAE/1-302P---ATRL----------------------------------------DLLEVVRGE------R----------LSEVR-
D3RPA3_ALLVD/1-291P---VTHR----------------------------------------DVLRIANGL------K----------WPELR-
Q1QCR8_PSYCK/1-326P---ATRQ----------------------------------------DIWQVIKRD------K----------LPTIN-
B6C0F8_9GAMM/22-320P---ATRK----------------------------------------DIARVLNQQ------K----------LTGLR-
A1VWQ0_POLNA/1-302P---ATHK----------------------------------------DLSQIANGC------L----------LGQVR-
G2TCW8_RHORU/5-304P---ATRS----------------------------------------DLAAIANGH------R----------HPFLK-
Q9RSA7_DEIRA/8-310P---ATRP----------------------------------------DLVALGSG.------K----------HANLT-
D5BYR3_NITHN/21-319P---ATRQ----------------------------------------DVGKILNQQ------K----------LTGLR-
D8K7I6_NITWC/22-320P---ATRK----------------------------------------DIARILNQQ------K----------LTGLR-
E8U9R3_DEIML/2-300P---ATRD----------------------------------------DLTDLVSGA------K----------PLGAR-
A8MM95_ALKOO/30-369P---GIRD----------------------------------------RIGEDIVHG------R----------IKELM-
Q891X5_CLOTE/30-390P---GVRD----------------------------------------DIFEIIYKN------K----------YNSMQ-
A8F9P5_BACP2/30-380P---ATRE----------------------------------------DIADMLLSQ------K----------YEALC-
C9RML9_FIBSS/26-375P---GTK.----------------------------------------DFAQAIIDK------K----------YPGLT-
E3IYR0_FRASU/30-389P---GTRP----------------------------------------KLADDVRRQ------S----------AAGVA-
Q9KY27_STRCO/30-382P---ATRP----------------------------------------SLADDILKQ------S----------ARGLV-
E3DTS5_BACA1/30-372P---ATRH----------------------------------------DIEAVITNQ------K----------YEDLS-
Q5YN23_NOCFA/30-379P---ATRA----------------------------------------DLADTIRRR------A----------ERGVC-
B1HUS4_LYSSC/26-382P---ASMP----------------------------------------NIVGLIQSQ------K----------YKELT-
F2JGK5_CELLD/30-386P---AIHE----------------------------------------KLYDYLVTR------K----------YISLT-
I0UNS1_BACLI/30-379P---GNRK----------------------------------------DIADVIINN------K----------YPELC-
D1BEK0_SANKS/30-379P---GTRP----------------------------------------NLAADIAKR------A----------AYGVV-
D1A9P4_THECD/30-379P---ATRP----------------------------------------TLAHDIVKA------V----------RHGVM-
C9ZE12_STRSW/30-382P---ATRE----------------------------------------RLADDVVKQ------A----------GRGVV-
F4H5N5_CELFA/32-382P---GTRP----------------------------------------RLAHDLARQ------A----------AQGAV-
B7HBK1_BACC4/30-359P---GTKE----------------------------------------TIAEDIIRK------K----------HVDAT-
B7IMX8_BACC2/30-359P---GTKE----------------------------------------TIAEDIIRK------K----------HVDAT-
C8W644_DESAS/30-382P---GSSI----------------------------------------QAVNKLIEN------K----------IPGLV-
Q82B97_STRAW/30-381P---ATRP----------------------------------------QLADDVVKQ------A----------GRGVV-
Q0SDY5_RHOSR/44-394P---ATRS----------------------------------------DLADTILRR------S----------GDGVC-
Q72YD0_BACC1/30-359P---GTKE----------------------------------------TIAEDIIRK------K----------HVEAT-
C1B1Z6_RHOOB/52-402P---ATRS----------------------------------------DLADTILRR------S----------ADGVC-
A4J1D5_DESRM/16-371P---GTAN----------------------------------------RAIDKVINN------E----------IPGLT-
C0ZNQ3_RHOE4/41-390P---ATRA----------------------------------------GLADIVVKR------A----------SEGVS-
C0Z9Y5_BREBN/30-389P---AIRT----------------------------------------TISHDVMTQ------K----------HEGLV-
Q186J7_CLOD6/30-356P---ATQY----------------------------------------NMIYKSIIG------D----------VKGVR-
E3EE66_PAEPS/10-379P---ATRL----------------------------------------EVAEEIKNG------K----------HEGLT-
F4D0A7_PSEUX/30-386P---GDRP----------------------------------------ALAADIAKQ------A----------TAGVT-
E6UGJ0_RUMA7/26-378P---GTK.----------------------------------------DFTPKILSG------A----------MPGLT-
D0L8D1_GORB4/35-383P---GTRP----------------------------------------DLADTITHR------H----------AEGVT-
B1VYI2_STRGG/30-406P---ATRP----------------------------------------SLADDVLKQ------A----------ARGVV-
C9XQK5_CLODC/30-356P---ATQY----------------------------------------NMIYKSIIG------D----------VKGVR-
F4EXE4_9FIRM/15-342P---AYQE----------------------------------------NIVEKIRRQ------K----------NEHLT-
C8XAU7_NAKMY/30-380P---ATRS----------------------------------------DLATTVRRR------A----------AAGAR-
A8L403_FRASN/30-389P---GTRP----------------------------------------RLASDVRRQ------V----------AAGVT-
A6WD82_KINRD/30-386P---ATRE----------------------------------------RLAGDLLRL------A----------RRGVL-
Q0RDF4_FRAAA/30-389P---GTRP----------------------------------------HLAFDVRRQ------T----------AAGVN-
A2RKY2_LACLM/29-399P---LDSD----------------------------------------NVIERLKKL------E----------KYGAT-
Q2J6S0_FRASC/45-404P---GTRP----------------------------------------RLASDVCRQ------T----------AAGVT-
E3PRQ7_CLOSD/30-378P---ATK.----------------------------------------YIAPYLLEK------R----------YSHLT-

PF00463

ACEA_EMENI/14-536Y---TKRP----------------------------------------FTAEQIVAK------RGNLK.IEYPSNVQAK-
ACEA_YEAST/22-550K---TKRN----------------------------------------YSARDIAVR------RGTFPPIEYPSSVMAR-
ACEA_CANTR/18-543K---TKRI----------------------------------------YSAEDIAKK------RGTLK.IAYPSSQQSD-
ACEA1_SOYBN/3-534L---TKRP----------------------------------------YTARDVVSL------RGNLR.QTYASNEMAK-
ACEA_YARLI/10-536H---TKRV----------------------------------------YSPEDIASR------RGTIK.VPQASSQQAD-
ACEA_ECOLI/7-434G---ITRP----------------------------------------YSAEDVVKL------RGSVNPECTLAQLGAA-
ACEA_NEUCR/23-547Q---TKRP----------------------------------------FTAEQIVSK------RGNLK.IEYASNAQAK-

PF02896

PPDK1_MAIZE/589-947D---VRKL----------------------------------------KVLANADTP------DDALTAR----NNGAQ-
PT1_STACT/251-543D---GHHV----------------------------------------ELAANIGTP------NDLPGVI----ENGAE-
PT1_CUPNH/262-557D---GLEI----------------------------------------DLLANIEMA------EDAGAAL----AAGAV-
PPDK_CLOSY/515-871K---FRTL----------------------------------------KVRTNADTP------EDTLNAV----KLGAE-
PPDK_FLATR/595-953Q---ARRL----------------------------------------KVMANADTP------NDALTAR----NNGAQ-
PPDK_ENTHI/515-879E---IKKI----------------------------------------GVFAAGDLP------SAAKKAL----EFGAE-
PT1_ECOLI/250-542D---GHQV----------------------------------------EVCANIGTV------RDVEGAE----RNGAE-
PT1_HAEIN/250-542D---GHKV----------------------------------------DVVANIGTI------RDCDGAE----RNGAE-
PT1P_ECOLI/416-708S---GERI----------------------------------------KVMLNAGLS------PEHEEKL----GSRID-
PPSA_PYRFU/496-796T---GTMV----------------------------------------KV..NVSMP------EVAERAA----ATGAD-
PT1_MYCCT/251-542D---KIKK----------------------------------------LIEANIGST------NDVQSVL----DSGAE-
PTFAX_RHOCA/518-804D---GARV----------------------------------------EVVANISDV------AEAIASV----EAGAE-
PT1_GEOSE/256-548D---GIHV----------------------------------------ELAANIGTP------DDVKGAL----ANGAE-
PTFAX_XANCP/521-808D---GHHI----------------------------------------DIGANVNLP------EQVAMAL----TQGAE-
PT1_STRMU/252-546D---GKHF----------------------------------------ELAANIGTP------KDVEGVN----NNGAE-
PTFX2_ECOLI/362-654D---GIRI----------------------------------------EIAANIAHS------VEAQAAF----GNGAE-
PPSA_STAMF/504-813P---VTAT----------------------------------------KIYMNLGEP------DAIEKYK----DLPFD-

PF00224

KPYK_EMENI/32-379----FRRT----------------------------------------SIICTIGPK.................TNSVE.
KPYM_FELCA/42-395----ARNT----------------------------------------GIICTIGPA.................SRSVE.
KPYK_HAEIN/5-350----LRRT----------------------------------------KIVCTMGPS.................TDRDN.
KPYK2_ECOLI/5-350----LRRT----------------------------------------KIVTTLGPA.................TDRDN.
KPYK_YARLI/29-376----YRKS----------------------------------------SIIGTIGPN.................TNSAE.
KPYC_SOLTU/19-365----IPKT----------------------------------------KIVCTLGPS.................SRTVP.
KPYK1_TRYBB/19-364----HRAN----------------------------------------RIVCTIGPS.................TQSVE.
KPYR_HUMAN/85-438----ARST----------------------------------------SIIATIGPA.................SRSVE.
KPYK_GEOSE/2-346----KRKT----------------------------------------KIVCTIGPA.................SESVD.
KPYK_HYPJE/41-388----FRRT----------------------------------------SIICTIGPK.................TNSVE.
KPYK_LACLA/2-375----NKRV----------------------------------------KIVSTLGPAVEIRGGKKFGESGYWGESLDVEA
KPYK_LACDE/1-346----MKKT----------------------------------------KIVSTLGPA.................SDDIE.
KPYK1_YEAST/18-365----LRRT----------------------------------------SIIGTIGPK.................TNNPE.

PF02548

Q6BIM6_DEBHA/32-295T...KTPI----------------------------------------SVVTAYDFI-----------------------
PANB_HALHL/12-270E...GRPL----------------------------------------ACLTAYDYG-----------------------
PANB_SACD2/10-267D...KEKF----------------------------------------ITVALYDAP-----------------------
PANB_ECOUT/2-260D...KKRF----------------------------------------ATITAYDYS-----------------------
PANB2_METPP/15-275R...GEKI----------------------------------------AMITAYDAS-----------------------
PANB_AERPE/4-261....SRPI----------------------------------------VAVTAYDYP-----------------------
A6DLB6_9BACT/1-261S...GEKI----------------------------------------ACVTAYDST-----------------------
PANB_OCEIH/1-257E...GEKI----------------------------------------SMLTAYDYP-----------------------
A3W152_9RHOB/5-264K...GERI----------------------------------------VGMECHDTP-----------------------
PANB_THEP3/3-263E...GRKI----------------------------------------TALTAYDFP-----------------------
PANB_DESPS/1-261A...GQKI----------------------------------------SMLTAYDAS-----------------------
A0XYQ5_9GAMM/2-260E...NNKI----------------------------------------TALTAYDAS-----------------------
PANB_ROSDO/8-265....GEPI----------------------------------------VSLTAYTTP-----------------------
C5B0Y2_METEA/8-268E...GRKI----------------------------------------ISLTAYHAH-----------------------
PANB_PSEPF/2-261K...GEKI----------------------------------------TMLTCYDAT-----------------------
PANB_ALCBS/1-259D...GGKF----------------------------------------SVLTAYDAC-----------------------
PANB_GEOLS/3-262E...GRKV----------------------------------------TVLTAYDYP-----------------------
PANB_ALKMQ/4-262A...EEQV----------------------------------------AWVTAYDFP-----------------------
Q0FZZ2_9RHIZ/8-265....GEPI----------------------------------------VSLTAYSAV-----------------------
Q5UF70_9PROT/3-264K...KTKF----------------------------------------ACLTAYDAS-----------------------
A3F328_BACIU/1-260N...EEPI----------------------------------------VMLTAYDYP-----------------------
PANB_CHRSD/2-260A...QEPF----------------------------------------SCLTAYDAS-----------------------
A4A9Z8_9GAMM/3-260A...GEKF----------------------------------------VCITAYDAT-----------------------
PANB_SALRD/2-262E...GVPI----------------------------------------AALTAYDYT-----------------------
PANB_METCA/3-261R...GEKI----------------------------------------ACLTAYDAS-----------------------
A4BLN5_9GAMM/12-271A...GEVI----------------------------------------ACLTAYDHS-----------------------
PANB_PYRAR/4-259......PY----------------------------------------VWVTAYDYP-----------------------
PANB_HELHP/4-261....IEKI----------------------------------------TAITAYDAL-----------------------
PANB_NITEC/7-266E...KGKI----------------------------------------AALTCYDAT-----------------------
PANB_CAMJR/2-259K...NEKI----------------------------------------TMVSAYDYH-----------------------
A4TBM9_MYCGI/21-280E...GHKW----------------------------------------AMLTAYDYS-----------------------
A4SZR6_POLSQ/8-267E...GEKI----------------------------------------SMLTAYDST-----------------------
A5DHH9_PICGU/31-293T...KQPI----------------------------------------AMVTAYDYI-----------------------
A3EWD3_9BACT/4-264E...GPPL----------------------------------------TMVTAYDAP-----------------------
PANB_PYRAB/2-259....KEKI----------------------------------------AMITAYDYP-----------------------
A6GSM9_9BURK/14-273N...QEKI----------------------------------------AMLTCYDAC-----------------------
Q75D37_ASHGO/23-289A...KEPI----------------------------------------SMITAYDYI-----------------------
PANB_AQUAE/1-261E...GKKI----------------------------------------TMVSTYDYW-----------------------
PANB_XANOR/8-266A...GRKL----------------------------------------VMLTAYDAS-----------------------
A7G0V7_CLOBH/1-261K...GEKI----------------------------------------TMLTAYDYS-----------------------
PANB_CORDI/3-260N...NRPW----------------------------------------AMLTTYDYS-----------------------
PANB_NITMS/1-260G...KKKV----------------------------------------SVITGYDYT-----------------------
PANB_ANAMM/1-257....LEKI----------------------------------------ACLTAYTFP-----------------------
A8DJM8_9BACT/4-264D...GKRI----------------------------------------VALTAYDRP-----------------------
PANB_BUCAP/2-260N...QIKF----------------------------------------AAITAYDFS-----------------------
A8ZX35_DESOH/1-254Q...GRKI----------------------------------------TMLTAYDYP-----------------------
PANB_ROSCS/1-260R...GEPI----------------------------------------AMLTAYDAV-----------------------
PANB_THIDA/1-259K...GEKI----------------------------------------AVLTCYDAS-----------------------
PANB_TRIEI/1-261K...GRPI----------------------------------------VALTAYDYT-----------------------
Q1YYG7_PHOPR/2-260L...GEKF----------------------------------------ASITAYDAS-----------------------
PANB_SYNFM/1-262K....RKL----------------------------------------SELTAYDYP-----------------------
A4BJA6_9GAMM/3-261D...GQKF----------------------------------------TMLTAYDAT-----------------------
A5DVU0_LODEL/35-295E...KKPI----------------------------------------TMVTAFDSI-----------------------
PANB_LEPBJ/1-262G...KEKI----------------------------------------SVVTCYDFS-----------------------
PANB_METS4/15-273E...GRRI----------------------------------------VMVTAYDAA-----------------------
PANB_CHRVO/1-259E...GRKI----------------------------------------TMLTCYDAS-----------------------
PANB_HALMA/1-257....EEPI----------------------------------------TMLTAYDAV-----------------------
O82357_ARATH/40-306R...GEPI----------------------------------------TVVTAYDYP-----------------------
PANB_CAMC1/9-266....AEPI----------------------------------------VMITAYDAL-----------------------
PANB_RALSO/11-269A...GERI----------------------------------------AMLTAYDAS-----------------------
PANB_COXBU/3-262D...NKKI----------------------------------------SMVTCYDYW-----------------------
A4ET65_9RHOB/36-279S...GTTL----------------------------------------SMANPADRD-----------------------
A3ZKV5_9PLAN/9-265D...GKKI----------------------------------------SMLTAYDHT-----------------------
PANB_MAGSA/8-266....AEPL----------------------------------------VVLTAYTAP-----------------------
PANB_ANADE/9-273A...GERI----------------------------------------AMVTAYDAT-----------------------
PANB_YEAST/24-291T...GTPL----------------------------------------SMCTAYDFI-----------------------
A3JDV2_9ALTE/1-259R...GEAF----------------------------------------SALTSYDAT-----------------------
A5P8F6_9SPHN/22-283DGETKDPL----------------------------------------VMLTAYTAR-----------------------
PANB1_ZYMMO/32-297D...GEKI----------------------------------------AVLTAYDAT-----------------------
A4RSY4_OSTLU/34-300S...SKPI----------------------------------------TAVTAYDYP-----------------------
PANB_ACIC1/9-268Q...HRRW----------------------------------------AMLTCYDAL-----------------------
PANB_BDEBA/1-259K...KQKI----------------------------------------SMITCYDYS-----------------------
PANB_DECAR/8-267A...GEKI----------------------------------------AQFTCYDAS-----------------------
PANB1_METPP/12-271S...GEKM----------------------------------------VYTSVPDYT-----------------------
A7BVR3_9GAMM/2-261K...GEKI----------------------------------------AVLTAYDAS-----------------------
Q54LH3_DICDI/90-350D...GIPI----------------------------------------SMVTAYDFT-----------------------
PANB_HELPJ/9-266....QEKI----------------------------------------IAITAYDAL-----------------------
Q6CE35_YARLI/39-299N...KEKI----------------------------------------SMVTAHDYV-----------------------
PANB_RHOBA/9-265R...GERI----------------------------------------TMLTAYDFP-----------------------
PANB_DEHE1/1-261N...KQKI----------------------------------------AMLTAYDYP-----------------------
PANB_MAGSM/3-263Q...GEPI----------------------------------------VALTAYDYT-----------------------
Q6CLY9_KLULA/31-297R...RNPI----------------------------------------SMVTAYDYI-----------------------
PANB_THET2/1-258....GQRL----------------------------------------VYLTAYDYP-----------------------
Q7NSX9_CHRVO/9-255....RRKL----------------------------------------MALTAYSGA-----------------------
PANB_KORVE/10-270K...HDPI----------------------------------------TCLTAYDYS-----------------------
Q841Y3_CAMFE/9-266....REKI----------------------------------------VMITAYDAL-----------------------
PANB_HERA2/1-259R...GERL----------------------------------------VMVTAYDYT-----------------------
PANB_CAUCR/10-267....GVPI----------------------------------------VCLTAYTAP-----------------------
PANB_NOCSJ/33-292R...GEKF----------------------------------------AMLTAYEQY-----------------------
Q2UMW5_ASPOR/70-332K...GEPI----------------------------------------TMLTAHDFP-----------------------
PANB_FRATO/1-259T...QEKI----------------------------------------SMVTCYDYT-----------------------
A4GIZ2_9DELT/4-264S...GKKI----------------------------------------TALTAYDYS-----------------------
PANB_CHLCH/10-274Q...GEKI----------------------------------------SMLTAYDYT-----------------------
PANB_LEGPL/1-259E...QKKI----------------------------------------SMLTCYDYP-----------------------
A7TTC6_VANPO/35-302A...CEPL----------------------------------------SMCTAYDYI-----------------------
B4U641_HYDS0/3-262N...KQKI----------------------------------------TMVSLNNYI-----------------------
A7I1C3_CAMHC/2-260....MEKI----------------------------------------VMITAYDAL-----------------------
A5L777_9GAMM/1-252....KQRI----------------------------------------PMLTAYTFP-----------------------
PANB_BACSK/1-260D...GEPI----------------------------------------AMLTAYDAP-----------------------
PANB_SULSO/2-260M...KEKI----------------------------------------TMLTAYDYP-----------------------
Q5ABB3_CANAL/27-288T...GESI----------------------------------------SMVTSHDFI-----------------------
A3D6H9_SHEB5/8-266....KTPI----------------------------------------VALTAYEKP-----------------------
PANB1_PSEF5/6-266....RQKI----------------------------------------VSLTAYTSH-----------------------
A5FWA4_ACICJ/8-270N...GERR----------------------------------------ALITAYDYP-----------------------
PANB_NITSB/3-256....SNKL----------------------------------------VMITAYDAL-----------------------
PANB_MARMS/12-270D...KEKI----------------------------------------TCLTSYDAS-----------------------
A7BDA4_9ACTO/24-281E...GIPL----------------------------------------TMLTAYDAL-----------------------
Q8GDR8_HELMO/3-263Q...GKKF----------------------------------------RMVTAYDYP-----------------------
PANB_STAMF/2-259....KKKI----------------------------------------VMVTAYDYP-----------------------
PANB_TROWT/12-268....GRKL----------------------------------------VGLTCYDFS-----------------------
A4GK01_9BACT/1-254....KSKI----------------------------------------VCLTAYSKN-----------------------
PANB_DEIGD/1-259.....EPL----------------------------------------VMVTAYDYP-----------------------
B1K6U2_BURCC/8-266....IGSL----------------------------------------VSLTAYSAP-----------------------
PANB_WIGBR/2-261Q...NKKF----------------------------------------ASITAYDAT-----------------------
PANB_DESVH/19-278R....QRL----------------------------------------AMLTAYDYT-----------------------
A3WLA3_9GAMM/2-260Q...GEKI----------------------------------------ASLTAYDAS-----------------------
PANB_CORGB/9-268N...GQKV----------------------------------------SVLTSYDAL-----------------------

PF14010

CAPPA_METHJ/3-484PFF.T.EN----------------------------------------IELTGEDEVKE---------------------
B1V5L0_CLOPF/3-537......VE----------------------------------------TYISIQQEPAE---------------------
D2PDY7_SULID/4-511PEW.A.KS----------------------------------------EVIEGEDEVKE---------------------
D3S0D1_FERPA/2-476PFF.A.RG----------------------------------------EYLNGEDEVKE---------------------
B5YCF7_DICT6/5-497PFF.S.NN----------------------------------------PVLQGDDEIKE---------------------
CAPPA_HALSA/4-492PFF.T.AG----------------------------------------DVIEGEDEIQE---------------------
C6HVN3_9BACT/19-520PYWKGNQD----------------------------------------PFISTLDEIEE---------------------
A3EQI3_9BACT/19-520PYWKTNND----------------------------------------PFISTLDEIEE---------------------
CAPPA_PYRCJ/3-459......TT----------------------------------------VKITAAEEVDE---------------------
CAPPA_METTH/3-483PFF.A.EE----------------------------------------PELGGEDEIRE---------------------
CAPPA_PYRAB/2-469PFF.A.NS----------------------------------------PVLGGEDEITE---------------------
CAPPA_METMA/7-526......AS----------------------------------------KYISTQEEPGE---------------------
CAPPA_METKA/9-532......AT----------------------------------------KFVRVQEEPEE---------------------
F0LK16_THEBM/2-476PFF.A.RE----------------------------------------PQLGGEDEIIE---------------------
A8A9C2_IGNH4/3-488......ST----------------------------------------VVLMPQDEVEE---------------------
CAPPA_SULTO/4-511PEW.S.RS----------------------------------------EVISGESEVIE---------------------
B1I2W1_DESAP/7-489PFF.A.NS----------------------------------------QDMSGEDEIQE---------------------
B1YBY2_THENV/2-461......AT----------------------------------------VKVTASEEVDE---------------------
CAPPA_PICTO/6-508PAWAS.EK----------------------------------------SMIRNDDEVEE---------------------
CAPPA_CALMQ/4-512PQW.V.VN----------------------------------------DFIKGDDEVYE---------------------
CAPPA_METS5/4-509PEW.A.KG----------------------------------------DVIEGEAEVIE---------------------
Q1PXR4_9BACT/4-490PFF.T.EG----------------------------------------APFHGEDEIKE---------------------
CAPPA_ARCFU/2-471PFF.A.AS----------------------------------------EVLNGEDEVRE---------------------
CAPPA_PYRAR/4-460......TT----------------------------------------VKITTAEEVDE---------------------
CAPPA_PYRAE/3-460......ST----------------------------------------VKITAGEEVDE---------------------
C6A2T7_THESM/11-485PFF.A.HE----------------------------------------SSLGGEDEVLE---------------------
CAPPA_SULAC/4-511PEW.N.QG----------------------------------------EAISGENEIIE---------------------

PF01274

MASY_EMENI/11-531---MVVN----AL-----NS--------D--------------------VWTYMADFEDSSAP...........TWDN--
MASZ_CORGL/35-713---GLKD----IV-----LE--------S--------------------AITTIMDFEDSVAAVDAEDKTLGYSNWFG--
MASY_MYXXD/17-538---MVIN----AL-----NS--------G--------------------ANVFMADFEDANSP...........TWDN--
MASZ_ECOLI/17-697---HIND----VI-----VE--------A--------------------AISTILDCEDSVAAVDAEDKILLYRNLLG--
Q9RYN3_DEIRA/10-521---MIIN----AL-----NS--------G--------------------AKMFMADFEDASSP...........TWDN--
MASY_PICAN/21-543---MIVN----AF-----NT--------D--------------------VFTYMTDFEDSCSP...........TWNN--
MASZ_PSEFL/17-697---GVKD----VL-----ME--------A--------------------ALTTIMDCEDSVAAVDADDKVVIYRNWLG--
MASY_MAIZE/16-548---MVIN----AL-----NS--------G--------------------AKVFMADFEDAMSP...........TWEN--
MASY_STRAE/10-542---MTIN----AL-----NS--------G--------------------AKVWLADFEEPSAP...........TWEN--
MASY_NEUCR/11-531---MVVN----AL-----NS--------D--------------------VYTYMADFEDSSAP...........TWAN--
MASY_STRCL/10-540---MTVN----AL-----NS--------G--------------------ARVWLADFEDSSAP...........TWEN--
MASY_BRANA/21-551---MIIN----AL-----NS--------G--------------------AKVFMADFEDALSP...........SWEN--
MASY_ECOLI/11-533---MVIN----AL-----NA--------N--------------------VKVFMADFEDSLAP...........DWNK--
MASZ_MYCLE/17-704---GIKD----VI-----LE--------S--------------------AITTIMDFEDSVTAVDADDKVRGYRNWLG--
MASY_CANTR/15-540---MVIN----AL-----NS--------N--------------------VATYMADFEDSLTP...........AWKN--
MASY_YEAST/18-542---MLIN----AL-----NA--------P--------------------VNTYMTDFEDSASP...........TWNN--

PF03328

Q9RYM1_DEIRA/24-251---CAEI----CA-----GA--------G--------------------FDWLLIDGEHAP..-----------....--
Q8XL94_CLOPE/6-225---MIRD----CT-----IY--------G--------------------ADSVMFDLEDSV..-----------SIAE--
BPHF_SPHAR/18-244---IAEI----CA-----GQ--------G--------------------YDWLLIDGEHGP..-----------....--
Q9CGA8_LACLA/9-229---MIKD----AG-----IF--------E--------------------ADSIMFDLEDAV..-----------SLAE--
O22982_ARATH/17-240---LAEI----AA-----RA--------G--------------------FDFIVVYLEHGA..-----------....--
Q8Z9M3_SALTI/5-223---MLST----SF-----VY--------G--------------------ADAVMFDLEDAV..-----------ALRE--
RHMA_ECOLI/19-246---MAEI----AA-----TS--------G--------------------YDWLLIDGEHAP..-----------....--
Q8RDW5_FUSNN/9-227---MITD----AY-----IY--------G--------------------PDSVMIDLEDAT..-----------SVNQ--
GARL_ECOLI/20-246---STEV----LG-----LA--------G--------------------FDWLVLDGEHAP..-----------....--
Q9KTU0_VIBCH/11-230---MLSN----TF-----IY--------Q--------------------PDSIMFDLEDSV..-----------ALRE--
Q93167_CAEEL/26-259---MLDK----VP-----MM--------Q--------------------ADSVVLELEDGV..-----------ALTA--
Q9HRM8_HALSA/29-241---LMRK----AP-----TT--------G--------------------ADVVVFDLEDAV..-----------APAR--
Q8XBS2_ECO57/20-239---MVSN----SF-----IY--------P--------------------ADALMFDLEESV..-----------ALRE--
Q9UVD4_9ASCO/43-283---VTKV----LA-----AT--------K--------------------PDFVWIDVEHGM..-----------....--
O82487_ARATH/90-322---LAEI----AA-----HA--------G--------------------YDYVVVDMEHGP..-----------....--
HPCH_ECOLX/15-242---SAEL----LA-----GA--------G--------------------FDWLLIDGEHAP..-----------....--
CITEL_DEIRA/9-223---LIAK----LP-----RS--------A--------------------PDAVVIDLEDAVPG-----------TAEA--
Q8K7F2_STRP3/6-224---MLRD----AP-----LF--------G--------------------ADSIMFDLEDSV..-----------SLKE--
Q8VQP0_RHOER/12-226---KARK----AL-----FS--------N--------------------ADEVILDLEDAV..-----------TSAN--
BPHF_RHOSR/18-244---SAEV----CA-----GA--------G--------------------FDWLLIDGEHAP..-----------....--
Q9XY64_TRYCR/18-251---LAGQ----FS-----HS--------G--------------------YDWLLIDMQHSP..-----------....--
Q9RLT5_WEIPA/10-229---MIKD----AG-----IY--------G--------------------ADSIMFDLEDAV..-----------SMPE--

PF13714

A0JTC7_ARTS2/12-246---TAKV----AT-----DVP.......G......---------.....TTA.LATASHSIAA-----------SL.G--
A0K276_ARTS2/27-270---SARL----VE-----EA........G......---------.....AAA.LATSSSALSW-----------SL.G--
A0NXG4_9RHOB/11-252---TARI----LD-----GL........R......---------.....FDA.LATSSAGYAW-----------TQ.G--
A0QPJ7_MYCS2/16-251---SARL----AV-----DA........G......---------.....FAA.LTVGSHPVAD-----------SI.G--
A0R0I0_MYCS2/10-256---SAQI----IA-----RS........G......---------.....FEA.VFIGSFGIAA-----------SAYG--
A1CA54_ASPCL/14-274---TASI----VA-----NNP.......S......---------.....TKA.IATASYAVAA-----------AQ.G--
A1SIA9_NOCSJ/3-233---SAIA----FV-----EA........G......---------.....FPA.VGTTSFGVAT-----------SA.G--
A2VJA9_MYCTU/3-230---SALA----YL-----AE........G......---------.....FTA.IGTTSFGVSS-----------SG.G--
A3I8T3_9BACI/7-245---SALI----LE-----KA........G......---------.....FQA.IGTTSWGIAN-----------SL.G--
A3NHT8_BURP6/20-277---SAMI----SE-----KV..........YVAHG---------ASQSEFDG.FWSSSLTDST-----------LR.G--
A3TPN1_9MICO/3-233---SAKR----LE-----EA........G......---------.....FPA.LATTSHGHAA-----------TL.G--
A3UJ38_9RHOB/7-249---SALA----IE-----RS........G......---------.....AKA.IATSSWAVAA-----------AL.G--
A3WAP9_9SPHN/6-247---SAVA----VA-----RA........G......---------.....ARA.IATGSHSLAG-----------AQ.G--
A3Y7J5_9GAMM/4-243---SAKC----AQ-----EA........G......---------.....YQA.LGTSSAAIAN-----------ML.G--
A4AEG4_9ACTN/15-253---TARI----VA-----ETP.......S......---------.....VRA.LATASHAVSF-----------AH.G--
A4ET25_9RHOB/10-247---SALA----VE-----QA........G......---------.....AQA.LATGSWSVAA-----------AQ.G--
A4F7M3_SACEN/8-232---SAAA----LA-----AA........G......---------.....FPA.VGTTSLGVAA-----------AH.G--
A4FH54_SACEN/26-273---TARL----VE-----EA........G......---------.....FPA.VATTSHAVAE-----------SL.G--
A4X5C0_SALTO/32-264---SARL----IE-----EA........G......---------.....AAA.IATTSAGVAW-----------SV.G--
A4X7L5_SALTO/4-223---SARG----LV-----EA........G......---------.....FPA.LGTTSLGVAA-----------AA.G--
A4XS21_PSEMY/12-254---SAKI----LA-----AL........G......---------.....FEA.LATTSAGLAF-----------AL.G--
A4YVZ4_BRASO/12-249---TAKM----LQ-----HL........G......---------.....FKA.IASTSAGFAW-----------SI.G--
A5G4A7_GEOUR/12-254---STRI----FE-----HA........S......---------.....FQA.IGTTSYAIAA-----------SL.G--
A5LD69_STRPN/2-260---SAYI----ID-----QT........KYSADKG---------DIFE.YDG.IWISSLCDSI-----------IR.G--
A5V3Q4_SPHWW/10-252---SARA----VA-----EA........G......---------.....APA.LATSSWAVAA-----------AA.G--
A8LYX8_SALAI/6-252---AATA----AA-----GA........G......---------.....FDA.LWVSSLEVSA-----------AA.G--
A8TK14_9PROT/10-251---SARI----AE-----DL........G......---------.....FEIGMFAGSIASMT-----------VL.G--
A9DYN3_9FLAO/3-242---SAKT----AE-----KL........N......---------.....FQA.IGTSSAAIAS-----------LL.G--
A9WM41_RENSM/9-245---STRL----MV-----RA........G......---------.....AQA.VATSSSAVSW-----------SH.G--
B1IHA0_CLOBK/33-275---SAVI----YE-----KF........N......---------.....FPA.VGTTSAGLAY-----------SL.G--
B1T3E7_9BURK/12-255---SART----VA-----DA........G......---------.....GVA.LATGSWSVAV-----------AN.G--
B1VSN1_STRGG/14-249---SART----AA-----DA........G......---------.....FPA.LTVGSHPLAD-----------SR.G--
B4RBF1_PHEZH/10-242---SAAI----MA-----DA........G......---------.....ARA.VATSSAAVAW-----------AH.G--
B4SLQ1_STRM5/8-241---GARL----VQ-----QQ........G......---------.....ARA.VGTSSAAMAW-----------SC.G--
B4WCU0_9CAUL/11-249---SARI----FQ-----AA........G......---------.....FDA.VATTSAGVAW-----------SR.G--
B5HHA0_STRPR/15-253---SATV----VA-----EA........G......---------.....FPA.VATASAAVSA-----------ML.G--
B5HRK0_9ACTO/12-259---SARI----LE-----AA........G......---------.....FPA.VATTSAGVAF-----------SL.G--
B5HVC7_9ACTO/7-239---SARV----CE-----EA........G......---------.....FPA.LATPSAGIAA-----------AL.G--
B6HSS2_PENCW/11-259---TASI----IA-----ALP.......T......---------.....APA.IATASYAIAA-----------TI.G--
B6YYQ6_9RHOB/10-253---TAQA----VA-----KA........G......---------.....AKA.VATGSASVAA-----------AH.G--
B8H7Q2_ARTCA/13-246---SAAT----VA-----ALP.......E......---------.....TKA.IATAGHSIAA-----------AL.G--
B8J5T4_ANAD2/11-248---TARA----LE-----RA........G......---------.....FRA.LATTSAGFAF-----------SR.G--
B8MDA8_TALSN/5-285---TKEA----VR-----LT........FSDNGES---------.....FDG.IWLSGLTQTT-----------YL.G--
B9JNZ3_AGRRK/15-273---SALI----VE-----HT........IVETENG---------SQS..FDG.MWASSLTDAT-----------AR.G--
B9K4D9_AGRVS/8-247---TARI----LA-----AL........G......---------.....FPA.LATTSAGMAF-----------SL.G--
B9NN70_9RHOB/11-254---SAKA----VQ-----DA........G......---------.....AKA.LATGSAPVAM-----------AQ.G--
B9YYY5_9NEIS/10-252---SARL----LS-----SL........G......---------.....FPA.IATTSAGIAF-----------SL.G--
C0CW09_9CLOT/6-270---SAII----EE-----KA........G......---------.....FDA.VKLGSSQLNA-----------SL.G--
C0D909_9CLOT/255-518---SARA----VE-----LC........G......---------.....YNA.ILLSSSELEF-----------SMNG--
C0RYY1_PARBP/55-297---TAEF----VA-----SHS.......S......---------.....STA.LATTSYSIAK-----------VH.G--
D7W5Q1_9FLAO/4-244---SARV----YE-----KL........G......---------.....YKA.LATSSSAVAL-----------SL.G--
C1D0L9_DEIDV/16-251---SAQV----VA-----DT........G......---------.....ARA.LATASHSIAS-----------SF.G--
D5UDN5_CELFN/12-253---SAAL----IA-----SA........G......---------.....ARA.IATTSGGVAW-----------SL.G--
C2G595_9SPHI/6-241---SAQL----AE-----KA........G......---------.....FAA.LGSSSHAIAN-----------LL.G--
C2SBC8_BACCE/6-244---SAKI----YE-----DL........N......---------.....YRA.IGTTSAGIAA-----------SL.G--
C3K8Q8_PSEFS/8-242---SARI----VE-----SV........G......---------.....SKA.VATSSAAVAW-----------AH.G--
OADC_PSEFS/13-253---SARI----AA-----DL........G......---------.....FEVGILGGSVASLQ-----------VL.A--
C4RQC1_9ACTO/15-253---SARA----VV-----AA........G......---------.....FAV.VATSSAAVAE-----------SL.G--
C5C673_BEUC1/6-244---SARW----LV-----GA........G......---------.....FDV.VGTTSLGVAF-----------AA.G--
C5ERW5_9FIRM/6-250---STRA----AE-----MN........G......---------.....FQM.VMISSSDFAC-----------SQTG--
C5K5X0_PERM5/22-289---SAMI----VE-----QT........RAHRPDG---------SEAK.FDC.LWSSSLTSST-----------LK.G--
D9SPL5_CLOC7/7-255---SAKI----IE-----YA........G......---------.....FSA.IQCSGYSYSI-----------SK.G--
C6CCM3_DICDC/20-260---TAIL----MQ-----NA........G......---------.....FKA.IGTTSAGLAF-----------SL.G--
C6W6H2_DYAFD/19-261---GAQL----LE-----KQ........G......---------.....FPA.IATASAAIAR-----------AH.G--
C7Q1F2_CATAD/16-252---TAKI----FT-----AL........G......---------.....FQA.LATTSAGIAH-----------SL.G--
C7YUL0_NECH7/9-264---SFNT----VV-----SLNDDASKP........---------.....VKA.LATASWAIAA-----------SL.G--
C7YZU2_NECH7/391-674---GAKL----VE-----EA........G......---------.....FGA.VWVSGFELSA-----------SY.A--
D6Z4R6_DESAT/153-411---TGLI----VE-----NL........F.EQQEG---------RRLE.FDG.MWLSSLTDST-----------AK.G--
C8TDE8_KLEPR/3-239---SAQA----AQ-----QA........G......---------.....YQA.LGSSSAAIAA-----------ML.G--
C9SRU6_VERA1/11-259---SLKA----VL-----SLNGSDTVSGP......---------.....VKA.IATASWAVAE-----------SQ.G--
D5VJX4_CAUST/12-246---SARR----LE-----KL........G......---------.....FKA.LASTSAGAAW-----------SM.G--
D1A2J0_THECD/5-232---SAVA----LA-----AA........G......---------.....FAA.VGTTSLGVAA-----------RY.G--
D1BED0_SANKS/11-246---SARV----VV-----AA........G......---------.....ARA.VATTSAGVAW-----------AH.G--
D1BI43_SANKS/12-247---SALV----AQ-----DA........G......---------.....APA.LATTSAGVAW-----------SR.G--
D1RNP5_SEROD/10-245---SALL----IE-----SL........G......---------.....AAA.IATTSAGVAW-----------SL.G--
D9TER7_MICAI/8-239---SAAA----LA-----AR........G......---------.....HQA.IGTTSLGVAA-----------AA.G--
F0QAJ3_ACIAP/21-266---SARI----VA-----EA........G......---------.....FKG.IWASGLSISA-----------SL.G--
E3J806_FRASU/10-249---SALM----LA-----DA........G......---------.....FEA.IGTSSAALAA-----------TL.G--
D2B1P9_STRRD/6-236---SAAA----LA-----AA........G......---------.....FAA.VATTSLGVAA-----------AA.G--
E3I6J4_RHOVT/30-272---SARV----IG-----DA........G......---------.....FDI.VGISPVSVAW-----------SC.G--
D2MU75_CAMJU/150-410---SALA----IE-----NT........FYKDENG---------INQE.FDF.LWLSSLTDSS-----------SK.G--
D2NZY3_LISM1/8-251---SARA----IQ-----QG........G......---------.....APV.IATSSYAIAE-----------SL.G--
D2PR97_KRIFD/29-269---SARL----AV-----AA........G......---------.....FPA.VATSSFATAA-----------IL.G--
D2Q3B1_KRIFD/7-234---SARI----VA-----EA........G......---------.....FAA.VATSSGATAR-----------VL.G--
D2Q4L3_KRIFD/4-243---SAII----LA-----EA........G......---------.....FPA.IATTSAGIAF-----------SL.G--
D2SNG0_STRFR/150-408---TGLI----IE-----NS........K.VTVDN---------QARE.FDG.MWSSSLTDSL-----------AR.G--
D2YH96_VIBMI/2-242---SAKI----AE-----RI........G......---------.....FLA.IGTSSAAIAN-----------NF.G--
D3AHD3_9CLOT/10-248---STRA----AE-----YM........G......---------.....CKGALLSASALTHT-----------VH.G--
D3AHD4_9CLOT/10-270---TAMA----AE-----RS........G......---------.....YPC.MMLSGGAIAY-----------SMDG--
D3EII1_GEOS4/13-252---SAKT----FE-----KC........G......---------.....FKA.IGTTSAGIAV-----------SH.G--
D3V3K7_XENBS/39-278---SSRL----AE-----QS........G......---------.....AKA.IATTSSGISW-----------SL.G--
D4AZN8_ARTBC/10-268---TADI----VL-----SHKGSNGEH.S......---------.....AKA.LATSSFAVAA-----------VH.G--
D4GMW6_PANAM/2-261---SALI----AS-----KA........EQTNSEG---------RIVK.FDG.IWSSSLTDSA-----------SR.G--
D4LCE5_RUMC1/6-261---EAYV----AE-----HA........FAPDSEG---------NQIT.FDG.LWLSGLCHAA-----------AA.G--
PEPM_STRHY/22-268---SARI----AV-----AE........G......---------.....FEA.LWASGLCMST-----------AR.G--
Q01YZ5_SOLUE/12-251---SARI----LA-----GL........G......---------.....FQA.LATSSAASAA-----------AL.G--
OADC_RHOP5/10-250---SMRI----AD-----DL........G......---------.....FEVGMFGGSVASLA-----------IL.G--
Q08U27_STIAD/11-246---SARL----LE-----SL........G......---------.....AAA.LATSSAAVAW-----------AH.G--
Q0BYP5_HYPNA/11-255---SART----VA-----AA........G......---------.....ARA.LATGSASVGG-----------AL.G--
Q0RPX9_FRAAA/13-247---TARV----LA-----AV........G......---------.....CLA.VGTTSSGFAG-----------TL.G--
Q0ZQ45_9ACTO/7-253---SARI----AQ-----DA........G......---------.....FDV.LWASGLGISA-----------AH.A--
Q12Q29_SHEDO/14-259---SAKI----IE-----EV........G......---------.....FSG.IWASGLTISS-----------SL.G--
Q1GKC0_SILST/10-253---GAKA----LA-----EN........G......---------.....APA.VATGSLSMAA-----------AH.G--
Q1GQT2_SPHAL/9-246---SAKA----VA-----AA........G......---------.....AKA.IATGSFGVAG-----------AQ.G--
Q1MM68_RHIL3/10-253---TAKA----VG-----DA........G......---------.....AKA.LATGSWSVAA-----------AH.G--
Q28RZ5_JANSC/10-249---SARM----MA-----AS........G......---------.....ALA.LATTSSGHAF-----------TL.G--
Q2CCZ7_9RHOB/9-248---SARM----LE-----AL........G......---------.....ARA.IATSSAAHAF-----------TL.G--
Q2JAX2_FRASC/15-255---TARL----LT-----QA........G......---------.....FVA.IGTTSAGLAF-----------SH.G--
Q3KEA6_PSEPF/8-242---GARL----VE-----QL........G......---------.....GKA.VATSSAAVAW-----------AH.G--
Q4DNR3_TRYCC/14-261---SARI----VE-----ET........G......---------.....FKA.IWASGLSISA-----------QM.G--
Q4KET5_PSEF5/11-270---SALL----AE-----QS........RLERGSG---------PSLV.YDA.IWSSSLTDST-----------HK.G--
Q4ZV58_PSEU2/7-249---SARL----IQ-----QL........G......---------.....YAS.LGTTSAGIAY-----------AQ.G--
Q5E5F2_VIBF1/18-278---SALI----AE-----KA........SANDIDS---------EENVEYQG.FWSSSLTDSV-----------SQ.G--
Q5LNA0_SILPO/10-253---SAQA----IA-----KA........G......---------.....ARA.IATGSWSLAA-----------AQ.G--
Q5LUG9_SILPO/10-245---SAKV----MA-----RL........G......---------.....AQA.LATTSSGYGF-----------TL.G--
Q5WBL4_BACSK/19-257---SAKM----FE-----AG........G......---------.....FQA.IGTTSAGIAA-----------SL.G--
Q65ND9_BACLD/10-248---SAKA----FQ-----NC........G......---------.....FKA.VGTTSAGIAM-----------SL.G--
Q72PY6_LEPIC/12-252---SARM----LV-----GS........G......---------.....FSA.IGTTSAGIAF-----------AA.G--
Q7NXV8_CHRVO/33-277---SARV----FE-----QA........G......---------.....FPA.LATSSAAVAW-----------SL.G--
Q7P124_CHRVO/3-243---SARL----AE-----AA........G......---------.....YAA.IGTSSAAISD-----------ML.G--
Q893V9_CLOTE/153-411---TGLI----AE-----KT.........VVERNG---------ELDQ.FDA.MWISSLCDST-----------AK.G--
Q8EI00_SHEON/9-240---SAAI----IQ-----AS........G......---------.....ARA.IATSSAALAW-----------SL.G--
Q8KJ74_RHILI/14-259---SAAI----AE-----RA........G......---------.....FKA.LWASGLSISS-----------SL.G--
Q9LPL2_ARATH/39-259---SAAI----VQ-----QT........G......---------.....FSAALISGYALSAV-----------TL.G--

PF00311

C7M9P2_BRAFD/148-942---REEL....RA-----HG--------ANLRDDQ..........VPLRFGSWIGGDRDGNPFVTAQV------TREV--
A8YCL3_MICAE/183-1018---QQSL....QS-----SF--------PRLQAPK.........NNFCRFGSWVGGDRDGNPSVTPEV------TWKT--
CAPP_ACTP2/128-879---NFQL....EK-----HF--------D.VQYEV........ALSPVRFSSWMGGDRDGNPFVTAEI------TQKV--
A0ZJ69_NODSP/196-1034---KYAL....GK-----TF--------TWLEPPH.........KNFCSFGSWVGSDRDGNPSVTPEI------TWQT--
CAPP_SYNP6/236-1053---RLAL....QG-----TF--------PDLQPPR.........YNFCQFGSWVGSDRDGNPSVTSAV------TWQT--
D3VH32_XENNA/127-879---NEQL....EE-----SI--------G.YSLPV........EAVPVRFTSWMGGDRDGNPNVTADI------TRHV--
Q474V2_CUPPJ/200-1006---EEDI....AA-----IF--------PASRKTKGAAAEAAPLAPFMQMGSWIGGDRDGNPNVTAET------LDHA--
A0N072_CITSI/164-967---DTAL....KN-----IG--------INERVPY........NAPLIQFSSWMGGDRDGNPRVTPEV------TRDV--
Q2KZS8_BORA1/137-936---SKLL..RPES-----SF--------SAAPEPL.........VPFLRMGSWIGGDRDGNPNVDAGT------LELA--
B5W9X1_SPIMA/196-1035---KQTL....HP-----CF--------PHLKPPN.........YDFCKFGSWVGADRDGNPSVTPEV------TWKT--
D2QW47_PIRSD/157-942---RLAL....DT-----HY--------PGEGIRP.........GLFLRFGSWMGGDRDGNPNVTAPI------TKQT--
A5GVT4_SYNR3/167-992---RKAL....KD-----SY--------PDVTPPE.........DGFCTFGSWVGSDRDGNPSVTPEI------TWRT--
C6D470_PAESJ/147-936---ERNL....TK-----YY--------PGESWHV.........PSYLRFGSWIGGDRDGNPSVTAKV------TWET--
A3IQQ1_9CHRO/183-1016---QQAL....KA-----NF--------PRIKPPH.........NNFCSFGSWVGGDRDGNPFVTTDI------TWRT--
A3JFS1_9ALTE/116-876---DTAL....LE-----AT--------G.KGLPL........QATPVRVASWMGGDRDGNPNVTHRV------TRKV--
B8HVC9_CYAP4/199-1018---TQSL....QQ-----SF--------PNLRPPR.........HNFCKFGSWVGADRDGNPSVTPEV------TWET--
C1F4Y2_ACIC5/161-947---SAAL....AS-----EY--------GLTLDAA.......SLPLMLGFGSWIGGDRDGNPFVTPQV------TREA--
CAPP_SYNY3/193-1034---GQAI....KE-----TF--------PHLRAPR.........ANFCYFGSWVGGDRDGNPSVTPEV------TWQT--
CAPP_ECOK1/128-883---NEQL....EE-----NL--------G.YKLPV........EFVPVRFTSWMGGDRDGNPNVTADI------TRHV--
B1XMB9_SYNP2/163-995---QQAL....KA-----SF--------PTLKVPT.........TNFCNFGSWVGGDRDGNPSVTPDV------TWKT--
A4S610_OSTLU/183-1007---DTSL....LA-----NG--------C.PRLPL........DRSIVTFGSWMGGDRDGNPYVTASC------TRDV--
A9RUR8_PHYPA/162-969---DTAL....KS-----IG--------VKERLPH........NVKLIHFSSWMGGDRDGNPRVTPEV------TRDV--
C6J5X1_9BACL/143-933---ERCL....TK-----YY--------PEHYWHV.........PTYLRFGSWIGGDRDGNPSVTSDV------TWET--
B8GNA5_THISH/143-947---EKAI....RR-----TY--------GNDEAGN....PRVRVPSFLRFGSWIGGDRDGNPNVTPAV------TELA--
CAPP_HAHCH/132-881---DAAL....LE-----RF--------G.EGLPI........NVNPVRFASWMGGDRDGNPNVTSEV------TREV--
B1Y159_LEPCP/163-950---EQAL......-----..--------PGHDIGN...........FFRMGNWIGGDRDGNPFVTADT------LKLA--
CAPP_THEEB/197-1011---EQSL....HE-----TF--------PALQPPR.........HRFCRFGSWVGGDRDGNPYVKPEV------TWQT--
A4NFT0_HAEIF/128-879---NETA....RE-----FL--------G.YDLPV........GLKPVRISSWMGGDRDGNPFVTAQI------TKKV--
A9S2G6_PHYPA/161-965---DTAL....KA-----IG--------VEERLPY........DVPLIQFSSWMGGDRDGNPRVTPEV------TRDV--
Q54JZ3_DICDI/144-931---NRCC....VK-----YL--------G.KELPP........TFANIHVASWVGGDRDGNHNVTAEV------TRQV--
CAPP_ACIBT/133-894---NELV....QD-----NC--------Q.QNLPL........HIAPVRFASWMGGDRDGNPNVTHQI------TQEV--
B4VT20_9CYAN/197-1034---KQGI....QS-----SF--------PWLNPPR.........KNFCKFGSWVGSDRDGNPSVKPEV------TWQT--
C1MJ77_MICPC/164-991---DTAL....IN-----QG--------L.PRIPL........DKSIMKFSSWMGGDRDGNPNVDSHC------TKDA--
A2C517_PROM1/168-994---TTAL....AS-----SY--------PDVEIPN.........EAFCTFGSWVGSDRDGNPSVTPEI------TWRT--
E0UJ33_CYAP2/184-1020---KRTL....KS-----AF--------PRLRPPK.........NNFCYFGSWVGGDRDGNPFVTPEV------TWAT--
B7DNZ9_9BACL/131-906---EQAV....EE-----QF--------GRQLLEL.........PPLIRFGSWMGGDRDGNPNVTSDI------TWQT--
B4WPD5_9SYNE/199-1032---CRAL....EG-----TF--------PSLRPPQ.........HGFCRFGSWVGSDRDGNPSVTPQV------TWKT--
A4CSJ4_SYNPV/168-991---SSAL....AC-----SY--------PDVQLPP.........SSFCTFGSWVGSDRDGNPSVTTDI------TWRT--
A5WCX5_PSYWF/133-932---KNAI....VD-----VY--------PELSDYA........LPAFLSFGSWIGGDRDGNPFVTHET------TEMA--
A0JSJ3_ARTS2/161-954---SELL....GE-----HG--------VTLPSQK..........APIRFGSWIGGDRDGNPNVTAGV------TREI--
B7G725_PHATC/84-877---DQQC....RL-----TL--------G.QSLPV........DVCPIKFASWIGGDRDGNPNVTPEV------TREV--
B8KBA6_VIBPA/130-880---DGRL....KD-----YL--------G.EGLPI........DARPVHFSSWMGGDRDGNPFVTHTV------TREV--
CAPP_GLOVI/141-939---VRCL....DM-----FH--------PSLTRSL.........GTFCRFGSWVGSDRDGNPSVNALV------TWKT--
C5Z450_SORBI/157-961---DTAL....KN-----IG--------INERLPY........DVPLIKFCSWMGGDRDGNPRVTPEV------TRDV--
C3X714_OXAFO/147-957---QEEI....AE-----RY--------PESRDGV...PAPGSESKYLQMGSWIGGDRDGNPNVNADT------MLHA--
C8PZR0_9GAMM/162-956---DYQL....KE-----RF--------PDTDMPN...........LLNIGGWIGGDRDGNPFVSADT------LRYA--
D1CE74_THET1/138-931---SDAL....KS-----VY--------KDWNFQI.........PPVIQFGTWMGGDRDGNPNVTPEV------TIRT--
Q117S5_TRIEI/186-1038---KQAL....HS-----SF--------PYLKPPS.........YNFCKFGSWVGSDRDGNPFCTPAV------TWQT--
C1AE63_GEMAT/147-933---EDLL....SA-----QF--------PGSTWQL.........TPFLQPGSWIGGDRDGNPFVTADV------LHET--
A9QPD2_METI4/151-931---QRVL....DI-----YY--------PGVTLKP..........KWISFGSWIGGDRDGNFQVTTKT------TATT--
B0BZ90_ACAM1/184-1012---SLNL....KQ-----AF--------PKLQPPR.........YNFCKFGSWVGSDRDGNPAVTPDI------TWQT--
A4X3B0_SALTO/171-972---ADTL....RT-----LG--------VETSPTA..........RPLTFGTWIGGDRDGNPFVTPTV------TREV--
E3JCU0_FRASU/173-968---DGAL....AQ-----VG--------AGLPITA..........RPLRFGTWAGGDRDGNPNVTPTV------TLDV--
Q2JKJ2_SYNJB/177-978---SRSL....KK-----AF--------PSVEPPP.........AGFCNFGSWVGGDRDGNPSVTADV------TWQT--
CAPP_PROMS/165-989---AEAL....TD-----NY--------PDVQLPS.........ESFCNFGSWVGSDRDGNPSVTPEI------TWRT--
A9IDM8_BORPD/139-951---SRLLGRDSAK-----PF--------AAPPAPL.........EPFLRMGSWIGGDRDGNPNVDAST------LELA--
A0L255_SHESA/136-889---NDQV....QD-----RT--------G.QQLPI........DIAPVRFSSWMGGDRDGNPFVTAKV------TQEV--
A4G3V1_HERAR/147-944---ESEI....AE-----RF--------PQRASSA.....SREQPLYIQMGSWIGGDRDGNPNVNGDT------MQLA--
C1DZM5_MICSR/162-982---DSAL....IN-----QG--------L.PRIPM........EHSIMRFSSWMGGDRDGNPFVTATC------TRDV--
D0CKG9_9SYNE/185-1009---ISSL....HR-----HY--------PDVQVPQ.........ASFCTFGSWVGSDRDGNPSVTPEI------TWRT--
D3EKG0_GEOS4/142-928---ERCL....TK-----YY--------PGHHWHV.........PTYLRFGSWIGGDRDGNPSVTADV------TWRT--
A3YUN9_9SYNE/171-1002---INAL....AG-----SY--------PDVEAPR.........DAFCTFGSWVGSDRDGNPSVTPDI------TWRT--
A0YPE3_LYNSP/196-1038---KHAL....HA-----SF--------PYLKPPR.........YDFCKFGSWVGADRDGNPSVTPEV------TWRT--
B1VUI2_STRGG/125-909---AAEL....ER-----VG--------VELPAGT..........RPLTFGTWIGGDRDGNPNVTPAV------TWDV--
CAPP1_CHLRE/154-974---DTAL....EK-----LG--------L.PRLPL........DRALFKFGSWMGGDRDGNPNVTAET------TRDV--

PF15617

H4XEK7_ECOLX/4-311---SLVI----CL-----ED--------A--------------------VSEADIPVALKN-------------LE-H--
D5CKQ7_ENTCC/4-311---SLVI----CL-----ED--------A--------------------VSEADIPIALKN-------------LE-H--
B2NP51_ECO57/4-311---SLVI----CL-----ED--------A--------------------VSEADIPVALKN-------------LE-H--
A7MPV2_CROS8/4-311---SLVI----CL-----ED--------A--------------------VSEADIPVALKN-------------LG-Q--
C4XDI3_KLEPN/4-311---SLVV----CL-----ED--------A--------------------VSEHDIPLAIQN-------------LS-L--
B5RKC3_KLEP3/4-311---SLVV----CL-----ED--------A--------------------VSEHDIPLAIQN-------------LS-L--
D0KLU5_PECWW/4-310---SLVI----CL-----ED--------A--------------------VAESDVPLALLR-------------LR-E--
B4EW80_PROMH/4-311---SLII----CL-----ED--------A--------------------VSDTDIPQALQN-------------LA-T--
D3V2D7_XENBS/4-313---SLVI----CL-----ED--------A--------------------VSDQDIPAAIEN-------------LD-G--
A4TRW8_YERPP/4-311---SLVI----CL-----ED--------A--------------------VSEDDVPLAISQ-------------LS-T--
B1JNG5_YERPY/4-311---SLVI----CL-----ED--------A--------------------VSEDDVPLAISQ-------------LS-T--
E1PL56_PANVC/4-311---SMVI----CL-----ED--------A--------------------VSEEQIDMALNN-------------LS-E--
D3VJW5_XENNA/4-312---SLVI----CL-----ED--------A--------------------VSERDIPAAIDN-------------LG-G--
E2MHA5_PSEUB/3-308---SLVV----CL-----ED--------A--------------------VALIDVDTALLN-------------LR-Q--
Q4ZYA8_PSEU2/3-308---SLVV----CL-----ED--------A--------------------VALTDVDTALIN-------------LR-Q--
F3K7E7_PSESZ/3-308---SLVV----CL-----ED--------A--------------------VALIDVDTALVN-------------LR-Q--
Q39AX0_BURS3/4-309---SLVV----CL-----ED--------A--------------------VAAIDVESALAN-------------LQ-A--
Q6FAX8_ACIAD/1-293---SLVI----CL-----ED--------A--------------------ITEQDVELAKQN-------------LK-Q--
A5WBK4_PSYWF/17-345---SVII----CL-----ED--------A--------------------VSESDVPYAWSN-------------IQ-K--
Q4FTQ0_PSYA2/59-379---SIII----CL-----ED--------A--------------------VSHNDVEVALER-------------LQ-I--
Q5NWT6_AROAE/1-302---SVIF----CT-----ED--------S--------------------VRLKDLPFAIEN-------------LR-A--
D3RPA3_ALLVD/1-291---SVIF----CT-----ED--------A--------------------VAPSALQSGLAN-------------LR-D--
Q1QCR8_PSYCK/1-326---SIII----CL-----ED--------A--------------------VSHNDVELALER-------------LQ-T--
B6C0F8_9GAMM/22-320---SAVV----CT-----ED--------S--------------------ILEQDLSPALAN-------------LR-L--
A1VWQ0_POLNA/1-302---SLIF----CT-----ED--------A--------------------VADSELSYALFN-------------LS-L--
G2TCW8_RHORU/5-304---SVIL----CT-----ED--------S--------------------ILAEQVDAALVN-------------LA-E--
Q9RSA7_DEIRA/8-310---SLIY----CT-----ED--------A--------------------VREADVPLALDN-------------LR-R--
D5BYR3_NITHN/21-319---SAVV----CT-----ED--------S--------------------ILEQELAPALNH-------------LQ-L--
D8K7I6_NITWC/22-320---SAVV----CT-----ED--------S--------------------ILEQELPPALAN-------------LR-R--
E8U9R3_DEIML/2-300---SLIL----CT-----ED--------A--------------------VREEDLPLALAR-------------LQ-E--
A8MM95_ALKOO/30-369---SVII----CL-----ED--------A--------------------IEDTLVDVGIKN-------------VV-S--
Q891X5_CLOTE/30-390---SMVI----CL-----ED--------A--------------------ISEKDVEKAETN-------------VI-D--
A8F9P5_BACP2/30-380---SVVF----CL-----ED--------A--------------------IGDQEVDMAEQN-------------LV-A--
C9RML9_FIBSS/26-375---SMVM----CF-----ED--------A--------------------CKEEDVPAAEIN-------------SI-H--
E3IYR0_FRASU/30-389---SMVL----CL-----ED--------A--------------------ISDGDVPAAEAN-------------VV-R--
Q9KY27_STRCO/30-382---SMVL----CL-----ED--------S--------------------IDDADVPVGEEN-------------LV-R--
E3DTS5_BACA1/30-372---SVVF----CL-----ED--------A--------------------IGDDEVKQAEHN-------------LK-H--
Q5YN23_NOCFA/30-379---SMVI----DL-----ED--------A--------------------VADHEVETAKRR-------------AV-A--
B1HUS4_LYSSC/26-382---SLVI----DL-----ED--------A--------------------VGDSELGDCEAK-------------LL-E--
F2JGK5_CELLD/30-386---TLVI----CL-----ED--------G--------------------IADSQVEEAEMR-------------LK-E--
I0UNS1_BACLI/30-379---SVVF----CL-----ED--------S--------------------IGDCEVLQAENN-------------LV-S--
D1BEK0_SANKS/30-379---SLVV----CL-----ED--------S--------------------IADEEVPFAEQN-------------TV-A--
D1A9P4_THECD/30-379---SMVV----CL-----ED--------A--------------------IPDDQVPAAEAN-------------MI-D--
C9ZE12_STRSW/30-382---SMVL----CL-----ED--------S--------------------IGDAEVPGAEEN-------------LV-R--
F4H5N5_CELFA/32-382---SSVV----CL-----ED--------A--------------------IADADVEQAQEN-------------VV-A--
B7HBK1_BACC4/30-359---SIIL----CL-----ED--------A--------------------ISDEEVKLAEQN-------------IV-V--
B7IMX8_BACC2/30-359---SIIL----CL-----ED--------A--------------------ISDEEVKLAEQN-------------IV-V--
C8W644_DESAS/30-382---STVL----CL-----ED--------A--------------------VDDRYVAHVEKN-------------LN-S--
Q82B97_STRAW/30-381---SMVL----CL-----ED--------S--------------------IDDADVVDAEEN-------------LV-R--
Q0SDY5_RHOSR/44-394---SMVL----DL-----ED--------A--------------------VADDQVEAALLN-------------AV-D--
Q72YD0_BACC1/30-359---SIIF----CL-----ED--------S--------------------ISDKEVKFAEQN-------------IV-F--
C1B1Z6_RHOOB/52-402---SMVL----DL-----ED--------A--------------------VADDQVESALLN-------------AV-D--
A4J1D5_DESRM/16-371---STVL----CL-----ED--------A--------------------VDDREVEDAEEN-------------LA-L--
C0ZNQ3_RHOE4/41-390---SMVL----DL-----ED--------A--------------------VADHEVESARAN-------------AV-D--
C0Z9Y5_BREBN/30-389---SMVI----CL-----ED--------A--------------------IGDHEVTEAEQS-------------LI-R--
Q186J7_CLOD6/30-356---PLAI----CL-----ED--------A--------------------VGVNGELEAIEN-------------LR-L--
E3EE66_PAEPS/10-379---TVIL----DL-----ED--------A--------------------IGDQQVGQAEES-------------LA-Q--
F4D0A7_PSEUX/30-386---SVVV----CL-----ED--------A--------------------VPDDRVAEAEDI-------------VV-A--
E6UGJ0_RUMA7/26-378---TVVL----CF-----ED--------A--------------------CPEDSVEAAEKN-------------VY-R--
D0L8D1_GORB4/35-383---SMVI----DL-----ED--------A--------------------VADHEERLATES-------------TV-E--
B1VYI2_STRGG/30-406---SMVL----CL-----ED--------S--------------------IDDAEVIGAESN-------------LI-R--
C9XQK5_CLODC/30-356---PLAI----CL-----ED--------A--------------------VGVNGELEAIEN-------------LR-L--
F4EXE4_9FIRM/15-342---AICF----CL-----ED--------A--------------------IGDMAVADAERV-------------LR-T--
C8XAU7_NAKMY/30-380---SMVI----DL-----ED--------A--------------------ITDHSVDSAVAS-------------TS-A--
A8L403_FRASN/30-389---SMVL----CL-----ED--------A--------------------IADHEVLGAESN-------------VA-A--
A6WD82_KINRD/30-386---SAVA----CL-----ED--------S--------------------VPDHRVAEAEEI-------------LV-R--
Q0RDF4_FRAAA/30-389---SMVL----CL-----ED--------S--------------------IADTEVADAEAN-------------VV-A--
A2RKY2_LACLM/29-399---SIIL----DL-----ED--------G--------------------IDFQKLEFAEEN-------------LK-K--
Q2J6S0_FRASC/45-404---SMVL----CL-----ED--------S--------------------IADTEVAAAEAN-------------VV-A--
E3PRQ7_CLOSD/30-378---SFVM----CF-----EN--------L--------------------IEERNINIAEKT-------------LL-N--

PF00463

ACEA_EMENI/14-536---KLWG----IL-----ER--------N--------------------FKNKEASFTYGC-------------LDPT--
ACEA_YEAST/22-550---KLFK----VL-----EK--------H--------------------HNEGTVSKTFGA-------------LDPV--
ACEA_CANTR/18-543---KLFK----LL-----EK--------H--------------------DAEKSVSFTFGA-------------LDPI--
ACEA1_SOYBN/3-534---KLWR----LL-----KN--------H--------------------QANGTASRTFGA-------------LDPV--
ACEA_YARLI/10-536---KLFK----LL-----QE--------H--------------------EKNHTASFTYGA-------------LDPV--
ACEA_ECOLI/7-434---KMWR----LL-----HG--------E--------------------SKKGYINSLGAL-------------TGGQ--
ACEA_NEUCR/23-547---KLWK----IL-----ED--------R--------------------FAKRDASYTYGC-------------LEPT--

PF02896

PPDK1_MAIZE/589-947---GIGL----CR-----TE--------H--------------------MFFAS.DERIKA-------------VR-QMI
PT1_STACT/251-543---GIGL----YR-----TE--------F--------------------LYMGR.DQ.MPT-------------EE-E..
PT1_CUPNH/262-557---GVGL----FR-----SE--------F--------------------LFMNRRDE.LPG-------------ED-E..
PPDK_CLOSY/515-871---GIGL----CR-----TE--------H--------------------MFFEA.D.RIMK-------------IR-KMI
PPDK_FLATR/595-953---GIGL----CR-----TE--------H--------------------MFFAS.DERIKA-------------VR-KMI
PPDK_ENTHI/515-879---GIGL----CR-----TE--------R--------------------MFNAV.E.RLPI-------------VV-KMI
PT1_ECOLI/250-542---GVGL----YR-----TE--------F--------------------LFMDR.DA.LPT-------------EE-E..
PT1_HAEIN/250-542---GIGL----YR-----TE--------F--------------------LFMDR.EQ.LPT-------------EE-E..
PT1P_ECOLI/416-708---GIGL----YR-----TE--------I--------------------PFMLQ.SG.FPS-------------EE-E..
PPSA_PYRFU/496-796---GVGL----LR-----AE--------H--------------------MILSI.GQHPIK-------------FI-KEG
PT1_MYCCT/251-542---GIGL----FR-----TE--------F--------------------LYMDN.DH.FPT-------------EE-E..
PTFAX_RHOCA/518-804---GVGL----LR-----TE--------F--------------------LFVNR.EA.PPG-------------ED-E..
PT1_GEOSE/256-548---GIGL----YR-----TE--------F--------------------LYMGR.SE.LPT-------------ED-E..
PTFAX_XANCP/521-808---GVGL----MR-----TE--------F--------------------LFLER.GS.TPT-------------ED-E..
PT1_STRMU/252-546---AVGL----YR-----TE--------F--------------------LYMDS.QD.FPT-------------ED-E..
PTFX2_ECOLI/362-654---GVGL----FR-----TE--------M--------------------LYMDR.TS.APG-------------ES-E..
PPSA_STAMF/504-813---GIGL----MR-----IE--------F--------------------IITDWVQYHPLY-------------LI-EQG

PF00224

KPYK_EMENI/32-379...KINA----LR-----RA--------G--------------------LNVVRMNFSHGS-------------YE-Y--
KPYM_FELCA/42-395...ILKE----MI-----KS--------G--------------------MNVARLNFSHGT-------------HE-Y--
KPYK_HAEIN/5-350...NLEK----II-----AA--------G--------------------ANVVRMNFSHGT-------------PD-D--
KPYK2_ECOLI/5-350...NLEK----VI-----AA--------G--------------------ANVVRMNFSHGS-------------PE-D--
KPYK_YARLI/29-376...MISK----LR-----QA--------G--------------------LNIVRMNFSHGS-------------YE-Y--
KPYC_SOLTU/19-365...MLEK----LL-----RA--------G--------------------MNVARFNFSHGT-------------HE-Y--
KPYK1_TRYBB/19-364...ALKN----LM-----KS--------G--------------------MSVARMNFSHGS-------------HE-Y--
KPYR_HUMAN/85-438...RLKE----MI-----KA--------G--------------------MNIARLNFSHGS-------------HE-Y--
KPYK_GEOSE/2-346...KLVQ----LM-----EA--------G--------------------MNVARLNFSHGD-------------HE-E--
KPYK_HYPJE/41-388...ALNK----LR-----DA--------G--------------------LNVARMNFSHGS-------------YE-Y--
KPYK_LACLA/2-375SAKNIAA----LI-----EE--------G--------------------ANVFRFNFSHGD-------------HP-E--
KPYK_LACDE/1-346...TITK----LA-----EA--------G--------------------ANVFRFNFSHGN-------------HE-E--
KPYK1_YEAST/18-365...TLVA----LR-----KA--------G--------------------LNIVRMNFSHGS-------------YE-Y--

PF02548

Q6BIM6_DEBHA/32-295---TGKY----AE-----SA--------D--------------------VDINLVGDSLAM-------------VALG--
PANB_HALHL/12-270---FAAA----CE-----RA--------G--------------------VDLLLIGDSLGM-------------VVQG--
PANB_SACD2/10-267---MAAM----AQ-----KC--------G--------------------VEVVLIGDSLGM-------------TVLG--
PANB_ECOUT/2-260---FAKL----FA-----EE--------G--------------------LNVMLVGDSLGM-------------TVQG--
PANB2_METPP/15-275---FAAL----VD-----TA--------G--------------------VDCILVGDSLGM-------------VLKG--
PANB_AERPE/4-261---TAWI----AD-----EA--------G--------------------VDVILVGDSLGM-------------VVLG--
A6DLB6_9BACT/1-261---SALL----AD-----RA--------G--------------------VDLLLVGDSLGM-------------TVLG--
PANB_OCEIH/1-257---SAKQ----AE-----AA--------E--------------------IDMILVGDSLGM-------------TVLG--
A3W152_9RHOB/5-264---SAMM----AE-----EL--------G--------------------MDLLCCGSPGPM-------------GLMG--
PANB_THEP3/3-263---TAKI----LD-----NC--------G--------------------IDMILVGDSLGM-------------VVLG--
PANB_DESPS/1-261---MSAL----LD-----QA--------G--------------------IDILLVGDSLGM-------------TVLG--
A0XYQ5_9GAMM/2-260---FAKL----FH-----DN--------G--------------------VNVILVGDSLGM-------------VLQG--
PANB_ROSDO/8-265---MAQM----MD-----AH--------.--------------------CDIVLVGDSLGM-------------VLHG--
C5B0Y2_METEA/8-268---TAGI----VD-----AY--------.--------------------CDFVLVGDSLGM-------------VMHG--
PANB_PSEPF/2-261---FAHA----CN-----EA--------G--------------------VEVLLVGDSLGM-------------VLQG--
PANB_ALCBS/1-259---FSRL----IS-----EA--------G--------------------VEAILVGDSLGN-------------VIQG--
PANB_GEOLS/3-262---TARL----VD-----AG--------G--------------------VDAILVGDSAGV-------------VFSG--
PANB_ALKMQ/4-262---TASF----AE-----QA--------G--------------------MEMILVGDSLGM-------------VVLG--
Q0FZZ2_9RHIZ/8-265---TARL----VE-----PH--------.--------------------ADFVLVGDSLGM-------------VEHG--
Q5UF70_9PROT/3-264---LSEL----MS-----KA--------G--------------------VELILVGDSLGM-------------VVQG--
A3F328_BACIU/1-260---AAKL----AE-----QA--------G--------------------VDMILVGDSLGM-------------VVLG--
PANB_CHRSD/2-260---FAQH----AD-----AA--------G--------------------IDVLLVGDSLGM-------------VLQG--
A4A9Z8_9GAMM/3-260---FARL----VS-----EA--------G--------------------AETILVGDSLGM-------------VLQG--
PANB_SALRD/2-262---SARL----LD-----RA--------G--------------------ADVLLVGDSAAN-------------VMAG--
PANB_METCA/3-261---SAAL----QD-----EA--------G--------------------IEVILVGDSLGN-------------VIQG--
A4BLN5_9GAMM/12-271---LACV----VD-----EA--------G--------------------VDVILVGDTLGM-------------VIQG--
PANB_PYRAR/4-259---TAKL----VD-----EA--------G--------------------VDGILVGDSLGM-------------VVLG--
PANB_HELHP/4-261---MARI----FD-----GE--------.--------------------VDVILVGDSLKM-------------SFGG--
PANB_NITEC/7-266---FAAV----LE-----NA--------G--------------------VDILLVGDSLGN-------------VIQG--
PANB_CAMJR/2-259---SAKI----LD-----NC--------D--------------------IDIILVGDSLAM-------------TVLG--
A4TBM9_MYCGI/21-280---TAAV----FD-----EA--------Q--------------------IPVLLVGDSAAN-------------VVYG--
A4SZR6_POLSQ/8-267---MSAL----LN-----RC--------G--------------------VETILIGDSLGN-------------VIQG--
A5DHH9_PICGU/31-293---SAQV----CE-----AA--------N--------------------ADITLVGDSLAM-------------VALG--
A3EWD3_9BACT/4-264---TARL----LS-----RA--------G--------------------IDIALVGDSVAM-------------VVQG--
PANB_PYRAB/2-259---SALL----AD-----KA--------G--------------------FDIVFVGDSLGM-------------VVYG--
A6GSM9_9BURK/14-273---FASV----LD-----AS--------G--------------------VDILLIGDSLGM-------------VLAG--
Q75D37_ASHGO/23-289---TATW----AH-----AA--------H--------------------TDMILVGDSLAM-------------STLG--
PANB_AQUAE/1-261---SAKL----CD-----EV--------G--------------------IDCILVGDSLGT-------------VVKG--
PANB_XANOR/8-266---FART----FD-----VN--------G--------------------VDLILVGDSLGM-------------VMQG--
A7G0V7_CLOBH/1-261---MAKL----ID-----SS--------G--------------------INGILVGDSLGM-------------VCLG--
PANB_CORDI/3-260---TTRA----FV-----DA--------G--------------------IEVFLVGDSAAN-------------TMLG--
PANB_NITMS/1-260---LASL----CD-----KA--------G--------------------IDVLLVGDSAGM-------------VMLG--
PANB_ANAMM/1-257---MARI----LD-----EH--------.--------------------CDLILVGDSVGQ-------------TVYG--
A8DJM8_9BACT/4-264---TALV----CE-----AA--------G--------------------VDVILVGDSLGN-------------VLLG--
PANB_BUCAP/2-260---FSRL----FE-----KE--------G--------------------IPIMLVGDSLGM-------------TIQG--
A8ZX35_DESOH/1-254---TAVL----ED-----RA--------G--------------------IDILLVGDSVGR-------------NILG--
PANB_ROSCS/1-260---TAAL----FD-----AA--------G--------------------VPMLLVGDSLGD-------------NVLG--
PANB_THIDA/1-259---FARV----FD-----AA--------G--------------------VDVLLVGDSLGM-------------VIQG--
PANB_TRIEI/1-261---IAQL----LD-----NA--------G--------------------VDLILVGDSLGM-------------VTLG--
Q1YYG7_PHOPR/2-260---FSKI----FE-----EQ--------N--------------------MPVLIVGDSLGS-------------VIQG--
PANB_SYNFM/1-262---TALW----AD-----QS--------G--------------------IDMLLVGDSLAM-------------VVLG--
A4BJA6_9GAMM/3-261---FASM----FS-----KA--------G--------------------VETLLVGDSLGM-------------VCQG--
A5DVU0_LODEL/35-295---TSRM----SE-----EA--------Q--------------------IDITLVGDSLAN-------------TSLG--
PANB_LEPBJ/1-262---FARI----LG-----ET--------P--------------------IDSILVGDSLGM-------------VFQG--
PANB_METS4/15-273---MARL----VD-----PV--------.--------------------VDVILVGDSVGN-------------VCLG--
PANB_CHRVO/1-259---FASL----LD-----EA--------G--------------------VEILLVGDSLGP-------------VMQG--
PANB_HALMA/1-257---TASI----VD-----DT--------G--------------------VDVILVGDSMGN-------------AVLG--
O82357_ARATH/40-306---SAVH----LD-----TA--------G--------------------IDVCLVGDSASM-------------VVHG--
PANB_CAMC1/9-266---FAKI----FD-----DY--------.--------------------ADVILVGDSLNM-------------SFNM--
PANB_RALSO/11-269---FAAL----ME-----RS--------G--------------------VDVVLVGDSLGN-------------VVQG--
PANB_COXBU/3-262---SACI----IS-----QS--------N--------------------VDCILVGDSLAM-------------VMYG--
A4ET65_9RHOB/36-279---QIRA----CV-----EA--------E--------------------IDLLVVGTE..Q-------------M...--
A3ZKV5_9PLAN/9-265---MAQL----LD-----EA--------G--------------------VDSILVGDSLSM-------------VVQG--
PANB_MAGSA/8-266---IARL----LD-----PI--------.--------------------CDILLVGDSLGM-------------VVYG--
PANB_ANADE/9-273---AARL----VA-----AA--------G--------------------VDAVLVGDSLGM-------------AVQG--
PANB_YEAST/24-291---TATW----VN-----KA--------N--------------------CDLLLVGDSLAM-------------TSLG--
A3JDV2_9ALTE/1-259---FAQL----VS-----EA--------G--------------------VDVILIGDSLGM-------------VLQG--
A5P8F6_9SPHN/22-283---QAQL----LD-----AH--------.--------------------CDMLLVGDSLGQ-------------VIYG--
PANB1_ZYMMO/32-297---FAAA----AD-----AA--------G--------------------VDCIMVGDSLGM-------------VCQG--
A4RSY4_OSTLU/34-300---SAKQ----VD-----SA--------G--------------------IDVVLVGDSAAM-------------VVHG--
PANB_ACIC1/9-268---TARI----FE-----EA--------G--------------------IDVLLVGDSAAN-------------TVLG--
PANB_BDEBA/1-259---FARI----VA-----DS--------D--------------------IDCILVGDSLAM-------------VMLG--
PANB_DECAR/8-267---FARL----LD-----GA--------G--------------------VDSILIGDSLGN-------------VIQG--
PANB1_METPP/12-271---SAKW----AE-----LA--------G--------------------VDVAVVGDSLAM-------------VAHG--
A7BVR3_9GAMM/2-261---FANL----LD-----QA--------C--------------------LEILLVGDSLGM-------------VIQG--
Q54LH3_DICDI/90-350---SSKI----VD-----KS--------G--------------------MDMILVGDSLGM-------------VMNG--
PANB_HELPJ/9-266---FAQI----FD-----PL--------.--------------------VDVILVGDSLNM-------------SFFN--
Q6CE35_YARLI/39-299---TGLI----AD-----KA--------G--------------------VDMILVGDSLAM-------------VALG--
PANB_RHOBA/9-265---TAKI----LD-----EA--------G--------------------VDVLLVGDTVGM-------------VVQG--
PANB_DEHE1/1-261---TAQI----LD-----KA--------G--------------------IPAILVGDSLGM-------------VVLG--
PANB_MAGSM/3-263---LARL----VD-----AA--------D--------------------VDLVLVGDSLGM-------------VVQG--
Q6CLY9_KLULA/31-297---TASW----AQ-----NA--------N--------------------SDMILVGDSVAM-------------CSLG--
PANB_THET2/1-258---TARL----AE-----AA--------G--------------------VDAILVGDSLGM-------------VVLG--
Q7NSX9_CHRVO/9-255---IAEA----VD-----EW--------.--------------------VDIVLIDDAVPM-------------EGDA--
PANB_KORVE/10-270---TARL----VD-----EA--------G--------------------IDMILVGDSLAQ-------------TMLG--
Q841Y3_CAMFE/9-266---FARL----FD-----DY--------.--------------------VDMILVGDSLNM-------------SFGG--
PANB_HERA2/1-259---SAQL----VD-----RT--------D--------------------IPLILVGDSLGM-------------VIQG--
PANB_CAUCR/10-267---VAAA----LD-----DA--------.--------------------CDVLLVGDSVGM-------------VVHG--
PANB_NOCSJ/33-292---AAQT----FD-----EA--------G--------------------IEVLLVGDSASN-------------NVFA--
Q2UMW5_ASPOR/70-332---SGHI----AE-----AA--------G--------------------MEMILVGDSLAM-------------VALG--
PANB_FRATO/1-259---LAKI----IN-----ST--------D--------------------IDCILVGDSGGM-------------VLLG--
A4GIZ2_9DELT/4-264---LSKL----LD-----AT--------D--------------------LDIILVGDSLGM-------------VSLG--
PANB_CHLCH/10-274---MARI----LD-----RA--------G--------------------VDVLLVGDSASN-------------VFSG--
PANB_LEGPL/1-259---SACI----VA-----ES--------N--------------------IDCVLVGDSVAM-------------AVHG--
A7TTC6_VANPO/35-302---TASW----AQ-----KS--------N--------------------CDMILIGDSLAM-------------TSLG--
B4U641_HYDS0/3-262---SAKI----CE-----EA--------G--------------------IDTILVGDSLGM-------------VFKG--
A7I1C3_CAMHC/2-260---FAKL----FD-----EY--------.--------------------VDIILVGDSLNM-------------SFNG--
A5L777_9GAMM/1-252---VAAS----IE-----SA--------G--------------------IPIILVGDTVGM-------------VEMG--
PANB_BACSK/1-260---SARL----AE-----RA--------G--------------------VDMILVGDSLGM-------------VVLG--
PANB_SULSO/2-260---TAKI----IS-----NT--------T--------------------LDSILVGDSLGM-------------VVLG--
Q5ABB3_CANAL/27-288---TSQI----LE-----QA--------K--------------------VDINLIGDSLAN-------------TTLG--
A3D6H9_SHEB5/8-266---MAEL----ID-----PH--------.--------------------VDMIIVGDSVGM-------------VVYG--
PANB1_PSEF5/6-266---MARL----MD-----PF--------.--------------------VDFILIGDSTAM-------------VGYG--
A5FWA4_ACICJ/8-270---FAKL----AE-----AA--------G--------------------IDGILIGDSLGM-------------TVQG--
PANB_NITSB/3-256---FAKL----FE-----PI--------.--------------------VDMILVGDSLNM-------------VFAG--
PANB_MARMS/12-270---FTNV----MN-----VA--------G--------------------VETILVGDSLGM-------------VIQG--
A7BDA4_9ACTO/24-281---TAPI----LE-----AA--------G--------------------VDMLLVGDSLGN-------------VILG--
Q8GDR8_HELMO/3-263---FAQL----VD-----ES--------E--------------------VEVILVGDSLGM-------------VVLG--
PANB_STAMF/2-259---FAKL----VD-----EA--------G--------------------VDIILVGDSAGM-------------VVHG--
PANB_TROWT/12-268---TARV----LS-----DC--------E--------------------LDFLLVGDSASG-------------VIYG--
A4GK01_9BACT/1-254---IAEE----VD-----KY--------.--------------------VDIVLVGDSLGS-------------VLYN--
PANB_DEIGD/1-259---GARH----AE-----AA--------G--------------------VDLILVGDSLGN-------------VVLG--
B1K6U2_BURCC/8-266---MAKL----VD-----EV--------.--------------------ADVIIVGDSVGM-------------VLYG--
PANB_WIGBR/2-261---FANL----FF-----KK--------G--------------------IRTILVGDSLGM-------------TIQG--
PANB_DESVH/19-278---SARI----VD-----GA--------G--------------------ADLILVGDSLGM-------------VMLG--
A3WLA3_9GAMM/2-260---FAKL----MV-----EQ--------G--------------------VDCILVGDSLGN-------------VVQG--
PANB_CORGB/9-268---SARI----FD-----EA--------G--------------------VDMLLVGDSAAN-------------VVLG--

PF14010

CAPPA_METHJ/3-484---AYYV----YS.....HL--------G--------------------CTEQMWDCEGKE-------------VDNY--
B1V5L0_CLOPF/3-537---AIKG----LTPQDKGGL--------G--------------------IEEVMIDFEGKL-------------TPYH--
D2PDY7_SULID/4-511---AFLA----YS.....MY--------G--------------------VHEVMWDAEGKD-------------VDTH--
D3S0D1_FERPA/2-476---AYYV----FS.....HF--------G--------------------CDEQMWDFEGKE-------------VDDF--
B5YCF7_DICT6/5-497---AYYA----FS.....YL--------G--------------------VDEVMWDVEGKE-------------TDEF--
CAPPA_HALSA/4-492---AYYV----YS.....HL--------G--------------------CDEQMWDFEGKE-------------GDEY--
C6HVN3_9BACT/19-520---CYRS----YI.....DI--------G--------------------CQEYMWDWEGKY-------------VDEG--
A3EQI3_9BACT/19-520---CYRT----YT.....DL--------G--------------------CQEYMWDWEGKY-------------VDEG--
CAPPA_PYRCJ/3-459---AIVA----FT.....AY--------G--------------------CDEVMVDYEGKA-------------TPYS--
CAPPA_METTH/3-483---AYYV----FS.....HL--------G--------------------CDEQMWDCEGKE-------------VDNY--
CAPPA_PYRAB/2-469---AFYA----FN.....VL--------G--------------------ADEQMWDFEGKE-------------VDEF--
CAPPA_METMA/7-526---AIEA----AV.....VF--------G--------------------CDEYMPDYEGKA-------------TPYH--
CAPPA_METKA/9-532---AVEC----LV.....EL--------G--------------------AEEYMVDFEGKL-------------TPYL--
F0LK16_THEBM/2-476---AFYA----FS.....VL--------G--------------------IEEQMWDFEGKE-------------VDEF--
A8A9C2_IGNH4/3-488---AIQD----VLPLDQGGR--------G--------------------CDEKMVDYEGKA-------------TPYN--
CAPPA_SULTO/4-511---AYLA----YE.....HY--------E--------------------VDEVMWDAEGKD-------------VDTH--
B1I2W1_DESAP/7-489---AYYV----IS.....HL--------Q--------------------CQEQMWDCEGKE-------------VDNF--
B1YBY2_THENV/2-461---AIVA----YT.....AY--------G--------------------CDEVMIDYEGKT-------------TPYA--
CAPPA_PICTO/6-508---AYQC----YT......I--------G--------------------IKEVMWDAEGKD-------------VDTH--
CAPPA_CALMQ/4-512---AYMN----YS.....IY--------D--------------------CQETMWDFEGKD-------------VDIY--
CAPPA_METS5/4-509---AYYA----FS.....RL--------N--------------------VHEVMWDAEGKD-------------VDTH--
Q1PXR4_9BACT/4-490---AYYV----FS.....HL--------R--------------------CDEQMWDCEGKE-------------VDEF--
CAPPA_ARCFU/2-471---AYYV----FS.....HF--------K--------------------CDEQMWDFEGKE-------------ADAH--
CAPPA_PYRAR/4-460---AIVA----YT.....AY--------G--------------------CDEVMVDYEGKM-------------TPYG--
CAPPA_PYRAE/3-460---AVVA----FL.....AY--------G--------------------CDEVMVDYEGKA-------------TPYS--
C6A2T7_THESM/11-485---AFYA----FS.....VL--------G--------------------VQEQMWDFEGKE-------------VDEF--
CAPPA_SULAC/4-511---AYLA----FS.....RY--------G--------------------VEEVMWDAEGKD-------------VDTH--

PF01274

MASY_EMENI/11-531------------------------------------------------------MING---------Q-------INLYD
MASZ_CORGL/35-713------------------------------------------------------LNTG---------E-------LKEEM
MASY_MYXXD/17-538------------------------------------------------------VVRG---------Q-------INLRD
MASZ_ECOLI/17-697------------------------------------------------------LMQG---------T-------LQEKM
Q9RYN3_DEIRA/10-521------------------------------------------------------CVQG---------Q-------INLRD
MASY_PICAN/21-543------------------------------------------------------MIYG---------Q-------VNLYD
MASZ_PSEFL/17-697------------------------------------------------------LMKG---------D-------LAEEV
MASY_MAIZE/16-548------------------------------------------------------LMHG---------Q-------VNLRD
MASY_STRAE/10-542------------------------------------------------------VVLG---------Q-------VNLSD
MASY_NEUCR/11-531------------------------------------------------------MVNG---------Q-------VNLYD
MASY_STRCL/10-540------------------------------------------------------VISG---------Q-------LALSD
MASY_BRANA/21-551------------------------------------------------------LMRG---------Q-------VNLKD
MASY_ECOLI/11-533------------------------------------------------------VIDG---------Q-------INLRD
MASZ_MYCLE/17-704------------------------------------------------------LNKG---------D-------LTEEV
MASY_CANTR/15-540------------------------------------------------------LVEG---------Q-------VNLYD
MASY_YEAST/18-542------------------------------------------------------MVYG---------Q-------VNLYD

PF03328

Q9RYM1_DEIRA/24-251------------------------------------------------------....---------.-------NDVRS
Q8XL94_CLOPE/6-225------------------------------------------------------KDSA---------R-------RLVYH
BPHF_SPHAR/18-244------------------------------------------------------....---------.-------QTLPG
Q9CGA8_LACLA/9-229------------------------------------------------------KDAA---------R-------VLVYE
O22982_ARATH/17-240------------------------------------------------------....---------.-------GGIRE
Q8Z9M3_SALTI/5-223------------------------------------------------------KDTA---------R-------LLVHH
RHMA_ECOLI/19-246------------------------------------------------------....---------.-------NTIQD
Q8RDW5_FUSNN/9-227------------------------------------------------------KDAA---------R-------FLVSE
GARL_ECOLI/20-246------------------------------------------------------....---------.-------NDIST
Q9KTU0_VIBCH/11-230------------------------------------------------------KDTA---------R-------MLVFH
Q93167_CAEEL/26-259------------------------------------------------------KADA---------R-------VRAAA
Q9HRM8_HALSA/29-241------------------------------------------------------KGDA---------R-------RAVSD
Q8XBS2_ECO57/20-239------------------------------------------------------KDTA---------R-------RMVYH
Q9UVD4_9ASCO/43-283------------------------------------------------------..FN---------R-------LELHD
O82487_ARATH/90-322------------------------------------------------------....---------.-------GGIPE
HPCH_ECOLX/15-242------------------------------------------------------....---------.-------NNVQT
CITEL_DEIRA/9-223------------------------------------------------------KAAA---------R-------PVAHD
Q8K7F2_STRP3/6-224------------------------------------------------------KDTS---------R-------ALVHF
Q8VQP0_RHOER/12-226------------------------------------------------------KDLA---------R-------TLVST
BPHF_RHOSR/18-244------------------------------------------------------....---------.-------QDLRS
Q9XY64_TRYCR/18-251------------------------------------------------------....---------.-------VDALT
Q9RLT5_WEIPA/10-229------------------------------------------------------KDAA---------R-------YLVYE

PF13714

A0JTC7_ARTS2/12-246------------------------------------------------------YEDG.........E-------NIPAN
A0K276_ARTS2/27-270------------------------------------------------------FPDG.........N-------HLPRE
A0NXG4_9RHOB/11-252------------------------------------------------------VKDA........EG-------LITRD
A0QPJ7_MYCS2/16-251------------------------------------------------------KSDG.........E-------NMAFE
A0R0I0_MYCS2/10-256------------------------------------------------------LPDT.........G-------LLSLD
A1CA54_ASPCL/14-274------------------------------------------------------IAD..........E-------DLTLT
A1SIA9_NOCSJ/3-233------------------------------------------------------HPDG.........D-------GATRD
A2VJA9_MYCTU/3-230------------------------------------------------------HPDG.........H-------RATRG
A3I8T3_9BACI/7-245------------------------------------------------------YADG.........E-------LIDFQ
A3NHT8_BURP6/20-277------------------------------------------------------RPDI.........E-------ILDIA
A3TPN1_9MICO/3-233------------------------------------------------------KSDL..........-------EVTRD
A3UJ38_9RHOB/7-249------------------------------------------------------FEDG.........E-------SLPLE
A3WAP9_9SPHN/6-247------------------------------------------------------YDDG.........E-------HIPFS
A3Y7J5_9GAMM/4-243------------------------------------------------------YEDG.........E-------HISFN
A4AEG4_9ACTN/15-253------------------------------------------------------VPDG.........E-------GLSIE
A4ET25_9RHOB/10-247------------------------------------------------------YGDG.........E-------QLPLD
A4F7M3_SACEN/8-232------------------------------------------------------LPDA.........E-------GAAKS
A4FH54_SACEN/26-273------------------------------------------------------FDDG.........E-------TAPPA
A4X5C0_SALTO/32-264------------------------------------------------------AGDG.........E-------TMGRD
A4X7L5_SALTO/4-223------------------------------------------------------LPDG.........T-------DAALG
A4XS21_PSEMY/12-254------------------------------------------------------RPDG........EG-------LISRE
A4YVZ4_BRASO/12-249------------------------------------------------------KADT..........-------HTMLD
A5G4A7_GEOUR/12-254------------------------------------------------------YLDG.........E-------CVPFA
A5LD69_STRPN/2-260------------------------------------------------------KPDM.........E-------VVNIT
A5V3Q4_SPHWW/10-252------------------------------------------------------YPDG.........E-------ALPFD
A8LYX8_SALAI/6-252------------------------------------------------------LADA.........N-------VLGVR
A8TK14_9PROT/10-251------------------------------------------------------APDL.........I-------VLTLS
A9DYN3_9FLAO/3-242------------------------------------------------------YNDG.........E-------EMEFS
A9WM41_RENSM/9-245------------------------------------------------------YPDG.........N-------NLPFE
B1IHA0_CLOBK/33-275------------------------------------------------------YSDG.........E-------KIDFE
B1T3E7_9BURK/12-255------------------------------------------------------FADG.........E-------QMPKA
B1VSN1_STRGG/14-249------------------------------------------------------ADDQ.........E-------GQTFE
B4RBF1_PHEZH/10-242------------------------------------------------------HPDG.........D-------AAPFD
B4SLQ1_STRM5/8-241------------------------------------------------------YADG.........G-------ALPDT
B4WCU0_9CAUL/11-249------------------------------------------------------VRDG.........E-------GLGRE
B5HHA0_STRPR/15-253------------------------------------------------------HPDG.........E-------GAPWQ
B5HRK0_9ACTO/12-259------------------------------------------------------RPDHDFFAEQPPED-------RVDRE
B5HVC7_9ACTO/7-239------------------------------------------------------HEDG.........S-------.TPAD
B6HSS2_PENCW/11-259------------------------------------------------------VDD..........N-------ALTKA
B6YYQ6_9RHOB/10-253------------------------------------------------------YEDG.........E-------KIPLS
B8H7Q2_ARTCA/13-246------------------------------------------------------YADG..........-------AMPLD
B8J5T4_ANAD2/11-248------------------------------------------------------LPDG..........-------AVAGA
B8MDA8_TALSN/5-285------------------------------------------------------IPDT.........E-------LISPL
B9JNZ3_AGRRK/15-273------------------------------------------------------MPDI.........E-------VVDVA
B9K4D9_AGRVS/8-247------------------------------------------------------VPEG........I.-------.VSRD
B9NN70_9RHOB/11-254------------------------------------------------------FGDG.........Q-------NIPME
B9YYY5_9NEIS/10-252------------------------------------------------------LPDY........AG-------AVSRE
C0CW09_9CLOT/6-270------------------------------------------------------LPDL.........G-------LVTAA
C0D909_9CLOT/255-518------------------------------------------------------IPG..........G-------LYNWE
C0RYY1_PARBP/55-297------------------------------------------------------FED..........D-------FLDLD
D7W5Q1_9FLAO/4-244------------------------------------------------------YEDG.........E-------QMTFE
C1D0L9_DEIDV/16-251------------------------------------------------------YADG.........E-------NIPLE
D5UDN5_CELFN/12-253------------------------------------------------------RTDG.........H-------GLTRE
C2G595_9SPHI/6-241------------------------------------------------------YEDG.........E-------NIAFE
C2SBC8_BACCE/6-244------------------------------------------------------YSDG.........E-------QLPFE
C3K8Q8_PSEFS/8-242------------------------------------------------------YQDG.........N-------QLPLK
OADC_PSEFS/13-253------------------------------------------------------APDF.........A-------LITLS
C4RQC1_9ACTO/15-253------------------------------------------------------YADG.........E-------ATPVE
C5C673_BEUC1/6-244------------------------------------------------------KPDG.........S-------GAIAE
C5ERW5_9FIRM/6-250------------------------------------------------------IPDL.........N-------LLSVD
C5K5X0_PERM5/22-289------------------------------------------------------MPDI.........E-------TVDTT
D9SPL5_CLOC7/7-255------------------------------------------------------YKSE.........E-------DIDLN
C6CCM3_DICDC/20-260------------------------------------------------------KLDR........AQ-------SVTLE
C6W6H2_DYAFD/19-261------------------------------------------------------YEDG.........E-------HIPFD
C7Q1F2_CATAD/16-252------------------------------------------------------QGDG........S.-------.ITRD
C7YUL0_NECH7/9-264------------------------------------------------------IKD..........E-------ELTLE
C7YZU2_NECH7/391-674------------------------------------------------------VPDA.........S-------ILPMS
D6Z4R6_DESAT/153-411------------------------------------------------------KPDI.........E-------AVDVT
C8TDE8_KLEPR/3-239------------------------------------------------------YEDG.........E-------EMSFD
C9SRU6_VERA1/11-259------------------------------------------------------IKD..........E-------DLTFE
D5VJX4_CAUST/12-246------------------------------------------------------KDDG..........-------QLTRD
D1A2J0_THECD/5-232------------------------------------------------------MADA.........S-------RAIAE
D1BED0_SANKS/11-246------------------------------------------------------SADG.........H-------RLPRA
D1BI43_SANKS/12-247------------------------------------------------------LPDG.........D-------HLGRA
D1RNP5_SEROD/10-245------------------------------------------------------YRDG.........D-------RLPLA
D9TER7_MICAI/8-239------------------------------------------------------RPDA.........V-------RATRT
F0QAJ3_ACIAP/21-266------------------------------------------------------VRDA.........N-------EASWT
E3J806_FRASU/10-249------------------------------------------------------RLDG........RH-------AVSRQ
D2B1P9_STRRD/6-236------------------------------------------------------LPDA.........E-------QATWA
E3I6J4_RHOVT/30-272------------------------------------------------------LLPS.........D-------RVPLD
D2MU75_CAMJU/150-410------------------------------------------------------KPDI.........E-------FVDLT
D2NZY3_LISM1/8-251------------------------------------------------------AVDG.........E-------HLTFD
D2PR97_KRIFD/29-269------------------------------------------------------YDDG.........E-------AAPVG
D2Q3B1_KRIFD/7-234------------------------------------------------------YDDG.........E-------LTPPA
D2Q4L3_KRIFD/4-243------------------------------------------------------AGDH...TLPDGAP-------SVPAD
D2SNG0_STRFR/150-408------------------------------------------------------KPDT.........E-------AVDVS
D2YH96_VIBMI/2-242------------------------------------------------------KEDG.........E-------NINFE
D3AHD3_9CLOT/10-248------------------------------------------------------TPDE.........G-------TLSTS
D3AHD4_9CLOT/10-270------------------------------------------------------QPDM.........A-------FGTLD
D3EII1_GEOS4/13-252------------------------------------------------------YAD..........R-------NMPFD
D3V3K7_XENBS/39-278------------------------------------------------------YPDN.........Q-------LADRK
D4AZN8_ARTBC/10-268------------------------------------------------------KPD..........E-------ELEPE
D4GMW6_PANAM/2-261------------------------------------------------------IPDN.........E-------TLALS
D4LCE5_RUMC1/6-261------------------------------------------------------MPDD.........G-------RMPLS
PEPM_STRHY/22-268------------------------------------------------------VRDS.........D-------EASWT
Q01YZ5_SOLUE/12-251------------------------------------------------------RADG........A.-------.LTRD
OADC_RHOP5/10-250------------------------------------------------------DPDI.........A-------LITLT
Q08U27_STIAD/11-246------------------------------------------------------APDG.........E-------HFEFD
Q0BYP5_HYPNA/11-255------------------------------------------------------FADG.........E-------AVPLD
Q0RPX9_FRAAA/13-247------------------------------------------------------RLDR..........-------SVTRE
Q0ZQ45_9ACTO/7-253------------------------------------------------------VPDD.........S-------ILTMT
Q12Q29_SHEDO/14-259------------------------------------------------------VRDR.........N-------EISWT
Q1GKC0_SILST/10-253------------------------------------------------------YADG.........E-------SIPLD
Q1GQT2_SPHAL/9-246------------------------------------------------------RADG.........E-------DFPLE
Q1MM68_RHIL3/10-253------------------------------------------------------YADG.........E-------KLPMS
Q28RZ5_JANSC/10-249------------------------------------------------------RADM.........G-------GVDRD
Q2CCZ7_9RHOB/9-248------------------------------------------------------RPDG.........G-------TVTRD
Q2JAX2_FRASC/15-255------------------------------------------------------VADG........AN-------LIDRT
Q3KEA6_PSEPF/8-242------------------------------------------------------YPDG.........N-------TLPLE
Q4DNR3_TRYCC/14-261------------------------------------------------------FRDN.........N-------EASWT
Q4KET5_PSEF5/11-270------------------------------------------------------LPDI.........E-------ILSPS
Q4ZV58_PSEU2/7-249------------------------------------------------------YRDS........SP-------SMDNE
Q5E5F2_VIBF1/18-278------------------------------------------------------KPDI.........E-------LLDIK
Q5LNA0_SILPO/10-253------------------------------------------------------YADG.........Q-------QMPLE
Q5LUG9_SILPO/10-245------------------------------------------------------LADG.........G-------QISRD
Q5WBL4_BACSK/19-257------------------------------------------------------YPDG.........Q-------QLPRA
Q65ND9_BACLD/10-248------------------------------------------------------YPDG.........E-------HLPFE
Q72PY6_LEPIC/12-252------------------------------------------------------LPDH........Q.-------ILDRD
Q7NXV8_CHRVO/33-277------------------------------------------------------YRDG.........G-------ELPRE
Q7P124_CHRVO/3-243------------------------------------------------------YSDG.........E-------AMGFA
Q893V9_CLOTE/153-411------------------------------------------------------KPDI.........E-------LVDMS
Q8EI00_SHEON/9-240------------------------------------------------------YPDG.........Q-------ALPKV
Q8KJ74_RHILI/14-259------------------------------------------------------YRDA.........N-------EASWS
Q9LPL2_ARATH/39-259------------------------------------------------------KPDF.........D-------LRRWQ

PF00311

C7M9P2_BRAFD/148-942------------------------------------------------------LKLQ---------A-------ETSID
A8YCL3_MICAE/183-1018------------------------------------------------------CCYQ---------R-------NLVIK
CAPP_ACTP2/128-879------------------------------------------------------LRMN---------R-------WKAAE
A0ZJ69_NODSP/196-1034------------------------------------------------------ACYQ---------R-------KMVLE
CAPP_SYNP6/236-1053------------------------------------------------------ACYQ---------R-------SLVLD
D3VH32_XENNA/127-879------------------------------------------------------LLLS---------R-------WKAAD
Q474V2_CUPPJ/200-1006------------------------------------------------------ATQQ---------S-------RMILG
A0N072_CITSI/164-967------------------------------------------------------CLLA---------R-------MMAAN
Q2KZS8_BORA1/137-936------------------------------------------------------MLRQ---------A-------AVVFE
B5W9X1_SPIMA/196-1035------------------------------------------------------ACYQ---------R-------GMIID
D2QW47_PIRSD/157-942------------------------------------------------------LVWL---------R-------ERAIS
A5GVT4_SYNR3/167-992------------------------------------------------------ACYQ---------R-------QLMLE
C6D470_PAESJ/147-936------------------------------------------------------LTLN---------R-------QLAIK
A3IQQ1_9CHRO/183-1016------------------------------------------------------ACYQ---------R-------NLILE
A3JFS1_9ALTE/116-876------------------------------------------------------FLLG---------R-------WMAAD
B8HVC9_CYAP4/199-1018------------------------------------------------------ACYQ---------R-------DLVLE
C1F4Y2_ACIC5/161-947------------------------------------------------------IHEA---------R-------TRLLD
CAPP_SYNY3/193-1034------------------------------------------------------ACYQ---------R-------GLVLG
CAPP_ECOK1/128-883------------------------------------------------------LLLS---------R-------WKATD
B1XMB9_SYNP2/163-995------------------------------------------------------ACYQ---------R-------GLVLE
A4S610_OSTLU/183-1007------------------------------------------------------VLLA---------R-------VQGVN
A9RUR8_PHYPA/162-969------------------------------------------------------CLLA---------R-------LMAAN
C6J5X1_9BACL/143-933------------------------------------------------------LRMQ---------R-------KLAVR
B8GNA5_THISH/143-947------------------------------------------------------CRLA---------M-------EQVLS
CAPP_HAHCH/132-881------------------------------------------------------FLLS---------R-------WMAAD
B1Y159_LEPCP/163-950------------------------------------------------------LSRQ---------S-------ETVLR
CAPP_THEEB/197-1011------------------------------------------------------ACYQ---------R-------NLVLE
A4NFT0_HAEIF/128-879------------------------------------------------------LYFA---------R-------WKAAD
A9S2G6_PHYPA/161-965------------------------------------------------------CLLA---------R-------LMAAN
Q54JZ3_DICDI/144-931------------------------------------------------------SYFS---------R-------WIAAT
CAPP_ACIBT/133-894------------------------------------------------------LWLS---------R-------WQAAD
B4VT20_9CYAN/197-1034------------------------------------------------------ACYQ---------R-------NLVLE
C1MJ77_MICPC/164-991------------------------------------------------------VYLA---------R-------SKAAD
A2C517_PROM1/168-994------------------------------------------------------ACYQ---------R-------QLMLD
E0UJ33_CYAP2/184-1020------------------------------------------------------ACYQ---------R-------NVVIE
B7DNZ9_9BACL/131-906------------------------------------------------------LVLH---------C-------DLALN
B4WPD5_9SYNE/199-1032------------------------------------------------------ANYQ---------R-------NMVLG
A4CSJ4_SYNPV/168-991------------------------------------------------------ACYQ---------R-------QLMLD
A5WCX5_PSYWF/133-932------------------------------------------------------VLLH---------A-------NTVLR
A0JSJ3_ARTS2/161-954------------------------------------------------------LQIQ---------N-------QHAVR
B7G725_PHATC/84-877------------------------------------------------------VLQQ---------R-------LRAAR
B8KBA6_VIBPA/130-880------------------------------------------------------MLLS---------R-------WKAAD
CAPP_GLOVI/141-939------------------------------------------------------ACHQ---------R-------SRVLA
C5Z450_SORBI/157-961------------------------------------------------------CLLS---------R-------MMAAN
C3X714_OXAFO/147-957------------------------------------------------------LERQ---------S-------HLIME
C8PZR0_9GAMM/162-956------------------------------------------------------FKRQ---------A-------ATVFY
D1CE74_THET1/138-931------------------------------------------------------ARLQ---------K-------GVLLR
Q117S5_TRIEI/186-1038------------------------------------------------------ACYQ---------R-------QIVLE
C1AE63_GEMAT/147-933------------------------------------------------------LRLQ---------A-------SATFD
A9QPD2_METI4/151-931------------------------------------------------------FILQ---------R-------NLALR
B0BZ90_ACAM1/184-1012------------------------------------------------------SCYQ---------R-------NLVLE
A4X3B0_SALTO/171-972------------------------------------------------------LAIA---------H-------EHGLA
E3JCU0_FRASU/173-968------------------------------------------------------LTLQ---------H-------EFGIR
Q2JKJ2_SYNJB/177-978------------------------------------------------------ARYQ---------R-------NLILG
CAPP_PROMS/165-989------------------------------------------------------ACYQ---------R-------QLMLE
A9IDM8_BORPD/139-951------------------------------------------------------LLRQ---------A-------TVLFE
A0L255_SHESA/136-889------------------------------------------------------LDRN---------R-------HAAAR
A4G3V1_HERAR/147-944------------------------------------------------------LARQ---------S-------TTILE
C1DZM5_MICSR/162-982------------------------------------------------------VYLA---------R-------ITAVN
D0CKG9_9SYNE/185-1009------------------------------------------------------ACYQ---------R-------QLMLE
D3EKG0_GEOS4/142-928------------------------------------------------------LEMQ---------R-------KLAIR
A3YUN9_9SYNE/171-1002------------------------------------------------------ACYQ---------R-------QLMIE
A0YPE3_LYNSP/196-1038------------------------------------------------------ACYQ---------R-------HLVLE
B1VUI2_STRGG/125-909------------------------------------------------------LILQ---------H-------EHGIT
CAPP1_CHLRE/154-974------------------------------------------------------VVLA---------R-------LEAVN

PF15617

H4XEK7_ECOLX/4-311------------------LLHELSNSMHSL........................GKND---------W-------PLVFI
D5CKQ7_ENTCC/4-311------------------LLHELSNSMRSL........................GKND---------W-------PLVFI
B2NP51_ECO57/4-311------------------LLHELSNSMSSL........................GKND---------W-------PLVFI
A7MPV2_CROS8/4-311------------------LLHELSNSMLSL........................GKND---------W-------PLVFI
C4XDI3_KLEPN/4-311------------------FLKQLRHARAVN........................DDEK---------Y-------PLVFI
B5RKC3_KLEP3/4-311------------------FLKQLRHARAVN........................DDEK---------Y-------PLVFI
D0KLU5_PECWW/4-310------------------LLTVLAQAKQAN........................GKAD---------W-------PLVFV
B4EW80_PROMH/4-311------------------LLTTLSDYKKHH........................DCTE---------W-------PLLFI
D3V2D7_XENBS/4-313------------------VLQSLAGADISSSH......................TERD---------Y-------PLIFI
A4TRW8_YERPP/4-311------------------LLGTLAVEKKRD........................GSAH---------W-------PLIFV
B1JNG5_YERPY/4-311------------------LLGTLAVEKKRD........................GSAH---------W-------PLIFV
E1PL56_PANVC/4-311------------------LLDKLKQTANQG........................CQDS---------R-------PLVFI
D3VJW5_XENNA/4-312------------------VLQILAEAGVRHAGKQVSD.................TKRH---------H-------PLLFI
E2MHA5_PSEUB/3-308------------------VLTRIHDRGG..........................RPAN---------G-------PLLFV
Q4ZYA8_PSEU2/3-308------------------VLTRIRDHGG..........................RPAN---------G-------PLLFV
F3K7E7_PSESZ/3-308------------------VLTRIQDRGG..........................RPAN---------G-------PLLFV
Q39AX0_BURS3/4-309------------------LLMNIDARGG..........................RAES---------G-------PLLFV
Q6FAX8_ACIAD/1-293------------------LLQKIQQQQWHE...........................Q---------H-------PKVFI
A5WBK4_PSYWF/17-345------------------LLSHWASVQQDTPLSVSRSQCVNQIDEATGVQISAVQKSN---------R-------PLVFI
Q4FTQ0_PSYA2/59-379------------------LLHTWATHVDSINEPTQQADIQP.............EQPT---------R-------PLVFV
Q5NWT6_AROAE/1-302------------------PIRALTSA...............................S---------H-------QMRFI
D3RPA3_ALLVD/1-291------------------CLDAMEPR...............................P---------S-------LLRFV
Q1QCR8_PSYCK/1-326------------------LLYTWATHVDSINEPIQQAETQQTKIQT........EQPT---------R-------PLVFV
B6C0F8_9GAMM/22-320------------------VLEQLRP................................S---------S-------MLRFI
A1VWQ0_POLNA/1-302------------------ALQQMTP...............................RP---------G-------TDRFV
G2TCW8_RHORU/5-304------------------CLTKLED................................G---------R-------PLVFI
Q9RSA7_DEIRA/8-310------------------ALPQLPL...............................TG---------G-------PLRFI
D5BYR3_NITHN/21-319------------------VLEQLRS................................S---------S-------MLRFI
D8K7I6_NITWC/22-320------------------VLEQLRP................................S---------S-------MLRFI
E8U9R3_DEIML/2-300------------------ALPHLPA..............................PGS---------G-------PLMFV
A8MM95_ALKOO/30-369------------------QLNQIDEAVQKGHV......................KADN---------L-------PLIFI
Q891X5_CLOTE/30-390------------------ICKKITYCIETKKI......................NPNN---------L-------PLIFL
A8F9P5_BACP2/30-380------------------QLTSLKEKVTHAPE......................TAEH---------L-------PLIFI
C9RML9_FIBSS/26-375------------------VLDTLAECEKNGTL......................KYED---------I-------PLIFF
E3IYR0_FRASU/30-389------------------ALNELGENPPT.........................VGDS---------P-------GLIFV
Q9KY27_STRCO/30-382------------------QLTDLAER............................SGDD---------V-------PLLFV
E3DTS5_BACA1/30-372------------------QLERIDQAVQQRKQ......................LAEH---------F-------PFMFV
Q5YN23_NOCFA/30-379------------------ALDELAA.............................DEDP---------A-------PLLFV
B1HUS4_LYSSC/26-382------------------DISELYKLYHQKQL......................LLQD---------I-------PLLFI
F2JGK5_CELLD/30-386------------------TFIGLGQALKNGIV......................KEED---------L-------PLLFI
I0UNS1_BACLI/30-379------------------QADMIYQAQKLQNI......................NSDV---------L-------PLMFI
D1BEK0_SANKS/30-379------------------QLRTYAE.............................TGAS---------G-------PLIFV
D1A9P4_THECD/30-379------------------QLRRVHA.............................SGSA---------A-------PLLFI
C9ZE12_STRSW/30-382------------------QFADLAER............................PDVD---------L-------PLLFI
F4H5N5_CELFA/32-382------------------QLRELSR.............................SGAT---------A-------PFVFV
B7HBK1_BACC4/30-359------------------QIQQIANLVSANIL......................NQAD---------I-------PLLFI
B7IMX8_BACC2/30-359------------------QIQQIANLVSANIL......................NQAD---------I-------PLLFI
C8W644_DESAS/30-382------------------QLKTLLIMEKKG..........................SF---------L-------PFIFI
Q82B97_STRAW/30-381------------------QFTDLAGR............................SDVP---------L-------PLLFV
Q0SDY5_RHOSR/44-394------------------ALDRLAT.............................HGGA---------R-------MQLFV
Q72YD0_BACC1/30-359------------------QIQQISNLVSDNIL......................NQAD---------I-------PLLFI
C1B1Z6_RHOOB/52-402------------------ALDLLAT.............................RGGP---------R-------MQLFV
A4J1D5_DESRM/16-371------------------QLGTLLAMAEKG..........................SS---------L-------PFIFV
C0ZNQ3_RHOE4/41-390------------------ALDKIAS.............................TDAV---------G-------MLLFV
C0Z9Y5_BREBN/30-389------------------QVRDISSRLRNGLI......................QQDD---------I-------PIMFV
Q186J7_CLOD6/30-356------------------ILKNISNESIT.........................NKDG---------I-------PLIFV
E3EE66_PAEPS/10-379------------------QLFQLLSYVRTGMM......................SEQQ---------L-------PLLFV
F4D0A7_PSEUX/30-386------------------TLRDLHAG............................RPSD---------L-------PLLFV
E6UGJ0_RUMA7/26-378------------------LLDTVAFATEQGTL......................SPDK---------V-------PLIFV
D0L8D1_GORB4/35-383------------------TLRTLAG.............................RDAA---------S-------MLLFV
B1VYI2_STRGG/30-406------------------QFAELAARDAAAGPEGRTEGTAARDPHGTTDA....AGAD---------V-------PLLFV
C9XQK5_CLODC/30-356------------------ILKNISNESIT.........................NKDG---------I-------PLIFV
F4EXE4_9FIRM/15-342------------------NLAALKEVCKE.........................EGRE---------T-------PLLFV
C8XAU7_NAKMY/30-380------------------VLGQL.D.............................QDPP---------D-------SLIFV
A8L403_FRASN/30-389------------------ALADLGEDPPA.........................CGEG---------L-------PLLFV
A6WD82_KINRD/30-386------------------ELAGLARTPEW.........................RDGA---------P-------LMLFV
Q0RDF4_FRAAA/30-389------------------ALRSLADDPPR.........................SGDG---------L-------PLVFV
A2RKY2_LACLM/29-399------------------VLDYIEKLEQ..........................NNKN---------H-------PYFFV
Q2J6S0_FRASC/45-404------------------ALRALAAEPPW.........................AAGA---------M-------PLLFV
E3PRQ7_CLOSD/30-378------------------TLRTLKMAENENRI......................NKDE---------L-------PLFFI

PF00463

ACEA_EMENI/14-536------------------MVTQMAKYLDTV------------------------YVSG---------W-------QSSST
ACEA_YEAST/22-550------------------QISQMAKYLDTI------------------------YISG---------W-------QCSST
ACEA_CANTR/18-543------------------HVAQMAKYLDSI------------------------YVSG---------W-------QCSST
ACEA1_SOYBN/3-534------------------QVTQMAKHLDTI------------------------YVSG---------W-------QCSAT
ACEA_YARLI/10-536------------------QVTQMAKYLDSI------------------------YVSG---------W-------QSSST
ACEA_ECOLI/7-434------------------ALQQAKAGIEAV------------------------YLSG---------W-------QVAAD
ACEA_NEUCR/23-547------------------MVTQMAKYLDTV------------------------YVSG---------W-------QSSST

PF02896

PPDK1_MAIZE/589-947MAPTLELRQQALDRLLTYQRSDFEGIFRAM------------------------DGLP---------V-------TIRLL
PT1_STACT/251-543..................QFEAYKAVLEAM------------------------KGKR---------V-------VVRTL
PT1_CUPNH/262-557..................QFQAYRGAVDAM------------------------HGLP---------V-------TIRTI
PPDK_CLOSY/515-871LSDSVEAREEALNELIPFQKGDFKAMYKAL------------------------EGRP---------M-------TVRYL
PPDK_FLATR/595-953MAVTPEQRKVALDLLLPYQRSDFEGIFRAM------------------------DGLP---------V-------TIRLL
PPDK_ENTHI/515-879LSNTLEERKKYLNELMPLQKQDFIGLLKTM------------------------NGLP---------V-------TVRLL
PT1_ECOLI/250-542..................QFAAYKAVAEAC------------------------GSQA---------V-------IVRTM
PT1_HAEIN/250-542..................QFIAYKQVVEAM------------------------NGRL---------T-------VIRTM
PT1P_ECOLI/416-708..................QVAQYQGMLQMF------------------------NDKP---------V-------TLRTL
PPSA_PYRFU/496-796KEE..........ELVEKLAEGIEKVAAAF------------------------YPRP---------V-------WYRTL
PT1_MYCCT/251-542..................QFEAYKKVVSQI------------------------K.HL---------V-------VFRTL
PTFAX_RHOCA/518-804..................QLAIYAAMLSAL------------------------NGLP---------I-------IIRTL
PT1_GEOSE/256-548..................QFVAYKTVLEQM------------------------NGKP---------V-------VVRTL
PTFAX_XANCP/521-808..................QYQTYLAMARAL------------------------DGRP---------L-------IVRAL
PT1_STRMU/252-546..................QYEAYKAVLEGM------------------------NGKP---------V-------VVRTM
PTFX2_ECOLI/362-654..................LYNIFCQALESA------------------------NGRS---------I-------IVRTM
PPSA_STAMF/504-813KES..........LFIDKLAEGIAKVAQAI------------------------YPRP---------V-------VVRFS

PF00224

KPYK_EMENI/32-379------------------HQSVIDHAREAE------------------------KQQA---------G.....RPVAIAL
KPYM_FELCA/42-395------------------HAETIKNVRAAT------------------------ESFA---------SDPIRYRPVAVAL
KPYK_HAEIN/5-350------------------HIGRAERVRSIA------------------------KKLG---------KT......VAILG
KPYK2_ECOLI/5-350------------------HKMRADKVREIA------------------------AKLG---------RH......VAILG
KPYK_YARLI/29-376------------------HQSVIENARESE------------------------QQFQ---------G.....RPLAIAL
KPYC_SOLTU/19-365------------------HQETLDNLKIAM------------------------QNTQ---------IL......CAVML
KPYK1_TRYBB/19-364------------------HQTTINNVRAAA------------------------AELG---------LH......IGIAL
KPYR_HUMAN/85-438------------------HAESIANVREAV------------------------ESFA---------GSPLSYRPVAIAL
KPYK_GEOSE/2-346------------------HGRRIANIREAA------------------------KRTG---------RT......VAILL
KPYK_HYPJE/41-388------------------HQSVIDNVRASV------------------------AAHP---------G.....RPVAIAL
KPYK_LACLA/2-375------------------QGARMATVHRAE------------------------EIAG---------HK......VGFLL
KPYK_LACDE/1-346------------------HLARMNMVREVE------------------------KKTG---------KL......LGIAL
KPYK1_YEAST/18-365------------------HKSVIDNARKSE------------------------ELYP---------G.....RPLAIAL

PF02548

Q6BIM6_DEBHA/32-295------------------------------------------------------YEDT---------T-------EISFD
PANB_HALHL/12-270------------------------------------------------------HETT---------L-------PVTVD
PANB_SACD2/10-267------------------------------------------------------YDST---------V-------PVTME
PANB_ECOUT/2-260------------------------------------------------------HDST---------L-------PVTVA
PANB2_METPP/15-275------------------------------------------------------QSST---------L-------SVTME
PANB_AERPE/4-261------------------------------------------------------YPST---------L-------QVTLD
A6DLB6_9BACT/1-261------------------------------------------------------HETT---------V-------PVSLE
PANB_OCEIH/1-257------------------------------------------------------YEST---------V-------DVTLD
A3W152_9RHOB/5-264------------------------------------------------------HKSM---------A-------TVDFE
PANB_THEP3/3-263------------------------------------------------------YEST---------I-------PVTME
PANB_DESPS/1-261------------------------------------------------------YDST---------V-------PVTMA
A0XYQ5_9GAMM/2-260------------------------------------------------------GDDT---------L-------GVTNQ
PANB_ROSDO/8-265------------------------------------------------------LPST---------L-------EVTME
C5B0Y2_METEA/8-268------------------------------------------------------MEST---------L-------PVTLE
PANB_PSEPF/2-261------------------------------------------------------HDST---------L-------PVTTA
PANB_ALCBS/1-259------------------------------------------------------QTST---------V-------PVTLE
PANB_GEOLS/3-262------------------------------------------------------HENT---------L-------PVTMD
PANB_ALKMQ/4-262------------------------------------------------------YQGT---------I-------PVTME
Q0FZZ2_9RHIZ/8-265------------------------------------------------------MAST---------L-------SVSLD
Q5UF70_9PROT/3-264------------------------------------------------------HDST---------I-------PVSME
A3F328_BACIU/1-260------------------------------------------------------LDST---------V-------GVTVA
PANB_CHRSD/2-260------------------------------------------------------HAST---------L-------PVTLD
A4A9Z8_9GAMM/3-260------------------------------------------------------HDST---------I-------PVTIQ
PANB_SALRD/2-262------------------------------------------------------HETT---------L-------PMTLD
PANB_METCA/3-261------------------------------------------------------QPTT---------L-------SVTLD
A4BLN5_9GAMM/12-271------------------------------------------------------HETT---------L-------SVSVD
PANB_PYRAR/4-259------------------------------------------------------LPNT---------L-------GVTLA
PANB_HELHP/4-261------------------------------------------------------ENET---------L-------GASMQ
PANB_NITEC/7-266------------------------------------------------------QAST---------L-------PVTLD
PANB_CAMJR/2-259------------------------------------------------------MQDT---------L-------SVTMD
A4TBM9_MYCGI/21-280------------------------------------------------------YDTT---------V-------PVTLD
A4SZR6_POLSQ/8-267------------------------------------------------------HSST---------T-------PVTVE
A5DHH9_PICGU/31-293------------------------------------------------------YNDT---------N-------EIPYE
A3EWD3_9BACT/4-264------------------------------------------------------LENT---------L-------PVTID
PANB_PYRAB/2-259------------------------------------------------------EPNT---------L-------NVSME
A6GSM9_9BURK/14-273------------------------------------------------------MPST---------L-------PVTME
Q75D37_ASHGO/23-289------------------------------------------------------HVST---------V-------DLDLQ
PANB_AQUAE/1-261------------------------------------------------------EGDT---------L-------SVTLE
PANB_XANOR/8-266------------------------------------------------------HDST---------L-------AVTTA
A7G0V7_CLOBH/1-261------------------------------------------------------YENT---------L-------SVTME
PANB_CORDI/3-260------------------------------------------------------YSGT---------N-------QVSFE
PANB_NITMS/1-260------------------------------------------------------YENT---------I-------PVTMD
PANB_ANAMM/1-257------------------------------------------------------MEST---------L-------SVTLD
A8DJM8_9BACT/4-264------------------------------------------------------YETT---------L-------PVTMD
PANB_BUCAP/2-260------------------------------------------------------HNST---------L-------PVKIQ
A8ZX35_DESOH/1-254------------------------------------------------------YASE---------L-------EVTME
PANB_ROSCS/1-260------------------------------------------------------FGST---------I-------PVTID
PANB_THIDA/1-259------------------------------------------------------HAST---------L-------PVKLA
PANB_TRIEI/1-261------------------------------------------------------YETT---------L-------PVTLE
Q1YYG7_PHOPR/2-260------------------------------------------------------KPTT---------L-------NVSID
PANB_SYNFM/1-262------------------------------------------------------HDDT---------L-------SVGMT
A4BJA6_9GAMM/3-261------------------------------------------------------QEST---------V-------PVTMD
A5DVU0_LODEL/35-295------------------------------------------------------YRDT---------N-------QLNLE
PANB_LEPBJ/1-262------------------------------------------------------NSST---------L-------PVTLE
PANB_METS4/15-273------------------------------------------------------FDNT---------L-------PVSLA
PANB_CHRVO/1-259------------------------------------------------------VDST---------L-------PVSEE
PANB_HALMA/1-257------------------------------------------------------HDDT---------L-------PVTLD
O82357_ARATH/40-306------------------------------------------------------HDTT---------L-------PISLD
PANB_CAMC1/9-266------------------------------------------------------KEST---------L-------SADMS
PANB_RALSO/11-269------------------------------------------------------QKTT---------L-------PVTLD
PANB_COXBU/3-262------------------------------------------------------HSTT---------L-------PATVE
A4ET65_9RHOB/36-279------------------------------------------------------....---------.-------.....
A3ZKV5_9PLAN/9-265------------------------------------------------------HDTT---------L-------PVTLD
PANB_MAGSA/8-266------------------------------------------------------METT---------L-------AVTLE
PANB_ANADE/9-273------------------------------------------------------HEST---------L-------PVTLD
PANB_YEAST/24-291------------------------------------------------------YDST---------I-------TLSLN
A3JDV2_9ALTE/1-259------------------------------------------------------NDST---------L-------PVTMD
A5P8F6_9SPHN/22-283------------------------------------------------------LPST---------I-------PVTLE
PANB1_ZYMMO/32-297------------------------------------------------------RTTT---------V-------GVSLE
A4RSY4_OSTLU/34-300------------------------------------------------------HETT---------L-------PITLN
PANB_ACIC1/9-268------------------------------------------------------YPDT---------L-------GVDVD
PANB_BDEBA/1-259------------------------------------------------------HSTT---------L-------DVSAS
PANB_DECAR/8-267------------------------------------------------------HDTT---------L-------PVTVA
PANB1_METPP/12-271------------------------------------------------------HSST---------V-------PATMD
A7BVR3_9GAMM/2-261------------------------------------------------------HDST---------L-------PVTVE
Q54LH3_DICDI/90-350------------------------------------------------------ESGT---------T-------SVTME
PANB_HELPJ/9-266------------------------------------------------------QNDT---------L-------SASVK
Q6CE35_YARLI/39-299------------------------------------------------------YPNT---------N-------QIELE
PANB_RHOBA/9-265------------------------------------------------------HSTT---------L-------PVTMD
PANB_DEHE1/1-261------------------------------------------------------YDST---------V-------SVTME
PANB_MAGSM/3-263------------------------------------------------------HETT---------L-------PVTLD
Q6CLY9_KLULA/31-297------------------------------------------------------YEST---------T-------QLSLD
PANB_THET2/1-258------------------------------------------------------YPST---------V-------PVTLE
Q7NSX9_CHRVO/9-255------------------------------------------------------QPGA---------Q-------SFALE
PANB_KORVE/10-270------------------------------------------------------YENT---------L-------PVTMD
Q841Y3_CAMFE/9-266------------------------------------------------------KNET---------I-------GLSVD
PANB_HERA2/1-259------------------------------------------------------NSST---------V-------PVTID
PANB_CAUCR/10-267------------------------------------------------------LPNT---------V-------GVTME
PANB_NOCSJ/33-292------------------------------------------------------NETS---------L-------PVTVD
Q2UMW5_ASPOR/70-332------------------------------------------------------MEDT---------S-------EVVME
PANB_FRATO/1-259------------------------------------------------------KKNT---------T-------YTTLD
A4GIZ2_9DELT/4-264------------------------------------------------------HENT---------L-------SVTME
PANB_CHLCH/10-274------------------------------------------------------HSTT---------L-------PITIE
PANB_LEGPL/1-259------------------------------------------------------YPTT---------I-------MATIE
A7TTC6_VANPO/35-302------------------------------------------------------YKST---------T-------DLPFD
B4U641_HYDS0/3-262------------------------------------------------------EPNT---------L-------GVSLE
A7I1C3_CAMHC/2-260------------------------------------------------------QKDT---------I-------NIGMR
A5L777_9GAMM/1-252------------------------------------------------------FSST---------R-------DVTIE
PANB_BACSK/1-260------------------------------------------------------YDST---------V-------PVSVD
PANB_SULSO/2-260------------------------------------------------------YTNT---------L-------NVTMR
Q5ABB3_CANAL/27-288------------------------------------------------------YDDT---------N-------ELTLD
A3D6H9_SHEB5/8-266------------------------------------------------------QDST---------L-------GVTLE
PANB1_PSEF5/6-266------------------------------------------------------RTST---------L-------DMSLA
A5FWA4_ACICJ/8-270------------------------------------------------------ERDT---------L-------RVTLE
PANB_NITSB/3-256------------------------------------------------------RSDT---------L-------SATLD
PANB_MARMS/12-270------------------------------------------------------QDST---------L-------PVTIE
A7BDA4_9ACTO/24-281------------------------------------------------------HSST---------L-------PVTLE
Q8GDR8_HELMO/3-263------------------------------------------------------YDST---------V-------PVTLE
PANB_STAMF/2-259------------------------------------------------------LPST---------I-------PVTMD
PANB_TROWT/12-268------------------------------------------------------YENT---------G-------SVCLD
A4GK01_9BACT/1-254------------------------------------------------------YSTT---------R-------KVTLT
PANB_DEIGD/1-259------------------------------------------------------YDST---------A-------PVTLD
B1K6U2_BURCC/8-266------------------------------------------------------MPDT---------L-------RVTLD
PANB_WIGBR/2-261------------------------------------------------------HSST---------V-------PVKID
PANB_DESVH/19-278------------------------------------------------------REDT---------L-------SVTLD
A3WLA3_9GAMM/2-260------------------------------------------------------RSST---------V-------PVTMT
PANB_CORGB/9-268------------------------------------------------------RDTT---------L-------SITLD

PF14010

CAPPA_METHJ/3-484------------------VVKKLLSRYGDYFKEHHLGRDLFLTLRVPNPEIERTEAKI---------LLETLGSIPRSYD
B1V5L0_CLOPF/3-537------------------QTSQIALGLIS..NGIIPGKDVRVTPRIPNANKESVFRQL---------MSIMSIIETNVQ.
D2PDY7_SULID/4-511------------------VVRKLLSNYPDYFREHILGKDVFLTYRLPNPKVEGADRKV---------FAETMESIPITYD
D3S0D1_FERPA/2-476------------------VVRKLLSNYPDFFKKKPLGKCFRLTPRIPNPSVEKEEAKL---------LSEILEMIPRSYD
B5YCF7_DICT6/5-497------------------VIRKLVSDYPEFFKQKVIGKDIFITLRVPNPNYEKAEGKL---------LIETLESIPRSYD
CAPPA_HALSA/4-492------------------AVKKLLSRYDEFFADHQLGTDVRLTVRGPNPDVEGSEAKI---------LLEILESIPRSFD
C6HVN3_9BACT/19-520------------------VVEKLFSTYYDYFKDNQIGKDIFLTFRLPNIWYEKEYR..---------IARAYIGILTFED
A3EQI3_9BACT/19-520------------------VVDKLFSLYHPYFSENQLGKDVFLTFRLPNIWYEKEYR..---------IARAYIGILTFEE
CAPPA_PYRCJ/3-459------------------QPKEVVMKAAK..SELPLGEKFVITVRLPNPRLEEFDRAM---------LALEAAVVANYF.
CAPPA_METTH/3-483------------------VVKKLLTKYQAFFRDHVLGEDLRLTLRVPNPTVERAEAKI---------LLETLESIPRSYD
CAPPA_PYRAB/2-469------------------VVKKLLERYPSFFRKVILGKDVRLTPRVPNPTVEKAEAKL---------LLETLQGITRAAD
CAPPA_METMA/7-526------------------QNVQIVSRFIEE.TDLIPGKDIFITPRAPSAAQENRFRQL---------MVMMSIAEANHG.
CAPPA_METKA/9-532------------------QPIQVLMELYD..AGVRVGEERFVIVRVPSATKENVLRQV---------QALLGVMEANSEL
F0LK16_THEBM/2-476------------------VVKKLLERYPHFFRKHKLGEDFRLTPRVPNPSVEKAEAKL---------LLETLESISRSAD
A8A9C2_IGNH4/3-488------------------QMRDIIEEVRK..YDVVPGEDFLITPRVPNPKLEDKDRHL---------LAITAAVTANMY.
CAPPA_SULTO/4-511------------------VVRKLLTQYPEFFKEKILGRDIFLTYRIPNPKIEGAEKKV---------FAETMESIPITYD
B1I2W1_DESAP/7-489------------------VVRKLLTQYEHFFAHNRLGRDVFLTLRVPNPTVEHTEGKV---------LIETLQSIPRSFD
B1YBY2_THENV/2-461------------------QPKDITVKAHD..SGLPLGEKFYLTPRMPNPRLEEFERSM---------LTLEAAILANYF.
CAPPA_PICTO/6-508------------------VLRKLISKNHEFFEKNVLGSDIFLTYRVPNPAIEGTERKV---------LTETLESIPVNYD
CAPPA_CALMQ/4-512------------------VVRKLLENYGGFFINKVLGEDIYLTYRLPNPNVEASDRKI---------FAEALETIPMAYD
CAPPA_METS5/4-509------------------VVRKLFSSFDEYFKNNILGEDIFLTYRLPNPKIEGAERKV---------FAETMESIPITFD
Q1PXR4_9BACT/4-490------------------VIKKLLTRYENFFKNKRIGKDLFITLRAPNPAYEMSEAKI---------LLETLESAPRSYD
CAPPA_ARCFU/2-471------------------IVRKLLSSYYDFFSSRPLGKDFRLTMRVPNPEIEKGEAKL---------LAETLEMIPRSYD
CAPPA_PYRAR/4-460------------------QPKEIVMKAIR..GDVPLGDEFYITVRLPNPKLEEFDRAM---------LSLEAALVANYF.
CAPPA_PYRAE/3-460------------------QPRDVASKALA..LGLPLGERFFITPRVPNPRLEDFERSM---------LSLEAAVLANSY.
C6A2T7_THESM/11-485------------------VIKKLLEKYGQFFKKKKLGRDIRITPRVPNPSVEKAEAKL---------LLETLESIPRSAD
CAPPA_SULAC/4-511------------------VVRKLLSQYPEFFRHRILGKDIFLTYRVPNPKIEGAERKV---------FAETLNTIPITYD

PF01274

MASY_EMENI/11-531AI-----RR-------QVDFKQG..QKEYKLR---------------------T.....DRTLPTLI-------------
MASZ_CORGL/35-713SK-----NG-------RIFTRELNKDRVYIGR---------------------NGTELVLHGRSLLF-------------
MASY_MYXXD/17-538AV-----RG-------TISFTAE.NGKHYALN---------------------.......PKRAVLF-------------
MASZ_ECOLI/17-697EK-----NG-------RQIVRKLNDDRHYTAA---------------------DGSEISLHGRSLLF-------------
Q9RYN3_DEIRA/10-521AV-----RG-------TISLEQ..NGKSYKLN---------------------.......DTTATLL-------------
MASY_PICAN/21-543AI-----RD-------RIDFTNEATGKRYKIN---------------------RE....GRRVPVMI-------------
MASZ_PSEFL/17-697AK-----GG-------KTFTRTMNPDRVYTGV---------------------DGQDVTLHGRSLLF-------------
MASY_MAIZE/16-548AV-----AG-------TISFRDAPRGRTYELN---------------------.......DRTAKLF-------------
MASY_STRAE/10-542AY-----TR-------NIDFTDERTGKTYALR---------------------P.....L.KSWRPS-------------
MASY_NEUCR/11-531AI-----RR-------QIDFKQG..PKEYKLR---------------------.T....DRTLPTLI-------------
MASY_STRCL/10-540AY-----HR-------RIDFTDERSGKSYALR---------------------P.....DAELATVV-------------
MASY_BRANA/21-551AV-----DG-------SITFNDKARNKVYKLN---------------------.......DQVAKLF-------------
MASY_ECOLI/11-533AV-----NG-------TISYTNE.AGKIYQLK---------------------.......PNPAVLI-------------
MASZ_MYCLE/17-704NK-----DG-------KTFTRVLNADRSYTTP---------------------DGGELTLPGRSLLF-------------
MASY_CANTR/15-540AV-----RR-------NLSATIN..GKQYNLN---------------------LE...KGRHIPTLI-------------
MASY_YEAST/18-542AI-----RN-------QIDFDTP..RKSYKLN---------------------GN....VANLPTII-------------

PF03328

Q9RYM1_DEIRA/24-251TL-----AQ-------LQALAAY--------------------------------------P.VAPV-------------
Q8XL94_CLOPE/6-225AL-----TS-------MDF.GDT--------------------------------------...ETV-------------
BPHF_SPHAR/18-244IV-----AQ-------LRAVEAT--------------------------------------PPCSAI-------------
Q9CGA8_LACLA/9-229AV-----KN-------IDF.GGA--------------------------------------...ELV-------------
O22982_ARATH/17-240AL-----HC-------IRAIEAA--------------------------------------G.CSTV-------------
Q8Z9M3_SALTI/5-223AL-----QH-------PFY.QDV--------------------------------------...EKV-------------
RHMA_ECOLI/19-246LY-----HQ-------LQAVAPY--------------------------------------A.SQPV-------------
Q8RDW5_FUSNN/9-227AL-----KT-------IDY.KTT--------------------------------------...ETV-------------
GARL_ECOLI/20-246FI-----PQ-------LMALKGS--------------------------------------A.SAPV-------------
Q9KTU0_VIBCH/11-230AL-----QH-------PMY.QEM--------------------------------------...ETV-------------
Q93167_CAEEL/26-259AL-----DK-------LPYHTLA--------------------------------------C.QELG-------------
Q9HRM8_HALSA/29-241LL-----TA-------ADFDPDC--------------------------------------...EVC-------------
Q8XBS2_ECO57/20-239AL-----QH-------PLY.RDI--------------------------------------...ETI-------------
Q9UVD4_9ASCO/43-283AI-----HA-------AQHHSEG--------------------------------------R.SLVI-------------
O82487_ARATH/90-322AL-----DC-------IRALNAA--------------------------------------G.TSAI-------------
HPCH_ECOLX/15-242VL-----TQ-------LQAIAPY--------------------------------------P.SQPV-------------
CITEL_DEIRA/9-223AA-----RD-------LIA.AAP--------------------------------------H.LAVF-------------
Q8K7F2_STRP3/6-224AL-----KT-------FDY.SSV--------------------------------------...ETV-------------
Q8VQP0_RHOER/12-226LV-----HE-------FGRAR..--------------------------------------...TIS-------------
BPHF_RHOSR/18-244VL-----AQ-------LQVIGAY--------------------------------------RDCHAA-------------
Q9XY64_TRYCR/18-251LS-----QL-------IAAIRTG--------------------------------------H.AKVM-------------
Q9RLT5_WEIPA/10-229AL-----KM-------VDY.GDA--------------------------------------...ELV-------------

PF13714

A0JTC7_ARTS2/12-246LM...I.EA-------AGRIAAS.T.S.....---------------------...........LPV-------------
A0K276_ARTS2/27-270LA...V.AA-------LRRIAAS.T.E.....---------------------...........LPV-------------
A0NXG4_9RHOB/11-252DA...L.GH-------AADIIAA.T.S.....---------------------...........VPI-------------
A0QPJ7_MYCS2/16-251DL...L.TR-------VRQITAA.V.E.....---------------------...........VPV-------------
A0R0I0_MYCS2/10-256QL...T.EH-------TRNTARA.V.D.....---------------------...........IPV-------------
A1CA54_ASPCL/14-274RN...L.AT-------VRSISAV.L.RPKDES---------------------TSEKQTDTLPRLPL-------------
A1SIA9_NOCSJ/3-233AN...R.VL-------AERLAR..L.P.....---------------------...........AYV-------------
A2VJA9_MYCTU/3-230AN...I.AL-------AAALAP..L.Q.....---------------------...........CYV-------------
A3I8T3_9BACI/7-245RH...L.AI-------IQAITEQ.V.N.....---------------------...........IPV-------------
A3NHT8_BURP6/20-277SR...L.AN-------VQHIFDV.T.T.....---------------------...........KPL-------------
A3TPN1_9MICO/3-233EL...V.AH-------VALLTSV.I.T.....---------------------...........VPL-------------
A3UJ38_9RHOB/7-249WL...E.RI-------TRRMAKT.I.S.....---------------------...........VPL-------------
A3WAP9_9SPHN/6-247RL...T.ET-------AKQIADA.V.D.....---------------------...........LPI-------------
A3Y7J5_9GAMM/4-243EL...A.FM-------VQRIASA.S.L.....---------------------...........LPL-------------
A4AEG4_9ACTN/15-253QA...L.AS-------ASIICNA.V.E.....---------------------...........IPV-------------
A4ET25_9RHOB/10-247LL...L.TI-------VRRISES.C.E.....---------------------...........LPL-------------
A4F7M3_SACEN/8-232ET...L.AL-------ARRLVR..L.P.....---------------------...........CLV-------------
A4FH54_SACEN/26-273EM...L.AA-------ARRVSRA.V.S.....---------------------...........VPV-------------
A4X5C0_SALTO/32-264RA...L.DL-------IARVAST.V.S.....---------------------...........VPV-------------
A4X7L5_SALTO/4-223ET...L.RL-------TRSLAA..L.P.....---------------------...........VHL-------------
A4XS21_PSEMY/12-254ET...L.AN-------ARAIVAA.T.P.....---------------------...........LPV-------------
A4YVZ4_BRASO/12-249EM...L.AH-------LAAVSTA.V.D.....---------------------...........IPV-------------
A5G4A7_GEOUR/12-254EM...M.EV-------IERIAKN.T.D.....---------------------...........LPV-------------
A5LD69_STRPN/2-260DR...L.QT-------IDDILCV.T.E.....---------------------...........KHI-------------
A5V3Q4_SPHWW/10-252AL...L.AT-------ASAILRA.T.D.....---------------------...........LPV-------------
A8LYX8_SALAI/6-252DL...C.DV-------VLAVGRT.A.H.....---------------------...........LPV-------------
A8TK14_9PROT/10-251EF...A.DQ-------ARRICRA.G.G.....---------------------...........LPL-------------
A9DYN3_9FLAO/3-242EL...E.YI-------IKRIALH.T.T.....---------------------...........LPL-------------
A9WM41_RENSM/9-245LA...L.AT-------IARIVHT.V.D.....---------------------...........VPV-------------
B1IHA0_CLOBK/33-275HI...V.QI-------VNQITQR.I.S.....---------------------...........IPV-------------
B1T3E7_9BURK/12-255LV...M.EV-------LARIAQA.T.D.....---------------------...........LPV-------------
B1VSN1_STRGG/14-249EV...L.AA-------VAPIIAA.V.D.....---------------------...........VPV-------------
B4RBF1_PHEZH/10-242KV...C.AT-------IAEVVRA.V.D.....---------------------...........VPV-------------
B4SLQ1_STRM5/8-241AL...L.QR-------VSEIARV.I.S.....---------------------...........LPV-------------
B4WCU0_9CAUL/11-249DM...M.RE-------VAAIARA.T.T.....---------------------...........LPF-------------
B5HHA0_STRPR/15-253EM...F.AA-------AGRVARA.V.P.....---------------------...........VPV-------------
B5HRK0_9ACTO/12-259TM...L.GR-------VREIAGG.L.A.....---------------------...........VPL-------------
B5HVC7_9ACTO/7-239EM...F.AA-------VARVCGA.V.D.....---------------------...........VPV-------------
B6HSS2_PENCW/11-259QN...L.TA-------IAAIAAS.V.RATNPT---------------------...........KPL-------------
B6YYQ6_9RHOB/10-253LV...E.II-------AGRIAES.V.E.....---------------------...........VPF-------------
B8H7Q2_ARTCA/13-246VA...L.EG-------AKRIVDA.V.D.....---------------------...........LPV-------------
B8J5T4_ANAD2/11-248DM...L.AH-------VRELVGA.T.S.....---------------------...........LPV-------------
B8MDA8_TALSN/5-285QRATYM.SS-------SNNNIEQ.HGS.....---------------------...........RPL-------------
B9JNZ3_AGRRK/15-273SR...L.GS-------LGEVMQV.T.S.....---------------------...........KPV-------------
B9K4D9_AGRVS/8-247DT...L.DN-------CRAIVAA.T.S.....---------------------...........LPV-------------
B9NN70_9RHOB/11-254HA...L.DN-------ARRIVAA.A.D.....---------------------...........VPV-------------
B9YYY5_9NEIS/10-252AM...L.ER-------VGQIAAA.V.D.....---------------------...........LPV-------------
C0CW09_9CLOT/6-270EV...R.DR-------IYNISNHIQ.......---------------------...........IPL-------------
C0D909_9CLOT/255-518EY...I.WA-------TERIAGS.S.G.....---------------------...........LPL-------------
C0RYY1_PARBP/55-297TN...L.NA-------IRRIAPI.A.LNYN..---------------------...........KPL-------------
D7W5Q1_9FLAO/4-244EY...F.YI-------IKRIKAS.V.S.....---------------------...........IPL-------------
C1D0L9_DEIDV/16-251LH...L.DM-------VRRIVQA.V.D