Sequence alignment for CL0151

PF15617

H9TH48_SALET/4-300--------RL----------------------------------------------------------------------
A0A0H3CW75_ENTCC/4-300--------RL----------------------------------------------------------------------
A0A023YVC9_ECOLX/4-300--------RL----------------------------------------------------------------------
A7MPV2_CROS8/4-300--------RL----------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------QP----------------------------------------------------------------------
D0KLU5_PECWW/4-299--------RL----------------------------------------------------------------------
B4EW80_PROMH/4-300--------RL----------------------------------------------------------------------
D3V2D7_XENBS/4-302--------IP----------------------------------------------------------------------
Q7CKQ7_YERPE/4-300--------TP----------------------------------------------------------------------
E1PL56_PANVC/4-300--------NI----------------------------------------------------------------------
D3VJW5_XENNA/4-307--------IP----------------------------------------------------------------------
Q888S8_PSESM/3-297--------LF----------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------LF----------------------------------------------------------------------
F3K7E7_PSEAJ/3-297--------LF----------------------------------------------------------------------
Q39AX0_BURL3/4-298--------TI----------------------------------------------------------------------
Q6FAX8_ACIAD/1-291--------ML----------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------PL----------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------MH----------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------MR----------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------ML----------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------MH----------------------------------------------------------------------
Q3JCD2_NITOC/22-310--------IP----------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------MA----------------------------------------------------------------------
Q2RVZ6_RHORT/5-292--------IS----------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------PL----------------------------------------------------------------------
D5BYR3_NITHN/21-309--------IP----------------------------------------------------------------------
D8K7I6_NITWC/22-310--------IP----------------------------------------------------------------------
E8U9R3_DEIML/2-291--------LN----------------------------------------------------------------------
A8MM95_ALKOO/30-358--------DK----------------------------------------------------------------------
Q891X5_CLOTE/30-379--------TY----------------------------------------------------------------------
A8F9P5_BACP2/30-369--------HV----------------------------------------------------------------------
C9RML9_FIBSS/26-364--------SL----------------------------------------------------------------------
E3IYR0_FRASU/30-378--------RL----------------------------------------------------------------------
Q9KY27_STRCO/30-371--------RL----------------------------------------------------------------------
A0A080UMD5_BACIU/30-361--------KL----------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------EL----------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------DI----------------------------------------------------------------------
F2JGK5_CELLD/30-375--------EK----------------------------------------------------------------------
Q65NP8_BACLD/30-368--------RI----------------------------------------------------------------------
D1BEK0_SANKS/30-368--------GM----------------------------------------------------------------------
D1A9P4_THECD/30-368--------AL----------------------------------------------------------------------
C9ZE12_STRSW/30-371--------RI----------------------------------------------------------------------
F4H5N5_CELFA/32-371--------AL----------------------------------------------------------------------
B7HBK1_BACC4/30-348--------EQ----------------------------------------------------------------------
A0A0B5R5V5_BACTU/30-348--------EQ----------------------------------------------------------------------
C8W644_DESAS/30-371--------KT----------------------------------------------------------------------
Q82B97_STRAW/30-370--------RV----------------------------------------------------------------------
Q0SDY5_RHOJR/44-383--------TV----------------------------------------------------------------------
Q72YD0_BACC1/30-348--------EQ----------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------TV----------------------------------------------------------------------
A4J1D5_DESRM/16-360--------DT----------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------DL----------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------EV----------------------------------------------------------------------
Q186J7_PEPD6/30-345--------DV----------------------------------------------------------------------
E3EE66_PAEPS/10-368--------SI----------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------EL----------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------EL----------------------------------------------------------------------
D0L8D1_GORB4/35-372--------TQ----------------------------------------------------------------------
B1VYI2_STRGG/30-395--------RM----------------------------------------------------------------------
C9YLT5_PEPDR/30-345--------DV----------------------------------------------------------------------
F4EXE4_SELS3/15-331--------EI----------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------SV----------------------------------------------------------------------
A8L403_FRASN/30-378--------RL----------------------------------------------------------------------
A6WD82_KINRD/30-375--------DE----------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------RL----------------------------------------------------------------------
A2RKY2_LACLM/29-388--------EM----------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------HL----------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------NQ----------------------------------------------------------------------

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOJR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947PALSGDLGTF----------------------------------------------------------------------
PT1_STACT/251-543KQELQKLRDA----------------------------------------------------------------------
PT1_CUPNH/262-557KKRLQRLRHT----------------------------------------------------------------------
PT1_ECOLI/250-542KAELAKLKDL----------------------------------------------------------------------
PT1_HAEIN/250-542KAELAKLKDL----------------------------------------------------------------------
PT1P_ECOLI/416-708SRLAEDDVNL----------------------------------------------------------------------
PPSA_PYRFU/496-796KAEGGQVVVA----------------------------------------------------------------------
PTFAX_XANCP/521-808REREAAQRAL----------------------------------------------------------------------
PT1_STRMU/252-546KAEWALLKDA----------------------------------------------------------------------
PTFX2_ECOLI/362-654REQQRVWLTQ----------------------------------------------------------------------
PPSA_STAMF/504-813VAGVGISPEQ----------------------------------------------------------------------
D5AMJ7_RHOCB/521-803...EARERYK----------------------------------------------------------------------
Q24801_ENTHI/517-878..GSGYFGTI----------------------------------------------------------------------
Q5L199_GEOKA/251-541KAEWAKLVDQ----------------------------------------------------------------------
Q6MTX2_MYCMS/252-540.DQLKKFKDK----------------------------------------------------------------------

PF01274

MASY_EMENI/11-531VAILGSVSNEARKILTKEACAFLAILHRTFNPTRKALLQRRVDRQAEIDKGH.LP..........DFL.PETKHIRDDPS
MASZ_CORGL/35-713YDFVTEAVLPRVGVDAEKFWSGFAAIARDLTPRNRELLARRDELQMLIDDYHRNNSGTIDQEAYEDFL.KEIGYLVEEPE
MASY_MYXXD/17-538VVVKGTWHPDYAEVLTPEALEFVAKLARNFGERRLALLERRKTVQAAWSKGA.RP..........HFL.PETKAVR.EGD
MASZ_ECOLI/17-697KRFVDEEVLPGTGLDAAAFWRNFDEIVHDLAPENRQLLAERDRIQAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPE
Q9RYN3_DEIRA/10-521MTINAPIKPEYAEILTPEALAFVAELHRRFEPRRRELMQKREERQQRLDAGE.LP..........DFL.PETAEIR.AGD
MASY_MAIZE/16-548VDVRGRYDREFAGILTRDALDFVAGLQREFRGAVRYAMEQRREAQRRYDAGE.LP..........RFD.PATTLVR.EGD
MASY_ECOLI/11-533LAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDNGT.LP..........DFI.SETASIR.DAD
MASZ_MYCLE/17-704YDFVNNEALPGTDINPNSFWSGVAKVVADLTPQNQSLLNSRDELQAQIDKWHRHRVIEPFDVDAYRQFLIDIGYLLPEPD
MASY_YEAST/18-542EPFFKPSSTTVGDILTKDALEFIVLLHRTFNNKRKQLLENRQVVQKKLDSGS.YH.........LDFL.PETANIRNDPT
B5GRN8_STRC2/12-539..VTAPAVPRQDEVLTEAALVFLAELHRRFTPRRDELLARRARRRAEISRTG.TL..........DFL.PETAHVRADDS
C5MBE7_CANTT/16-539.QILGPIPDDAKHIFNQETLAFVATLHRGFEARRQELLNNRKEQQKLRDQGF.LP..........DFL.PETEYIRNDPT
M4EJ48_BRARP/22-551.EVRGRYDQVFAKILTRDALGFVAELQREFRGHVRYAMECRREAKRRYNSGA.VP..........GFD.PSTKFIR.DGE
W1QBI0_OGAPD/27-543........ATPRDILTKDALKFIVLLHRSFNETRKQLLENRQKVQERLDAGE.SL..........HFL.EETKYIREDPN

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------------------------
CAPP_ACTP2/128-879--------------------------------------------------------------------------------
A0ZJ69_NODSP/196-1034--------------------------------------------------------------------------------
D3VH32_XENNA/127-879--------------------------------------------------------------------------------
Q2KZS8_BORA1/137-936--------------------------------------------------------------------------------
D2QW47_PIRSD/157-942--------------------------------------------------------------------------------
A5GVT4_SYNR3/167-992--------------------------------------------------------------------------------
C6D470_PAESJ/147-936--------------------------------------------------------------------------------
B8HVC9_CYAP4/199-1018--------------------------------------------------------------------------------
C1F4Y2_ACIC5/161-947--------------------------------------------------------------------------------
CAPP_SYNY3/193-1034--------------------------------------------------------------------------------
B1XMB9_SYNP2/163-995--------------------------------------------------------------------------------
A4S610_OSTLU/183-1007--------------------------------------------------------------------------------
A9RUR8_PHYPA/162-969--------------------------------------------------------------------------------
B8GNA5_THISH/143-947--------------------------------------------------------------------------------
CAPP_HAHCH/132-881--------------------------------------------------------------------------------
B1Y159_LEPCP/163-950--------------------------------------------------------------------------------
CAPP_THEEB/197-1011--------------------------------------------------------------------------------
A9S2G6_PHYPA/161-965--------------------------------------------------------------------------------
Q54JZ3_DICDI/144-931--------------------------------------------------------------------------------
C1MJ77_MICPC/164-991--------------------------------------------------------------------------------
E0UJ33_CYAP2/184-1020--------------------------------------------------------------------------------
A5WCX5_PSYWF/133-932--------------------------------------------------------------------------------
A0JSJ3_ARTS2/161-954--------------------------------------------------------------------------------
B7G725_PHATC/84-877--------------------------------------------------------------------------------
CAPP_GLOVI/141-939--------------------------------------------------------------------------------
C5Z450_SORBI/157-961--------------------------------------------------------------------------------
D1CE74_THET1/138-931--------------------------------------------------------------------------------
Q117S5_TRIEI/186-1038--------------------------------------------------------------------------------
C1AE63_GEMAT/147-933--------------------------------------------------------------------------------
A9QPD2_METI4/151-931--------------------------------------------------------------------------------
B0BZ90_ACAM1/184-1012--------------------------------------------------------------------------------
A4X3B0_SALTO/171-972--------------------------------------------------------------------------------
E3JCU0_FRASU/173-968--------------------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------------------------
A9IDM8_BORPD/139-951--------------------------------------------------------------------------------
A4G3V1_HERAR/147-944--------------------------------------------------------------------------------
C1DZM5_MICSR/162-982--------------------------------------------------------------------------------
D3EKG0_GEOS4/142-928--------------------------------------------------------------------------------
B1VUI2_STRGG/125-909--------------------------------------------------------------------------------
CAPP_SYNPW/180-1003--------------------------------------------------------------------------------
B0JPY0_MICAN/183-1018--------------------------------------------------------------------------------
B1WNZ1_CYAA5/187-1020--------------------------------------------------------------------------------
C8WQK0_ALIAD/133-906--------------------------------------------------------------------------------
D4ZQG2_ARTPN/196-1035--------------------------------------------------------------------------------
M1FKU6_9ALTE/130-889--------------------------------------------------------------------------------
CAPP_ECOLI/129-883--------------------------------------------------------------------------------
CAPP_HAEIN/129-879--------------------------------------------------------------------------------
Q0K7M4_CUPNH/207-1012--------------------------------------------------------------------------------
Q31KY7_SYNE7/201-1017--------------------------------------------------------------------------------
Q46IP1_PROMT/168-994--------------------------------------------------------------------------------
CAPP_PROMP/165-989--------------------------------------------------------------------------------
CAPP_VIBPA/129-877--------------------------------------------------------------------------------
CAPP_SHEON/129-881--------------------------------------------------------------------------------
U5GXD4_POPTR/166-968--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTN/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTN/7-239--------------------------------------------------------------------------------
B6HSS2_PENRW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
D4GMW6_PANAM/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_RUBBR/3-257--------------------------------------------------------------------------------
I0DRD2_PROSM/4-258--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
W6RP24_9RHIZ/9-265--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_BURRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
U5T1Y9_9GAMM/5-261--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_MYCSM/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENRW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARHV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_PSELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_DECSP/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
C4XU18_DESMR/3-260--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
E4U2F8_SULKY/3-258--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_ZYMTI/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
T0ULG9_9STRE/2-260--------------------------------------------------------------------------------
PANB_ALTMD/3-259--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
C5CWU9_VARPS/32-292--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTN/24-281--------------------------------------------------------------------------------
I2F2C6_9BACT/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9ENTR/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALMC/10-273--------------------------------------------------------------------------------
F0S4V2_PSESL/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_ANAHA/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_ARTAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCR/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICSR/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_CUPMC/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
A0A0D2VT44_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9SPHI/9-267--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_PSEFD/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
F2KYW8_PREDF/10-268--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_RHISN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTN/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_BURP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_GRATM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_PIRID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
I3YPM0_ALIFI/9-267--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
A0A068NY03_9BACT/4-257--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
PANB_ERWT9/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
C7R7Z0_KANKD/3-259--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
E3HRX5_ACHXA/19-273--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENRW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CHRO/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGMM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
C4R687_PICPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_AMYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_BURP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOJR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_RHISN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
E3HW38_ACHXA/8-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METRA/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_ZYMTI/9-275--------------------------------------------------------------------------------
N1PYG8_DOTSN/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_MODMB/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF15617

H9TH48_SALET/4-300--------------------------------------------------------------------------------
A0A0H3CW75_ENTCC/4-300--------------------------------------------------------------------------------
A0A023YVC9_ECOLX/4-300--------------------------------------------------------------------------------
A7MPV2_CROS8/4-300--------------------------------------------------------------------------------
B5RKC3_KLEP3/4-300--------------------------------------------------------------------------------
D0KLU5_PECWW/4-299--------------------------------------------------------------------------------
B4EW80_PROMH/4-300--------------------------------------------------------------------------------
D3V2D7_XENBS/4-302--------------------------------------------------------------------------------
Q7CKQ7_YERPE/4-300--------------------------------------------------------------------------------
E1PL56_PANVC/4-300--------------------------------------------------------------------------------
D3VJW5_XENNA/4-307--------------------------------------------------------------------------------
Q888S8_PSESM/3-297--------------------------------------------------------------------------------
Q4ZYA8_PSEU2/3-297--------------------------------------------------------------------------------
F3K7E7_PSEAJ/3-297--------------------------------------------------------------------------------
Q39AX0_BURL3/4-298--------------------------------------------------------------------------------
Q6FAX8_ACIAD/1-291--------------------------------------------------------------------------------
A5WBK4_PSYWF/17-339--------------------------------------------------------------------------------
Q4FTQ0_PSYA2/59-368--------------------------------------------------------------------------------
Q5NWT6_AROAE/1-291--------------------------------------------------------------------------------
D3RPA3_ALLVD/1-291--------------------------------------------------------------------------------
Q1QCR8_PSYCK/1-315--------------------------------------------------------------------------------
Q3JCD2_NITOC/22-310--------------------------------------------------------------------------------
A1VWQ0_POLNA/1-291--------------------------------------------------------------------------------
Q2RVZ6_RHORT/5-292--------------------------------------------------------------------------------
Q9RSA7_DEIRA/8-299--------------------------------------------------------------------------------
D5BYR3_NITHN/21-309--------------------------------------------------------------------------------
D8K7I6_NITWC/22-310--------------------------------------------------------------------------------
E8U9R3_DEIML/2-291--------------------------------------------------------------------------------
A8MM95_ALKOO/30-358--------------------------------------------------------------------------------
Q891X5_CLOTE/30-379--------------------------------------------------------------------------------
A8F9P5_BACP2/30-369--------------------------------------------------------------------------------
C9RML9_FIBSS/26-364--------------------------------------------------------------------------------
E3IYR0_FRASU/30-378--------------------------------------------------------------------------------
Q9KY27_STRCO/30-371--------------------------------------------------------------------------------
A0A080UMD5_BACIU/30-361--------------------------------------------------------------------------------
Q5YN23_NOCFA/30-368--------------------------------------------------------------------------------
B1HUS4_LYSSC/26-371--------------------------------------------------------------------------------
F2JGK5_CELLD/30-375--------------------------------------------------------------------------------
Q65NP8_BACLD/30-368--------------------------------------------------------------------------------
D1BEK0_SANKS/30-368--------------------------------------------------------------------------------
D1A9P4_THECD/30-368--------------------------------------------------------------------------------
C9ZE12_STRSW/30-371--------------------------------------------------------------------------------
F4H5N5_CELFA/32-371--------------------------------------------------------------------------------
B7HBK1_BACC4/30-348--------------------------------------------------------------------------------
A0A0B5R5V5_BACTU/30-348--------------------------------------------------------------------------------
C8W644_DESAS/30-371--------------------------------------------------------------------------------
Q82B97_STRAW/30-370--------------------------------------------------------------------------------
Q0SDY5_RHOJR/44-383--------------------------------------------------------------------------------
Q72YD0_BACC1/30-348--------------------------------------------------------------------------------
C1B1Z6_RHOOB/52-391--------------------------------------------------------------------------------
A4J1D5_DESRM/16-360--------------------------------------------------------------------------------
C0ZNQ3_RHOE4/41-379--------------------------------------------------------------------------------
C0Z9Y5_BREBN/30-378--------------------------------------------------------------------------------
Q186J7_PEPD6/30-345--------------------------------------------------------------------------------
E3EE66_PAEPS/10-368--------------------------------------------------------------------------------
F4D0A7_PSEUX/30-375--------------------------------------------------------------------------------
E6UGJ0_RUMA7/26-367--------------------------------------------------------------------------------
D0L8D1_GORB4/35-372--------------------------------------------------------------------------------
B1VYI2_STRGG/30-395--------------------------------------------------------------------------------
C9YLT5_PEPDR/30-345--------------------------------------------------------------------------------
F4EXE4_SELS3/15-331--------------------------------------------------------------------------------
C8XAU7_NAKMY/30-369--------------------------------------------------------------------------------
A8L403_FRASN/30-378--------------------------------------------------------------------------------
A6WD82_KINRD/30-375--------------------------------------------------------------------------------
Q0RDF4_FRAAA/30-378--------------------------------------------------------------------------------
A2RKY2_LACLM/29-388--------------------------------------------------------------------------------
Q2J6S0_FRASC/45-393--------------------------------------------------------------------------------
E3PRQ7_CLOSD/30-367--------------------------------------------------------------------------------

PF03328

Q9RYM1_DEIRA/24-251--------------------------------------------------------------------------------
Q8XL94_CLOPE/6-225--------------------------------------------------------------------------------
Q9CGA8_LACLA/9-229--------------------------------------------------------------------------------
RHMA_ECOLI/19-246--------------------------------------------------------------------------------
Q8RDW5_FUSNN/9-227--------------------------------------------------------------------------------
GARL_ECOLI/20-246--------------------------------------------------------------------------------
Q9KTU0_VIBCH/11-230--------------------------------------------------------------------------------
Q93167_CAEEL/26-259--------------------------------------------------------------------------------
Q9HRM8_HALSA/29-241--------------------------------------------------------------------------------
O82487_ARATH/90-322--------------------------------------------------------------------------------
CITEL_DEIRA/9-223--------------------------------------------------------------------------------
BPHF_RHOJR/18-244--------------------------------------------------------------------------------
A4XDW8_NOVAD/18-242--------------------------------------------------------------------------------
HPCH_KLEP7/15-240--------------------------------------------------------------------------------
C0ZQX9_RHOE4/12-226--------------------------------------------------------------------------------
CITE_ECOLI/15-234--------------------------------------------------------------------------------
Q4DGT6_TRYCC/18-249--------------------------------------------------------------------------------
Q8ZRY2_SALTY/5-223--------------------------------------------------------------------------------
Q99ZK8_STRP1/6-224--------------------------------------------------------------------------------

PF02896

PPDK1_MAIZE/589-947--------------------------------------------------------------------------------
PT1_STACT/251-543--------------------------------------------------------------------------------
PT1_CUPNH/262-557--------------------------------------------------------------------------------
PT1_ECOLI/250-542--------------------------------------------------------------------------------
PT1_HAEIN/250-542--------------------------------------------------------------------------------
PT1P_ECOLI/416-708--------------------------------------------------------------------------------
PPSA_PYRFU/496-796--------------------------------------------------------------------------------
PTFAX_XANCP/521-808--------------------------------------------------------------------------------
PT1_STRMU/252-546--------------------------------------------------------------------------------
PTFX2_ECOLI/362-654--------------------------------------------------------------------------------
PPSA_STAMF/504-813--------------------------------------------------------------------------------
D5AMJ7_RHOCB/521-803--------------------------------------------------------------------------------
Q24801_ENTHI/517-878--------------------------------------------------------------------------------
Q5L199_GEOKA/251-541--------------------------------------------------------------------------------
Q6MTX2_MYCMS/252-540--------------------------------------------------------------------------------

PF01274

MASY_EMENI/11-531WKG.AP..........................................................................
MASZ_CORGL/35-713AAEIRTQNVDTEISSTAGPQLVVPILNARFALNAANARWGSLYDALYGTNAIPETDGAEKGKEYNPVRGQKVI.EWGREF
MASY_MYXXD/17-538WTV.AP..........................................................................
MASZ_ECOLI/17-697RVTVETTGIDSEITSQAGPQLVVPAMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIA..WVRRFL
Q9RYN3_DEIRA/10-521WKI.SP..........................................................................
MASY_MAIZE/16-548WTC.AS..........................................................................
MASY_ECOLI/11-533WKI.RG..........................................................................
MASZ_MYCLE/17-704DFTISTSGVDDEITMTAGPQLVVPVLNARFALNAANARWGSLYDALYGTDTIPETEGAEKGSEYNKIRGDKVIAYARKFM
MASY_YEAST/18-542WQG.PI..........................................................................
B5GRN8_STRC2/12-539WRV.AP..........................................................................
C5MBE7_CANTT/16-539WTG.PA..........................................................................
M4EJ48_BRARP/22-551WVC.AS..........................................................................
W1QBI0_OGAPD/27-543WKC.LP..........................................................................

PF00224

KPYK_EMENI/32-379--------------------------------------------------------------------------------
KPYM_FELCA/42-395--------------------------------------------------------------------------------
KPYK_HAEIN/5-350--------------------------------------------------------------------------------
KPYK_YARLI/29-376--------------------------------------------------------------------------------
KPYC_SOLTU/19-365--------------------------------------------------------------------------------
KPYR_HUMAN/85-438--------------------------------------------------------------------------------
KPYK_LACLA/2-375--------------------------------------------------------------------------------
KPYK1_YEAST/18-365--------------------------------------------------------------------------------
G0RKV7_HYPJQ/42-387--------------------------------------------------------------------------------
Q1GAL0_LACDA/1-345--------------------------------------------------------------------------------
Q5KWB2_GEOKA/3-345--------------------------------------------------------------------------------

PF14010

CAPPA_METHJ/3-484--------------------------------------------------------------------------------
D3S0D1_FERPA/2-476--------------------------------------------------------------------------------
CAPPA_HALSA/4-492--------------------------------------------------------------------------------
CAPPA_METTH/3-483--------------------------------------------------------------------------------
CAPPA_METKA/9-532--------------------------------------------------------------------------------
A8A9C2_IGNH4/3-488--------------------------------------------------------------------------------
CAPPA_SULTO/4-511--------------------------------------------------------------------------------
B1I2W1_DESAP/7-489--------------------------------------------------------------------------------
CAPPA_PICTO/6-508--------------------------------------------------------------------------------
CAPPA_CALMQ/4-512--------------------------------------------------------------------------------
CAPPA_METS5/4-509--------------------------------------------------------------------------------
CAPPA_ARCFU/2-471--------------------------------------------------------------------------------
CAPPA_PYRAE/3-460--------------------------------------------------------------------------------
CAPPA_SULAC/4-511--------------------------------------------------------------------------------
J9ZD85_LEPFM/19-520--------------------------------------------------------------------------------
CAPPA_CLOPE/3-537--------------------------------------------------------------------------------
CAPPA_SULSO/4-511--------------------------------------------------------------------------------

PF00311

C7M9P2_BRAFD/148-942--------------------------------------------------------------------------------
CAPP_ACTP2/128-879--------------------------------------------------------------------------------
A0ZJ69_NODSP/196-1034--------------------------------------------------------------------------------
D3VH32_XENNA/127-879--------------------------------------------------------------------------------
Q2KZS8_BORA1/137-936--------------------------------------------------------------------------------
D2QW47_PIRSD/157-942--------------------------------------------------------------------------------
A5GVT4_SYNR3/167-992--------------------------------------------------------------------------------
C6D470_PAESJ/147-936--------------------------------------------------------------------------------
B8HVC9_CYAP4/199-1018--------------------------------------------------------------------------------
C1F4Y2_ACIC5/161-947--------------------------------------------------------------------------------
CAPP_SYNY3/193-1034--------------------------------------------------------------------------------
B1XMB9_SYNP2/163-995--------------------------------------------------------------------------------
A4S610_OSTLU/183-1007--------------------------------------------------------------------------------
A9RUR8_PHYPA/162-969--------------------------------------------------------------------------------
B8GNA5_THISH/143-947--------------------------------------------------------------------------------
CAPP_HAHCH/132-881--------------------------------------------------------------------------------
B1Y159_LEPCP/163-950--------------------------------------------------------------------------------
CAPP_THEEB/197-1011--------------------------------------------------------------------------------
A9S2G6_PHYPA/161-965--------------------------------------------------------------------------------
Q54JZ3_DICDI/144-931--------------------------------------------------------------------------------
C1MJ77_MICPC/164-991--------------------------------------------------------------------------------
E0UJ33_CYAP2/184-1020--------------------------------------------------------------------------------
A5WCX5_PSYWF/133-932--------------------------------------------------------------------------------
A0JSJ3_ARTS2/161-954--------------------------------------------------------------------------------
B7G725_PHATC/84-877--------------------------------------------------------------------------------
CAPP_GLOVI/141-939--------------------------------------------------------------------------------
C5Z450_SORBI/157-961--------------------------------------------------------------------------------
D1CE74_THET1/138-931--------------------------------------------------------------------------------
Q117S5_TRIEI/186-1038--------------------------------------------------------------------------------
C1AE63_GEMAT/147-933--------------------------------------------------------------------------------
A9QPD2_METI4/151-931--------------------------------------------------------------------------------
B0BZ90_ACAM1/184-1012--------------------------------------------------------------------------------
A4X3B0_SALTO/171-972--------------------------------------------------------------------------------
E3JCU0_FRASU/173-968--------------------------------------------------------------------------------
Q2JKJ2_SYNJB/177-978--------------------------------------------------------------------------------
A9IDM8_BORPD/139-951--------------------------------------------------------------------------------
A4G3V1_HERAR/147-944--------------------------------------------------------------------------------
C1DZM5_MICSR/162-982--------------------------------------------------------------------------------
D3EKG0_GEOS4/142-928--------------------------------------------------------------------------------
B1VUI2_STRGG/125-909--------------------------------------------------------------------------------
CAPP_SYNPW/180-1003--------------------------------------------------------------------------------
B0JPY0_MICAN/183-1018--------------------------------------------------------------------------------
B1WNZ1_CYAA5/187-1020--------------------------------------------------------------------------------
C8WQK0_ALIAD/133-906--------------------------------------------------------------------------------
D4ZQG2_ARTPN/196-1035--------------------------------------------------------------------------------
M1FKU6_9ALTE/130-889--------------------------------------------------------------------------------
CAPP_ECOLI/129-883--------------------------------------------------------------------------------
CAPP_HAEIN/129-879--------------------------------------------------------------------------------
Q0K7M4_CUPNH/207-1012--------------------------------------------------------------------------------
Q31KY7_SYNE7/201-1017--------------------------------------------------------------------------------
Q46IP1_PROMT/168-994--------------------------------------------------------------------------------
CAPP_PROMP/165-989--------------------------------------------------------------------------------
CAPP_VIBPA/129-877--------------------------------------------------------------------------------
CAPP_SHEON/129-881--------------------------------------------------------------------------------
U5GXD4_POPTR/166-968--------------------------------------------------------------------------------

PF00463

ACEA_EMENI/14-536--------------------------------------------------------------------------------
ACEA_YEAST/22-550--------------------------------------------------------------------------------
ACEA1_SOYBN/3-534--------------------------------------------------------------------------------
ACEA_YARLI/10-536--------------------------------------------------------------------------------
ACEA_NEUCR/23-547--------------------------------------------------------------------------------
C5MF59_CANTT/18-543--------------------------------------------------------------------------------

PF13714

A0JTC7_ARTS2/12-246--------------------------------------------------------------------------------
A0K276_ARTS2/27-270--------------------------------------------------------------------------------
A0QPJ7_MYCS2/16-251--------------------------------------------------------------------------------
A0R0I0_MYCS2/10-256--------------------------------------------------------------------------------
A1CA54_ASPCL/14-274--------------------------------------------------------------------------------
A1SIA9_NOCSJ/3-233--------------------------------------------------------------------------------
A4F7M3_SACEN/8-232--------------------------------------------------------------------------------
A4FH54_SACEN/26-273--------------------------------------------------------------------------------
A4X5C0_SALTO/32-264--------------------------------------------------------------------------------
A4X7L5_SALTO/4-223--------------------------------------------------------------------------------
A4XS21_PSEMY/12-254--------------------------------------------------------------------------------
A4YVZ4_BRASO/12-249--------------------------------------------------------------------------------
A5G4A7_GEOUR/12-254--------------------------------------------------------------------------------
A5V3Q4_SPHWW/10-252--------------------------------------------------------------------------------
A9WM41_RENSM/9-245--------------------------------------------------------------------------------
B1VSN1_STRGG/14-249--------------------------------------------------------------------------------
B4RBF1_PHEZH/10-242--------------------------------------------------------------------------------
B5HHA0_STRPR/15-253--------------------------------------------------------------------------------
B5HRK0_9ACTN/12-259--------------------------------------------------------------------------------
B5HVC7_9ACTN/7-239--------------------------------------------------------------------------------
B6HSS2_PENRW/11-259--------------------------------------------------------------------------------
B8MDA8_TALSN/5-285--------------------------------------------------------------------------------
B9JNZ3_AGRRK/15-273--------------------------------------------------------------------------------
B9K4D9_AGRVS/8-247--------------------------------------------------------------------------------
C1D0L9_DEIDV/16-251--------------------------------------------------------------------------------
D5UDN5_CELFN/12-253--------------------------------------------------------------------------------
C5C673_BEUC1/6-244--------------------------------------------------------------------------------
C5K5X0_PERM5/22-289--------------------------------------------------------------------------------
D9SPL5_CLOC7/7-255--------------------------------------------------------------------------------
C6W6H2_DYAFD/19-261--------------------------------------------------------------------------------
C7Q1F2_CATAD/16-252--------------------------------------------------------------------------------
C7YUL0_NECH7/9-264--------------------------------------------------------------------------------
C7YZU2_NECH7/391-674--------------------------------------------------------------------------------
D6Z4R6_DESAT/153-411--------------------------------------------------------------------------------
C9SRU6_VERA1/11-259--------------------------------------------------------------------------------
D1A2J0_THECD/5-232--------------------------------------------------------------------------------
D1BED0_SANKS/11-246--------------------------------------------------------------------------------
D1BI43_SANKS/12-247--------------------------------------------------------------------------------
D9TER7_MICAI/8-239--------------------------------------------------------------------------------
E3J806_FRASU/10-249--------------------------------------------------------------------------------
D2B1P9_STRRD/6-236--------------------------------------------------------------------------------
E3I6J4_RHOVT/30-272--------------------------------------------------------------------------------
D2PR97_KRIFD/29-269--------------------------------------------------------------------------------
D2Q3B1_KRIFD/7-234--------------------------------------------------------------------------------
D2Q4L3_KRIFD/4-243--------------------------------------------------------------------------------
D3EII1_GEOS4/13-252--------------------------------------------------------------------------------
D3V3K7_XENBS/39-278--------------------------------------------------------------------------------
D4AZN8_ARTBC/10-268--------------------------------------------------------------------------------
D4LCE5_RUMC1/6-261--------------------------------------------------------------------------------
Q01YZ5_SOLUE/12-251--------------------------------------------------------------------------------
Q08U27_STIAD/11-246--------------------------------------------------------------------------------
Q0BYP5_HYPNA/11-255--------------------------------------------------------------------------------
Q0RPX9_FRAAA/13-247--------------------------------------------------------------------------------
Q12Q29_SHEDO/14-259--------------------------------------------------------------------------------
Q1GKC0_RUEST/10-253--------------------------------------------------------------------------------
Q1GQT2_SPHAL/9-246--------------------------------------------------------------------------------
Q28RZ5_JANSC/10-249--------------------------------------------------------------------------------
Q2JAX2_FRASC/15-255--------------------------------------------------------------------------------
Q4DNR3_TRYCC/14-261--------------------------------------------------------------------------------
Q4KET5_PSEF5/11-270--------------------------------------------------------------------------------
Q5E5F2_VIBF1/18-278--------------------------------------------------------------------------------
Q5LNA0_RUEPO/10-253--------------------------------------------------------------------------------
Q5LUG9_RUEPO/10-245--------------------------------------------------------------------------------
Q5WBL4_BACSK/19-257--------------------------------------------------------------------------------
Q65ND9_BACLD/10-248--------------------------------------------------------------------------------
Q7NXV8_CHRVO/33-277--------------------------------------------------------------------------------
Q7P124_CHRVO/3-243--------------------------------------------------------------------------------
Q893V9_CLOTE/153-411--------------------------------------------------------------------------------
Q8EI00_SHEON/9-240--------------------------------------------------------------------------------
A6TFP2_KLEP7/3-236--------------------------------------------------------------------------------
G2J0B0_PSEUL/10-251--------------------------------------------------------------------------------
G8PVS4_PSEUV/10-253--------------------------------------------------------------------------------
D4GMW6_PANAM/3-261--------------------------------------------------------------------------------
Y1998_MYCTU/3-229--------------------------------------------------------------------------------
Q2IK57_ANADE/11-247--------------------------------------------------------------------------------
Q2KD40_RHIEC/10-252--------------------------------------------------------------------------------
Q63MP0_BURPS/20-277--------------------------------------------------------------------------------
Q8F693_LEPIN/12-250--------------------------------------------------------------------------------
Q8YAP2_LISMO/8-250--------------------------------------------------------------------------------
Q98AR7_RHILO/15-259--------------------------------------------------------------------------------
R5T8T3_9CLOT/12-269--------------------------------------------------------------------------------
R5TTB9_9CLOT/13-246--------------------------------------------------------------------------------

PF02548

C8XKD1_NAKMY/14-272--------------------------------------------------------------------------------
A7HMC7_FERNB/3-256--------------------------------------------------------------------------------
PANB_NITMU/2-259--------------------------------------------------------------------------------
E3I2N4_RHOVT/9-264--------------------------------------------------------------------------------
PANB_THEFY/18-275--------------------------------------------------------------------------------
F0NZT0_WEEVC/9-267--------------------------------------------------------------------------------
C5DYQ5_ZYGRC/31-296--------------------------------------------------------------------------------
D8RYD4_SELML/4-266--------------------------------------------------------------------------------
S9W2M7_SCHCR/5-262--------------------------------------------------------------------------------
D2PXN9_KRIFD/534-791--------------------------------------------------------------------------------
H1Z987_MYROD/10-268--------------------------------------------------------------------------------
C5BN63_TERTT/12-267--------------------------------------------------------------------------------
A8LKB6_DINSH/13-268--------------------------------------------------------------------------------
D7BNG1_ARCHD/5-260--------------------------------------------------------------------------------
D7A714_STAND/9-264--------------------------------------------------------------------------------
PANB_BORPD/9-265--------------------------------------------------------------------------------
PANB_MAGSA/9-265--------------------------------------------------------------------------------
E8RFZ1_DESPD/5-262--------------------------------------------------------------------------------
PANB_PROMA/4-255--------------------------------------------------------------------------------
K9RVA1_SYNP3/11-268--------------------------------------------------------------------------------
D5WZ20_THIK1/22-279--------------------------------------------------------------------------------
B8LYN4_TALSN/78-338--------------------------------------------------------------------------------
K9RDA0_9CYAN/11-264--------------------------------------------------------------------------------
PANB_METRJ/10-267--------------------------------------------------------------------------------
A9UP51_MONBE/1-268--------------------------------------------------------------------------------
PANB_PROA2/11-273--------------------------------------------------------------------------------
F2UAL1_SALR5/62-329--------------------------------------------------------------------------------
V2XXG0_MONRO/40-299--------------------------------------------------------------------------------
G2IQV3_9SPHN/23-282--------------------------------------------------------------------------------
PANB_CLONN/2-260--------------------------------------------------------------------------------
PANB_WIGBR/3-260--------------------------------------------------------------------------------
M1FDT2_9ALTE/4-264--------------------------------------------------------------------------------
E4TII1_CALNY/9-264--------------------------------------------------------------------------------
K0I9Q1_NITGG/2-255--------------------------------------------------------------------------------
C7MD29_BRAFD/11-267--------------------------------------------------------------------------------
G8PQN3_PSEUV/9-264--------------------------------------------------------------------------------
PANB_LEPCP/16-279--------------------------------------------------------------------------------
K1VYW4_TRIAC/1535-1794--------------------------------------------------------------------------------
B8I2Z4_CLOCE/9-266--------------------------------------------------------------------------------
I0AFM0_IGNAJ/3-258--------------------------------------------------------------------------------
I4CAV2_DESTA/3-261--------------------------------------------------------------------------------
PANB_SULDN/4-259--------------------------------------------------------------------------------
S8DNJ0_FOMPI/15-274--------------------------------------------------------------------------------
PANB_METCA/5-260--------------------------------------------------------------------------------
F3YUG3_DESAF/5-260--------------------------------------------------------------------------------
PANB_SYNAS/9-267--------------------------------------------------------------------------------
C7LVL7_DESBD/2-259--------------------------------------------------------------------------------
PANB_NOCSJ/34-291--------------------------------------------------------------------------------
F0SK13_RUBBR/3-257--------------------------------------------------------------------------------
I0DRD2_PROSM/4-258--------------------------------------------------------------------------------
D3E7N3_GEOS4/7-265--------------------------------------------------------------------------------
G7EAQ5_MIXOS/98-357--------------------------------------------------------------------------------
R7GY01_9FIRM/2-260--------------------------------------------------------------------------------
U9SMK5_RHIID/19-277--------------------------------------------------------------------------------
R5GD14_9BACT/11-269--------------------------------------------------------------------------------
R1GLQ8_BOTPV/11-271--------------------------------------------------------------------------------
PANB_DESAH/4-258--------------------------------------------------------------------------------
PANB_DEIDV/5-258--------------------------------------------------------------------------------
S6CEI7_9ACTN/2-260--------------------------------------------------------------------------------
R5KEY8_9CLOT/2-260--------------------------------------------------------------------------------
K0SSA9_THAOC/101-366--------------------------------------------------------------------------------
C6XKS3_HIRBI/9-264--------------------------------------------------------------------------------
J9QSS2_RIEAN/9-267--------------------------------------------------------------------------------
S6BYU9_9GAMM/3-260--------------------------------------------------------------------------------
D0KZU6_HALNC/20-275--------------------------------------------------------------------------------
W6RP24_9RHIZ/9-265--------------------------------------------------------------------------------
G0W8X4_NAUDC/30-294--------------------------------------------------------------------------------
E5AM95_BURRH/11-268--------------------------------------------------------------------------------
I3TFJ1_THEC1/4-259--------------------------------------------------------------------------------
PANB_GRABC/9-265--------------------------------------------------------------------------------
G0GCR3_SPITZ/2-257--------------------------------------------------------------------------------
G1XV43_ARTOA/82-342--------------------------------------------------------------------------------
D9Q2W0_ACIS3/6-261--------------------------------------------------------------------------------
B1ZVH1_OPITP/3-258--------------------------------------------------------------------------------
R7EXA6_9BACT/11-269--------------------------------------------------------------------------------
F6B538_DESCC/4-262--------------------------------------------------------------------------------
D5UZ54_ARCNC/10-265--------------------------------------------------------------------------------
U1GVM1_ENDPU/59-319--------------------------------------------------------------------------------
G2QRB2_THITE/68-328--------------------------------------------------------------------------------
B7FR45_PHATC/3-276--------------------------------------------------------------------------------
PANB_THEEB/5-261--------------------------------------------------------------------------------
R7D6U7_9ACTN/3-263--------------------------------------------------------------------------------
E3GPR0_EUBLK/2-261--------------------------------------------------------------------------------
C1DI17_AZOVD/17-274--------------------------------------------------------------------------------
A5VB06_SPHWW/22-276--------------------------------------------------------------------------------
A4CLQ4_ROBBH/10-268--------------------------------------------------------------------------------
D5BTJ5_PUNMI/4-260--------------------------------------------------------------------------------
C9RK32_FIBSS/3-246--------------------------------------------------------------------------------
C4LHZ4_CORK4/17-275--------------------------------------------------------------------------------
W8KF56_HALHR/9-265--------------------------------------------------------------------------------
G7V5R4_THELD/5-262--------------------------------------------------------------------------------
I3ZIP5_TERRK/17-275--------------------------------------------------------------------------------
S6AIG3_9PROT/2-259--------------------------------------------------------------------------------
F3ZPG7_9BACE/11-269--------------------------------------------------------------------------------
PANB_AQUAE/2-260--------------------------------------------------------------------------------
R7ALC5_9ACTN/29-287--------------------------------------------------------------------------------
U5N9B5_9BURK/27-288--------------------------------------------------------------------------------
C6BVH5_DESAD/3-260--------------------------------------------------------------------------------
C5KFU4_PERM5/79-341--------------------------------------------------------------------------------
U5T1Y9_9GAMM/5-261--------------------------------------------------------------------------------
F4H271_CELFA/7-264--------------------------------------------------------------------------------
F8AZ74_FRADG/51-306--------------------------------------------------------------------------------
E4NQR1_HALBP/4-256--------------------------------------------------------------------------------
C6VWE8_DYAFD/10-268--------------------------------------------------------------------------------
R5KSN9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_NATPD/3-255--------------------------------------------------------------------------------
L0IYN2_MYCSM/17-274--------------------------------------------------------------------------------
PANB_CLOTH/4-262--------------------------------------------------------------------------------
PANB_SPHAL/26-281--------------------------------------------------------------------------------
I0A221_FERFK/7-263--------------------------------------------------------------------------------
T2GAB0_DESGI/5-261--------------------------------------------------------------------------------
C6WXZ0_METML/2-266--------------------------------------------------------------------------------
F2IID2_FLUTR/9-267--------------------------------------------------------------------------------
D5BNG2_PUNMI/9-267--------------------------------------------------------------------------------
PANB_ARTAT/40-297--------------------------------------------------------------------------------
PANB_CARHZ/3-261--------------------------------------------------------------------------------
A4G8C6_HERAR/16-272--------------------------------------------------------------------------------
E1QUY6_VULDI/5-260--------------------------------------------------------------------------------
PANB_METFK/3-256--------------------------------------------------------------------------------
PANB_CHESB/10-264--------------------------------------------------------------------------------
B6GXN5_PENRW/75-335--------------------------------------------------------------------------------
I0GU87_SELRL/2-260--------------------------------------------------------------------------------
R9AIM6_WALI9/451-714--------------------------------------------------------------------------------
R5BQ58_9FIRM/5-264--------------------------------------------------------------------------------
F8AC68_THEID/6-263--------------------------------------------------------------------------------
PANB_ALKEH/12-269--------------------------------------------------------------------------------
F8E6G1_FLESM/9-265--------------------------------------------------------------------------------
PANB_BORPE/9-264--------------------------------------------------------------------------------
E1VL92_9GAMM/2-258--------------------------------------------------------------------------------
R6CEN3_9FIRM/2-260--------------------------------------------------------------------------------
PANB_LEPBP/4-261--------------------------------------------------------------------------------
D5MI67_9BACT/6-263--------------------------------------------------------------------------------
G0EFC1_PYRF1/3-258--------------------------------------------------------------------------------
PANB_EXIS2/3-258--------------------------------------------------------------------------------
I4BB70_TURPD/157-414--------------------------------------------------------------------------------
PANB_MARHV/2-258--------------------------------------------------------------------------------
D8J2A6_HALJB/4-255--------------------------------------------------------------------------------
PANB_IGNH4/3-259--------------------------------------------------------------------------------
G4RJI6_THETK/5-260--------------------------------------------------------------------------------
K8GUE9_9CYAN/2-256--------------------------------------------------------------------------------
W6SJ04_9CLOT/2-259--------------------------------------------------------------------------------
D9SXD7_CLOC7/2-260--------------------------------------------------------------------------------
W5W0X3_9PSEU/35-292--------------------------------------------------------------------------------
F7V601_CLOSS/2-260--------------------------------------------------------------------------------
PANB_SYNE7/2-256--------------------------------------------------------------------------------
I2GYS6_TETBL/22-285--------------------------------------------------------------------------------
F2N7R6_CORGP/2-260--------------------------------------------------------------------------------
PANB_SODGM/2-257--------------------------------------------------------------------------------
PANB_MYXXD/4-262--------------------------------------------------------------------------------
W0JJ73_DESAE/2-258--------------------------------------------------------------------------------
PANB_SALRD/3-261--------------------------------------------------------------------------------
H1XSD8_9BACT/9-267--------------------------------------------------------------------------------
K4KI34_SIMAS/15-270--------------------------------------------------------------------------------
PANB_PHEZH/11-266--------------------------------------------------------------------------------
C1F8U4_ACIC5/19-277--------------------------------------------------------------------------------
PANB_BDEBA/2-258--------------------------------------------------------------------------------
PANB_PSELT/2-257--------------------------------------------------------------------------------
PANB_POLSJ/34-294--------------------------------------------------------------------------------
G0A0M7_METMM/10-265--------------------------------------------------------------------------------
E3E4R6_PAEPS/7-265--------------------------------------------------------------------------------
R7P8R5_9BACT/11-269--------------------------------------------------------------------------------
G8QNM1_DECSP/9-266--------------------------------------------------------------------------------
V6JZL1_STRNV/26-283--------------------------------------------------------------------------------
F4GUY4_PUSST/9-264--------------------------------------------------------------------------------
R7C4Y8_9BURK/5-261--------------------------------------------------------------------------------
R6EWT4_9BACT/11-269--------------------------------------------------------------------------------
PANB_PSYA2/2-261--------------------------------------------------------------------------------
E6UF09_RUMA7/2-260--------------------------------------------------------------------------------
PANB_PROMM/4-256--------------------------------------------------------------------------------
F8GE64_NITSI/2-259--------------------------------------------------------------------------------
G8YQ94_PICSO/33-293--------------------------------------------------------------------------------
R6EER5_9BACT/10-268--------------------------------------------------------------------------------
R6MV46_9FIRM/2-260--------------------------------------------------------------------------------
E1ZCJ6_CHLVA/23-287--------------------------------------------------------------------------------
PANB_NITSB/4-255--------------------------------------------------------------------------------
M4VAT0_9DELT/3-258--------------------------------------------------------------------------------
C4XU18_DESMR/3-260--------------------------------------------------------------------------------
J9ZD86_LEPFM/6-263--------------------------------------------------------------------------------
L0K4F1_HALHC/4-262--------------------------------------------------------------------------------
E6WZE1_NITSE/11-266--------------------------------------------------------------------------------
R7IQM6_9FIRM/7-262--------------------------------------------------------------------------------
R5JJK8_9FIRM/2-260--------------------------------------------------------------------------------
F8DZN0_CORRG/23-280--------------------------------------------------------------------------------
I4D5R2_DESAJ/3-259--------------------------------------------------------------------------------
PANB_LEIXX/16-273--------------------------------------------------------------------------------
E4U2F8_SULKY/3-258--------------------------------------------------------------------------------
PANB_NITMS/2-259--------------------------------------------------------------------------------
PANB1_PSEAE/9-265--------------------------------------------------------------------------------
G8BMS9_TETPH/44-308--------------------------------------------------------------------------------
R5V6Z6_9FIRM/2-260--------------------------------------------------------------------------------
R5U793_9BACE/11-269--------------------------------------------------------------------------------
F6CMZ4_DESK7/5-263--------------------------------------------------------------------------------
B9L8Y5_NAUPA/4-254--------------------------------------------------------------------------------
PANB_DESPS/2-260--------------------------------------------------------------------------------
L0F2P8_DESDL/3-259--------------------------------------------------------------------------------
K9Y6F0_HALP7/3-258--------------------------------------------------------------------------------
PANB_NITEU/8-264--------------------------------------------------------------------------------
M5C834_THACB/15-272--------------------------------------------------------------------------------
T2KQ61_9FLAO/10-268--------------------------------------------------------------------------------
I1NLG6_ORYGL/83-346--------------------------------------------------------------------------------
E6TZJ1_BACCJ/3-259--------------------------------------------------------------------------------
K0B4S7_CLOA9/4-262--------------------------------------------------------------------------------
R6VBN9_9CLOT/2-260--------------------------------------------------------------------------------
G4QJL3_GLANF/3-259--------------------------------------------------------------------------------
PANB_RHOBA/10-264--------------------------------------------------------------------------------
R5DYA6_9BURK/9-266--------------------------------------------------------------------------------
PANB_RHORT/10-268--------------------------------------------------------------------------------
A5DVU0_LODEL/36-294--------------------------------------------------------------------------------
B6JWN4_SCHJY/27-297--------------------------------------------------------------------------------
PANB_CORGL/8-265--------------------------------------------------------------------------------
PANB_RALSO/12-268--------------------------------------------------------------------------------
R6LXN4_9CLOT/2-260--------------------------------------------------------------------------------
PANB_MOOTA/6-264--------------------------------------------------------------------------------
F2F6S0_SOLSS/3-258--------------------------------------------------------------------------------
PANB_AZOSB/9-267--------------------------------------------------------------------------------
D3SC34_THISK/3-258--------------------------------------------------------------------------------
D4H852_DENA2/9-265--------------------------------------------------------------------------------
H6L4G9_SAPGL/9-267--------------------------------------------------------------------------------
R6DPQ8_9CLOT/2-260--------------------------------------------------------------------------------
N0B212_9BACI/3-259--------------------------------------------------------------------------------
R7K0E3_9CLOT/2-260--------------------------------------------------------------------------------
Q6BIM6_DEBHA/33-293--------------------------------------------------------------------------------
K0KXD0_WICCF/32-290--------------------------------------------------------------------------------
E8RS63_ASTEC/11-266--------------------------------------------------------------------------------
F9X8W4_ZYMTI/67-327--------------------------------------------------------------------------------
A4XA35_SALTO/20-277--------------------------------------------------------------------------------
D5U1C4_THEAM/4-259--------------------------------------------------------------------------------
T0ULG9_9STRE/2-260--------------------------------------------------------------------------------
PANB_ALTMD/3-259--------------------------------------------------------------------------------
I0ICC5_PHYMF/8-267--------------------------------------------------------------------------------
F4PL25_DICFS/108-366--------------------------------------------------------------------------------
G4KQR4_OSCVS/3-261--------------------------------------------------------------------------------
K9YNE4_CYASC/2-257--------------------------------------------------------------------------------
PANB_WOLSU/3-258--------------------------------------------------------------------------------
E6U5I9_ETHHY/4-262--------------------------------------------------------------------------------
B8BWG2_THAPS/41-307--------------------------------------------------------------------------------
K9SYS3_9SYNE/2-257--------------------------------------------------------------------------------
PANB_AERPE/5-260--------------------------------------------------------------------------------
R7DES0_9PORP/10-268--------------------------------------------------------------------------------
PANB_BAUCH/4-259--------------------------------------------------------------------------------
I5AYL4_9DELT/4-258--------------------------------------------------------------------------------
PANB_BACSK/2-259--------------------------------------------------------------------------------
R6A0K1_9BACT/11-268--------------------------------------------------------------------------------
B2IDS4_BEII9/7-254--------------------------------------------------------------------------------
K0C447_CYCSP/9-266--------------------------------------------------------------------------------
PANB_LISMO/5-258--------------------------------------------------------------------------------
PANB_RHILO/16-267--------------------------------------------------------------------------------
K9VPY0_9CYAN/2-258--------------------------------------------------------------------------------
C0ZCH0_BREBN/7-265--------------------------------------------------------------------------------
A7TTC6_VANPO/36-301--------------------------------------------------------------------------------
M4ZY73_9ACTN/20-278--------------------------------------------------------------------------------
D2U9Y6_XANAP/10-266--------------------------------------------------------------------------------
PANB_BACLD/3-259--------------------------------------------------------------------------------
K9ZZ09_DEIPD/3-257--------------------------------------------------------------------------------
D3UG21_HELM1/2-256--------------------------------------------------------------------------------
R5FZT9_9PORP/11-269--------------------------------------------------------------------------------
E0SBL5_DICD3/3-259--------------------------------------------------------------------------------
PANB_HALSA/12-261--------------------------------------------------------------------------------
PANB_CAMJE/4-258--------------------------------------------------------------------------------
C5CWU9_VARPS/32-292--------------------------------------------------------------------------------
Q0UNM3_PHANO/57-317--------------------------------------------------------------------------------
PANB_SULAC/5-259--------------------------------------------------------------------------------
M4NHU9_9GAMM/13-271--------------------------------------------------------------------------------
C5C4X5_BEUC1/14-271--------------------------------------------------------------------------------
E2SAV3_9ACTN/24-281--------------------------------------------------------------------------------
I2F2C6_9BACT/2-256--------------------------------------------------------------------------------
PANB_DECAR/9-266--------------------------------------------------------------------------------
W1Q8C1_OGAPD/26-284--------------------------------------------------------------------------------
PANB_KOSOT/2-256--------------------------------------------------------------------------------
PANB2_BRADU/11-267--------------------------------------------------------------------------------
R7NSE5_9FIRM/2-259--------------------------------------------------------------------------------
A8DWD1_NEMVE/4-260--------------------------------------------------------------------------------
D9SIJ1_GALCS/2-259--------------------------------------------------------------------------------
PANB2_VIBF1/3-259--------------------------------------------------------------------------------
C4Y7C6_CLAL4/28-286--------------------------------------------------------------------------------
E0UPX6_SULAO/4-259--------------------------------------------------------------------------------
C0QS02_PERMH/2-258--------------------------------------------------------------------------------
PANB_PELUB/4-253--------------------------------------------------------------------------------
F2LWA6_HIPMA/2-259--------------------------------------------------------------------------------
PANB_THICR/2-256--------------------------------------------------------------------------------
M5DV17_9GAMM/4-263--------------------------------------------------------------------------------
X2HEZ8_9NEIS/2-257--------------------------------------------------------------------------------
I1YKY2_METFJ/3-261--------------------------------------------------------------------------------
D2NU30_ROTMD/61-319--------------------------------------------------------------------------------
R5SB00_9GAMM/3-259--------------------------------------------------------------------------------
E1VAR3_HALED/19-275--------------------------------------------------------------------------------
D3SNL0_THEAH/2-259--------------------------------------------------------------------------------
U3U9E1_9ENTR/4-259--------------------------------------------------------------------------------
PANB_CLOAB/2-260--------------------------------------------------------------------------------
B7GHT0_ANOFW/22-277--------------------------------------------------------------------------------
B8EK33_METSB/5-251--------------------------------------------------------------------------------
C8X1K5_DESRD/4-262--------------------------------------------------------------------------------
G4T0T2_META2/12-267--------------------------------------------------------------------------------
PANB_ANAMF/4-256--------------------------------------------------------------------------------
I4YBJ3_WALMC/10-273--------------------------------------------------------------------------------
F0S4V2_PSESL/9-267--------------------------------------------------------------------------------
E6SCG6_INTC7/25-282--------------------------------------------------------------------------------
PANB_CORJK/21-279--------------------------------------------------------------------------------
F4PBH9_BATDJ/27-283--------------------------------------------------------------------------------
PANB_CYAP4/3-259--------------------------------------------------------------------------------
U5QGT4_9CYAN/2-258--------------------------------------------------------------------------------
E7A9J8_HELFC/3-264--------------------------------------------------------------------------------
PANB_ROSDO/14-264--------------------------------------------------------------------------------
I0H0N1_ACTM4/15-272--------------------------------------------------------------------------------
M2PBF7_CERS8/43-302--------------------------------------------------------------------------------
V4KY10_9DELT/4-261--------------------------------------------------------------------------------
D4MUX9_ANAHA/2-260--------------------------------------------------------------------------------
K4II33_PSYTT/10-268--------------------------------------------------------------------------------
G2TM93_BACCO/3-259--------------------------------------------------------------------------------
PANB_NOCFA/22-279--------------------------------------------------------------------------------
PANB_STRMK/10-265--------------------------------------------------------------------------------
R6Q9M5_9FIRM/3-261--------------------------------------------------------------------------------
PANB_GEOLS/4-261--------------------------------------------------------------------------------
PANB_STACT/3-256--------------------------------------------------------------------------------
D3IAK5_9BACT/11-269--------------------------------------------------------------------------------
E3RMD4_PYRTT/56-316--------------------------------------------------------------------------------
F8C4E6_THEGP/11-262--------------------------------------------------------------------------------
PANB_RHOCS/9-265--------------------------------------------------------------------------------
G8LWQ2_CLOCD/4-262--------------------------------------------------------------------------------
Q6CLY9_KLULA/32-295--------------------------------------------------------------------------------
PANB_SYNR3/10-261--------------------------------------------------------------------------------
R5J4T6_9FIRM/2-260--------------------------------------------------------------------------------
R5CPJ0_9BACT/11-269--------------------------------------------------------------------------------
PANB2_ZYMMO/10-265--------------------------------------------------------------------------------
PANB_UNCTG/3-261--------------------------------------------------------------------------------
A9SWR9_PHYPA/44-307--------------------------------------------------------------------------------
PANB_PSYWF/2-265--------------------------------------------------------------------------------
E1VXC6_ARTAR/15-272--------------------------------------------------------------------------------
F2J6X3_POLGS/33-294--------------------------------------------------------------------------------
PANB_GEOSW/3-259--------------------------------------------------------------------------------
D3PCJ6_DEFDS/9-265--------------------------------------------------------------------------------
F5XK06_MICPN/12-270--------------------------------------------------------------------------------
R5PEY0_9BACT/11-269--------------------------------------------------------------------------------
D1BFU9_SANKS/24-281--------------------------------------------------------------------------------
I3VRB5_THESW/4-262--------------------------------------------------------------------------------
PANB_AGRVS/9-265--------------------------------------------------------------------------------
PANB_XYLFA/10-265--------------------------------------------------------------------------------
M4SFZ5_9SPHN/23-277--------------------------------------------------------------------------------
G0RQ21_HYPJQ/11-271--------------------------------------------------------------------------------
R7FC11_9FIRM/2-261--------------------------------------------------------------------------------
C1MW11_MICPC/19-288--------------------------------------------------------------------------------
W5XWQ3_9CORY/8-265--------------------------------------------------------------------------------
L0EU60_LIBCB/3-258--------------------------------------------------------------------------------
L0E1F4_THIND/2-256--------------------------------------------------------------------------------
K9Z7J6_CYAAP/2-257--------------------------------------------------------------------------------
I4A0H9_ORNRL/9-266--------------------------------------------------------------------------------
A5HYW9_CLOBH/2-260--------------------------------------------------------------------------------
I3U7Q6_ADVKW/24-279--------------------------------------------------------------------------------
PANB1_PSEF5/9-264--------------------------------------------------------------------------------
E8UZX7_TERSS/17-275--------------------------------------------------------------------------------
PANB_CHLTE/11-273--------------------------------------------------------------------------------
F4CPV3_PSEUX/31-288--------------------------------------------------------------------------------
PANB_MARMM/13-268--------------------------------------------------------------------------------
K9WEF5_9CYAN/2-259--------------------------------------------------------------------------------
K9SKS8_9CYAN/2-258--------------------------------------------------------------------------------
R4VYJ3_9EURY/3-265--------------------------------------------------------------------------------
K5WY16_AGABU/47-306--------------------------------------------------------------------------------
A8NR68_COPC7/47-306--------------------------------------------------------------------------------
S5SZ30_9CORY/8-265--------------------------------------------------------------------------------
E3H7X2_ILYPC/2-260--------------------------------------------------------------------------------
B8D3I6_DESK1/7-262--------------------------------------------------------------------------------
I2BCN0_SHIBC/38-294--------------------------------------------------------------------------------
D8PBH0_9BACT/1-257--------------------------------------------------------------------------------
A7I1C3_CAMHC/4-259--------------------------------------------------------------------------------
D3Q8M5_STANL/19-275--------------------------------------------------------------------------------
V5UCI0_9BURK/11-268--------------------------------------------------------------------------------
L0H3K5_9GAMM/8-264--------------------------------------------------------------------------------
L0JL26_NATP1/3-257--------------------------------------------------------------------------------
A8IKB7_CHLRE/113-377--------------------------------------------------------------------------------
PANB_HELPY/10-265--------------------------------------------------------------------------------
R7BQ71_9ACTN/2-260--------------------------------------------------------------------------------
D5V951_MORCR/17-276--------------------------------------------------------------------------------
U7PLW4_SPOS1/41-301--------------------------------------------------------------------------------
R7LEZ2_9BACT/2-258--------------------------------------------------------------------------------
D3FBP3_CONWI/22-279--------------------------------------------------------------------------------
C5CCN7_MICLC/23-281--------------------------------------------------------------------------------
F8PSJ9_SERL3/44-301--------------------------------------------------------------------------------
PANB_PELCD/4-262--------------------------------------------------------------------------------
D7CJ47_SYNLT/3-261--------------------------------------------------------------------------------
Q6FJH7_CANGA/29-292--------------------------------------------------------------------------------
D8M6X1_BLAHO/33-296--------------------------------------------------------------------------------
E1SVW3_FERBD/3-259--------------------------------------------------------------------------------
PANB_METS5/3-254--------------------------------------------------------------------------------
C1EBW8_MICSR/72-335--------------------------------------------------------------------------------
J7S291_KAZNA/30-296--------------------------------------------------------------------------------
B8MWV2_ASPFN/53-313--------------------------------------------------------------------------------
PANB_GLUDA/2-258--------------------------------------------------------------------------------
PANB3_BRADU/9-264--------------------------------------------------------------------------------
PANB_HALMA/3-256--------------------------------------------------------------------------------
PANB_STAA8/2-256--------------------------------------------------------------------------------
G4RCR9_PELHB/16-265--------------------------------------------------------------------------------
F7YY72_9THEM/2-258--------------------------------------------------------------------------------
D2W044_NAEGR/75-331--------------------------------------------------------------------------------
F4C347_SPHS2/9-267--------------------------------------------------------------------------------
B1I1N7_DESAP/5-263--------------------------------------------------------------------------------
A8NPY9_COPC7/58-317--------------------------------------------------------------------------------
R5E9H5_9CLOT/2-260--------------------------------------------------------------------------------
B8J200_DESDA/2-259--------------------------------------------------------------------------------
V4IHK4_9GAMM/6-262--------------------------------------------------------------------------------
PANB_CUPMC/11-266--------------------------------------------------------------------------------
PANB_SYNJB/4-259--------------------------------------------------------------------------------
PANB_SACEN/31-288--------------------------------------------------------------------------------
G0VBF0_NAUCC/42-307--------------------------------------------------------------------------------
D2SAW9_GEOOG/14-271--------------------------------------------------------------------------------
A5FWA4_ACICJ/13-269--------------------------------------------------------------------------------
N0B2M6_9RHIZ/10-264--------------------------------------------------------------------------------
H9UMW1_SPIAZ/3-258--------------------------------------------------------------------------------
PANB_CAMFF/3-258--------------------------------------------------------------------------------
G7USF2_PSEUP/10-266--------------------------------------------------------------------------------
A0A0D2VT44_CAPO3/54-312--------------------------------------------------------------------------------
A8ZX35_DESOH/4-253--------------------------------------------------------------------------------
PANB_CAUCR/12-266--------------------------------------------------------------------------------
D5WPY7_KYRT2/8-259--------------------------------------------------------------------------------
I0JN82_HALH3/5-258--------------------------------------------------------------------------------
E4T2P1_PALPW/10-268--------------------------------------------------------------------------------
E4U845_OCEP5/3-257--------------------------------------------------------------------------------
B8IX11_METNO/22-279--------------------------------------------------------------------------------
PANB_PARL1/9-264--------------------------------------------------------------------------------
C1D7E8_LARHH/49-306--------------------------------------------------------------------------------
PANB_YEAST/26-290--------------------------------------------------------------------------------
I1XL09_METNJ/3-260--------------------------------------------------------------------------------
PANB_TRIEI/2-260--------------------------------------------------------------------------------
K7AE29_9ALTE/3-259--------------------------------------------------------------------------------
S2J9Z0_MUCC1/36-294--------------------------------------------------------------------------------
W0EVM7_9SPHI/9-267--------------------------------------------------------------------------------
PANB_CALMQ/5-260--------------------------------------------------------------------------------
S0EZ89_CHTCT/9-267--------------------------------------------------------------------------------
Q6CE35_YARLI/40-298--------------------------------------------------------------------------------
R5ACL8_9FIRM/2-260--------------------------------------------------------------------------------
G8R5C5_OWEHD/10-268--------------------------------------------------------------------------------
PANB_TOLAT/3-259--------------------------------------------------------------------------------
B3QT33_CHLT3/14-276--------------------------------------------------------------------------------
B0VG23_CLOAI/8-266--------------------------------------------------------------------------------
G8B7V6_CANPC/30-291--------------------------------------------------------------------------------
D5UXM6_TSUPD/25-282--------------------------------------------------------------------------------
W0DU54_9GAMM/2-258--------------------------------------------------------------------------------
F0YK17_AURAN/2-266--------------------------------------------------------------------------------
N1QBK2_PSEFD/41-301--------------------------------------------------------------------------------
G8TR11_NIAKG/11-269--------------------------------------------------------------------------------
K0NQW1_DESTT/4-258--------------------------------------------------------------------------------
C5DIL6_LACTC/24-292--------------------------------------------------------------------------------
F4B4G2_ACIHW/4-258--------------------------------------------------------------------------------
PANB_DESAG/9-266--------------------------------------------------------------------------------
E1QGK1_DESB2/5-263--------------------------------------------------------------------------------
F9Z613_ODOSD/10-267--------------------------------------------------------------------------------
R6QG64_9CLOT/9-267--------------------------------------------------------------------------------
PANB_NEIG1/2-257--------------------------------------------------------------------------------
PANB_ALKMQ/4-261--------------------------------------------------------------------------------
F0LTK0_VIBFN/3-259--------------------------------------------------------------------------------
A5D5T4_PELTS/5-263--------------------------------------------------------------------------------
PANB_TROWT/13-267--------------------------------------------------------------------------------
J7IT73_DESMD/3-259--------------------------------------------------------------------------------
D4KZZ1_9FIRM/4-262--------------------------------------------------------------------------------
PANB_SACD2/11-266--------------------------------------------------------------------------------
PANB_CYAP8/2-257--------------------------------------------------------------------------------
PANB1_ZYMMO/33-296--------------------------------------------------------------------------------
PANB1_HAHCH/9-265--------------------------------------------------------------------------------
B4U641_HYDS0/4-261--------------------------------------------------------------------------------
C7PAE1_CHIPD/9-267--------------------------------------------------------------------------------
PANB_EXISA/3-259--------------------------------------------------------------------------------
PANB_FRAAA/42-298--------------------------------------------------------------------------------
A8GIZ6_SERP5/25-281--------------------------------------------------------------------------------
PANB_MARMS/13-269--------------------------------------------------------------------------------
B9I8Q3_POPTR/46-310--------------------------------------------------------------------------------
F2KYW8_PREDF/10-268--------------------------------------------------------------------------------
W8X8F9_CASDE/9-264--------------------------------------------------------------------------------
C7MWE6_SACVD/37-294--------------------------------------------------------------------------------
W8TJC5_EUBAC/5-263--------------------------------------------------------------------------------
R6MRV8_9FIRM/2-260--------------------------------------------------------------------------------
E1R683_SPISS/12-255--------------------------------------------------------------------------------
E0TIB5_PARBH/9-264--------------------------------------------------------------------------------
C9R9H9_AMMDK/3-261--------------------------------------------------------------------------------
L0ECE9_THECK/4-262--------------------------------------------------------------------------------
PANB_RHIEC/9-265--------------------------------------------------------------------------------
PANB_RHOS4/11-264--------------------------------------------------------------------------------
C8W3T9_DESAS/5-263--------------------------------------------------------------------------------
H8GHP8_METAL/6-259--------------------------------------------------------------------------------
R6FWR6_9CLOT/2-260--------------------------------------------------------------------------------
Q7NSX9_CHRVO/10-253--------------------------------------------------------------------------------
PANB_DESVH/21-277--------------------------------------------------------------------------------
PANB_RHISN/11-264--------------------------------------------------------------------------------
K9SDR5_9CYAN/2-259--------------------------------------------------------------------------------
R6FYY2_9FIRM/2-260--------------------------------------------------------------------------------
PANB_THIDA/2-258--------------------------------------------------------------------------------
PANB2_METPP/16-274--------------------------------------------------------------------------------
PANB_ROSS1/2-259--------------------------------------------------------------------------------
H6C1C9_EXODN/62-322--------------------------------------------------------------------------------
F2NLZ2_MARHT/3-259--------------------------------------------------------------------------------
F0R8P2_BACSH/11-269--------------------------------------------------------------------------------
D5SWW3_PLAL2/21-276--------------------------------------------------------------------------------
R5EQ78_9GAMM/2-259--------------------------------------------------------------------------------
E8U6D3_DEIML/3-257--------------------------------------------------------------------------------
B3PI46_CELJU/20-275--------------------------------------------------------------------------------
PANB_SYNFM/4-261--------------------------------------------------------------------------------
H2J7Z9_MARPK/2-256--------------------------------------------------------------------------------
PANB_CHRSD/3-259--------------------------------------------------------------------------------
H8L6Y3_FRAAD/13-270--------------------------------------------------------------------------------
PANB_DEHM1/2-259--------------------------------------------------------------------------------
PANB_HELHP/5-260--------------------------------------------------------------------------------
B2GG07_KOCRD/16-273--------------------------------------------------------------------------------
J3YT69_9ENTR/2-257--------------------------------------------------------------------------------
PANB_RUTMC/2-256--------------------------------------------------------------------------------
F4KKJ6_PORAD/11-269--------------------------------------------------------------------------------
E4TNZ1_MARTH/10-268--------------------------------------------------------------------------------
PANB_ACIAD/3-261--------------------------------------------------------------------------------
M1E8E9_9FIRM/4-260--------------------------------------------------------------------------------
H2FZS0_OCESG/3-259--------------------------------------------------------------------------------
E3D016_9BACT/4-262--------------------------------------------------------------------------------
R7Y0I9_9ACTN/27-284--------------------------------------------------------------------------------
C7R4W8_JONDD/10-267--------------------------------------------------------------------------------
B3DYC2_METI4/5-256--------------------------------------------------------------------------------
PANB_BURP8/11-267--------------------------------------------------------------------------------
PANB_OCEIH/3-256--------------------------------------------------------------------------------
K4LJP4_9FIRM/4-262--------------------------------------------------------------------------------
C7M6V0_CAPOD/10-268--------------------------------------------------------------------------------
E6SG79_THEM7/29-287--------------------------------------------------------------------------------
H0UKG2_9BACT/4-262--------------------------------------------------------------------------------
G0AG10_COLFT/18-274--------------------------------------------------------------------------------
D0MKC7_RHOM4/15-273--------------------------------------------------------------------------------
K9TFZ3_9CYAN/2-258--------------------------------------------------------------------------------
PANB_SYNY3/2-258--------------------------------------------------------------------------------
PANB_CHRVO/2-258--------------------------------------------------------------------------------
PANB_PYRAE/11-257--------------------------------------------------------------------------------
D3G0K7_BACPE/3-259--------------------------------------------------------------------------------
G8ZML5_TORDC/45-310--------------------------------------------------------------------------------
B8GNA9_THISH/9-265--------------------------------------------------------------------------------
PANB_YERPE/3-260--------------------------------------------------------------------------------
PANB_HALHL/14-269--------------------------------------------------------------------------------
I7H5U9_9HELI/5-260--------------------------------------------------------------------------------
PANB_FLAJ1/10-268--------------------------------------------------------------------------------
H2AZP6_KAZAF/28-293--------------------------------------------------------------------------------
PANB_HYPNA/9-263--------------------------------------------------------------------------------
F0T218_SYNGF/3-260--------------------------------------------------------------------------------
K0J2M4_AMPXN/5-260--------------------------------------------------------------------------------
PANB_PELPD/7-264--------------------------------------------------------------------------------
PANB_ACAM1/2-259--------------------------------------------------------------------------------
R5HLC5_9SPIR/4-262--------------------------------------------------------------------------------
E6W3R1_DESIS/9-267--------------------------------------------------------------------------------
E8WV64_GRATM/17-275--------------------------------------------------------------------------------
B0RBZ8_CLAMS/26-283--------------------------------------------------------------------------------
R7J318_9BACT/11-269--------------------------------------------------------------------------------
D1C1L8_SPHTD/5-263--------------------------------------------------------------------------------
D5CQ24_SIDLE/3-260--------------------------------------------------------------------------------
K9U8V4_9CYAN/2-257--------------------------------------------------------------------------------
R7Z1Y2_CONA1/60-319--------------------------------------------------------------------------------
A3GFD5_PICST/27-288--------------------------------------------------------------------------------
PANB_GEOMG/4-262--------------------------------------------------------------------------------
D1B8U6_THEAS/5-263--------------------------------------------------------------------------------
D1AZH1_SULD5/18-272--------------------------------------------------------------------------------
K9V2Q3_9CYAN/2-257--------------------------------------------------------------------------------
G4TES8_PIRID/16-274--------------------------------------------------------------------------------
PANB_AERHH/3-259--------------------------------------------------------------------------------
B5Y864_COPPD/3-251--------------------------------------------------------------------------------
E6VV69_DESAO/18-273--------------------------------------------------------------------------------
D0LB03_GORB4/26-283--------------------------------------------------------------------------------
R4XB88_TAPDE/13-270--------------------------------------------------------------------------------
C5XKA7_SORBI/74-338--------------------------------------------------------------------------------
PANB_HELMI/4-262--------------------------------------------------------------------------------
D4ZUG3_ARTPN/2-258--------------------------------------------------------------------------------
D3AXV1_POLPA/114-372--------------------------------------------------------------------------------
W5Y2G7_9CORY/15-272--------------------------------------------------------------------------------
W0IZ08_9BACT/4-264--------------------------------------------------------------------------------
G3AZ68_CANTC/24-285--------------------------------------------------------------------------------
E8R215_ISOPI/23-275--------------------------------------------------------------------------------
R4KP81_9FIRM/5-263--------------------------------------------------------------------------------
K5W3S2_PHACS/44-303--------------------------------------------------------------------------------
A9WS61_RENSM/30-287--------------------------------------------------------------------------------
PANB_ANADF/10-272--------------------------------------------------------------------------------
PANB_THEM4/1-256--------------------------------------------------------------------------------
PANB_SULSO/3-259--------------------------------------------------------------------------------
F0S244_DESTD/2-259--------------------------------------------------------------------------------
B9L4S0_THERP/5-263--------------------------------------------------------------------------------
C8WT97_ALIAD/4-262--------------------------------------------------------------------------------
PANB_STAEQ/2-256--------------------------------------------------------------------------------
PANB_OLICO/9-264--------------------------------------------------------------------------------
F6FX13_ISOV2/15-272--------------------------------------------------------------------------------
PANB_GEODF/4-262--------------------------------------------------------------------------------
D9QPL3_ACEAZ/4-262--------------------------------------------------------------------------------
F2JV64_MARM1/12-268--------------------------------------------------------------------------------
E0UCI4_CYAP2/2-257--------------------------------------------------------------------------------
D5EMA1_CORAD/2-258--------------------------------------------------------------------------------
G2IWQ8_PSEUL/2-259--------------------------------------------------------------------------------
X2GVH3_9BACI/3-258--------------------------------------------------------------------------------
D6XUX0_BACIE/3-260--------------------------------------------------------------------------------
D6Z2X7_DESAT/7-263--------------------------------------------------------------------------------
PANB_KORVE/11-269--------------------------------------------------------------------------------
A6QC29_SULNB/11-266--------------------------------------------------------------------------------
D3V561_XENBS/3-258--------------------------------------------------------------------------------
C6X7E4_METGS/1-265--------------------------------------------------------------------------------
D7WER9_9CORY/10-268--------------------------------------------------------------------------------
I3YPM0_ALIFI/9-267--------------------------------------------------------------------------------
R5HUC8_9FIRM/3-261--------------------------------------------------------------------------------
R5U8N9_9FIRM/2-260--------------------------------------------------------------------------------
PANB_HYPBU/6-262--------------------------------------------------------------------------------
B8P6R4_POSPM/2-261--------------------------------------------------------------------------------
PANB_SHELP/3-259--------------------------------------------------------------------------------
PANB_CHLAA/2-258--------------------------------------------------------------------------------
PANB_PHOLL/3-258--------------------------------------------------------------------------------
PANB_CLOK5/3-261--------------------------------------------------------------------------------
I0HQJ4_RUBGI/17-276--------------------------------------------------------------------------------
R5ZHJ8_9FIRM/2-260--------------------------------------------------------------------------------
U5MUW3_CLOSA/2-260--------------------------------------------------------------------------------
A0A068NY03_9BACT/4-257--------------------------------------------------------------------------------
K9T7C7_9CYAN/2-258--------------------------------------------------------------------------------
PANB_AZOPC/10-268--------------------------------------------------------------------------------
K3W4X2_PYTUL/57-320--------------------------------------------------------------------------------
A1CTJ0_ASPCL/72-332--------------------------------------------------------------------------------
A6WW04_OCHA4/18-274--------------------------------------------------------------------------------
V5SAA2_9RHIZ/10-264--------------------------------------------------------------------------------
D3HPA3_LEGLN/2-258--------------------------------------------------------------------------------
R5BRB9_9FIRM/4-262--------------------------------------------------------------------------------
B1VGE7_CORU7/16-274--------------------------------------------------------------------------------
W0RJ42_9BACT/5-261--------------------------------------------------------------------------------
PANB_PARDP/15-266--------------------------------------------------------------------------------
D5QI36_KOMHA/9-263--------------------------------------------------------------------------------
D1BSH7_XYLCX/21-280--------------------------------------------------------------------------------
L0DD73_SINAD/8-261--------------------------------------------------------------------------------
PANB_PEPD6/2-260--------------------------------------------------------------------------------
PANB_THEMA/2-256--------------------------------------------------------------------------------
C7N2J4_SLAHD/19-269--------------------------------------------------------------------------------
A4SZR6_POLSQ/9-266--------------------------------------------------------------------------------
D7B2F6_NOCDD/27-283--------------------------------------------------------------------------------
H3ZNX9_THELN/3-257--------------------------------------------------------------------------------
M4UAA2_9GAMM/3-259--------------------------------------------------------------------------------
K9QBM1_9NOSO/2-258--------------------------------------------------------------------------------
PANB_SALTY/3-258--------------------------------------------------------------------------------
W0E2Q1_MARPU/6-262--------------------------------------------------------------------------------
I1YQZ3_PREI7/10-268--------------------------------------------------------------------------------
L0A954_CALLD/5-260--------------------------------------------------------------------------------
D4Z3Z8_SPHJU/23-282--------------------------------------------------------------------------------
E6WRV2_PSEUU/10-266--------------------------------------------------------------------------------
F9ZNB5_ACICS/4-257--------------------------------------------------------------------------------
R5AXG3_9BACT/10-268--------------------------------------------------------------------------------
R6QI65_9FIRM/2-260--------------------------------------------------------------------------------
F4L4T8_HALH1/9-267--------------------------------------------------------------------------------
PANB_COLP3/3-259--------------------------------------------------------------------------------
PANB_ERWT9/3-259--------------------------------------------------------------------------------
D2B380_STRRD/20-276--------------------------------------------------------------------------------
Q54LH3_DICDI/91-349--------------------------------------------------------------------------------
R6RU48_9CLOT/2-260--------------------------------------------------------------------------------
C7QBN8_CATAD/33-291--------------------------------------------------------------------------------
E8NFW7_MICTS/5-263--------------------------------------------------------------------------------
PANB_THET8/2-257--------------------------------------------------------------------------------
M1PUL5_DESSD/4-262--------------------------------------------------------------------------------
PANB_HERA2/2-258--------------------------------------------------------------------------------
PANB_CORDI/5-259--------------------------------------------------------------------------------
G8P0T0_GRAMM/17-275--------------------------------------------------------------------------------
B0JGU8_MICAN/2-253--------------------------------------------------------------------------------
A4RSY4_OSTLU/35-299--------------------------------------------------------------------------------
G0VMJ3_MEGEL/4-263--------------------------------------------------------------------------------
G8JVR3_ERECY/22-285--------------------------------------------------------------------------------
D4ALU8_ARTBC/69-329--------------------------------------------------------------------------------
D8IYH6_HERSS/15-271--------------------------------------------------------------------------------
D5EGN8_AMICL/9-262--------------------------------------------------------------------------------
K0CGS1_ALCDB/3-252--------------------------------------------------------------------------------
M3HH38_CANMX/30-289--------------------------------------------------------------------------------
C7R7Z0_KANKD/3-259--------------------------------------------------------------------------------
H8KSY4_SOLCM/9-267--------------------------------------------------------------------------------
Q75D37_ASHGO/24-287--------------------------------------------------------------------------------
E4RTA9_LEAB4/5-263--------------------------------------------------------------------------------
E3HRX5_ACHXA/19-273--------------------------------------------------------------------------------
PANB_DESAA/4-258--------------------------------------------------------------------------------
D3DI50_HYDTT/5-262--------------------------------------------------------------------------------
T1KER8_TETUR/72-325--------------------------------------------------------------------------------
D9QLF2_BRESC/11-266--------------------------------------------------------------------------------
F8I3G8_SULAT/4-259--------------------------------------------------------------------------------
E8SI87_STAPH/2-256--------------------------------------------------------------------------------
D5BZ31_NITHN/3-259--------------------------------------------------------------------------------
PANB_ACIC1/10-267--------------------------------------------------------------------------------
PANB_BUCAI/3-259--------------------------------------------------------------------------------
D8RRV3_SELML/38-302--------------------------------------------------------------------------------
R5IEN0_9BACT/10-267--------------------------------------------------------------------------------
R5LDT0_9FIRM/2-259--------------------------------------------------------------------------------
D6ZCH0_SEGRD/15-271--------------------------------------------------------------------------------
PANB_LEPIN/9-261--------------------------------------------------------------------------------
PANB_FRATT/7-257--------------------------------------------------------------------------------
W0EB65_9FIRM/2-259--------------------------------------------------------------------------------
PANB_IDILO/5-261--------------------------------------------------------------------------------
PANB2_HAHCH/2-258--------------------------------------------------------------------------------
PANB_CHLPD/11-273--------------------------------------------------------------------------------
F0VHK9_NEOCL/2-249--------------------------------------------------------------------------------
W5X1Y4_BDEBC/3-258--------------------------------------------------------------------------------
PANB_ACISJ/26-287--------------------------------------------------------------------------------
PANB_SULTO/3-259--------------------------------------------------------------------------------
U4KYW8_PYROM/61-321--------------------------------------------------------------------------------
G8M4H3_9BURK/11-267--------------------------------------------------------------------------------
R7I0S5_9CLOT/17-275--------------------------------------------------------------------------------
PANB_LEGPH/2-258--------------------------------------------------------------------------------
PANB_PSYIN/3-259--------------------------------------------------------------------------------
B4EJY2_BURCJ/9-265--------------------------------------------------------------------------------
C3PI15_CORA7/10-267--------------------------------------------------------------------------------
D4G919_RIEPU/9-267--------------------------------------------------------------------------------
I7A1E3_MELRP/3-258--------------------------------------------------------------------------------
R6HBG1_9ACTN/2-260--------------------------------------------------------------------------------
C5ZWV0_9HELI/9-263--------------------------------------------------------------------------------
PANB_STAMF/3-258--------------------------------------------------------------------------------
PANB_CYTH3/10-268--------------------------------------------------------------------------------
H5WJ91_9BURK/17-281--------------------------------------------------------------------------------
PANB_ALCBS/2-258--------------------------------------------------------------------------------
B2V9F5_SULSY/3-258--------------------------------------------------------------------------------
I4ANF3_FLELS/11-269--------------------------------------------------------------------------------
B6H969_PENRW/50-309--------------------------------------------------------------------------------
X2GXI3_9GAMM/2-259--------------------------------------------------------------------------------
G4V1E0_NEUT9/11-271--------------------------------------------------------------------------------
C5ME17_CANTT/28-287--------------------------------------------------------------------------------
K9UIR8_9CHRO/3-253--------------------------------------------------------------------------------
A9GRC2_SORC5/21-278--------------------------------------------------------------------------------
R5NDJ7_9BACT/11-269--------------------------------------------------------------------------------
D2QWS1_PIRSD/7-261--------------------------------------------------------------------------------
C7RR60_ACCPU/9-266--------------------------------------------------------------------------------
PANB_MAGMM/4-262--------------------------------------------------------------------------------
PANB_SYNWW/3-261--------------------------------------------------------------------------------
D5AMQ4_RHOCB/10-264--------------------------------------------------------------------------------
PANB_BACHD/3-259--------------------------------------------------------------------------------
D0LJC1_HALO1/5-263--------------------------------------------------------------------------------
PANB_METS4/17-272--------------------------------------------------------------------------------
B2UME9_AKKM8/9-253--------------------------------------------------------------------------------
R5BAJ9_9BACE/11-269--------------------------------------------------------------------------------
PANB_EDWI9/4-259--------------------------------------------------------------------------------
R4KDW0_CLOPA/2-260--------------------------------------------------------------------------------
PANB_CALS8/3-260--------------------------------------------------------------------------------
D8QAA7_SCHCM/53-309--------------------------------------------------------------------------------
R5KL99_9CLOT/2-260--------------------------------------------------------------------------------
E3JA95_FRASU/46-302--------------------------------------------------------------------------------
D6ZI06_MOBCV/16-270--------------------------------------------------------------------------------
I3Y5B5_THIV6/6-262--------------------------------------------------------------------------------
U5Q4L3_9BACT/10-267--------------------------------------------------------------------------------
B8DSD1_DESVM/24-276--------------------------------------------------------------------------------
PANB_PROMH/3-258--------------------------------------------------------------------------------
R7JBN8_9FUSO/4-262--------------------------------------------------------------------------------
M1WKJ2_DESPC/25-280--------------------------------------------------------------------------------
W0BBT9_9GAMM/2-258--------------------------------------------------------------------------------
R5IDU3_9FIRM/17-266--------------------------------------------------------------------------------
A6RA45_AJECN/56-315--------------------------------------------------------------------------------
PANB_SYNP2/2-257--------------------------------------------------------------------------------
E4NAD9_KITSK/28-286--------------------------------------------------------------------------------
I3Z4N3_BELBD/11-269--------------------------------------------------------------------------------
D5X9N1_THEPJ/5-263--------------------------------------------------------------------------------
D8JZZ5_DEHLB/2-260--------------------------------------------------------------------------------
C7NW69_HALMD/3-255--------------------------------------------------------------------------------
K4LLM0_THEPS/3-261--------------------------------------------------------------------------------
PANB_XANP2/9-264--------------------------------------------------------------------------------
PANB_GEOBB/4-262--------------------------------------------------------------------------------
PANB_GLOVI/3-254--------------------------------------------------------------------------------
A6WD73_KINRD/16-272--------------------------------------------------------------------------------
B5YIG6_THEYD/2-260--------------------------------------------------------------------------------
H1XZL4_9SPHI/9-267--------------------------------------------------------------------------------
C6CUG2_PAESJ/4-263--------------------------------------------------------------------------------
PANB_ERYLH/23-282--------------------------------------------------------------------------------
PANB_SCHPO/5-262--------------------------------------------------------------------------------
D1CBZ3_THET1/7-265--------------------------------------------------------------------------------
K9XAD9_9CHRO/2-257--------------------------------------------------------------------------------
PANB_PSEHT/3-259--------------------------------------------------------------------------------
PANB_RUEST/10-264--------------------------------------------------------------------------------
V6JUX0_STRRC/32-289--------------------------------------------------------------------------------
R6BVU7_9BACT/10-268--------------------------------------------------------------------------------
C4R687_PICPG/26-284--------------------------------------------------------------------------------
K9XXG3_STAC7/2-258--------------------------------------------------------------------------------
A5DHH9_PICGU/32-292--------------------------------------------------------------------------------
I2ESX7_EMTOG/9-267--------------------------------------------------------------------------------
PANB_COXBU/4-260--------------------------------------------------------------------------------
B1X124_CYAA5/10-265--------------------------------------------------------------------------------
D5EWH2_PRER2/2-259--------------------------------------------------------------------------------
G2LF65_CHLTF/5-263--------------------------------------------------------------------------------
F6EEK6_AMYSD/18-275--------------------------------------------------------------------------------
G8RMJ4_MYCRN/4-264--------------------------------------------------------------------------------
G8AKD6_AZOBR/9-265--------------------------------------------------------------------------------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------------------------
A8MIW7_ALKOO/5-271--------------------------------------------------------------------------------
U5RTA7_9CLOT/8-273--------------------------------------------------------------------------------
D3EFW8_GEOS4/8-274--------------------------------------------------------------------------------
A0Q268_CLONN/3-268--------------------------------------------------------------------------------
I0GM52_SELRL/9-273--------------------------------------------------------------------------------
R5TZH9_9CLOT/6-271--------------------------------------------------------------------------------
A5I210_CLOBH/5-270--------------------------------------------------------------------------------
B2TMB2_CLOBB/6-270--------------------------------------------------------------------------------
E3GQA3_EUBLK/6-271--------------------------------------------------------------------------------
D3EFX0_GEOS4/19-284--------------------------------------------------------------------------------
K8END7_CARML/5-271--------------------------------------------------------------------------------
E3DLS5_HALPG/3-268--------------------------------------------------------------------------------
Q893M0_CLOTE/5-270--------------------------------------------------------------------------------
H6LDM1_ACEWD/6-271--------------------------------------------------------------------------------
G8AJD8_AZOBR/12-277--------------------------------------------------------------------------------
Q981G5_RHILO/24-290--------------------------------------------------------------------------------
H7C7V3_BRADU/40-302--------------------------------------------------------------------------------
L0D7P4_SINAD/6-270--------------------------------------------------------------------------------
B2JXP4_BURP8/9-270--------------------------------------------------------------------------------
K4LCM9_THEPS/9-273--------------------------------------------------------------------------------
Q0RZM6_RHOJR/7-274--------------------------------------------------------------------------------
K4LRH4_THEPS/9-277--------------------------------------------------------------------------------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------------------------
A4FLF5_SACEN/6-272--------------------------------------------------------------------------------
G7V878_THELD/7-273--------------------------------------------------------------------------------
I0HWG9_RUBGI/8-274--------------------------------------------------------------------------------
Y4OV_RHISN/14-280--------------------------------------------------------------------------------
Q92YY4_RHIME/8-274--------------------------------------------------------------------------------
D5BMI1_PUNMI/9-274--------------------------------------------------------------------------------
E3HW38_ACHXA/8-274--------------------------------------------------------------------------------
I3TKL1_TISMK/9-274--------------------------------------------------------------------------------
J7TQW5_MORMO/8-273--------------------------------------------------------------------------------
Q2RQL8_RHORT/9-274--------------------------------------------------------------------------------
Q89PU9_BRADU/9-274--------------------------------------------------------------------------------
D3VIG2_XENNA/6-272--------------------------------------------------------------------------------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------------------------
L0D8C0_SINAD/27-292--------------------------------------------------------------------------------
Q7UK17_RHOBA/15-279--------------------------------------------------------------------------------
B2ATL3_PODAN/9-281--------------------------------------------------------------------------------
M7SDL1_EUTLA/15-281--------------------------------------------------------------------------------
G9MDH1_HYPVG/9-275--------------------------------------------------------------------------------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------------------------
M1WHF6_CLAP2/9-277--------------------------------------------------------------------------------
M2T3U4_COCSN/9-275--------------------------------------------------------------------------------
C8VLH6_EMENI/9-275--------------------------------------------------------------------------------
E9F7B6_METRA/5-271--------------------------------------------------------------------------------
J4W7A5_BEAB2/10-276--------------------------------------------------------------------------------
F9X0V4_ZYMTI/9-275--------------------------------------------------------------------------------
N1PYG8_DOTSN/9-275--------------------------------------------------------------------------------
B8LW35_TALSN/9-275--------------------------------------------------------------------------------
C5GK37_AJEDR/9-275--------------------------------------------------------------------------------
B8NIT8_ASPFN/9-275--------------------------------------------------------------------------------
S7ZNB6_PENO1/9-275--------------------------------------------------------------------------------
H6C7I3_EXODN/9-275--------------------------------------------------------------------------------
M7TTH7_BOTF1/10-275--------------------------------------------------------------------------------
M2QNQ6_CERS8/9-277--------------------------------------------------------------------------------
F8Q7T4_SERL3/8-272--------------------------------------------------------------------------------
D7SP84_VITVI/487-753--------------------------------------------------------------------------------
K3XVH5_SETIT/468-734--------------------------------------------------------------------------------
D8R7X4_SELML/473-739--------------------------------------------------------------------------------
R9NXA1_PSEHS/13-279--------------------------------------------------------------------------------
U4LH42_PYROM/9-281--------------------------------------------------------------------------------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------------------------
B9L5F1_THERP/10-276--------------------------------------------------------------------------------
I4EWM7_MODMB/6-271--------------------------------------------------------------------------------
C5C4B4_BEUC1/7-272--------------------------------------------------------------------------------
L0DC12_SINAD/11-276--------------------------------------------------------------------------------
B5Y6G1_COPPD/8-273--------------------------------------------------------------------------------
I4BU20_ANAMD/8-273--------------------------------------------------------------------------------
Q5UWI2_HALMA/21-288--------------------------------------------------------------------------------
D2R8M3_PIRSD/8-274--------------------------------------------------------------------------------
G8XHR5_STREN/101-367--------------------------------------------------------------------------------
K7SG60_PROA4/5-271--------------------------------------------------------------------------------
X4REF3_9ACTO/5-271--------------------------------------------------------------------------------
B2A8A0_NATTJ/6-272--------------------------------------------------------------------------------
E4RLZ6_HALHG/7-273--------------------------------------------------------------------------------
Q893M3_CLOTE/7-273--------------------------------------------------------------------------------
H6LDL9_ACEWD/7-273--------------------------------------------------------------------------------
R6I4I1_9ACTN/8-274--------------------------------------------------------------------------------

PF15617

H9TH48_SALET/4-300-------------------------------------------------------------SPWNLGATL-YMPA-----
A0A0H3CW75_ENTCC/4-300-------------------------------------------------------------SPWNLGATL-YMPA-----
A0A023YVC9_ECOLX/4-300-------------------------------------------------------------SPWNLGATL-YMPA-----
A7MPV2_CROS8/4-300-------------------------------------------------------------SPWNLGATL-YMPA-----
B5RKC3_KLEP3/4-300-------------------------------------------------------------TPWELGATL-YMPA-----
D0KLU5_PECWW/4-299-------------------------------------------------------------SPWNLGATL-YMPA-----
B4EW80_PROMH/4-300-------------------------------------------------------------SPWNLGATL-YMPA-----
D3V2D7_XENBS/4-302-------------------------------------------------------------SPHQLGATL-YIPA-----
Q7CKQ7_YERPE/4-300-------------------------------------------------------------SAYALGATL-YMPA-----
E1PL56_PANVC/4-300-------------------------------------------------------------SPFMLGATL-YMPA-----
D3VJW5_XENNA/4-307-------------------------------------------------------------SPHQLGATL-YMPA-----
Q888S8_PSESM/3-297-------------------------------------------------------------SPYALGATL-YMPA-----
Q4ZYA8_PSEU2/3-297-------------------------------------------------------------SPYALGATL-YMPA-----
F3K7E7_PSEAJ/3-297-------------------------------------------------------------SPYALGATL-YMPA-----
Q39AX0_BURL3/4-298-------------------------------------------------------------SPFALGATL-YMPA-----
Q6FAX8_ACIAD/1-291-------------------------------------------------------------SALSLGATL-YIPA-----
A5WBK4_PSYWF/17-339-------------------------------------------------------------HPYQLGASL-YMPA-----
Q4FTQ0_PSYA2/59-368-------------------------------------------------------------HPYQLGASL-YMPA-----
Q5NWT6_AROAE/1-291-------------------------------------------------------------DATELGASL-YLPA-----
D3RPA3_ALLVD/1-291-------------------------------------------------------------DAYRLGGSL-YVPV-----
Q1QCR8_PSYCK/1-315-------------------------------------------------------------HPYQLGASL-YMPA-----
Q3JCD2_NITOC/22-310-------------------------------------------------------------HYMELGATL-YMPA-----
A1VWQ0_POLNA/1-291-------------------------------------------------------------EKKMLGASL-YVPA-----
Q2RVZ6_RHORT/5-292-------------------------------------------------------------A.LRLGASL-YVPA-----
Q9RSA7_DEIRA/8-299-------------------------------------------------------------SPWQLGASL-YAPA-----
D5BYR3_NITHN/21-309-------------------------------------------------------------CYMELGATL-YMPA-----
D8K7I6_NITWC/22-310-------------------------------------------------------------HYMELGATL-YMPA-----
E8U9R3_DEIML/2-291-------------------------------------------------------------FPFALGASL-YIPA-----
A8MM95_ALKOO/30-358-------------------------------------------------------------LAYSLGATL-YMPG-----
Q891X5_CLOTE/30-379-------------------------------------------------------------MQYALGATL-YMPG-----
A8F9P5_BACP2/30-369-------------------------------------------------------------LAHALGSTL-YMPA-----
C9RML9_FIBSS/26-364-------------------------------------------------------------LQYCLGATM-YMPG-----
E3IYR0_FRASU/30-378-------------------------------------------------------------VATALGATL-YAPG-----
Q9KY27_STRCO/30-371-------------------------------------------------------------LSAALGATL-YSPA-----
A0A080UMD5_BACIU/30-361-------------------------------------------------------------LEQALGAVL-YMPA-----
Q5YN23_NOCFA/30-368-------------------------------------------------------------LAIALGATL-YAPA-----
B1HUS4_LYSSC/26-371-------------------------------------------------------------LSYALGATL-YMPA-----
F2JGK5_CELLD/30-375-------------------------------------------------------------LSYALGATL-YIPA-----
Q65NP8_BACLD/30-368-------------------------------------------------------------LEYALGAAL-YVPG-----
D1BEK0_SANKS/30-368-------------------------------------------------------------LAVGLGATL-YSPG-----
D1A9P4_THECD/30-368-------------------------------------------------------------LAVALGATL-YSPA-----
C9ZE12_STRSW/30-371-------------------------------------------------------------LAAALGATL-YSPA-----
F4H5N5_CELFA/32-371-------------------------------------------------------------LAVALGATL-YMPG-----
B7HBK1_BACC4/30-348-------------------------------------------------------------LAYALGATL-YTPG-----
A0A0B5R5V5_BACTU/30-348-------------------------------------------------------------LAYALGATL-YTPG-----
C8W644_DESAS/30-371-------------------------------------------------------------LSYSLGATL-YMPG-----
Q82B97_STRAW/30-370-------------------------------------------------------------LAAALGATL-YSPA-----
Q0SDY5_RHOJR/44-383-------------------------------------------------------------LAVALGATL-YVPA-----
Q72YD0_BACC1/30-348-------------------------------------------------------------LAYALGATL-YTPG-----
C1B1Z6_RHOOB/52-391-------------------------------------------------------------LAVALGATL-YVPA-----
A4J1D5_DESRM/16-360-------------------------------------------------------------LAHALGATL-YMPG-----
C0ZNQ3_RHOE4/41-379-------------------------------------------------------------LAIALGATL-YVPA-----
C0Z9Y5_BREBN/30-378-------------------------------------------------------------LAHALGATL-YMPA-----
Q186J7_PEPD6/30-345-------------------------------------------------------------LKYALGAFL-YVPA-----
E3EE66_PAEPS/10-368-------------------------------------------------------------LAYAIGAAL-YMPA-----
F4D0A7_PSEUX/30-375-------------------------------------------------------------LSVALGATL-YMPG-----
E6UGJ0_RUMA7/26-367-------------------------------------------------------------LQYCLGATM-YMPG-----
D0L8D1_GORB4/35-372-------------------------------------------------------------LALALGATL-YVPG-----
B1VYI2_STRGG/30-395-------------------------------------------------------------LSVALGATL-YSPA-----
C9YLT5_PEPDR/30-345-------------------------------------------------------------LKYALGAFL-YVPA-----
F4EXE4_SELS3/15-331-------------------------------------------------------------LQYKVGGLL-YMPA-----
C8XAU7_NAKMY/30-369-------------------------------------------------------------LAHALGATL-YVPA-----
A8L403_FRASN/30-378-------------------------------------------------------------VATALGATL-YAPG-----
A6WD82_KINRD/30-375-------------------------------------------------------------LAVALGATL-YCPA-----
Q0RDF4_FRAAA/30-378-------------------------------------------------------------LATALGATL-YAPG-----
A2RKY2_LACLM/29-388-------------------------------------------------------------LASSLGASI-YCPL-----
Q2J6S0_FRASC/45-393-------------------------------------------------------------LATALGATL-YAPG-----
E3PRQ7_CLOSD/30-367-------------------------------------------------------------LRYALGATL-YLPA-----

PF03328

Q9RYM1_DEIRA/24-251------------------------------------------------------------------QIGL-WLGL-----
Q8XL94_CLOPE/6-225------------------------------------------------------------------RSMM-FVPG-----
Q9CGA8_LACLA/9-229------------------------------------------------------------------RTMM-FVPG-----
RHMA_ECOLI/19-246------------------------------------------------------------------QIGL-WLSS-----
Q8RDW5_FUSNN/9-227------------------------------------------------------------------RTMM-FLPG-----
GARL_ECOLI/20-246------------------------------------------------------------------QIGC-WSAL-----
Q9KTU0_VIBCH/11-230------------------------------------------------------------------RSML-FVPG-----
Q93167_CAEEL/26-259------------------------------------------------------------------RALL-YVPA-----
Q9HRM8_HALSA/29-241------------------------------------------------------------------RSVL-FSPG-----
O82487_ARATH/90-322------------------------------------------------------------------LYGL-FLLS-----
CITEL_DEIRA/9-223------------------------------------------------------------------RSVL-FAPG-----
BPHF_RHOJR/18-244------------------------------------------------------------------QIGF-WLAL-----
A4XDW8_NOVAD/18-242------------------------------------------------------------------QLGF-WLAL-----
HPCH_KLEP7/15-240------------------------------------------------------------------QIGL-WLGL-----
C0ZQX9_RHOE4/12-226------------------------------------------------------------------RASL-VAPG-----
CITE_ECOLI/15-234------------------------------------------------------------------RSML-FVPG-----
Q4DGT6_TRYCC/18-249------------------------------------------------------------------KFGV-FLNS-----
Q8ZRY2_SALTY/5-223------------------------------------------------------------------RSML-FIPG-----
Q99ZK8_STRP1/6-224------------------------------------------------------------------RTMM-FVPG-----

PF02896

PPDK1_MAIZE/589-947-------------------------------------------------------------MAWVDDVRK-LKVL-----
PT1_STACT/251-543-------------------------------------------------------------ESVTADGHH-VELA-----
PT1_CUPNH/262-557-------------------------------------------------------------PAVTLDGLE-IDLL-----
PT1_ECOLI/250-542-------------------------------------------------------------PAITLDGHQ-VEVC-----
PT1_HAEIN/250-542-------------------------------------------------------------PAITLDGHK-VDVV-----
PT1P_ECOLI/416-708-------------------------------------------------------------PAQLKSGER-IKVM-----
PPSA_PYRFU/496-796-------------------------------------------------------------GAPLVTGTM-VKV.-----
PTFAX_XANCP/521-808-------------------------------------------------------------PAETTDGHH-IDIG-----
PT1_STRMU/252-546-------------------------------------------------------------ETVTADGKH-FELA-----
PTFX2_ECOLI/362-654-------------------------------------------------------------QARTADGIR-IEIA-----
PPSA_STAMF/504-813-------------------------------------------------------------LLPLYPVTA-TKIY-----
D5AMJ7_RHOCB/521-803-------------------------------------------------------------PALTVDGAR-VEVV-----
Q24801_ENTHI/517-878-------------------------------------------------------------LKWANEIKK-IGVF-----
Q5L199_GEOKA/251-541-------------------------------------------------------------PTVTADGVH-VELA-----
Q6MTX2_MYCMS/252-540-------------------------------------------------------------PSLTKDKIK-KLIE-----

PF01274

MASY_EMENI/11-531.............................................................PAPGLVDRR-VEIT-----
MASZ_CORGL/35-713LDSVVPLDGASHADVEKYNITDGKLAAHIGDSVYRLKNRESYRGFTGNFLDPEAILLETNGLHIELQIDP-VHPI-----
MASY_MYXXD/17-538.............................................................LPADLQDRR-VEIT-----
MASZ_ECOLI/17-697DESLPLENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIELQIDA-NGRI-----
Q9RYN3_DEIRA/10-521.............................................................LPDALKDRR-VEIT-----
MASY_MAIZE/16-548.............................................................VPPAVADRT-VEIT-----
MASY_ECOLI/11-533.............................................................IPADLEDRR-VEIT-----
MASZ_MYCLE/17-704DQAVPLASDSWTNATGVSIFDGQLQIAIGTNSTGLASPEKFVGYNRQLRSSNWSVLLANHGLHIEVLIDP-ESPI-----
MASY_YEAST/18-542.............................................................LAPGLINRS-TEIT-----
B5GRN8_STRC2/12-539.............................................................APPALQDRR-VEIT-----
C5MBE7_CANTT/16-539.............................................................LAPGLIDRR-CEIT-----
M4EJ48_BRARP/22-551.............................................................VPPAVADRR-VEIT-----
W1QBI0_OGAPD/27-543.............................................................THPKLQCRK-IEIT-----

PF00224

KPYK_EMENI/32-379-------------------------------------------------------------FRRTSIICT-IGPK.....
KPYM_FELCA/42-395-------------------------------------------------------------ARNTGIICT-IGPA.....
KPYK_HAEIN/5-350-------------------------------------------------------------LRRTKIVCT-MGPS.....
KPYK_YARLI/29-376-------------------------------------------------------------YRKSSIIGT-IGPN.....
KPYC_SOLTU/19-365-------------------------------------------------------------IPKTKIVCT-LGPS.....
KPYR_HUMAN/85-438-------------------------------------------------------------ARSTSIIAT-IGPA.....
KPYK_LACLA/2-375-------------------------------------------------------------NKRVKIVST-LGPAVEIRG
KPYK1_YEAST/18-365-------------------------------------------------------------LRRTSIIGT-IGPK.....
G0RKV7_HYPJQ/42-387-------------------------------------------------------------.RRTSIICT-IGPK.....
Q1GAL0_LACDA/1-345-------------------------------------------------------------MKKTKIVST-LGPA.....
Q5KWB2_GEOKA/3-345-------------------------------------------------------------.RKTKIVCT-IGPA.....

PF14010

CAPPA_METHJ/3-484---------------------------------------------------------------IPRTMSTQHPDN-----
D3S0D1_FERPA/2-476---------------------------------------------------------------VPRVMSTQHPDN-----
CAPPA_HALSA/4-492---------------------------------------------------------------VPRLMSTQHPDN-----
CAPPA_METTH/3-483---------------------------------------------------------------VPRCMSTQHPDN-----
CAPPA_METKA/9-532---------------------------------------------------------------IARTLATQHPD.-----
A8A9C2_IGNH4/3-488---------------------------------------------------------------VPKLMATQHPD.-----
CAPPA_SULTO/4-511---------------------------------------------------------------IPRTMSTQHPDN-----
B1I2W1_DESAP/7-489---------------------------------------------------------------ISRTMSTQHPDN-----
CAPPA_PICTO/6-508---------------------------------------------------------------IPKTMSTQHPDN-----
CAPPA_CALMQ/4-512---------------------------------------------------------------IPRTMCTQHPDY-----
CAPPA_METS5/4-509---------------------------------------------------------------IPRTMSTQHPDN-----
CAPPA_ARCFU/2-471---------------------------------------------------------------VPRVMSTQHPDN-----
CAPPA_PYRAE/3-460---------------------------------------------------------------IPCLMCTQHPD.-----
CAPPA_SULAC/4-511---------------------------------------------------------------IPRTMSTQHPDN-----
J9ZD85_LEPFM/19-520---------------------------------------------------------------IPTTMATQHPDN-----
CAPPA_CLOPE/3-537---------------------------------------------------------------IPCSMMTQHPDN-----
CAPPA_SULSO/4-511---------------------------------------------------------------IPRTMSTQHPDN-----

PF00311

C7M9P2_BRAFD/148-942-------------------------------------------------------------SLDVRLVFTAHPTE-----
CAPP_ACTP2/128-879-------------------------------------------------------------KLSIELVLTAHPTE-----
A0ZJ69_NODSP/196-1034-------------------------------------------------------------HLDVRLVFTAHPTE-----
D3VH32_XENNA/127-879-------------------------------------------------------------ELAIELVLTAHPTE-----
Q2KZS8_BORA1/137-936-------------------------------------------------------------EACVMPVLTAHPTE-----
D2QW47_PIRSD/157-942-------------------------------------------------------------KMLIELVFTAHPSE-----
A5GVT4_SYNR3/167-992-------------------------------------------------------------ELDVRLVFTAHPTE-----
C6D470_PAESJ/147-936-------------------------------------------------------------NISLELVMTAHPTE-----
B8HVC9_CYAP4/199-1018-------------------------------------------------------------QLDIKLVFTAHPTE-----
C1F4Y2_ACIC5/161-947-------------------------------------------------------------RIFVVPVFTAHPTE-----
CAPP_SYNY3/193-1034-------------------------------------------------------------HLDIRLVITAHPTE-----
B1XMB9_SYNP2/163-995-------------------------------------------------------------QLDIRLVFTAHPTE-----
A4S610_OSTLU/183-1007-------------------------------------------------------------VQHVDLVLTAHPTQ-----
A9RUR8_PHYPA/162-969-------------------------------------------------------------EQTVDLVFTAHPTQ-----
B8GNA5_THISH/143-947-------------------------------------------------------------QLAYVPVFTAHPTE-----
CAPP_HAHCH/132-881-------------------------------------------------------------DLNLEFVLTAHPTE-----
B1Y159_LEPCP/163-950-------------------------------------------------------------HAYISPVLTAHPTE-----
CAPP_THEEB/197-1011-------------------------------------------------------------QLDIKLVFTAHPTE-----
A9S2G6_PHYPA/161-965-------------------------------------------------------------HQTVDLVLTAHPTQ-----
Q54JZ3_DICDI/144-931-------------------------------------------------------------QQKIELVLTAHPTQ-----
C1MJ77_MICPC/164-991-------------------------------------------------------------EQEVDLVFTAHPTQ-----
E0UJ33_CYAP2/184-1020-------------------------------------------------------------QLDVRLVFTAHPTE-----
A5WCX5_PSYWF/133-932-------------------------------------------------------------QLKFIPVFTAHPTE-----
A0JSJ3_ARTS2/161-954-------------------------------------------------------------ELDVRPIFTAHPTE-----
B7G725_PHATC/84-877-------------------------------------------------------------KQKVEIVLTAHPTQ-----
CAPP_GLOVI/141-939-------------------------------------------------------------QLDVRLVFTAHPTE-----
C5Z450_SORBI/157-961-------------------------------------------------------------NQSVDLVFTAHPTQ-----
D1CE74_THET1/138-931-------------------------------------------------------------RLRARFVFTAHPTE-----
Q117S5_TRIEI/186-1038-------------------------------------------------------------NLDIRLVFTAHPTE-----
C1AE63_GEMAT/147-933-------------------------------------------------------------SALVSPVLTAHPTE-----
A9QPD2_METI4/151-931-------------------------------------------------------------KMEIVLVFTAHPTE-----
B0BZ90_ACAM1/184-1012-------------------------------------------------------------NLDIQLVFTAHPTE-----
A4X3B0_SALTO/171-972-------------------------------------------------------------RLAIRPVFTAHPTE-----
E3JCU0_FRASU/173-968-------------------------------------------------------------RLELRPVFTAHPTE-----
Q2JKJ2_SYNJB/177-978-------------------------------------------------------------QLHIRMVFTAHPTE-----
A9IDM8_BORPD/139-951-------------------------------------------------------------EARVVPVLTAHPTE-----
A4G3V1_HERAR/147-944-------------------------------------------------------------DALISPVLTAHPTE-----
C1DZM5_MICSR/162-982-------------------------------------------------------------EQEVDLVLTAHPTQ-----
D3EKG0_GEOS4/142-928-------------------------------------------------------------SLSLELVMTAHPTE-----
B1VUI2_STRGG/125-909-------------------------------------------------------------NLNVRPVFTAHPTE-----
CAPP_SYNPW/180-1003-------------------------------------------------------------ELDIRLVFTAHPTE-----
B0JPY0_MICAN/183-1018-------------------------------------------------------------QLDIRLVFTAHPTE-----
B1WNZ1_CYAA5/187-1020-------------------------------------------------------------QLDIRLVFTAHPTE-----
C8WQK0_ALIAD/133-906-------------------------------------------------------------..GIELVLTAHPTE-----
D4ZQG2_ARTPN/196-1035-------------------------------------------------------------QLDIRLVFTAHPTE-----
M1FKU6_9ALTE/130-889-------------------------------------------------------------.LRVEFVLTAHPTE-----
CAPP_ECOLI/129-883-------------------------------------------------------------.LSLELVLTAHPTE-----
CAPP_HAEIN/129-879-------------------------------------------------------------.LLIELVLTAHPTE-----
Q0K7M4_CUPNH/207-1012-------------------------------------------------------------..LIVPVLTAHPTE-----
Q31KY7_SYNE7/201-1017-------------------------------------------------------------.LDIRLVFTAHPTE-----
Q46IP1_PROMT/168-994-------------------------------------------------------------EMDIRLVFTAHPTE-----
CAPP_PROMP/165-989-------------------------------------------------------------EMDIRLVFTAHPTE-----
CAPP_VIBPA/129-877-------------------------------------------------------------.LNIELVLTAHPTE-----
CAPP_SHEON/129-881-------------------------------------------------------------.LDIDLVLTAHPTE-----
U5GXD4_POPTR/166-968-------------------------------------------------------------.QTVELVFTAHPTQ-----

PF00463

ACEA_EMENI/14-536---------------------------------------------------------------EVAAVKNWWK-------
ACEA_YEAST/22-550---------------------------------------------------------------DAAEIEKWWS-------
ACEA1_SOYBN/3-534---------------------------------------------------------------EVAEVQAWWN-------
ACEA_YARLI/10-536---------------------------------------------------------------EVEEIKKWWS-------
ACEA_NEUCR/23-547---------------------------------------------------------------EVEEVKKWWS-------
C5MF59_CANTT/18-543---------------------------------------------------------------EVAEIKKWWS-------

PF13714

A0JTC7_ARTS2/12-246-------------------------------------------------------------------LLR.LH..-----
A0K276_ARTS2/27-270-------------------------------------------------------------------FHA.LH..-----
A0QPJ7_MYCS2/16-251-------------------------------------------------------------------LLA.LH..-----
A0R0I0_MYCS2/10-256-------------------------------------------------------------------FAERLH..-----
A1CA54_ASPCL/14-274-------------------------------------------------------------------LCR.LH..-----
A1SIA9_NOCSJ/3-233-------------------------------------------------------------------FRA.LH..-----
A4F7M3_SACEN/8-232-------------------------------------------------------------------FRA.LH..-----
A4FH54_SACEN/26-273-------------------------------------------------------------------LRD.LH..-----
A4X5C0_SALTO/32-264-------------------------------------------------------------------FRS.LH..-----
A4X7L5_SALTO/4-223-------------------------------------------------------------------FAA.LH..-----
A4XS21_PSEMY/12-254-------------------------------------------------------------------FQA.LH..-----
A4YVZ4_BRASO/12-249-------------------------------------------------------------------FRK.LH..-----
A5G4A7_GEOUR/12-254-------------------------------------------------------------------FLR.LH..-----
A5V3Q4_SPHWW/10-252-------------------------------------------------------------------FSK.LH..-----
A9WM41_RENSM/9-245-------------------------------------------------------------------FRS.LH..-----
B1VSN1_STRGG/14-249-------------------------------------------------------------------LKH.LH..-----
B4RBF1_PHEZH/10-242-------------------------------------------------------------------FRK.LH..-----
B5HHA0_STRPR/15-253-------------------------------------------------------------------LRE.LH..-----
B5HRK0_9ACTN/12-259-------------------------------------------------------------------FAE.LH..-----
B5HVC7_9ACTN/7-239-------------------------------------------------------------------FRA.LHRG-----
B6HSS2_PENRW/11-259-------------------------------------------------------------------FRA.LH..-----
B8MDA8_TALSN/5-285-------------------------------------------------------------------IKSVLK..-----
B9JNZ3_AGRRK/15-273-------------------------------------------------------------------LRALLE..-----
B9K4D9_AGRVS/8-247-------------------------------------------------------------------FRQ.LH..-----
C1D0L9_DEIDV/16-251-------------------------------------------------------------------LLD.LH..-----
D5UDN5_CELFN/12-253-------------------------------------------------------------------LRS.FH..-----
C5C673_BEUC1/6-244-------------------------------------------------------------------FRR.RH..-----
C5K5X0_PERM5/22-289-------------------------------------------------------------------LRQLIN..-----
D9SPL5_CLOC7/7-255-------------------------------------------------------------------LKKLLN..-----
C6W6H2_DYAFD/19-261-------------------------------------------------------------------LKK.LH..-----
C7Q1F2_CATAD/16-252-------------------------------------------------------------------FAS.LH..-----
C7YUL0_NECH7/9-264-------------------------------------------------------------------LKA.LH..-----
C7YZU2_NECH7/391-674-------------------------------------------------------------------IRAAFK..-----
D6Z4R6_DESAT/153-411-------------------------------------------------------------------LRRLID..-----
C9SRU6_VERA1/11-259-------------------------------------------------------------------LKA.LH..-----
D1A2J0_THECD/5-232-------------------------------------------------------------------FGE.LH..-----
D1BED0_SANKS/11-246-------------------------------------------------------------------FAS.LH..-----
D1BI43_SANKS/12-247-------------------------------------------------------------------FRS.LH..-----
D9TER7_MICAI/8-239-------------------------------------------------------------------FRE.LH..-----
E3J806_FRASU/10-249-------------------------------------------------------------------FLA.LH..-----
D2B1P9_STRRD/6-236-------------------------------------------------------------------FRA.LH..-----
E3I6J4_RHOVT/30-272-------------------------------------------------------------------FRKRLQ..-----
D2PR97_KRIFD/29-269-------------------------------------------------------------------LRA.LH..-----
D2Q3B1_KRIFD/7-234-------------------------------------------------------------------FRA.LH..-----
D2Q4L3_KRIFD/4-243-------------------------------------------------------------------FRD.LH..-----
D3EII1_GEOS4/13-252-------------------------------------------------------------------FKK.LH..-----
D3V3K7_XENBS/39-278-------------------------------------------------------------------FRQ.LH..-----
D4AZN8_ARTBC/10-268-------------------------------------------------------------------LRS.LH..-----
D4LCE5_RUMC1/6-261-------------------------------------------------------------------LGSLLK..-----
Q01YZ5_SOLUE/12-251-------------------------------------------------------------------FRA.LH..-----
Q08U27_STIAD/11-246-------------------------------------------------------------------FRA.LH..-----
Q0BYP5_HYPNA/11-255-------------------------------------------------------------------FAS.LH..-----
Q0RPX9_FRAAA/13-247-------------------------------------------------------------------FRE.LH..-----
Q12Q29_SHEDO/14-259-------------------------------------------------------------------LKDILL..-----
Q1GKC0_RUEST/10-253-------------------------------------------------------------------FAA.LH..-----
Q1GQT2_SPHAL/9-246-------------------------------------------------------------------FRA.LH..-----
Q28RZ5_JANSC/10-249-------------------------------------------------------------------FAR.LH..-----
Q2JAX2_FRASC/15-255-------------------------------------------------------------------FRE.LH..-----
Q4DNR3_TRYCC/14-261-------------------------------------------------------------------LKSMLR..-----
Q4KET5_PSEF5/11-270-------------------------------------------------------------------LSQLLR..-----
Q5E5F2_VIBF1/18-278-------------------------------------------------------------------LINVIK..-----
Q5LNA0_RUEPO/10-253-------------------------------------------------------------------FAA.LH..-----
Q5LUG9_RUEPO/10-245-------------------------------------------------------------------FRT.LH..-----
Q5WBL4_BACSK/19-257-------------------------------------------------------------------FRC.LH..-----
Q65ND9_BACLD/10-248-------------------------------------------------------------------FLD.LH..-----
Q7NXV8_CHRVO/33-277-------------------------------------------------------------------FRR.LH..-----
Q7P124_CHRVO/3-243-------------------------------------------------------------------FAQ.LH..-----
Q893V9_CLOTE/153-411-------------------------------------------------------------------LRQLLK..-----
Q8EI00_SHEON/9-240-------------------------------------------------------------------FKA.LH..-----
A6TFP2_KLEP7/3-236-------------------------------------------------------------------FNA.LH..-----
G2J0B0_PSEUL/10-251-------------------------------------------------------------------FKE.LH..-----
G8PVS4_PSEUV/10-253-------------------------------------------------------------------FAA.LH..-----
D4GMW6_PANAM/3-261-------------------------------------------------------------------.KK.LI..-----
Y1998_MYCTU/3-229-------------------------------------------------------------------FHD.LH..-----
Q2IK57_ANADE/11-247-------------------------------------------------------------------FRA.LH..-----
Q2KD40_RHIEC/10-252-------------------------------------------------------------------FGA.LH..-----
Q63MP0_BURPS/20-277-------------------------------------------------------------------FKEKLA..-----
Q8F693_LEPIN/12-250-------------------------------------------------------------------FRS.LH..-----
Q8YAP2_LISMO/8-250-------------------------------------------------------------------LKS.LH..-----
Q98AR7_RHILO/15-259-------------------------------------------------------------------.RR.MI..-----
R5T8T3_9CLOT/12-269-------------------------------------------------------------------........-----
R5TTB9_9CLOT/13-246-------------------------------------------------------------------........-----

PF02548

C8XKD1_NAKMY/14-272-------------------------------------------------------------.IAIPDLFE-LK-------
A7HMC7_FERNB/3-256-------------------------------------------------------------..NTKKIID-MK-------
PANB_NITMU/2-259-------------------------------------------------------------RITQDVFQK-MR-------
E3I2N4_RHOVT/9-264-------------------------------------------------------------RVTAPDIRA-KK-------
PANB_THEFY/18-275-------------------------------------------------------------RVTVQDLAA-AK-------
F0NZT0_WEEVC/9-267-------------------------------------------------------------RITTETIRK-MK-------
C5DYQ5_ZYGRC/31-296-------------------------------------------------------------SNTIQSLHE-KY-------
D8RYD4_SELML/4-266-------------------------------------------------------------KVTMRYLQS-KY-------
S9W2M7_SCHCR/5-262-------------------------------------------------------------PITTSVLRQ-WK-------
D2PXN9_KRIFD/534-791-------------------------------------------------------------KYRIHHLRD-LK-------
H1Z987_MYROD/10-268-------------------------------------------------------------KVTTKSLID-MK-------
C5BN63_TERTT/12-267-------------------------------------------------------------SVSIKTLQA-MK-------
A8LKB6_DINSH/13-268-------------------------------------------------------------RLTVPQIAA-RK-------
D7BNG1_ARCHD/5-260-------------------------------------------------------------RVRAHHLAQ-MK-------
D7A714_STAND/9-264-------------------------------------------------------------RLTAPDIRA-KK-------
PANB_BORPD/9-265-------------------------------------------------------------RKTTTAIRQ-AK-------
PANB_MAGSA/9-265-------------------------------------------------------------RITTRDIRA-RK-------
E8RFZ1_DESPD/5-262-------------------------------------------------------------KLTIPDLRN-RK-------
PANB_PROMA/4-255-------------------------------------------------------------....KELVR-FK-------
K9RVA1_SYNP3/11-268-------------------------------------------------------------PVTIPQLQH-WK-------
D5WZ20_THIK1/22-279-------------------------------------------------------------PLTLHRLRA-MR-------
B8LYN4_TALSN/78-338-------------------------------------------------------------PVTISTLRN-MY-------
K9RDA0_9CYAN/11-264-------------------------------------------------------------AITIQKLIQ-YK-------
PANB_METRJ/10-267-------------------------------------------------------------.LRAIDIGK-RK-------
A9UP51_MONBE/1-268-------------------------------------------------------------.VTMNKLKR-KR-------
PANB_PROA2/11-273-------------------------------------------------------------HVTTRRLHD-MK-------
F2UAL1_SALR5/62-329-------------------------------------------------------------.VTIPSIHA-AY-------
V2XXG0_MONRO/40-299-------------------------------------------------------------KVTIDTLQA-MK-------
G2IQV3_9SPHN/23-282-------------------------------------------------------------RLTIPALRA-RK-------
PANB_CLONN/2-260-------------------------------------------------------------KNTVTTFQK-AK-------
PANB_WIGBR/3-260-------------------------------------------------------------KTNIYDLYK-LK-------
M1FDT2_9ALTE/4-264-------------------------------------------------------------KVTIPRLQQ-MK-------
E4TII1_CALNY/9-264-------------------------------------------------------------KVTVNQIKN-MK-------
K0I9Q1_NITGG/2-255-------------------------------------------------------------..SVNDIVA-MK-------
C7MD29_BRAFD/11-267-------------------------------------------------------------KIRLRHLQQ-AK-------
G8PQN3_PSEUV/9-264-------------------------------------------------------------RKTIKDIMK-AK-------
PANB_LEPCP/16-279-------------------------------------------------------------PLTLPALRA-MQ-------
K1VYW4_TRIAC/1535-1794-------------------------------------------------------------KLTVGALQK-QY-------
B8I2Z4_CLOCE/9-266-------------------------------------------------------------KNTAASIQN-QK-------
I0AFM0_IGNAJ/3-258-------------------------------------------------------------..SILEFQK-KK-------
I4CAV2_DESTA/3-261-------------------------------------------------------------KITIQTLRE-KK-------
PANB_SULDN/4-259-------------------------------------------------------------KMTITSIKK-SK-------
S8DNJ0_FOMPI/15-274-------------------------------------------------------------KITIQHLHA-MK-------
PANB_METCA/5-260-------------------------------------------------------------.VTLPDLLA-MK-------
F3YUG3_DESAF/5-260-------------------------------------------------------------.LTAPDIAS-RK-------
PANB_SYNAS/9-267-------------------------------------------------------------KITTSVIRG-MK-------
C7LVL7_DESBD/2-259-------------------------------------------------------------.KTISDFLQ-MK-------
PANB_NOCSJ/34-291-------------------------------------------------------------RIRTHHLRE-MK-------
F0SK13_RUBBR/3-257-------------------------------------------------------------QMTVPRFVA-AK-------
I0DRD2_PROSM/4-258-------------------------------------------------------------.ISLATLGQ-FK-------
D3E7N3_GEOS4/7-265-------------------------------------------------------------.LNIVKLKN-MK-------
G7EAQ5_MIXOS/98-357-------------------------------------------------------------KVTLLDIAK-AK-------
R7GY01_9FIRM/2-260-------------------------------------------------------------KNTIATLQQ-QK-------
U9SMK5_RHIID/19-277-------------------------------------------------------------KVTINTIQK-LY-------
R5GD14_9BACT/11-269-------------------------------------------------------------KVTTLRLKE-MK-------
R1GLQ8_BOTPV/11-271-------------------------------------------------------------KVTLNTLHS-LH-------
PANB_DESAH/4-258-------------------------------------------------------------RVTTTTLFK-MK-------
PANB_DEIDV/5-258-------------------------------------------------------------...IPELLQ-SE-------
S6CEI7_9ACTN/2-260-------------------------------------------------------------SVTVSTFLK-MK-------
R5KEY8_9CLOT/2-260-------------------------------------------------------------KNTVVTFQK-AK-------
K0SSA9_THAOC/101-366-------------------------------------------------------------KVTTLTIRA-KK-------
C6XKS3_HIRBI/9-264-------------------------------------------------------------RKTVRDIAK-AK-------
J9QSS2_RIEAN/9-267-------------------------------------------------------------KVTTEVLRK-MK-------
S6BYU9_9GAMM/3-260-------------------------------------------------------------KITITTLER-MK-------
D0KZU6_HALNC/20-275-------------------------------------------------------------.KTLTTLQN-AK-------
W6RP24_9RHIZ/9-265-------------------------------------------------------------RLTTASIRA-MK-------
G0W8X4_NAUDC/30-294-------------------------------------------------------------.TTILDIQS-KR-------
E5AM95_BURRH/11-268-------------------------------------------------------------AVTVPRLQQ-MR-------
I3TFJ1_THEC1/4-259-------------------------------------------------------------KVTVRDIIK-KK-------
PANB_GRABC/9-265-------------------------------------------------------------RISVPALRA-RK-------
G0GCR3_SPITZ/2-257-------------------------------------------------------------..NVRSFLA-RK-------
G1XV43_ARTOA/82-342-------------------------------------------------------------KVTINTIRK-MY-------
D9Q2W0_ACIS3/6-261-------------------------------------------------------------KVTVRKIVN-LK-------
B1ZVH1_OPITP/3-258-------------------------------------------------------------..TIRDLAA-AK-------
R7EXA6_9BACT/11-269-------------------------------------------------------------KVTTRRLVE-MK-------
F6B538_DESCC/4-262-------------------------------------------------------------RVTTADFRR-MK-------
D5UZ54_ARCNC/10-265-------------------------------------------------------------KMNINKIKK-AK-------
U1GVM1_ENDPU/59-319-------------------------------------------------------------PVTIQTIRD-LH-------
G2QRB2_THITE/68-328-------------------------------------------------------------KVTIGTLRA-LY-------
B7FR45_PHATC/3-276-------------------------------------------------------------KVSALSLTS-KR-------
PANB_THEEB/5-261-------------------------------------------------------------SVTLPQLQA-KK-------
R7D6U7_9ACTN/3-263-------------------------------------------------------------KNTVLTLKK-KV-------
E3GPR0_EUBLK/2-261-------------------------------------------------------------KKSIIDFRR-MA-------
C1DI17_AZOVD/17-274-------------------------------------------------------------RVRIPYLKE-LK-------
A5VB06_SPHWW/22-276-------------------------------------------------------------RLTVPAIRA-AK-------
A4CLQ4_ROBBH/10-268-------------------------------------------------------------RVTVRSLVE-MK-------
D5BTJ5_PUNMI/4-260-------------------------------------------------------------KMTVDTFTA-LK-------
C9RK32_FIBSS/3-246-------------------------------------------------------------..TPEDIKA-KK-------
C4LHZ4_CORK4/17-275-------------------------------------------------------------KTRIHHLDQ-FK-------
W8KF56_HALHR/9-265-------------------------------------------------------------RLTLRDLQG-LR-------
G7V5R4_THELD/5-262-------------------------------------------------------------.LSIPDFMR-MK-------
I3ZIP5_TERRK/17-275-------------------------------------------------------------KVTPQTLLQ-SK-------
S6AIG3_9PROT/2-259-------------------------------------------------------------RVTLSNLQK-MA-------
F3ZPG7_9BACE/11-269-------------------------------------------------------------KVTTHHLAE-MK-------
PANB_AQUAE/2-260-------------------------------------------------------------AINLQTLFK-KK-------
R7ALC5_9ACTN/29-287-------------------------------------------------------------KNTVATFQE-MK-------
U5N9B5_9BURK/27-288-------------------------------------------------------------.FTLPRLRE-MH-------
C6BVH5_DESAD/3-260-------------------------------------------------------------KVTAPDITA-.L-------
C5KFU4_PERM5/79-341-------------------------------------------------------------KITLTQIKK-LH-------
U5T1Y9_9GAMM/5-261-------------------------------------------------------------.VTLATLRR-MK-------
F4H271_CELFA/7-264-------------------------------------------------------------RVRVHHLRE-AK-------
F8AZ74_FRADG/51-306-------------------------------------------------------------RTTVRELQA-AK-------
E4NQR1_HALBP/4-256-------------------------------------------------------------...VRDVRE-K.-------
C6VWE8_DYAFD/10-268-------------------------------------------------------------RITTHVIQE-MK-------
R5KSN9_9FIRM/2-260-------------------------------------------------------------KNTVNTLLQ-QK-------
PANB_NATPD/3-255-------------------------------------------------------------...AKDIRA-K.-------
L0IYN2_MYCSM/17-274-------------------------------------------------------------KVRTHHLQK-WK-------
PANB_CLOTH/4-262-------------------------------------------------------------KFTTASFLE-SK-------
PANB_SPHAL/26-281-------------------------------------------------------------RLTVPRIRQ-RK-------
I0A221_FERFK/7-263-------------------------------------------------------------KITMRKFIK-KK-------
T2GAB0_DESGI/5-261-------------------------------------------------------------.QTARSVSA-RK-------
C6WXZ0_METML/2-266-------------------------------------------------------------..TLPKLHE-MA-------
F2IID2_FLUTR/9-267-------------------------------------------------------------RVTTNVLQE-MK-------
D5BNG2_PUNMI/9-267-------------------------------------------------------------KVTYKTLLK-KM-------
PANB_ARTAT/40-297-------------------------------------------------------------RVRIHHLQQ-AK-------
PANB_CARHZ/3-261-------------------------------------------------------------RVTVSSLKE-MK-------
A4G8C6_HERAR/16-272-------------------------------------------------------------AVTVPALFA-LR-------
E1QUY6_VULDI/5-260-------------------------------------------------------------KVTVQTIMS-MK-------
PANB_METFK/3-256-------------------------------------------------------------...LLTLQQ-MK-------
PANB_CHESB/10-264-------------------------------------------------------------.FTPPDIAK-AK-------
B6GXN5_PENRW/75-335-------------------------------------------------------------KVTIQTLQN-MH-------
I0GU87_SELRL/2-260-------------------------------------------------------------KNTVATFAK-MK-------
R9AIM6_WALI9/451-714-------------------------------------------------------------KVTISSLNK-LK-------
R5BQ58_9FIRM/5-264-------------------------------------------------------------PKTITTIKQ-MK-------
F8AC68_THEID/6-263-------------------------------------------------------------KITVPELIA-KK-------
PANB_ALKEH/12-269-------------------------------------------------------------PVTVGRLQR-MK-------
F8E6G1_FLESM/9-265-------------------------------------------------------------KITVSHFKK-MK-------
PANB_BORPE/9-264-------------------------------------------------------------RITTRQLRM-RT-------
E1VL92_9GAMM/2-258-------------------------------------------------------------AVTLSTINK-IK-------
R6CEN3_9FIRM/2-260-------------------------------------------------------------KNTAATLMS-QK-------
PANB_LEPBP/4-261-------------------------------------------------------------..IILQYKK-KY-------
D5MI67_9BACT/6-263-------------------------------------------------------------.VRTVTLQQ-MK-------
G0EFC1_PYRF1/3-258-------------------------------------------------------------RISVRDILA-KK-------
PANB_EXIS2/3-258-------------------------------------------------------------..TMTPLLK-KQ-------
I4BB70_TURPD/157-414-------------------------------------------------------------.MNIHDFTK-KK-------
PANB_MARHV/2-258-------------------------------------------------------------AVTINTLRE-YK-------
D8J2A6_HALJB/4-255-------------------------------------------------------------...VADIR.-..-------
PANB_IGNH4/3-259-------------------------------------------------------------KVTIRDIMK-KY-------
G4RJI6_THETK/5-260-------------------------------------------------------------KITVQTFLN-MK-------
K8GUE9_9CYAN/2-256-------------------------------------------------------------PVTTQQIVQ-WK-------
W6SJ04_9CLOT/2-259-------------------------------------------------------------KNTSATFIE-MK-------
D9SXD7_CLOC7/2-260-------------------------------------------------------------KNTVITFKE-MK-------
W5W0X3_9PSEU/35-292-------------------------------------------------------------RVRIHHLQE-LK-------
F7V601_CLOSS/2-260-------------------------------------------------------------SKTLNTFRK-MK-------
PANB_SYNE7/2-256-------------------------------------------------------------PITPRHLRQ-WK-------
I2GYS6_TETBL/22-285-------------------------------------------------------------.LTIPDLLR-KY-------
F2N7R6_CORGP/2-260-------------------------------------------------------------KTTVTTFQQ-AK-------
PANB_SODGM/2-257-------------------------------------------------------------.TTISHLRK-WK-------
PANB_MYXXD/4-262-------------------------------------------------------------KVTIHTLKR-FK-------
W0JJ73_DESAE/2-258-------------------------------------------------------------KMTVPKFVS-MK-------
PANB_SALRD/3-261-------------------------------------------------------------RVTTKTVQE-MK-------
H1XSD8_9BACT/9-267-------------------------------------------------------------RITVPVIKR-MK-------
K4KI34_SIMAS/15-270-------------------------------------------------------------AVTVNTLRK-MK-------
PANB_PHEZH/11-266-------------------------------------------------------------RIAAPDIAA-RK-------
C1F8U4_ACIC5/19-277-------------------------------------------------------------KVTLATLQE-KK-------
PANB_BDEBA/2-258-------------------------------------------------------------.KTILDFHD-KK-------
PANB_PSELT/2-257-------------------------------------------------------------..NVNKFKS-MK-------
PANB_POLSJ/34-294-------------------------------------------------------------.LSLPRLRE-MH-------
G0A0M7_METMM/10-265-------------------------------------------------------------TLSIADLRA-MK-------
E3E4R6_PAEPS/7-265-------------------------------------------------------------.LNIVKMRK-MK-------
R7P8R5_9BACT/11-269-------------------------------------------------------------KVTTHRLQE-MK-------
G8QNM1_DECSP/9-266-------------------------------------------------------------RLTITDMAK-LK-------
V6JZL1_STRNV/26-283-------------------------------------------------------------RVTVHDIAA-AK-------
F4GUY4_PUSST/9-264-------------------------------------------------------------RISVPQLMQ-YK-------
R7C4Y8_9BURK/5-261-------------------------------------------------------------..KVTDFAR-MK-------
R6EWT4_9BACT/11-269-------------------------------------------------------------KVTAPLFFE-MK-------
PANB_PSYA2/2-261-------------------------------------------------------------.TTLSTLNK-FK-------
E6UF09_RUMA7/2-260-------------------------------------------------------------KNTVSTLLK-QK-------
PANB_PROMM/4-256-------------------------------------------------------------....SELTQ-LK-------
F8GE64_NITSI/2-259-------------------------------------------------------------RITQTTLQK-ML-------
G8YQ94_PICSO/33-293-------------------------------------------------------------RYSIADIQE-LH-------
R6EER5_9BACT/10-268-------------------------------------------------------------KVTVKTFAE-MK-------
R6MV46_9FIRM/2-260-------------------------------------------------------------KKTVTTFAK-AK-------
E1ZCJ6_CHLVA/23-287-------------------------------------------------------------RVTLRTLRD-KY-------
PANB_NITSB/4-255-------------------------------------------------------------RHTVNTIKS-AK-------
M4VAT0_9DELT/3-258-------------------------------------------------------------..SILDFQK-RK-------
C4XU18_DESMR/3-260-------------------------------------------------------------RTTAPDVAA-AK-------
J9ZD86_LEPFM/6-263-------------------------------------------------------------.MTIDQFPI-RK-------
L0K4F1_HALHC/4-262-------------------------------------------------------------QVTIKTLQQ-KK-------
E6WZE1_NITSE/11-266-------------------------------------------------------------KVTVRTVQK-LK-------
R7IQM6_9FIRM/7-262-------------------------------------------------------------...AVTFKN-AK-------
R5JJK8_9FIRM/2-260-------------------------------------------------------------KNTTTTIKA-QK-------
F8DZN0_CORRG/23-280-------------------------------------------------------------QVRISDFHR-YK-------
I4D5R2_DESAJ/3-259-------------------------------------------------------------..STKDFLE-MK-------
PANB_LEIXX/16-273-------------------------------------------------------------RVRTRHFQA-AK-------
E4U2F8_SULKY/3-258-------------------------------------------------------------KLSIGSILK-RK-------
PANB_NITMS/2-259-------------------------------------------------------------HKSVQDIVN-MK-------
PANB1_PSEAE/9-265-------------------------------------------------------------RLSVPDIQR-RK-------
G8BMS9_TETPH/44-308-------------------------------------------------------------.KTILDIQR-KY-------
R5V6Z6_9FIRM/2-260-------------------------------------------------------------KNTVVTFQE-AK-------
R5U793_9BACE/11-269-------------------------------------------------------------KVTTHRLVE-MK-------
F6CMZ4_DESK7/5-263-------------------------------------------------------------QVTTAYFRE-AK-------
B9L8Y5_NAUPA/4-254-------------------------------------------------------------..TLKTLYK-K.-------
PANB_DESPS/2-260-------------------------------------------------------------RKTVVDIIA-MK-------
L0F2P8_DESDL/3-259-------------------------------------------------------------..TTTDFLA-MK-------
K9Y6F0_HALP7/3-258-------------------------------------------------------------.VTTAQLLK-WK-------
PANB_NITEU/8-264-------------------------------------------------------------RMTITTLQN-AC-------
M5C834_THACB/15-272-------------------------------------------------------------KVTIQKLHA-LK-------
T2KQ61_9FLAO/10-268-------------------------------------------------------------KVTVKTLSD-MK-------
I1NLG6_ORYGL/83-346-------------------------------------------------------------RVTLATLRG-KH-------
E6TZJ1_BACCJ/3-259-------------------------------------------------------------..TTTDFFN-MK-------
K0B4S7_CLOA9/4-262-------------------------------------------------------------KFTVNSFLE-SK-------
R6VBN9_9CLOT/2-260-------------------------------------------------------------KNTIITFKQ-SK-------
G4QJL3_GLANF/3-259-------------------------------------------------------------KVTTSTLMQ-LK-------
PANB_RHOBA/10-264-------------------------------------------------------------RITTRTLQR-MR-------
R5DYA6_9BURK/9-266-------------------------------------------------------------PVRLSTIKK-MY-------
PANB_RHORT/10-268-------------------------------------------------------------RLTVRDIAS-RK-------
A5DVU0_LODEL/36-294-------------------------------------------------------------KKTISYIQN-LY-------
B6JWN4_SCHJY/27-297-------------------------------------------------------------..TVRSIRK-LY-------
PANB_CORGL/8-265-------------------------------------------------------------KIRTRHFRE-AK-------
PANB_RALSO/12-268-------------------------------------------------------------AVTVTSLQG-MR-------
R6LXN4_9CLOT/2-260-------------------------------------------------------------KNTVRTFQM-AK-------
PANB_MOOTA/6-264-------------------------------------------------------------RVTLPQLQA-MK-------
F2F6S0_SOLSS/3-258-------------------------------------------------------------..TTAQFLK-MK-------
PANB_AZOSB/9-267-------------------------------------------------------------PVTLFELGK-MR-------
D3SC34_THISK/3-258-------------------------------------------------------------PITVNTLAR-RK-------
D4H852_DENA2/9-265-------------------------------------------------------------KINLNTFKK-MK-------
H6L4G9_SAPGL/9-267-------------------------------------------------------------KVTTHVLHA-MK-------
R6DPQ8_9CLOT/2-260-------------------------------------------------------------KKTVSTLQQ-AK-------
N0B212_9BACI/3-259-------------------------------------------------------------..QTTNFLK-MK-------
R7K0E3_9CLOT/2-260-------------------------------------------------------------KNTVQTWRQ-AK-------
Q6BIM6_DEBHA/33-293-------------------------------------------------------------RKTLLDIQR-LY-------
K0KXD0_WICCF/32-290-------------------------------------------------------------RKSLNDIRQ-LY-------
E8RS63_ASTEC/11-266-------------------------------------------------------------RLTAPEIYA-RK-------
F9X8W4_ZYMTI/67-327-------------------------------------------------------------KITLQTLQA-MY-------
A4XA35_SALTO/20-277-------------------------------------------------------------RVRARDLLA-AK-------
D5U1C4_THEAM/4-259-------------------------------------------------------------KVNVKTIMK-MK-------
T0ULG9_9STRE/2-260-------------------------------------------------------------KNTVLSFQK-AK-------
PANB_ALTMD/3-259-------------------------------------------------------------KVTVSGLLK-KK-------
I0ICC5_PHYMF/8-267-------------------------------------------------------------RTTLRDLRH-RA-------
F4PL25_DICFS/108-366-------------------------------------------------------------KTTILDIKK-KF-------
G4KQR4_OSCVS/3-261-------------------------------------------------------------KKTVIDLYK-MK-------
K9YNE4_CYASC/2-257-------------------------------------------------------------KVTIQKLCQ-WK-------
PANB_WOLSU/3-258-------------------------------------------------------------NITVSSIKK-KK-------
E6U5I9_ETHHY/4-262-------------------------------------------------------------TVTTQSFLD-AK-------
B8BWG2_THAPS/41-307-------------------------------------------------------------KVTTLTIAA-KK-------
K9SYS3_9SYNE/2-257-------------------------------------------------------------PVTISQLLT-WK-------
PANB_AERPE/5-260-------------------------------------------------------------KVTARRILK-MK-------
R7DES0_9PORP/10-268-------------------------------------------------------------KVTTRRLAE-MK-------
PANB_BAUCH/4-259-------------------------------------------------------------.TTISHLRK-YK-------
I5AYL4_9DELT/4-258-------------------------------------------------------------KITTSSLMK-MK-------
PANB_BACSK/2-259-------------------------------------------------------------.KTTKTFKQ-MK-------
R6A0K1_9BACT/11-268-------------------------------------------------------------KVTTHRLKE-MK-------
B2IDS4_BEII9/7-254-------------------------------------------------------------...AARFAE-MK-------
K0C447_CYCSP/9-266-------------------------------------------------------------KITNTDLLT-MK-------
PANB_LISMO/5-258-------------------------------------------------------------....VDFFA-MK-------
PANB_RHILO/16-267-------------------------------------------------------------.....LIRR-RK-------
K9VPY0_9CYAN/2-258-------------------------------------------------------------SVTTHQLIQ-WK-------
C0ZCH0_BREBN/7-265-------------------------------------------------------------PITTSSIRK-KK-------
A7TTC6_VANPO/36-301-------------------------------------------------------------RKSILDLNK-KY-------
M4ZY73_9ACTN/20-278-------------------------------------------------------------RVRTRHFQQ-AK-------
D2U9Y6_XANAP/10-266-------------------------------------------------------------.WTVPALAD-AK-------
PANB_BACLD/3-259-------------------------------------------------------------..TKTDFLK-MK-------
K9ZZ09_DEIPD/3-257-------------------------------------------------------------.KTVPDLVR-SE-------
D3UG21_HELM1/2-256-------------------------------------------------------------KTTITSLQK-KK-------
R5FZT9_9PORP/11-269-------------------------------------------------------------KITATRFMA-MK-------
E0SBL5_DICD3/3-259-------------------------------------------------------------ATTISHLRQ-WK-------
PANB_HALSA/12-261-------------------------------------------------------------.......NT-D.-------
PANB_CAMJE/4-258-------------------------------------------------------------..SMISFLE-KK-------
C5CWU9_VARPS/32-292-------------------------------------------------------------.LSLPRLAD-MH-------
Q0UNM3_PHANO/57-317-------------------------------------------------------------PVTINTLQA-LY-------
PANB_SULAC/5-259-------------------------------------------------------------KVSIRDFLK-KK-------
M4NHU9_9GAMM/13-271-------------------------------------------------------------PVTVPGLLA-MK-------
C5C4X5_BEUC1/14-271-------------------------------------------------------------RVRVQHLRA-AK-------
E2SAV3_9ACTN/24-281-------------------------------------------------------------RVRTHHLRQ-WK-------
I2F2C6_9BACT/2-256-------------------------------------------------------------..NVREIVQ-MK-------
PANB_DECAR/9-266-------------------------------------------------------------RLTQADLAK-LY-------
W1Q8C1_OGAPD/26-284-------------------------------------------------------------QKTLTDIKK-LY-------
PANB_KOSOT/2-256-------------------------------------------------------------..NIRQIIN-SK-------
PANB2_BRADU/11-267-------------------------------------------------------------RVTIPALQQ-WK-------
R7NSE5_9FIRM/2-259-------------------------------------------------------------KNNVSTFAK-MK-------
A8DWD1_NEMVE/4-260-------------------------------------------------------------.VTLTTLQS-LK-------
D9SIJ1_GALCS/2-259-------------------------------------------------------------RTTLTTLKA-MK-------
PANB2_VIBF1/3-259-------------------------------------------------------------KITISDLNN-WK-------
C4Y7C6_CLAL4/28-286-------------------------------------------------------------RTTLTDLRK-LY-------
E0UPX6_SULAO/4-259-------------------------------------------------------------KLTISTIKK-SK-------
C0QS02_PERMH/2-258-------------------------------------------------------------.KTIHDFLR-AK-------
PANB_PELUB/4-253-------------------------------------------------------------..KILNFIK-KK-------
F2LWA6_HIPMA/2-259-------------------------------------------------------------AITVPKIKD-MK-------
PANB_THICR/2-256-------------------------------------------------------------..TLTKLHK-MK-------
M5DV17_9GAMM/4-263-------------------------------------------------------------.ISIRSLQT-MK-------
X2HEZ8_9NEIS/2-257-------------------------------------------------------------.HTIHTLRK-MK-------
I1YKY2_METFJ/3-261-------------------------------------------------------------RLSLSHLRK-MK-------
D2NU30_ROTMD/61-319-------------------------------------------------------------KVRTVHLAQ-AK-------
R5SB00_9GAMM/3-259-------------------------------------------------------------..TVTSFQR-LK-------
E1VAR3_HALED/19-275-------------------------------------------------------------TVTLSTLQA-HK-------
D3SNL0_THEAH/2-259-------------------------------------------------------------KVTLRTLFR-KR-------
U3U9E1_9ENTR/4-259-------------------------------------------------------------.TTISYLNQ-LK-------
PANB_CLOAB/2-260-------------------------------------------------------------KNTTETFKN-SK-------
B7GHT0_ANOFW/22-277-------------------------------------------------------------..TKLDFLN-MK-------
B8EK33_METSB/5-251-------------------------------------------------------------....ARFFE-MK-------
C8X1K5_DESRD/4-262-------------------------------------------------------------KLSVHTLQG-LK-------
G4T0T2_META2/12-267-------------------------------------------------------------PLTITDLQS-MK-------
PANB_ANAMF/4-256-------------------------------------------------------------..NILDIQA-KK-------
I4YBJ3_WALMC/10-273-------------------------------------------------------------KVTIAKLNK-MR-------
F0S4V2_PSESL/9-267-------------------------------------------------------------RVTTFSLQE-MK-------
E6SCG6_INTC7/25-282-------------------------------------------------------------RVRIPHLQA-MK-------
PANB_CORJK/21-279-------------------------------------------------------------KVRIADLKA-RK-------
F4PBH9_BATDJ/27-283-------------------------------------------------------------KVTITALRK-LY-------
PANB_CYAP4/3-259-------------------------------------------------------------.VTIPQLQQ-WK-------
U5QGT4_9CYAN/2-258-------------------------------------------------------------AVSIHHLRR-LK-------
E7A9J8_HELFC/3-264-------------------------------------------------------------KITLDSLYR-KK-------
PANB_ROSDO/14-264-------------------------------------------------------------.....DIKS-RK-------
I0H0N1_ACTM4/15-272-------------------------------------------------------------RVRTRDLIN-AK-------
M2PBF7_CERS8/43-302-------------------------------------------------------------KVTIHHLQA-MR-------
V4KY10_9DELT/4-261-------------------------------------------------------------KLTRFDLQT-MK-------
D4MUX9_ANAHA/2-260-------------------------------------------------------------KTTVSTVQK-MK-------
K4II33_PSYTT/10-268-------------------------------------------------------------RITVKSLIE-MK-------
G2TM93_BACCO/3-259-------------------------------------------------------------..QTTDFVK-MK-------
PANB_NOCFA/22-279-------------------------------------------------------------KTRIPHLRQ-MK-------
PANB_STRMK/10-265-------------------------------------------------------------.WTVPALAE-AK-------
R6Q9M5_9FIRM/3-261-------------------------------------------------------------KNTVSTFRE-QK-------
PANB_GEOLS/4-261-------------------------------------------------------------KITIPEILL-MK-------
PANB_STACT/3-256-------------------------------------------------------------..QLSNLFD-MK-------
D3IAK5_9BACT/11-269-------------------------------------------------------------KITTQKFIE-LK-------
E3RMD4_PYRTT/56-316-------------------------------------------------------------PVTINTLQS-MY-------
F8C4E6_THEGP/11-262-------------------------------------------------------------......LIE-KK-------
PANB_RHOCS/9-265-------------------------------------------------------------RLAVPDIAA-RK-------
G8LWQ2_CLOCD/4-262-------------------------------------------------------------KITVSNFRE-SK-------
Q6CLY9_KLULA/32-295-------------------------------------------------------------QLTVKDIMA-KY-------
PANB_SYNR3/10-261-------------------------------------------------------------....EQLRQ-RK-------
R5J4T6_9FIRM/2-260-------------------------------------------------------------KNTVLTFKE-AK-------
R5CPJ0_9BACT/11-269-------------------------------------------------------------KVTTHRFIE-MK-------
PANB2_ZYMMO/10-265-------------------------------------------------------------RRTIPELRA-RK-------
PANB_UNCTG/3-261-------------------------------------------------------------KKTVLTILK-KK-------
A9SWR9_PHYPA/44-307-------------------------------------------------------------RVTLRHLEA-KY-------
PANB_PSYWF/2-265-------------------------------------------------------------.ITLSTLKK-YK-------
E1VXC6_ARTAR/15-272-------------------------------------------------------------RIRLHHLQQ-AK-------
F2J6X3_POLGS/33-294-------------------------------------------------------------RTTLSTLDR-IK-------
PANB_GEOSW/3-259-------------------------------------------------------------..TKTDFFK-MK-------
D3PCJ6_DEFDS/9-265-------------------------------------------------------------KITVNHLKK-MK-------
F5XK06_MICPN/12-270-------------------------------------------------------------RIRIPDLQQ-AK-------
R5PEY0_9BACT/11-269-------------------------------------------------------------KVTAPAFFK-MK-------
D1BFU9_SANKS/24-281-------------------------------------------------------------RFRVHHLAE-HK-------
I3VRB5_THESW/4-262-------------------------------------------------------------KITVSTLKR-LK-------
PANB_AGRVS/9-265-------------------------------------------------------------RLTPTTIAA-LK-------
PANB_XYLFA/10-265-------------------------------------------------------------.WTVPALAE-AK-------
M4SFZ5_9SPHN/23-277-------------------------------------------------------------RMTVPQIQA-RK-------
G0RQ21_HYPJQ/11-271-------------------------------------------------------------KVTMSTIKS-LY-------
R7FC11_9FIRM/2-261-------------------------------------------------------------KQTVQTIQA-KK-------
C1MW11_MICPC/19-288-------------------------------------------------------------RFTLRKLAA-KY-------
W5XWQ3_9CORY/8-265-------------------------------------------------------------RVRTRHFFE-AK-------
L0EU60_LIBCB/3-258-------------------------------------------------------------TTTIETLNQ-LK-------
L0E1F4_THIND/2-256-------------------------------------------------------------RTTIRTLEK-YK-------
K9Z7J6_CYAAP/2-257-------------------------------------------------------------KVTIQNLQQ-WK-------
I4A0H9_ORNRL/9-266-------------------------------------------------------------KITTETLRN-LK-------
A5HYW9_CLOBH/2-260-------------------------------------------------------------RNTVSTFQE-LK-------
I3U7Q6_ADVKW/24-279-------------------------------------------------------------RITVPQLRA-YK-------
PANB1_PSEF5/9-264-------------------------------------------------------------RLSVPQLVA-MK-------
E8UZX7_TERSS/17-275-------------------------------------------------------------KTTPQSLQD-QK-------
PANB_CHLTE/11-273-------------------------------------------------------------HVTTRRMLD-MK-------
F4CPV3_PSEUX/31-288-------------------------------------------------------------RTRIHHLAE-MK-------
PANB_MARMM/13-268-------------------------------------------------------------RITAPDIRA-RK-------
K9WEF5_9CYAN/2-259-------------------------------------------------------------AVTTQQLIQ-WK-------
K9SKS8_9CYAN/2-258-------------------------------------------------------------TVTTANLQT-FK-------
R4VYJ3_9EURY/3-265-------------------------------------------------------------RTTIRDLQT-RY-------
K5WY16_AGABU/47-306-------------------------------------------------------------KVTIQGLHA-LR-------
A8NR68_COPC7/47-306-------------------------------------------------------------KVTIQTLHS-MR-------
S5SZ30_9CORY/8-265-------------------------------------------------------------RVRTRHFAQ-AK-------
E3H7X2_ILYPC/2-260-------------------------------------------------------------KNTVVSFRN-SK-------
B8D3I6_DESK1/7-262-------------------------------------------------------------RVTVRDIVK-MK-------
I2BCN0_SHIBC/38-294-------------------------------------------------------------PTTVANLRQ-LK-------
D8PBH0_9BACT/1-257-------------------------------------------------------------.MTVPDLQK-CK-------
A7I1C3_CAMHC/4-259-------------------------------------------------------------.ITPNAIIA-KK-------
D3Q8M5_STANL/19-275-------------------------------------------------------------RVRTRDLKL-AK-------
V5UCI0_9BURK/11-268-------------------------------------------------------------AVTVPGLAQ-MR-------
L0H3K5_9GAMM/8-264-------------------------------------------------------------.IGISTLAA-MK-------
L0JL26_NATP1/3-257-------------------------------------------------------------..TVRDVRS-K.-------
A8IKB7_CHLRE/113-377-------------------------------------------------------------RVTLRTIRK-KY-------
PANB_HELPY/10-265-------------------------------------------------------------KITLNHLQA-KK-------
R7BQ71_9ACTN/2-260-------------------------------------------------------------KNTVTTFKD-AK-------
D5V951_MORCR/17-276-------------------------------------------------------------.ITLSTLNK-LK-------
U7PLW4_SPOS1/41-301-------------------------------------------------------------KVTVGTLRS-LY-------
R7LEZ2_9BACT/2-258-------------------------------------------------------------KKSIKTIFK-KK-------
D3FBP3_CONWI/22-279-------------------------------------------------------------.VSLPQLAE-KK-------
C5CCN7_MICLC/23-281-------------------------------------------------------------RYRTVHLQR-AK-------
F8PSJ9_SERL3/44-301-------------------------------------------------------------KVTIQSLYN-QH-------
PANB_PELCD/4-262-------------------------------------------------------------RKTVLDIQR-MK-------
D7CJ47_SYNLT/3-261-------------------------------------------------------------RVTTTLLRE-KK-------
Q6FJH7_CANGA/29-292-------------------------------------------------------------.KTILDLQR-KY-------
D8M6X1_BLAHO/33-296-------------------------------------------------------------KVTVSTIAS-KY-------
E1SVW3_FERBD/3-259-------------------------------------------------------------RITTSTLNR-YK-------
PANB_METS5/3-254-------------------------------------------------------------RLTIRDFLK-KK-------
C1EBW8_MICSR/72-335-------------------------------------------------------------RMTLKRLRA-KY-------
J7S291_KAZNA/30-296-------------------------------------------------------------RTTLSDITG-RY-------
B8MWV2_ASPFN/53-313-------------------------------------------------------------KVTIQTLQS-LH-------
PANB_GLUDA/2-258-------------------------------------------------------------RITLFDVQA-MK-------
PANB3_BRADU/9-264-------------------------------------------------------------RKTAPDLRI-RK-------
PANB_HALMA/3-256-------------------------------------------------------------..TVRDLQA-M.-------
PANB_STAA8/2-256-------------------------------------------------------------.KTVSQLID-MK-------
G4RCR9_PELHB/16-265-------------------------------------------------------------......ILA-RK-------
F7YY72_9THEM/2-258-------------------------------------------------------------.ITLQKLIS-MK-------
D2W044_NAEGR/75-331-------------------------------------------------------------.VTLQCINY-KY-------
F4C347_SPHS2/9-267-------------------------------------------------------------KVTVNSILE-MK-------
B1I1N7_DESAP/5-263-------------------------------------------------------------RLTTLDIRR-KK-------
A8NPY9_COPC7/58-317-------------------------------------------------------------KVTIQTLHS-LR-------
R5E9H5_9CLOT/2-260-------------------------------------------------------------KNTVLTFKQ-AK-------
B8J200_DESDA/2-259-------------------------------------------------------------KNTVVTFRA-AK-------
V4IHK4_9GAMM/6-262-------------------------------------------------------------.ITSASLVR-MK-------
PANB_CUPMC/11-266-------------------------------------------------------------TVTIPKLQA-MR-------
PANB_SYNJB/4-259-------------------------------------------------------------.LSIHHFRQ-AK-------
PANB_SACEN/31-288-------------------------------------------------------------RVRTRHLLE-LK-------
G0VBF0_NAUCC/42-307-------------------------------------------------------------PITIPDIHS-KY-------
D2SAW9_GEOOG/14-271-------------------------------------------------------------RVRVHHLQQ-AK-------
A5FWA4_ACICJ/13-269-------------------------------------------------------------.KSIGSWER-AK-------
N0B2M6_9RHIZ/10-264-------------------------------------------------------------.LMAPDITA-RK-------
H9UMW1_SPIAZ/3-258-------------------------------------------------------------..RLADFPV-RK-------
PANB_CAMFF/3-258-------------------------------------------------------------KVTINDLFM-MK-------
G7USF2_PSEUP/10-266-------------------------------------------------------------.WTVPALRQ-AK-------
A0A0D2VT44_CAPO3/54-312-------------------------------------------------------------KRTIIDLKK-MH-------
A8ZX35_DESOH/4-253-------------------------------------------------------------...LSVFRD-YK-------
PANB_CAUCR/12-266-------------------------------------------------------------.LAAPDIAA-RK-------
D5WPY7_KYRT2/8-259-------------------------------------------------------------.......FR-KR-------
I0JN82_HALH3/5-258-------------------------------------------------------------....SQFIK-MK-------
E4T2P1_PALPW/10-268-------------------------------------------------------------RVTTQRLLE-MK-------
E4U845_OCEP5/3-257-------------------------------------------------------------KLTIPELKS-RK-------
B8IX11_METNO/22-279-------------------------------------------------------------KRTITDIRN-SK-------
PANB_PARL1/9-264-------------------------------------------------------------RVTVPEIRA-RK-------
C1D7E8_LARHH/49-306-------------------------------------------------------------KVTVSTLAR-LK-------
PANB_YEAST/26-290-------------------------------------------------------------.NTIQDIRN-KY-------
I1XL09_METNJ/3-260-------------------------------------------------------------RTSLNQLRK-MK-------
PANB_TRIEI/2-260-------------------------------------------------------------AVTTKQLIQ-WK-------
K7AE29_9ALTE/3-259-------------------------------------------------------------KVTTSSLLK-MK-------
S2J9Z0_MUCC1/36-294-------------------------------------------------------------KVSIKTIQS-LY-------
W0EVM7_9SPHI/9-267-------------------------------------------------------------RVTTHTLAK-MK-------
PANB_CALMQ/5-260-------------------------------------------------------------KVTIRYFLE-SK-------
S0EZ89_CHTCT/9-267-------------------------------------------------------------RITVPELRA-RK-------
Q6CE35_YARLI/40-298-------------------------------------------------------------KVTIPELAK-MR-------
R5ACL8_9FIRM/2-260-------------------------------------------------------------KNTVATLQQ-QK-------
G8R5C5_OWEHD/10-268-------------------------------------------------------------KVTTNSVQE-MK-------
PANB_TOLAT/3-259-------------------------------------------------------------KISLTQVQK-MK-------
B3QT33_CHLT3/14-276-------------------------------------------------------------QVTTRKLVE-MK-------
B0VG23_CLOAI/8-266-------------------------------------------------------------KTDIAVFKE-MK-------
G8B7V6_CANPC/30-291-------------------------------------------------------------RKTVADIHQ-FH-------
D5UXM6_TSUPD/25-282-------------------------------------------------------------KVRIHHLAD-LK-------
W0DU54_9GAMM/2-258-------------------------------------------------------------KKTLKQLYK-MA-------
F0YK17_AURAN/2-266-------------------------------------------------------------.TTAMSLLR-MK-------
N1QBK2_PSEFD/41-301-------------------------------------------------------------KTSLQTLKS-MY-------
G8TR11_NIAKG/11-269-------------------------------------------------------------KITTHTLQK-MK-------
K0NQW1_DESTT/4-258-------------------------------------------------------------RVTTSTLIK-MK-------
C5DIL6_LACTC/24-292-------------------------------------------------------------.KTLADLFS-KH-------
F4B4G2_ACIHW/4-258-------------------------------------------------------------KITVKSFLK-KK-------
PANB_DESAG/9-266-------------------------------------------------------------AITAADIRA-AK-------
E1QGK1_DESB2/5-263-------------------------------------------------------------KVTISDLYQ-KK-------
F9Z613_ODOSD/10-267-------------------------------------------------------------.VTTHVLSE-MK-------
R6QG64_9CLOT/9-267-------------------------------------------------------------DVTVNTFFK-KK-------
PANB_NEIG1/2-257-------------------------------------------------------------.ITVNTLQK-MK-------
PANB_ALKMQ/4-261-------------------------------------------------------------KKSILDLMK-MK-------
F0LTK0_VIBFN/3-259-------------------------------------------------------------KITINDLMK-WK-------
A5D5T4_PELTS/5-263-------------------------------------------------------------KVTTATIKQ-MK-------
PANB_TROWT/13-267-------------------------------------------------------------RTRIHRFHK-.G-------
J7IT73_DESMD/3-259-------------------------------------------------------------..STKDFWV-QK-------
D4KZZ1_9FIRM/4-262-------------------------------------------------------------KNTVVTLQK-QK-------
PANB_SACD2/11-266-------------------------------------------------------------KVTVNTLRK-MK-------
PANB_CYAP8/2-257-------------------------------------------------------------AMTLPYLIQ-AK-------
PANB1_ZYMMO/33-296-------------------------------------------------------------KTTTARISQ-MR-------
PANB1_HAHCH/9-265-------------------------------------------------------------RITIPQIRS-MK-------
B4U641_HYDS0/4-261-------------------------------------------------------------KLNIELLFK-KK-------
C7PAE1_CHIPD/9-267-------------------------------------------------------------RITTHILQK-MK-------
PANB_EXISA/3-259-------------------------------------------------------------..TMTTLLK-KM-------
PANB_FRAAA/42-298-------------------------------------------------------------RFTVRDVAA-AK-------
A8GIZ6_SERP5/25-281-------------------------------------------------------------PTTVTHLHQ-WK-------
PANB_MARMS/13-269-------------------------------------------------------------AVTLSTLKK-MK-------
B9I8Q3_POPTR/46-310-------------------------------------------------------------RVTLTHLKQ-KH-------
F2KYW8_PREDF/10-268-------------------------------------------------------------KVTAKTLLQ-MK-------
W8X8F9_CASDE/9-264-------------------------------------------------------------RVTVPQLVS-FK-------
C7MWE6_SACVD/37-294-------------------------------------------------------------RVRIHHLRE-LK-------
W8TJC5_EUBAC/5-263-------------------------------------------------------------KFTVSSFME-SK-------
R6MRV8_9FIRM/2-260-------------------------------------------------------------KNTTVTFKN-KK-------
E1R683_SPISS/12-255-------------------------------------------------------------KVT......-..-------
E0TIB5_PARBH/9-264-------------------------------------------------------------RQTAASITA-RK-------
C9R9H9_AMMDK/3-261-------------------------------------------------------------KVTTADFRR-WK-------
L0ECE9_THECK/4-262-------------------------------------------------------------.LTVTKWLK-MK-------
PANB_RHIEC/9-265-------------------------------------------------------------RLTPPRISA-MK-------
PANB_RHOS4/11-264-------------------------------------------------------------..MAADILA-RK-------
C8W3T9_DESAS/5-263-------------------------------------------------------------KVTTATFRN-MK-------
H8GHP8_METAL/6-259-------------------------------------------------------------.LSIHDLAA-MK-------
R6FWR6_9CLOT/2-260-------------------------------------------------------------KNTVVTFKQ-AK-------
Q7NSX9_CHRVO/10-253-------------------------------------------------------------RVTVPAIRN-SK-------
PANB_DESVH/21-277-------------------------------------------------------------.LTTADIRK-AK-------
PANB_RHISN/11-264-------------------------------------------------------------..SPASIEA-LK-------
K9SDR5_9CYAN/2-259-------------------------------------------------------------AVTVRQLMQ-RK-------
R6FYY2_9FIRM/2-260-------------------------------------------------------------KNTVTTFQA-MK-------
PANB_THIDA/2-258-------------------------------------------------------------PVTLSTLKA-LR-------
PANB2_METPP/16-274-------------------------------------------------------------PVTLHTLRE-MH-------
PANB_ROSS1/2-259-------------------------------------------------------------RKTITDIQQ-MK-------
H6C1C9_EXODN/62-322-------------------------------------------------------------PVTIQTLQK-MY-------
F2NLZ2_MARHT/3-259-------------------------------------------------------------KLTVLDLKA-KK-------
F0R8P2_BACSH/11-269-------------------------------------------------------------KVTTHRLME-MK-------
D5SWW3_PLAL2/21-276-------------------------------------------------------------RMTVPRFQG-AK-------
R5EQ78_9GAMM/2-259-------------------------------------------------------------KVTVATFAK-MK-------
E8U6D3_DEIML/3-257-------------------------------------------------------------.LTVPDIVR-AE-------
B3PI46_CELJU/20-275-------------------------------------------------------------SVTINTLYK-LK-------
PANB_SYNFM/4-261-------------------------------------------------------------RVTVPEIIA-SK-------
H2J7Z9_MARPK/2-256-------------------------------------------------------------..SIRKFLK-MK-------
PANB_CHRSD/3-259-------------------------------------------------------------TVTLSRLNA-FK-------
H8L6Y3_FRAAD/13-270-------------------------------------------------------------PVTAPGLRA-MK-------
PANB_DEHM1/2-259-------------------------------------------------------------RTTISQLKE-MK-------
PANB_HELHP/5-260-------------------------------------------------------------KMSIATLKA-KK-------
B2GG07_KOCRD/16-273-------------------------------------------------------------RVRTVHLQR-AK-------
J3YT69_9ENTR/2-257-------------------------------------------------------------.TTISHLQT-WK-------
PANB_RUTMC/2-256-------------------------------------------------------------..NIEALNN-FK-------
F4KKJ6_PORAD/11-269-------------------------------------------------------------KVTTRRLLE-MK-------
E4TNZ1_MARTH/10-268-------------------------------------------------------------KITTHQLQE-MK-------
PANB_ACIAD/3-261-------------------------------------------------------------..SLSDLRK-FK-------
M1E8E9_9FIRM/4-260-------------------------------------------------------------KLYAPDIIK-LK-------
H2FZS0_OCESG/3-259-------------------------------------------------------------KITTARLQA-MK-------
E3D016_9BACT/4-262-------------------------------------------------------------RMTLPRLRE-MK-------
R7Y0I9_9ACTN/27-284-------------------------------------------------------------KIRTHHLRE-MK-------
C7R4W8_JONDD/10-267-------------------------------------------------------------RFRVHDFAR-AK-------
B3DYC2_METI4/5-256-------------------------------------------------------------KITPDWIRL-RK-------
PANB_BURP8/11-267-------------------------------------------------------------AVTVPKLMA-MR-------
PANB_OCEIH/3-256-------------------------------------------------------------..ALKDFMR-MK-------
K4LJP4_9FIRM/4-262-------------------------------------------------------------KVNINALQN-KV-------
C7M6V0_CAPOD/10-268-------------------------------------------------------------RVTTKSIVE-MK-------
E6SG79_THEM7/29-287-------------------------------------------------------------RVTVRTVLE-SK-------
H0UKG2_9BACT/4-262-------------------------------------------------------------KMSVLDFKR-YK-------
G0AG10_COLFT/18-274-------------------------------------------------------------PITIPALQA-LR-------
D0MKC7_RHOM4/15-273-------------------------------------------------------------RVTTQTLQE-MK-------
K9TFZ3_9CYAN/2-258-------------------------------------------------------------PITPQQLIE-RK-------
PANB_SYNY3/2-258-------------------------------------------------------------AITPTQLLD-WK-------
PANB_CHRVO/2-258-------------------------------------------------------------KITVNTLHK-LA-------
PANB_PYRAE/11-257-------------------------------------------------------------.........-VK-------
D3G0K7_BACPE/3-259-------------------------------------------------------------..TTATFKK-MK-------
G8ZML5_TORDC/45-310-------------------------------------------------------------SNTIHDMHN-AY-------
B8GNA9_THISH/9-265-------------------------------------------------------------RITTRRLQE-MR-------
PANB_YERPE/3-260-------------------------------------------------------------TTTMSQLRQ-WK-------
PANB_HALHL/14-269-------------------------------------------------------------.VTVSRMRA-MK-------
I7H5U9_9HELI/5-260-------------------------------------------------------------KMSITDLQA-KK-------
PANB_FLAJ1/10-268-------------------------------------------------------------RITTKSLIE-MK-------
H2AZP6_KAZAF/28-293-------------------------------------------------------------RITIQDIQK-KY-------
PANB_HYPNA/9-263-------------------------------------------------------------RKTVKDIAA-AK-------
F0T218_SYNGF/3-260-------------------------------------------------------------KKTILDFWK-MS-------
K0J2M4_AMPXN/5-260-------------------------------------------------------------....FEFLK-MK-------
PANB_PELPD/7-264-------------------------------------------------------------KVTIPDILK-MK-------
PANB_ACAM1/2-259-------------------------------------------------------------AVTIHQLRT-WK-------
R5HLC5_9SPIR/4-262-------------------------------------------------------------KVTVNTIQK-YK-------
E6W3R1_DESIS/9-267-------------------------------------------------------------KITTTAVMS-MK-------
E8WV64_GRATM/17-275-------------------------------------------------------------KVTPQTLLD-RK-------
B0RBZ8_CLAMS/26-283-------------------------------------------------------------RVRIRHFAR-AK-------
R7J318_9BACT/11-269-------------------------------------------------------------KVTTARLTE-MK-------
D1C1L8_SPHTD/5-263-------------------------------------------------------------RVTIADLKA-MK-------
D5CQ24_SIDLE/3-260-------------------------------------------------------------RKTLSTLQA-MR-------
K9U8V4_9CYAN/2-257-------------------------------------------------------------PITTQQLIQ-WK-------
R7Z1Y2_CONA1/60-319-------------------------------------------------------------KVTLGTLRA-LY-------
A3GFD5_PICST/27-288-------------------------------------------------------------RKTVADINR-FY-------
PANB_GEOMG/4-262-------------------------------------------------------------KKTIIDIQK-MK-------
D1B8U6_THEAS/5-263-------------------------------------------------------------KVTIPALRE-MK-------
D1AZH1_SULD5/18-272-------------------------------------------------------------.KTITSIKQ-HK-------
K9V2Q3_9CYAN/2-257-------------------------------------------------------------PVTIQQLIQ-WK-------
G4TES8_PIRID/16-274-------------------------------------------------------------KVTLARLAE-MR-------
PANB_AERHH/3-259-------------------------------------------------------------KITTTNLLK-MK-------
B5Y864_COPPD/3-251-------------------------------------------------------------...ATQFKK-LK-------
E6VV69_DESAO/18-273-------------------------------------------------------------.VTAPDIMA-RK-------
D0LB03_GORB4/26-283-------------------------------------------------------------KTRVHHLAQ-MK-------
R4XB88_TAPDE/13-270-------------------------------------------------------------.LNLGTIQK-LY-------
C5XKA7_SORBI/74-338-------------------------------------------------------------RVTLATLRG-KH-------
PANB_HELMI/4-262-------------------------------------------------------------KITLPQCKE-MK-------
D4ZUG3_ARTPN/2-258-------------------------------------------------------------AVTTQQLID-WK-------
D3AXV1_POLPA/114-372-------------------------------------------------------------KTTILDIKK-KY-------
W5Y2G7_9CORY/15-272-------------------------------------------------------------KIRVSDLVK-LK-------
W0IZ08_9BACT/4-264-------------------------------------------------------------...VLDFKA-RK-------
G3AZ68_CANTC/24-285-------------------------------------------------------------RNTIADIYS-MY-------
E8R215_ISOPI/23-275-------------------------------------------------------------..QPPDLIR-YK-------
R4KP81_9FIRM/5-263-------------------------------------------------------------KANILTFKE-MK-------
K5W3S2_PHACS/44-303-------------------------------------------------------------KVTIQHLHH-LR-------
A9WS61_RENSM/30-287-------------------------------------------------------------KIRVHHLQQ-AK-------
PANB_ANADF/10-272-------------------------------------------------------------RVTIHELRR-MK-------
PANB_THEM4/1-256-------------------------------------------------------------.MTIQKFLA-MK-------
PANB_SULSO/3-259-------------------------------------------------------------KVTIRDFIK-KK-------
F0S244_DESTD/2-259-------------------------------------------------------------AITTATFLE-KK-------
B9L4S0_THERP/5-263-------------------------------------------------------------RVTVADLRA-MK-------
C8WT97_ALIAD/4-262-------------------------------------------------------------TVTVRTLAN-MK-------
PANB_STAEQ/2-256-------------------------------------------------------------.KTLNHLNK-MK-------
PANB_OLICO/9-264-------------------------------------------------------------RKTAPEIFA-RK-------
F6FX13_ISOV2/15-272-------------------------------------------------------------RVRVHHLAE-AK-------
PANB_GEODF/4-262-------------------------------------------------------------ATTILDIQK-MK-------
D9QPL3_ACEAZ/4-262-------------------------------------------------------------KKSILDFME-MK-------
F2JV64_MARM1/12-268-------------------------------------------------------------PVTLSKLRK-MK-------
E0UCI4_CYAP2/2-257-------------------------------------------------------------AVTTGQIIK-WK-------
D5EMA1_CORAD/2-258-------------------------------------------------------------SISTQTIAR-LK-------
G2IWQ8_PSEUL/2-259-------------------------------------------------------------KINVNTLFK-MA-------
X2GVH3_9BACI/3-258-------------------------------------------------------------..TTSDFLK-MK-------
D6XUX0_BACIE/3-260-------------------------------------------------------------..TTSDFRT-MK-------
D6Z2X7_DESAT/7-263-------------------------------------------------------------..TVCDLAA-KK-------
PANB_KORVE/11-269-------------------------------------------------------------KVTSSTLLD-KK-------
A6QC29_SULNB/11-266-------------------------------------------------------------KITLSTISA-MK-------
D3V561_XENBS/3-258-------------------------------------------------------------PTTLTDLSQ-LK-------
C6X7E4_METGS/1-265-------------------------------------------------------------.MTVHDLQT-MA-------
D7WER9_9CORY/10-268-------------------------------------------------------------KVRVADLRQ-KK-------
I3YPM0_ALIFI/9-267-------------------------------------------------------------AVTTYRLTE-MK-------
R5HUC8_9FIRM/3-261-------------------------------------------------------------QNNVVTLAA-MK-------
R5U8N9_9FIRM/2-260-------------------------------------------------------------KTTVSTLKK-QK-------
PANB_HYPBU/6-262-------------------------------------------------------------KVTVRDIVR-AK-------
B8P6R4_POSPM/2-261-------------------------------------------------------------KVTIQHLHS-LR-------
PANB_SHELP/3-259-------------------------------------------------------------KITSSTLLK-FK-------
PANB_CHLAA/2-258-------------------------------------------------------------RITIRDIQQ-MR-------
PANB_PHOLL/3-258-------------------------------------------------------------PMTMTDLNQ-LK-------
PANB_CLOK5/3-261-------------------------------------------------------------KNNVSTFVS-AK-------
I0HQJ4_RUBGI/17-276-------------------------------------------------------------.LNLVRLRE-MA-------
R5ZHJ8_9FIRM/2-260-------------------------------------------------------------KTTVTTLQN-MK-------
U5MUW3_CLOSA/2-260-------------------------------------------------------------KNTILTFKK-AK-------
A0A068NY03_9BACT/4-257-------------------------------------------------------------RVTVPHIRA-MR-------
K9T7C7_9CYAN/2-258-------------------------------------------------------------AVTIQQLIQ-WK-------
PANB_AZOPC/10-268-------------------------------------------------------------KITIQHLIE-MK-------
K3W4X2_PYTUL/57-320-------------------------------------------------------------KVTTLDLGI-LK-------
A1CTJ0_ASPCL/72-332-------------------------------------------------------------KVTMQTLRS-LY-------
A6WW04_OCHA4/18-274-------------------------------------------------------------RLTPKAISA-LK-------
V5SAA2_9RHIZ/10-264-------------------------------------------------------------.LMAPDISA-LK-------
D3HPA3_LEGLN/2-258-------------------------------------------------------------..KIQDFKR-KK-------
R5BRB9_9FIRM/4-262-------------------------------------------------------------KKCIHDLYK-MK-------
B1VGE7_CORU7/16-274-------------------------------------------------------------QVRISDLTA-RK-------
W0RJ42_9BACT/5-261-------------------------------------------------------------.VTTGDLAA-MK-------
PANB_PARDP/15-266-------------------------------------------------------------.....DIRA-RK-------
D5QI36_KOMHA/9-263-------------------------------------------------------------RRTIRDVT.-.K-------
D1BSH7_XYLCX/21-280-------------------------------------------------------------RVTPPSLAA-LA-------
L0DD73_SINAD/8-261-------------------------------------------------------------.VTPPDFAR-WK-------
PANB_PEPD6/2-260-------------------------------------------------------------KNTIQTFKN-AK-------
PANB_THEMA/2-256-------------------------------------------------------------..NVEKLKK-MK-------
C7N2J4_SLAHD/19-269-------------------------------------------------------------..NLAYLQK-QK-------
A4SZR6_POLSQ/9-266-------------------------------------------------------------PITITKLLA-MH-------
D7B2F6_NOCDD/27-283-------------------------------------------------------------RVTIRDLAA-AK-------
H3ZNX9_THELN/3-257-------------------------------------------------------------EITPKKIME-MK-------
M4UAA2_9GAMM/3-259-------------------------------------------------------------RISVSHLMK-MK-------
K9QBM1_9NOSO/2-258-------------------------------------------------------------PVTTQQLIQ-WK-------
PANB_SALTY/3-258-------------------------------------------------------------PTTISLLQK-CK-------
W0E2Q1_MARPU/6-262-------------------------------------------------------------.TTVASLAA-MK-------
I1YQZ3_PREI7/10-268-------------------------------------------------------------KITAKTLRE-MK-------
L0A954_CALLD/5-260-------------------------------------------------------------KLTIRDIMK-MK-------
D4Z3Z8_SPHJU/23-282-------------------------------------------------------------RLTVPAIQR-RK-------
E6WRV2_PSEUU/10-266-------------------------------------------------------------.WTVPALAE-AK-------
F9ZNB5_ACICS/4-257-------------------------------------------------------------..KLEVWRR-GK-------
R5AXG3_9BACT/10-268-------------------------------------------------------------KVTTRRLVE-MK-------
R6QI65_9FIRM/2-260-------------------------------------------------------------KNTVSTFQK-MK-------
F4L4T8_HALH1/9-267-------------------------------------------------------------RITTHVLQA-MK-------
PANB_COLP3/3-259-------------------------------------------------------------KITTASLLN-MK-------
PANB_ERWT9/3-259-------------------------------------------------------------PTTVSTLRQ-WK-------
D2B380_STRRD/20-276-------------------------------------------------------------RITVRDIAA-AK-------
Q54LH3_DICDI/91-349-------------------------------------------------------------KKTVLDILK-KY-------
R6RU48_9CLOT/2-260-------------------------------------------------------------KNTAVTFKN-AK-------
C7QBN8_CATAD/33-291-------------------------------------------------------------RVTVRDLAK-AK-------
E8NFW7_MICTS/5-263-------------------------------------------------------------RVTLRRLSE-LA-------
PANB_THET8/2-257-------------------------------------------------------------RRTVKDFRN-.A-------
M1PUL5_DESSD/4-262-------------------------------------------------------------RKTVAGILA-MK-------
PANB_HERA2/2-258-------------------------------------------------------------RTQLSDIQR-MK-------
PANB_CORDI/5-259-------------------------------------------------------------.VRLQDLRD-YK-------
G8P0T0_GRAMM/17-275-------------------------------------------------------------RVTADVLLQ-KK-------
B0JGU8_MICAN/2-253-------------------------------------------------------------AVTTSKLIE-WK-------
A4RSY4_OSTLU/35-299-------------------------------------------------------------RFTLGELRK-KY-------
G0VMJ3_MEGEL/4-263-------------------------------------------------------------KVTNLTIKK-MK-------
G8JVR3_ERECY/22-285-------------------------------------------------------------QKTIPDLLQ-KY-------
D4ALU8_ARTBC/69-329-------------------------------------------------------------KVTIKSLEA-LY-------
D8IYH6_HERSS/15-271-------------------------------------------------------------PVTTHTLQA-MR-------
D5EGN8_AMICL/9-262-------------------------------------------------------------.....EFVK-MK-------
K0CGS1_ALCDB/3-252-------------------------------------------------------------KKHAQALME-MK-------
M3HH38_CANMX/30-289-------------------------------------------------------------RKTIEDIHQ-LY-------
C7R7Z0_KANKD/3-259-------------------------------------------------------------TLTISDIEQ-LK-------
H8KSY4_SOLCM/9-267-------------------------------------------------------------RITTNTVQE-MK-------
Q75D37_ASHGO/24-287-------------------------------------------------------------QKTIPDIFK-KY-------
E4RTA9_LEAB4/5-263-------------------------------------------------------------RITTNTLRE-FK-------
E3HRX5_ACHXA/19-273-------------------------------------------------------------.LSVPAFRA-RK-------
PANB_DESAA/4-258-------------------------------------------------------------KVTVTVLAK-MK-------
D3DI50_HYDTT/5-262-------------------------------------------------------------.ITIRHLFK-KK-------
T1KER8_TETUR/72-325-------------------------------------------------------------KVRTIDIVS-MK-------
D9QLF2_BRESC/11-266-------------------------------------------------------------RLAAPDIMK-RK-------
F8I3G8_SULAT/4-259-------------------------------------------------------------KLTAPELRR-QK-------
E8SI87_STAPH/2-256-------------------------------------------------------------.KTLNHIQQ-MK-------
D5BZ31_NITHN/3-259-------------------------------------------------------------RLTLTKLRK-MK-------
PANB_ACIC1/10-267-------------------------------------------------------------RVTIHDLQL-RK-------
PANB_BUCAI/3-259-------------------------------------------------------------SITISQLKN-WK-------
D8RRV3_SELML/38-302-------------------------------------------------------------RVTLRHLQS-KY-------
R5IEN0_9BACT/10-267-------------------------------------------------------------.MTTHRLLE-MK-------
R5LDT0_9FIRM/2-259-------------------------------------------------------------.TTVTTLMN-MK-------
D6ZCH0_SEGRD/15-271-------------------------------------------------------------RVRISHLHE-MK-------
PANB_LEPIN/9-261-------------------------------------------------------------.......SP-EK-------
PANB_FRATT/7-257-------------------------------------------------------------......FKK-AK-------
W0EB65_9FIRM/2-259-------------------------------------------------------------RKTVPYFFQ-MK-------
PANB_IDILO/5-261-------------------------------------------------------------KTSIATLQK-MK-------
PANB2_HAHCH/2-258-------------------------------------------------------------SITLSTLLD-LK-------
PANB_CHLPD/11-273-------------------------------------------------------------HVTTRKLLD-MK-------
F0VHK9_NEOCL/2-249-------------------------------------------------------------....ADLLQ-RK-------
W5X1Y4_BDEBC/3-258-------------------------------------------------------------..SILEFQE-AK-------
PANB_ACISJ/26-287-------------------------------------------------------------.VSLPRLAQ-MR-------
PANB_SULTO/3-259-------------------------------------------------------------KVTIRDFLK-KK-------
U4KYW8_PYROM/61-321-------------------------------------------------------------KVTINTLRN-LY-------
G8M4H3_9BURK/11-267-------------------------------------------------------------TITVPKLQA-MR-------
R7I0S5_9CLOT/17-275-------------------------------------------------------------KHTVLTLQE-QK-------
PANB_LEGPH/2-258-------------------------------------------------------------..KIHDFKI-KK-------
PANB_PSYIN/3-259-------------------------------------------------------------KISVSRLTK-MK-------
B4EJY2_BURCJ/9-265-------------------------------------------------------------RKTVTAIRS-TK-------
C3PI15_CORA7/10-267-------------------------------------------------------------RLRTRHFAR-AK-------
D4G919_RIEPU/9-267-------------------------------------------------------------.TTIEDIRI-WK-------
I7A1E3_MELRP/3-258-------------------------------------------------------------..TVSEFRK-SK-------
R6HBG1_9ACTN/2-260-------------------------------------------------------------KNTVATFKK-MK-------
C5ZWV0_9HELI/9-263-------------------------------------------------------------QTTITQILE-KK-------
PANB_STAMF/3-258-------------------------------------------------------------KITIRDILK-MK-------
PANB_CYTH3/10-268-------------------------------------------------------------KVTTHQLQE-MK-------
H5WJ91_9BURK/17-281-------------------------------------------------------------...LVRLRD-MG-------
PANB_ALCBS/2-258-------------------------------------------------------------SITIRTLQK-RK-------
B2V9F5_SULSY/3-258-------------------------------------------------------------..SINEFFK-AK-------
I4ANF3_FLELS/11-269-------------------------------------------------------------RITTHSLQE-MK-------
B6H969_PENRW/50-309-------------------------------------------------------------KVTIQTIQN-LY-------
X2GXI3_9GAMM/2-259-------------------------------------------------------------KKTILTLQQ-RK-------
G4V1E0_NEUT9/11-271-------------------------------------------------------------KVTLNTLQS-MY-------
C5ME17_CANTT/28-287-------------------------------------------------------------RKTLADIRQ-LY-------
K9UIR8_9CHRO/3-253-------------------------------------------------------------..TVRQLLQ-YK-------
A9GRC2_SORC5/21-278-------------------------------------------------------------KVTVPEIRS-RK-------
R5NDJ7_9BACT/11-269-------------------------------------------------------------KVTTHRLIE-MK-------
D2QWS1_PIRSD/7-261-------------------------------------------------------------RVTVPEFVS-FK-------
C7RR60_ACCPU/9-266-------------------------------------------------------------RLTQLDLAR-MR-------
PANB_MAGMM/4-262-------------------------------------------------------------RVRVPDLVR-MK-------
PANB_SYNWW/3-261-------------------------------------------------------------RVTVSVLKD-KK-------
D5AMQ4_RHOCB/10-264-------------------------------------------------------------.LMPSDILA-LK-------
PANB_BACHD/3-259-------------------------------------------------------------..TTASFKK-MK-------
D0LJC1_HALO1/5-263-------------------------------------------------------------KVTIHTLQQ-KK-------
PANB_METS4/17-272-------------------------------------------------------------.VTIPMLQA-WR-------
B2UME9_AKKM8/9-253-------------------------------------------------------------....ERIRA-CK-------
R5BAJ9_9BACE/11-269-------------------------------------------------------------KVTTALLRK-MK-------
PANB_EDWI9/4-259-------------------------------------------------------------.TTLSHLRK-RK-------
R4KDW0_CLOPA/2-260-------------------------------------------------------------KNTSSTFVS-AK-------
PANB_CALS8/3-260-------------------------------------------------------------KVTTKTLFE-KK-------
D8QAA7_SCHCM/53-309-------------------------------------------------------------KVTVADLQK-MH-------
R5KL99_9CLOT/2-260-------------------------------------------------------------KNTTTSIMQ-MK-------
E3JA95_FRASU/46-302-------------------------------------------------------------RPTVRDLAT-WK-------
D6ZI06_MOBCV/16-270-------------------------------------------------------------.FRVQHVQQ-YF-------
I3Y5B5_THIV6/6-262-------------------------------------------------------------.ISVTALAA-MK-------
U5Q4L3_9BACT/10-267-------------------------------------------------------------.ITTQRLLE-MK-------
B8DSD1_DESVM/24-276-------------------------------------------------------------.....DVRA-AK-------
PANB_PROMH/3-258-------------------------------------------------------------PVTLSTLNR-YK-------
R7JBN8_9FUSO/4-262-------------------------------------------------------------KVTVNTIQK-YK-------
M1WKJ2_DESPC/25-280-------------------------------------------------------------.VTAPSVQA-SK-------
W0BBT9_9GAMM/2-258-------------------------------------------------------------..KIHDFKR-KK-------
R5IDU3_9FIRM/17-266-------------------------------------------------------------.KTINYLQK-LR-------
A6RA45_AJECN/56-315-------------------------------------------------------------KVTIKSLRA-LY-------
PANB_SYNP2/2-257-------------------------------------------------------------RVTPRTLQN-YK-------
E4NAD9_KITSK/28-286-------------------------------------------------------------RVTVRDLAK-AK-------
I3Z4N3_BELBD/11-269-------------------------------------------------------------RITTHTLQE-MK-------
D5X9N1_THEPJ/5-263-------------------------------------------------------------KVTTLTLKQ-KK-------
D8JZZ5_DEHLB/2-260-------------------------------------------------------------RTTIQAVRD-FK-------
C7NW69_HALMD/3-255-------------------------------------------------------------...ANDIRA-K.-------
K4LLM0_THEPS/3-261-------------------------------------------------------------RVTTATLLE-MK-------
PANB_XANP2/9-264-------------------------------------------------------------RITAPQIQA-RK-------
PANB_GEOBB/4-262-------------------------------------------------------------QRTILDFQR-MK-------
PANB_GLOVI/3-254-------------------------------------------------------------.LSIHSLRK-LK-------
A6WD73_KINRD/16-272-------------------------------------------------------------RTRVHHFQQ-WK-------
B5YIG6_THEYD/2-260-------------------------------------------------------------RFTVTDLLM-KK-------
H1XZL4_9SPHI/9-267-------------------------------------------------------------KITTNTLQA-MK-------
C6CUG2_PAESJ/4-263-------------------------------------------------------------RLTITNLKK-MK-------
PANB_ERYLH/23-282-------------------------------------------------------------RLTVPKIRA-RK-------
PANB_SCHPO/5-262-------------------------------------------------------------QITISTLRQ-WK-------
D1CBZ3_THET1/7-265-------------------------------------------------------------KVTIQDLIR-LK-------
K9XAD9_9CHRO/2-257-------------------------------------------------------------AVTIQQLIQ-WK-------
PANB_PSEHT/3-259-------------------------------------------------------------KITVSTLNK-MK-------
PANB_RUEST/10-264-------------------------------------------------------------.LTAEDIRA-MK-------
V6JUX0_STRRC/32-289-------------------------------------------------------------RITVRDITL-AK-------
R6BVU7_9BACT/10-268-------------------------------------------------------------KITTKTFAE-MK-------
C4R687_PICPG/26-284-------------------------------------------------------------QSTLRTLYS-KY-------
K9XXG3_STAC7/2-258-------------------------------------------------------------AITIQQLQK-WK-------
A5DHH9_PICGU/32-292-------------------------------------------------------------RKTLADIKQ-LY-------
I2ESX7_EMTOG/9-267-------------------------------------------------------------RVTTHTLQE-LK-------
PANB_COXBU/4-260-------------------------------------------------------------.MNTPDFQR-MK-------
B1X124_CYAA5/10-265-------------------------------------------------------------.LTTQQLIT-WK-------
D5EWH2_PRER2/2-259-------------------------------------------------------------RKSIFDLLE-RK-------
G2LF65_CHLTF/5-263-------------------------------------------------------------RVTPGDLTR-LK-------
F6EEK6_AMYSD/18-275-------------------------------------------------------------KTRIHHLQA-LK-------
G8RMJ4_MYCRN/4-264-------------------------------------------------------------KVKLADLQD-MK-------
G8AKD6_AZOBR/9-265-------------------------------------------------------------RVSVPALRA-RK-------

PF09370

I0GM51_SELRL/8-273--------------------------------------------------------------DILAGLRE-NL-------
A8MIW7_ALKOO/5-271--------------------------------------------------------------EILANFRE-RI-------
U5RTA7_9CLOT/8-273--------------------------------------------------------------EIIAGFKK-QV-------
D3EFW8_GEOS4/8-274--------------------------------------------------------------EVLAKLKS-EV-------
A0Q268_CLONN/3-268--------------------------------------------------------------DILDKLKK-RI-------
I0GM52_SELRL/9-273--------------------------------------------------------------.ILRRLRA-EV-------
R5TZH9_9CLOT/6-271--------------------------------------------------------------EILKRLRA-QI-------
A5I210_CLOBH/5-270--------------------------------------------------------------KILENLKS-QI-------
B2TMB2_CLOBB/6-270--------------------------------------------------------------EIIKNLNL-QI-------
E3GQA3_EUBLK/6-271--------------------------------------------------------------AFLEKLRR-EI-------
D3EFX0_GEOS4/19-284--------------------------------------------------------------QVLDRLHR-GI-------
K8END7_CARML/5-271--------------------------------------------------------------KITKKIRR-EL-------
E3DLS5_HALPG/3-268--------------------------------------------------------------.IQNRIEK-SI-------
Q893M0_CLOTE/5-270--------------------------------------------------------------VILKTMEN-SI-------
H6LDM1_ACEWD/6-271--------------------------------------------------------------AIEKMIKN-SL-------
G8AJD8_AZOBR/12-277--------------------------------------------------------------QLLDDLRR-AC-------
Q981G5_RHILO/24-290--------------------------------------------------------------EIVAGLKA-TL-------
H7C7V3_BRADU/40-302--------------------------------------------------------------....GIRQ-FF-------
L0D7P4_SINAD/6-270--------------------------------------------------------------....KLFA-SH-------
B2JXP4_BURP8/9-270--------------------------------------------------------------.IRDGLLR-QV-------
K4LCM9_THEPS/9-273--------------------------------------------------------------QVLERLRK-ES-------
Q0RZM6_RHOJR/7-274--------------------------------------------------------------QVVDRLNT-QV-------
K4LRH4_THEPS/9-277--------------------------------------------------------------EVLKRLKK-TI-------
D6DGJ5_CLOSC/7-273--------------------------------------------------------------EILRRLRK-NI-------
A4FLF5_SACEN/6-272--------------------------------------------------------------EIVRRLRA-KV-------
G7V878_THELD/7-273--------------------------------------------------------------EILEKLRK-KV-------
I0HWG9_RUBGI/8-274--------------------------------------------------------------QILDTFRA-KI-------
Y4OV_RHISN/14-280--------------------------------------------------------------ELIDRFHS-KI-------
Q92YY4_RHIME/8-274--------------------------------------------------------------TILEKFHG-MI-------
D5BMI1_PUNMI/9-274--------------------------------------------------------------SILKRLRA-KI-------
E3HW38_ACHXA/8-274--------------------------------------------------------------ELLDKYRA-MV-------
I3TKL1_TISMK/9-274--------------------------------------------------------------.LMDRFRR-MV-------
J7TQW5_MORMO/8-273--------------------------------------------------------------.LLKKFND-MI-------
Q2RQL8_RHORT/9-274--------------------------------------------------------------.LLETFHE-MV-------
Q89PU9_BRADU/9-274--------------------------------------------------------------.LLRRFRG-MA-------
D3VIG2_XENNA/6-272--------------------------------------------------------------QIIKDIKQ-KI-------
Q7N7U1_PHOLL/7-273--------------------------------------------------------------QIIETLKQ-KV-------
L0D8C0_SINAD/27-292--------------------------------------------------------------EIVKQLRK-KV-------
Q7UK17_RHOBA/15-279--------------------------------------------------------------SILSGFRK-KR-------
B2ATL3_PODAN/9-281--------------------------------------------------------------EILHRLRS-QI-------
M7SDL1_EUTLA/15-281--------------------------------------------------------------EALEALRA-SL-------
G9MDH1_HYPVG/9-275--------------------------------------------------------------KILASLRA-RI-------
T5ADJ6_OPHSC/10-273--------------------------------------------------------------.ILANLRA-QV-------
M1WHF6_CLAP2/9-277--------------------------------------------------------------DIVAKLRA-QI-------
M2T3U4_COCSN/9-275--------------------------------------------------------------SILENLRS-QI-------
C8VLH6_EMENI/9-275--------------------------------------------------------------EILSRLRA-QI-------
E9F7B6_METRA/5-271--------------------------------------------------------------EIIQRLRG-QI-------
J4W7A5_BEAB2/10-276--------------------------------------------------------------EILERLRG-QI-------
F9X0V4_ZYMTI/9-275--------------------------------------------------------------QILSGFRQ-QI-------
N1PYG8_DOTSN/9-275--------------------------------------------------------------QILDTFRK-QT-------
B8LW35_TALSN/9-275--------------------------------------------------------------EILARLRK-VI-------
C5GK37_AJEDR/9-275--------------------------------------------------------------EVLQRLRD-TI-------
B8NIT8_ASPFN/9-275--------------------------------------------------------------EVLDRLRK-TV-------
S7ZNB6_PENO1/9-275--------------------------------------------------------------EVLARLRK-TV-------
H6C7I3_EXODN/9-275--------------------------------------------------------------EVLSHLRE-QV-------
M7TTH7_BOTF1/10-275--------------------------------------------------------------.VLGRLKN-AV-------
M2QNQ6_CERS8/9-277--------------------------------------------------------------ETLAQLRE-II-------
F8Q7T4_SERL3/8-272--------------------------------------------------------------..LKHLRE-CI-------
D7SP84_VITVI/487-753--------------------------------------------------------------SIIQRLKD-QI-------
K3XVH5_SETIT/468-734--------------------------------------------------------------SILNKLKQ-HI-------
D8R7X4_SELML/473-739--------------------------------------------------------------TILANLKK-QI-------
R9NXA1_PSEHS/13-279--------------------------------------------------------------EAVERLRA-TA-------
U4LH42_PYROM/9-281--------------------------------------------------------------EALARLHA-TI-------
A5UWZ1_ROSS1/7-273--------------------------------------------------------------EILQRLRA-QI-------
B9L5F1_THERP/10-276--------------------------------------------------------------EALAKLRQ-TL-------
I4EWM7_MODMB/6-271--------------------------------------------------------------.ARQRLRE-TR-------
C5C4B4_BEUC1/7-272--------------------------------------------------------------ELLDRLNA-KI-------
L0DC12_SINAD/11-276--------------------------------------------------------------EILDRFRR-KV-------
B5Y6G1_COPPD/8-273--------------------------------------------------------------.ALERLQS-QV-------
I4BU20_ANAMD/8-273--------------------------------------------------------------EALKKLRA-NV-------
Q5UWI2_HALMA/21-288--------------------------------------------------------------.SLLRLRE-TV-------
D2R8M3_PIRSD/8-274--------------------------------------------------------------EILLRLRA-KV-------
G8XHR5_STREN/101-367--------------------------------------------------------------DVLRRLHA-KA-------
K7SG60_PROA4/5-271--------------------------------------------------------------EILDRFRA-QV-------
X4REF3_9ACTO/5-271--------------------------------------------------------------TILERLHT-QV-------
B2A8A0_NATTJ/6-272--------------------------------------------------------------DILKHIDE-QE-------
E4RLZ6_HALHG/7-273--------------------------------------------------------------EVREKLLA-EV-------
Q893M3_CLOTE/7-273--------------------------------------------------------------QIYENLKK-QI-------
H6LDL9_ACEWD/7-273--------------------------------------------------------------EVLRRLRE-QG-------
R6I4I1_9ACTN/8-274--------------------------------------------------------------EILDRFRK-SL-------

PF15617

H9TH48_SALET/4-300----------TREDIAD----AV------------------------------------------LHGKIPGLRSLVICL
A0A0H3CW75_ENTCC/4-300----------TREDIAD----AV------------------------------------------LHGKIPGLRSLVICL
A0A023YVC9_ECOLX/4-300----------TREDIAD----AV------------------------------------------LHGKIPGLRSLVICL
A7MPV2_CROS8/4-300----------TREDIAD----AV------------------------------------------LNGKIPGLRSLVICL
B5RKC3_KLEP3/4-300----------TRKDIAE----VV------------------------------------------LEGKIPGLRSLVVCL
D0KLU5_PECWW/4-299----------TRTDIAD----VI------------------------------------------LTDKISGLRSLVICL
B4EW80_PROMH/4-300----------TRTDIAA----TI------------------------------------------IDQKIDGLRSLIICL
D3V2D7_XENBS/4-302----------TRQGIAE----IV------------------------------------------LHNKIPGLRSLVICL
Q7CKQ7_YERPE/4-300----------TRTDIAD----II------------------------------------------IHNKISGLRSLVICL
E1PL56_PANVC/4-300----------TRTDLAE----VI------------------------------------------LHGKIPELRSMVICL
D3VJW5_XENNA/4-307----------TRQDIAE----IV------------------------------------------LQNKIVGLRSLVICL
Q888S8_PSESM/3-297----------TRDDIVD----VV------------------------------------------FGEKIPELRSLVVCL
Q4ZYA8_PSEU2/3-297----------TRDDIVD----VV------------------------------------------FGEKIPELRSLVVCL
F3K7E7_PSEAJ/3-297----------TRDDIVD----VV------------------------------------------FGEKIPELRSLVVCL
Q39AX0_BURL3/4-298----------TRSDILE----VV------------------------------------------SGARIPELRSLVVCL
Q6FAX8_ACIAD/1-291----------TRPDLWP----IV------------------------------------------TGEKYPELRSLVICL
A5WBK4_PSYWF/17-339----------TREDIWA----VI------------------------------------------SRSKLPNLDSVIICL
Q4FTQ0_PSYA2/59-368----------TRQDIWQ----VI------------------------------------------KRDKLPTINSIIICL
Q5NWT6_AROAE/1-291----------TRLDLLE----VV------------------------------------------RGERLSEVRSVIFCT
D3RPA3_ALLVD/1-291----------THRDVLR----IA------------------------------------------NGLKWPELRSVIFCT
Q1QCR8_PSYCK/1-315----------TRQDIWQ----VI------------------------------------------KRDKLPTINSIIICL
Q3JCD2_NITOC/22-310----------TRKDIAR----VL------------------------------------------NQQKLTGLRSAVVCT
A1VWQ0_POLNA/1-291----------THKDLSQ----IA------------------------------------------NGCLLGQVRSLIFCT
Q2RVZ6_RHORT/5-292----------TRSDLAA----IA------------------------------------------NGHRHPFLKSVILCT
Q9RSA7_DEIRA/8-299----------TRPDLVA----LG------------------------------------------SG.KHANLTSLIYCT
D5BYR3_NITHN/21-309----------TRQDVGK----IL------------------------------------------NQQKLTGLRSAVVCT
D8K7I6_NITWC/22-310----------TRKDIAR----IL------------------------------------------NQQKLTGLRSAVVCT
E8U9R3_DEIML/2-291----------TRDDLTD----LV------------------------------------------SGAKPLGARSLILCT
A8MM95_ALKOO/30-358----------IRDRIGE----DI------------------------------------------VHGRIKELMSVIICL
Q891X5_CLOTE/30-379----------VRDDIFE----II------------------------------------------YKNKYNSMQSMVICL
A8F9P5_BACP2/30-369----------TREDIAD----ML------------------------------------------LSQKYEALCSVVFCL
C9RML9_FIBSS/26-364----------TK.DFAQ----AI------------------------------------------IDKKYPGLTSMVMCF
E3IYR0_FRASU/30-378----------TRPKLAD----DV------------------------------------------RRQSAAGVASMVLCL
Q9KY27_STRCO/30-371----------TRPSLAD----DI------------------------------------------LKQSARGLVSMVLCL
A0A080UMD5_BACIU/30-361----------TRHDIEA----VI------------------------------------------TNQKYEDLSSVVFCL
Q5YN23_NOCFA/30-368----------TRADLAD----TI------------------------------------------RRRAERGVCSMVIDL
B1HUS4_LYSSC/26-371----------SMPNIVG----LI------------------------------------------QSQKYKELTSLVIDL
F2JGK5_CELLD/30-375----------IHEKLYD----YL------------------------------------------VTRKYISLTTLVICL
Q65NP8_BACLD/30-368----------NRKDIAD----VI------------------------------------------INNKYPELCSVVFCL
D1BEK0_SANKS/30-368----------TRPNLAA----DI------------------------------------------AKRAAYGVVSLVVCL
D1A9P4_THECD/30-368----------TRPTLAH----DI------------------------------------------VKAVRHGVMSMVVCL
C9ZE12_STRSW/30-371----------TRERLAD----DV------------------------------------------VKQAGRGVVSMVLCL
F4H5N5_CELFA/32-371----------TRPRLAH----DL------------------------------------------ARQAAQGAVSSVVCL
B7HBK1_BACC4/30-348----------TKETIAE----DI------------------------------------------IRKKHVDATSIILCL
A0A0B5R5V5_BACTU/30-348----------TKETIAE----DI------------------------------------------IRKKHVDATSIILCL
C8W644_DESAS/30-371----------SSIQAVN----KL------------------------------------------IENKIPGLVSTVLCL
Q82B97_STRAW/30-370----------TRPQLAD----DV------------------------------------------VKQAGRGVVSMVLCL
Q0SDY5_RHOJR/44-383----------TRSDLAD----TI------------------------------------------LRRSGDGVCSMVLDL
Q72YD0_BACC1/30-348----------TKETIAE----DI------------------------------------------IRKKHVEATSIIFCL
C1B1Z6_RHOOB/52-391----------TRSDLAD----TI------------------------------------------LRRSADGVCSMVLDL
A4J1D5_DESRM/16-360----------TANRAID----KV------------------------------------------INNEIPGLTSTVLCL
C0ZNQ3_RHOE4/41-379----------TRAGLAD----IV------------------------------------------VKRASEGVSSMVLDL
C0Z9Y5_BREBN/30-378----------IRTTISH----DV------------------------------------------MTQKHEGLVSMVICL
Q186J7_PEPD6/30-345----------TQYNMIY----KS------------------------------------------IIGDVKGVRPLAICL
E3EE66_PAEPS/10-368----------TRLEVAE----EI------------------------------------------KNGKHEGLTTVILDL
F4D0A7_PSEUX/30-375----------DRPALAA----DI------------------------------------------AKQATAGVTSVVVCL
E6UGJ0_RUMA7/26-367----------TK.DFTP----KI------------------------------------------LSGAMPGLTTVVLCF
D0L8D1_GORB4/35-372----------TRPDLAD----TI------------------------------------------THRHAEGVTSMVIDL
B1VYI2_STRGG/30-395----------TRPSLAD----DV------------------------------------------LKQAARGVVSMVLCL
C9YLT5_PEPDR/30-345----------TQYNMIY----KS------------------------------------------IIGDVKGVRPLAICL
F4EXE4_SELS3/15-331----------YQENIVE----KI------------------------------------------RRQKNEHLTAICFCL
C8XAU7_NAKMY/30-369----------TRSDLAT----TV------------------------------------------RRRAAAGARSMVIDL
A8L403_FRASN/30-378----------TRPRLAS----DV------------------------------------------RRQVAAGVTSMVLCL
A6WD82_KINRD/30-375----------TRERLAG----DL------------------------------------------LRLARRGVLSAVACL
Q0RDF4_FRAAA/30-378----------TRPHLAF----DV------------------------------------------RRQTAAGVNSMVLCL
A2RKY2_LACLM/29-388----------DSDNVIE----RL------------------------------------------KKLEKYGATSIILDL
Q2J6S0_FRASC/45-393----------TRPRLAS----DV------------------------------------------CRQTAAGVTSMVLCL
E3PRQ7_CLOSD/30-367----------TK.YIAP----YL------------------------------------------LEKRYSHLTSFVMCF

PF03328

Q9RYM1_DEIRA/24-251----------ADPYCAE----IC------------------------------------------AG---AGFDWLLIDG
Q8XL94_CLOPE/6-225----------SKPAMIR----DC------------------------------------------TI---YGADSVMFDL
Q9CGA8_LACLA/9-229----------NNPAMIK----DA------------------------------------------GI---FEADSIMFDL
RHMA_ECOLI/19-246----------TTAYMAE----IA------------------------------------------AT---SGYDWLLIDG
Q8RDW5_FUSNN/9-227----------NNPSMIT----DA------------------------------------------YI---YGPDSVMIDL
GARL_ECOLI/20-246----------SNPISTE----VL------------------------------------------GL---AGFDWLVLDG
Q9KTU0_VIBCH/11-230----------ANAAMLS----NT------------------------------------------FI---YQPDSIMFDL
Q93167_CAEEL/26-259----------SNQKMLD----KV------------------------------------------PM---MQADSVVLEL
Q9HRM8_HALSA/29-241----------DQPSLMR----KA------------------------------------------PT---TGADVVVFDL
O82487_ARATH/90-322----------FSPTLAE----IA------------------------------------------AH---AGYDYVVVDM
CITEL_DEIRA/9-223----------NRADLIA----KL------------------------------------------PR---SAPDAVVIDL
BPHF_RHOJR/18-244----------GDAYSAE----VC------------------------------------------AG---AGFDWLLIDG
A4XDW8_NOVAD/18-242----------AHPDIAE----IC------------------------------------------AG---QGYDWLLIDG
HPCH_KLEP7/15-240----------CSSYSAE----LL------------------------------------------AG---AGFDWLLIDG
C0ZQX9_RHOE4/12-226----------SDERKAR----KA------------------------------------------LS---SNADEVILDL
CITE_ECOLI/15-234----------ANAAMVS----NS------------------------------------------FI---YPADALMFDL
Q4DGT6_TRYCC/18-249----------ASHLLAG----QF------------------------------------------SH---SGYDWLLIDM
Q8ZRY2_SALTY/5-223----------ANAAMLS----TS------------------------------------------FV---YGADAVMFDL
Q99ZK8_STRP1/6-224----------ANAAMLR----DA------------------------------------------PL---FGADSIMFDL

PF02896

PPDK1_MAIZE/589-947----------ANADTPD----DA------------------------------------------LTARNNGAQGIGLCR
PT1_STACT/251-543----------ANIGTPN----DL------------------------------------------PGVIENGAEGIGLYR
PT1_CUPNH/262-557----------ANIEMAE----DA------------------------------------------GAALAAGAVGVGLFR
PT1_ECOLI/250-542----------ANIGTVR----DV------------------------------------------EGAERNGAEGVGLYR
PT1_HAEIN/250-542----------ANIGTIR----DC------------------------------------------DGAERNGAEGIGLYR
PT1P_ECOLI/416-708----------LNAGLSP----EH------------------------------------------EEKLGSRIDGIGLYR
PPSA_PYRFU/496-796----------.NVSMPE----VA------------------------------------------ERAAATGADGVGLLR
PTFAX_XANCP/521-808----------ANVNLPE----QV------------------------------------------AMALTQGAEGVGLMR
PT1_STRMU/252-546----------ANIGTPK----DV------------------------------------------EGVNNNGAEAVGLYR
PTFX2_ECOLI/362-654----------ANIAHSV----EA------------------------------------------QAAFGNGAEGVGLFR
PPSA_STAMF/504-813----------MNLGEPD----AI------------------------------------------EKYKDLPFDGIGLMR
D5AMJ7_RHOCB/521-803----------ANISDVA----EA------------------------------------------IASVEAGAEGVGLLR
Q24801_ENTHI/517-878----------ANADLPS----AA------------------------------------------KKALEFGAEGIGLCR
Q5L199_GEOKA/251-541----------ANIGTPD----DV------------------------------------------KGALANGAEGIGLYR
Q6MTX2_MYCMS/252-540----------ANIGSTN----DI------------------------------------------QSVLDSGAEGIGLFR

PF01274

MASY_EMENI/11-531----------GPTD.RK----MV------------------------------------------VNALNSDVWTYMADF
MASZ_CORGL/35-713----------GKAD.KT----GL------------------------------------------KDIVLESAITTIMDF
MASY_MYXXD/17-538----------GPVD.RK----MV------------------------------------------INALNSGANVFMADF
MASZ_ECOLI/17-697----------GKDD.PA----HI------------------------------------------NDVIVEAAISTILDC
Q9RYN3_DEIRA/10-521----------GPVD.RK----MI------------------------------------------INALNSGAKMFMADF
MASY_MAIZE/16-548----------GPAEPRK----MV------------------------------------------INALNSGAKVFMADF
MASY_ECOLI/11-533----------GPVE.RK----MV------------------------------------------INALNANVKVFMADF
MASZ_MYCLE/17-704----------GKTD.PV----GI------------------------------------------KDVILESAITTIMDF
MASY_YEAST/18-542----------GPPL.RN----ML------------------------------------------INALNAPVNTYMTDF
B5GRN8_STRC2/12-539----------GPAD.RR----MT------------------------------------------VNALNSGARVWLADF
C5MBE7_CANTT/16-539----------GPTD.RK----MV------------------------------------------INALNSNVATYMADF
M4EJ48_BRARP/22-551----------GPVE.RK----MI------------------------------------------INALNSGAKVFMADF
W1QBI0_OGAPD/27-543----------GPPD.AK----MI------------------------------------------VNAFNTDVFTYMTDF

PF00224

KPYK_EMENI/32-379............TNSVE....KI------------------------------------------NALRRAGLNVVRMNF
KPYM_FELCA/42-395............SRSVE....IL------------------------------------------KEMIKSGMNVARLNF
KPYK_HAEIN/5-350............TDRDN....NL------------------------------------------EKIIAAGANVVRMNF
KPYK_YARLI/29-376............TNSAE....MI------------------------------------------SKLRQAGLNIVRMNF
KPYC_SOLTU/19-365............SRTVP....ML------------------------------------------EKLLRAGMNVARFNF
KPYR_HUMAN/85-438............SRSVE....RL------------------------------------------KEMIKAGMNIARLNF
KPYK_LACLA/2-375GKKFGESGYWGESLDVEASAKNI------------------------------------------AALIEEGANVFRFNF
KPYK1_YEAST/18-365............TNNPE....TL------------------------------------------VALRKAGLNIVRMNF
G0RKV7_HYPJQ/42-387............TNSVE....AL------------------------------------------NKLRDAGLNVARMNF
Q1GAL0_LACDA/1-345............SDDIE....TI------------------------------------------TKLAEAGANVFRFNF
Q5KWB2_GEOKA/3-345............SESVD....KL------------------------------------------VQLIEAGMNVARLNF

PF14010

CAPPA_METHJ/3-484----------VHTPFF..TENIELTGEDEVKEAY-YVY--------------------S.....HLGCTEQMWDCEG---
D3S0D1_FERPA/2-476----------ANVPFF..ARGEYLNGEDEVKEAY-YVF--------------------S.....HFGCDEQMWDFEG---
CAPPA_HALSA/4-492----------ATLPFF..TAGDVIEGEDEIQEAY-YVY--------------------S.....HLGCDEQMWDFEG---
CAPPA_METTH/3-483----------VNPPFF..AEEPELGGEDEIREAY-YVF--------------------S.....HLGCDEQMWDCEG---
CAPPA_METKA/9-532----------.........ATKFVRVQEEPEEAV-ECL--------------------V.....ELGAEEYMVDFEG---
A8A9C2_IGNH4/3-488----------.........STVVLMPQDEVEEAI-QDV--------------------LPLDQGGRGCDEKMVDYEG---
CAPPA_SULTO/4-511----------ARVPEW..SRSEVISGESEVIEAY-LAY--------------------E.....HYEVDEVMWDAEG---
B1I2W1_DESAP/7-489----------VTVPFF..ANSQDMSGEDEIQEAY-YVI--------------------S.....HLQCQEQMWDCEG---
CAPPA_PICTO/6-508----------AKMPAW.ASEKSMIRNDDEVEEAY-QCY--------------------T......IGIKEVMWDAEG---
CAPPA_CALMQ/4-512----------ANVPQW..VVNDFIKGDDEVYEAY-MNY--------------------S.....IYDCQETMWDFEG---
CAPPA_METS5/4-509----------ATVPEW..AKGDVIEGEAEVIEAY-YAF--------------------S.....RLNVHEVMWDAEG---
CAPPA_ARCFU/2-471----------ARIPFF..AASEVLNGEDEVREAY-YVF--------------------S.....HFKCDEQMWDFEG---
CAPPA_PYRAE/3-460----------.........STVKITAGEEVDEAV-VAF--------------------L.....AYGCDEVMVDYEG---
CAPPA_SULAC/4-511----------AKVPEW..NQGEAISGENEIIEAY-LAF--------------------S.....RYGVEEVMWDAEG---
J9ZD85_LEPFM/19-520----------ARAPYWKTNNDPFISTLDEIEECY-RTY--------------------T.....DLGCQEYMWDWEG---
CAPPA_CLOPE/3-537----------.........VETYISIQQEPAEAI-KGL--------------------TPQDKGGLGIEEVMIDFEG---
CAPPA_SULSO/4-511----------AKVPEW..AKSEVIEGEDEVKEAF-LAY--------------------S.....MYGVHEVMWDAEG---

PF00311

C7M9P2_BRAFD/148-942----------ASRRAVLTKLRRISDILGEDTEEG.TPE.RRR..................QDRDLAELIETLWQTDELRR
CAPP_ACTP2/128-879----------VTRRSLVHKHVEINKCLGQLEHDD.LTE.AEQ................TKLKRRLMQLIALAWHTNEIRA
A0ZJ69_NODSP/196-1034----------IVRHTIRDKQRQVVNLLQKLDVAE.NRT.ESTLGGY........PWEAADLREQLLEEIRLWWRTDELHQ
D3VH32_XENNA/127-879----------IARRTLIHKLVEVNGCLAQLDHDD.LAD.YER................NNIMRRLRQLIAQSWHTDEIRK
Q2KZS8_BORA1/137-936----------VQRKSTLDAHREIAALLAQRDQ.T.LTA.EEI................ADIDNALLGRVDTLWQTRMLRY
D2QW47_PIRSD/157-942----------AKRRSIRAKLRRMRHALQELDRTD.LLP.RER................ARLESRIRTELTVLWQTDFLRP
A5GVT4_SYNR3/167-992----------IVRHTVRHKHRRVAHLIQRLEGLN.DEN.DSFD.............DRQGLRQQLLEEIRVWWRTDELHQ
C6D470_PAESJ/147-936----------ATRRAVLDIHKRIAEDVMELDNPT.LTY.RER................EILRDKLLNEVLILWQTDELRD
B8HVC9_CYAP4/199-1018----------IVRQTIRDKQRRIARILEQLDRVE.ATL.GSRSG...........VEMQNLHEQLIEEIRLWWRTDELHQ
C1F4Y2_ACIC5/161-947----------VARRSVLFKRRRIGEFLAHLDSIP.LPD.EEM................QDLENAVTAEITALWQSDEVRS
CAPP_SYNY3/193-1034----------IVRHTIRRKQRRVDRILRKLDQLQ.GSV.TGRDWLN........TWDAKTAIAQLTEEIRFWWRTDELHQ
B1XMB9_SYNP2/163-995----------IVRHTIRNKQRRIAGILRQLDQTE.EGL.KSLGTSD........SWEIENIQQQLTEEIRLWWRTDELHQ
A4S610_OSTLU/183-1007----------ALRRSMLKSFGIIREKLLQLQRFR.LSR.YER................AEVLDEIRSKVASAWRTDEIRR
A9RUR8_PHYPA/162-969----------AVRRSLLQKHSRIRNCLSQMYQKD.ITA.DEK................KEWDEALQREIQAAFRTDEIRR
B8GNA5_THISH/143-947----------ARRRTVMEAQRRIFLAADRLNDRR.LGR.EER................EELTQELETRIQVLWRTNEVRV
CAPP_HAHCH/132-881----------ITRRTLIQKYDQISECLESLDRSD.LLD.EEY................AKIVERLRRLITEAWHTDEIRY
B1Y159_LEPCP/163-950----------VQRKSILDAERAVAELIGERDD.L.HTA.GQR................ADNEALLRARVTQLWQTRMLRY
CAPP_THEEB/197-1011----------IVRQTIRDKQRRVARLLEQLDVLE.GAS.PHLTD...........WNAQTLRAQLMEEIRLWWRTDELHQ
A9S2G6_PHYPA/161-965----------SVRRSLLQKHTRIRSCLSQLNQVD.ITS.DER................QELDEALHREIQAAFRTDEIRR
Q54JZ3_DICDI/144-931----------IMRRTIISKNSAMGEALSSLDNQQ.LTM.FER................EDYEKRLIREVGGSWLTDEVRR
C1MJ77_MICPC/164-991----------ALRRSMLKNFARIRQCLLDLQARR.LSG.YER................AEILASMSSAIQAAWRTDEIRR
E0UJ33_CYAP2/184-1020----------IVRHTIRRKQRRIAHILQKLDQAE.ETF.RGMGLTN........SWEAEEAKEQLKEEIRLWWRTDELHQ
A5WCX5_PSYWF/133-932----------ARRRTTMNILQTLYAHSTALNDLP.EGS.LAY................QEAKQKTAETIDLLWSSDEVRT
A0JSJ3_ARTS2/161-954----------ASRRSVLDKIRRLSDVLAVSTEEG.TSA.RRR..................QDRQLAEVIDQMWQTDELRQ
B7G725_PHATC/84-877----------VQRKSLLRKYRRVSEMLAYLERPD.LDG.FEK................SSAQTSLQTILSSIWGADEIRR
CAPP_GLOVI/141-939----------IVRRTIRTKHRRIVHLLDDLDNA.........LSE..........WQQQQVHTTMLEEIRIWWRTDELHQ
C5Z450_SORBI/157-961----------SARRSLLQKNARIRNCLTQLSAKD.VTV.EDK................KELDEALHREIQAAFRTDEIRR
D1CE74_THET1/138-931----------SRRRTTLMHLRHISNLIALLDDAL.LTP.TQR................EMVIDRLREVVTALWQTDDFRE
Q117S5_TRIEI/186-1038----------IVRRTIRTKQRRIAKILQQLDQVN.ESL.SESHVDEEQVNSLVSSWKIESLKEQLTEEILLWWRTDELHQ
C1AE63_GEMAT/147-933----------VQRQSTLTVMQQIATLLEQRDRMV.LTG.EER................TESDALLTRLVLTLWHTRIVRG
A9QPD2_METI4/151-931----------IKRQTILNKLCEISSYLKKESFNS.KPS....................PAIHSTVERLIASLWLTERSRS
B0BZ90_ACAM1/184-1012----------IVRQTIRAKQRRIAKILGKLDEAE.AGL.ANNTRS.........NWEVDALQAQLTEEVRFWWRTDELHQ
A4X3B0_SALTO/171-972----------AARRSILSKLRAIADELDTETTNA.VLY.GASD..............EGPANRRLAELLDLMWQTDELRL
E3JCU0_FRASU/173-968----------ASRRSVLDVLRGIAELLDAADDPR.AQP.SRR................AVVDRRLAEAVDVLWQTDELRV
Q2JKJ2_SYNJB/177-978----------IVRHTIREKQRAFSRLLSQLDWAE.QTQ.PLQ...............AQMIKEQMAEEVLLWWRTDELHQ
A9IDM8_BORPD/139-951----------VQRKSTLDVHREISTLLLQREG.P.LTA.EEI................ADLDLALLGRVATLWQTRMLRY
A4G3V1_HERAR/147-944----------VQRKSILDAEHDIASLLAARDL.P.MTA.KER................AENTERIHSRVTTLWQTRLLRY
C1DZM5_MICSR/162-982----------ALRRSMLKNFGTVRQKLLDLQRAR.LSG.YER................AELLDSMASAIQSAWRTDEIRR
D3EKG0_GEOS4/142-928----------AMRRAILDIHKRIADDVMQLDNPT.LTF.RER................EQLREKLLNEVITLWQTDELRD
B1VUI2_STRGG/125-909----------AARRSVLNKLRRIAALLET....P.AIE.ADR................RRLDLRLAENIDLIWQTDELRV
CAPP_SYNPW/180-1003----------IVRHTVRHKQRRVASLLQQLEAQT.ESSTFEA................GTIRLQLEEEIRLWWRTDELHQ
B0JPY0_MICAN/183-1018----------IVRHTIRIKQRRISGILEKLDQAE.EIF.RSMGLTN........SREAQTVTKQLKEEIRFWWRTDELHQ
B1WNZ1_CYAA5/187-1020----------IVRHTIRLKQRRIATLLRRLDYAE.ESF.RGMGLSS........SWEAESIIEQLNEEIRLWWRTDELHQ
C8WQK0_ALIAD/133-906----------ALRRTVLDKHTKIAAFLEDMDDPR.KTP.REL................DVLRERIRTEIVALWQTRSVRK
D4ZQG2_ARTPN/196-1035----------IVRHTIRTKQRRIAKILQQLDTVD.ESY.GKVDNTNPEA.TGLVKTWTGELQEQLTEEIRLWWRTDELHQ
M1FKU6_9ALTE/130-889----------VTRRTLIMKYDDMSDCLEQLDHQD.LMP.SER................DGIVRRLTRLIAEAWHTDEIRY
CAPP_ECOLI/129-883----------ITRRTLIHKMVEVNACLKQLDNKD.IAD.YEH................NQLMRRLRQLIAQSWHTDEIRK
CAPP_HAEIN/129-879----------TTRRSLIHKHIEINKCLSKLEHHD.LTE.KER................NIIERLLLRLIAEAWHTNEIRT
Q0K7M4_CUPNH/207-1012----------VQRKSILDAEREIARLLAERDL.P.MTA.RER................DHNTAQLRAKVTTLWQTRMLRD
Q31KY7_SYNE7/201-1017----------IVRHTIRDKQRRIAYLLRQLDELE.TGK.NRGFRE..........LEAQNIRQQLTEEIRLWWRTDELHQ
Q46IP1_PROMT/168-994----------IVRHTVRHKQRRVATLLQQLQSNS.LIS.ESE...............KEIFRLQLEEEIRLWWRTDELHQ
CAPP_PROMP/165-989----------IVRHTIRHKQTRVANLLQKIQVEKFLTI.EDI................KSLKIQLKEEIRLWWRTDELHQ
CAPP_VIBPA/129-877----------ITRRTMINKLVKINECLSKLELSD.LSS.KER................KKTERRLEQLIAQSWHSDVIRQ
CAPP_SHEON/129-881----------ISRRTLIQKYAAIVDCLAEQENNQ.LSD.RER................QQINLRLRQLIAQIWHTNEIRR
U5GXD4_POPTR/166-968----------SVRRSLLQKHARIRNCLAQLYAKD.ITP.DDK................QELDEALQREIQAAFRTDEIRR

PF00463

ACEA_EMENI/14-536-----------DSRWRYTKR-PFTAEQIVAKRGN-LK.-IEYPSNVQAKKLWGILERNFKNKEASFTY--GCLDPTMVTQ
ACEA_YEAST/22-550-----------DSRWSKTKR-NYSARDIAVRRGT-FPP-IEYPSSVMARKLFKVLEKHHNEGTVSKTF--GALDPVQISQ
ACEA1_SOYBN/3-534-----------SERFRLTKR-PYTARDVVSLRGN-LR.-QTYASNEMAKKLWRLLKNHQANGTASRTF--GALDPVQVTQ
ACEA_YARLI/10-536-----------SPRWKHTKR-VYSPEDIASRRGT-IK.-VPQASSQQADKLFKLLQEHEKNHTASFTY--GALDPVQVTQ
ACEA_NEUCR/23-547-----------DSRWRQTKR-PFTAEQIVSKRGN-LK.-IEYASNAQAKKLWKILEDRFAKRDASYTY--GCLEPTMVTQ
C5MF59_CANTT/18-543-----------EPRWRKTKR-IYSAEDIAKKRGS-LK.-ISYPSSQQADKLFKLLEQHDAEKSVSFTF--GALDPIHVAQ

PF13714

A0JTC7_ARTS2/12-246----------.QAP.E....-IL...........-...-..........................QVI--NVWDAITAKV
A0K276_ARTS2/27-270----------.DGA.A....-PL...........-...-..........................VLV--NVWDVASARL
A0QPJ7_MYCS2/16-251----------.RPG.D....-PG...........-...-..........................VLP--TVWDAWSARL
A0R0I0_MYCS2/10-256----------.AGGNI....-.............-...-..........................VAP--GAYDALSAQI
A1CA54_ASPCL/14-274----------.TPG.K....-PL...........-...-..........................VLT--NVYDAATASI
A1SIA9_NOCSJ/3-233----------.HAE.L....-PL...........-...-..........................LLP--NAWDVPSAIA
A4F7M3_SACEN/8-232----------.RAG.D....-PL...........-...-..........................LLP--NAWDLASAAA
A4FH54_SACEN/26-273----------.VPK.R....-PL...........-...-..........................VLP--NAWDAVTARL
A4X5C0_SALTO/32-264----------.RPG.Q....-PL...........-...-..........................VLP--NAWDAASARL
A4X7L5_SALTO/4-223----------.RTG.D....-PL...........-...-..........................VLP--NVWDVASARG
A4XS21_PSEMY/12-254----------.QRD.E....-LL...........-...-..........................VLP--NPWDAGSAKI
A4YVZ4_BRASO/12-249----------.ES..G....-CF...........-...-..........................VLP--NPFDAGTAKM
A5G4A7_GEOUR/12-254----------.QGP.G....-TL...........-...-..........................VLP--NAWDVASTRI
A5V3Q4_SPHWW/10-252----------.VAG.D....-PL...........-...-..........................RLV--NVWDAGSARA
A9WM41_RENSM/9-245----------.DDL......-.L...........-...-..........................ILP--NAWDAASTRL
B1VSN1_STRGG/14-249----------.AEH.R....-PL...........-...-..........................VLP--TVWDVWSART
B4RBF1_PHEZH/10-242----------.TGA.E....-IL...........-...-..........................VLP--NAWDAASAAI
B5HHA0_STRPR/15-253----------.HG..E....-ML...........-...-..........................VLP--NVWDAASATV
B5HRK0_9ACTN/12-259----------.RE..G....-CF...........-...-..........................LLP--NAWDVGSARI
B5HVC7_9ACTN/7-239----------RLPG.D....-PL...........-...-..........................VLP--GPWDALSARV
B6HSS2_PENRW/11-259----------.QPG.N....-PL...........-...-..........................ILT--NVYDAATASI
B8MDA8_TALSN/5-285----------.KN..Q...D-RV...........-...-..........................RLL--EAHDHATKEA
B9JNZ3_AGRRK/15-273----------.KR..T....-FL...........-...-..........................RFL--DIHNALSALI
B9K4D9_AGRVS/8-247----------.EGS.G....-TF...........-...-..........................IIP--NPWDIGTARI
C1D0L9_DEIDV/16-251----------.EAP.E....-IL...........-...-..........................TLA--NVWDVVSAQV
D5UDN5_CELFN/12-253----------.ESG......-AL...........-...-..........................VLP--NAWDAASAAL
C5C673_BEUC1/6-244----------.RPG.A....-PL...........-...-..........................LLP--NAWDLASARW
C5K5X0_PERM5/22-289----------.TK..APNDG-VI...........-...-..........................RAM--EAHSGLSAMI
D9SPL5_CLOC7/7-255----------.SK..N....-TL...........-...-..........................IMP--DAFDPISAKI
C6W6H2_DYAFD/19-261----------.HSG.K....-ML...........-...-..........................VLP--NIWDAAGAQL
C7Q1F2_CATAD/16-252----------.AGP.D....-VF...........-...-..........................VIA--NAWDAGTAKI
C7YUL0_NECH7/9-264----------.KPS.T....-PI...........-...-..........................VFP--NVWDVASFNT
C7YZU2_NECH7/391-674----------.AR..Q....-LIHPCPHLYQHQP-QSS-SINIAMSATQSKVDILRERLNTAKPAIAM--AAHSPLGAKL
D6Z4R6_DESAT/153-411----------.AK..P....-MV...........-...-..........................RLM--EAHNGLTGLI
C9SRU6_VERA1/11-259----------.KPS.S....-PL...........-...-..........................ILP--NIWDYASLKA
D1A2J0_THECD/5-232----------.RAG.D....-PL...........-...-..........................VLP--NAWDVASAVA
D1BED0_SANKS/11-246----------.VSG.A....-PL...........-...-..........................VLP--NAWDVASARV
D1BI43_SANKS/12-247----------.DPR.H....-PL...........-...-..........................LLS--TVWDVASALV
D9TER7_MICAI/8-239----------.RPG.D....-PL...........-...-..........................LLP--NAWDHASAAA
E3J806_FRASU/10-249----------.TRT.G....-GL...........-...-..........................VMP--NAWDGLSALM
D2B1P9_STRRD/6-236----------.HGP.E....-PL...........-...-..........................LLP--NAWDHASAAA
E3I6J4_RHOVT/30-272----------.AR..E....-AF...........-...-..........................ILP--EVWDVISARV
D2PR97_KRIFD/29-269----------.VPG.K....-PL...........-...-..........................VLP--NVWDAASARL
D2Q3B1_KRIFD/7-234----------.HGG.T....-PL...........-...-..........................VLP--NAWDPVSARI
D2Q4L3_KRIFD/4-243----------.T...G....-SF...........-...-..........................VMP--NAWDAGSAII
D3EII1_GEOS4/13-252----------...S.N....-FF...........-...-..........................ILP--NAWDAASAKT
D3V3K7_XENBS/39-278----------.EEG......-RL...........-...-..........................ILA--NSWDVMSSRL
D4AZN8_ARTBC/10-268----------.RKG.N....-PL...........-...-..........................VLC--NVYDGRTADI
D4LCE5_RUMC1/6-261----------.NG..A....-PL...........-...-..........................RIL--EAVNGLEAYV
Q01YZ5_SOLUE/12-251----------.DGP.G....-VF...........-...-..........................IIP--NPWDVGSARI
Q08U27_STIAD/11-246----------.APG.Q....-LL...........-...-..........................VLP--NVWDAMSARL
Q0BYP5_HYPNA/11-255----------.GGA.Q....-PL...........-...-..........................VLV--NIWDAGSART
Q0RPX9_FRAAA/13-247----------.RPG.V....-PL...........-...-..........................VMP--NAWDAGTARV
Q12Q29_SHEDO/14-259----------.SP..T....-TE...........-...-..........................YLM--EAHNAISAKI
Q1GKC0_RUEST/10-253----------.QKG.D....-PV...........-...-..........................VLY--NIWDAAGAKA
Q1GQT2_SPHAL/9-246----------.VPG.D....-PL...........-...-..........................ILV--NIWDAGSAKA
Q28RZ5_JANSC/10-249----------.QSG.C....-.F...........-...-..........................VMP--NPWDRGSARM
Q2JAX2_FRASC/15-255----------.EQA.S....-PF...........-...-..........................VMA--NAWDAGTARL
Q4DNR3_TRYCC/14-261----------.SK..E....-LS...........-...-..........................FLM--EAHNGLSARI
Q4KET5_PSEF5/11-270----------.RK..R....-CL...........-...-..........................RVL--EAHSPISALL
Q5E5F2_VIBF1/18-278----------.SH..G....-CI...........-...-..........................RIL--ETHNPISALI
Q5LNA0_RUEPO/10-253----------.RPG.Q....-PL...........-...-..........................ILY--NAWDAGSAQA
Q5LUG9_RUEPO/10-245----------.VPG.N....-PL...........-...-..........................VMP--NPWDIGSAKV
Q5WBL4_BACSK/19-257----------.EQS.S....-TF...........-...-..........................VLP--NAWDAMSAKM
Q65ND9_BACLD/10-248----------.HQS.D....-PF...........-...-..........................VLP--NAWDAASAKA
Q7NXV8_CHRVO/33-277----------.QDE.R....-PL...........-...-..........................LLP--TVWDALSARV
Q7P124_CHRVO/3-243----------.RQA.E....-PL...........-...-..........................LLA--NVWDAASARL
Q893V9_CLOTE/153-411----------.LR..P....-IV...........-...-..........................KAI--EVHNGITGLI
Q8EI00_SHEON/9-240----------.QQS.E....-PL...........-...-..........................ILT--NAWDAASAAI
A6TFP2_KLEP7/3-236----------.QQN.Q....-PL...........-...-..........................LLA--NVWDASSAQA
G2J0B0_PSEUL/10-251----------.RRS.G....-TF...........-...-..........................LMP--NAWDAGSARL
G8PVS4_PSEUV/10-253----------.VKG.E....-PI...........-...-..........................TIY--NIWDAGTAQA
D4GMW6_PANAM/3-261----------.AEK.G....-TL...........-...-..........................IFI--EAHNPLSALI
Y1998_MYCTU/3-229----------.HQG.V....-PF...........-...-..........................VLP--NAWDVPSALA
Q2IK57_ANADE/11-247----------.QD..G....-CF...........-...-..........................VLP--NPWDAGTARA
Q2KD40_RHIEC/10-252----------.RKG.D....-PI...........-...-..........................VLY--NIWDAGTAKA
Q63MP0_BURPS/20-277----------.TG..R....-AL...........-...-..........................RFI--ESHSPISAMI
Q8F693_LEPIN/12-250----------.ER..G....-TF...........-...-..........................IMP--NAWDAGSARM
Q8YAP2_LISMO/8-250----------.ELP.T....-PL...........-...-..........................ILY--NCWDVASARA
Q98AR7_RHILO/15-259----------.ASS.E....-LA...........-...-..........................FAM--EAHDGLSAAI
R5T8T3_9CLOT/12-269----------.EKG.E....-QV...........-...-..........................FAP--CVYDCMTAMA
R5TTB9_9CLOT/13-246----------.....G....-QL...........-...-..........................IAP--DTFDGISTRA

PF02548

C8XKD1_NAKMY/14-272-----------RAG.....R-KI------------------------------------------VMV..TAYDYPSALA
A7HMC7_FERNB/3-256-----------GK......E-PI------------------------------------------TMI..TAYDYPTARI
PANB_NITMU/2-259-----------DDG.....E-KI------------------------------------------AIV..TCYDASFAAL
E3I2N4_RHOVT/9-264-----------..G....GD-KI------------------------------------------VSL..TCYHAHTARL
PANB_THEFY/18-275-----------ERG.....E-RW------------------------------------------PML..TAYDALTARI
F0NZT0_WEEVC/9-267-----------FSG.....E-KI------------------------------------------SML..TAYDFTIATL
C5DYQ5_ZYGRC/31-296-----------LKG.....I-PI------------------------------------------TVS..TAHDYITSQW
D8RYD4_SELML/4-266-----------ARK.....E-PI------------------------------------------TMV..TAYDYPSAVH
S9W2M7_SCHCR/5-262-----------LAK.....E-KF------------------------------------------SCI..TAYDASFSRL
D2PXN9_KRIFD/534-791-----------NRG.....E-KW------------------------------------------AML..TAYDQYTAEI
H1Z987_MYROD/10-268-----------ANG.....E-KI------------------------------------------SML..TCYDYSMAKV
C5BN63_TERTT/12-267-----------DRC.....E-KF------------------------------------------TTV..ALYDAPMAAM
A8LKB6_DINSH/13-268-----------..G....AE-PI------------------------------------------VAL..TASHVQFARI
D7BNG1_ARCHD/5-260-----------AEG.....T-PI------------------------------------------TML..TSYDALTTRI
D7A714_STAND/9-264-----------..G....GE-PI------------------------------------------VSL..TSYHAHTARL
PANB_BORPD/9-265-----------..G....PG-KV------------------------------------------VAL..TAYTAPMARQ
PANB_MAGSA/9-265-----------..G....AE-PL------------------------------------------VVL..TAYTAPIARL
E8RFZ1_DESPD/5-262-----------NG......T-PI------------------------------------------AEI..TAYDYPWAKA
PANB_PROMA/4-255-----------ELG.....N-QI------------------------------------------TIL..TAWDSLSSAI
K9RVA1_SYNP3/11-268-----------QQG.....R-PI------------------------------------------TML..TAWDFLLAEI
D5WZ20_THIK1/22-279-----------EAG.....E-KI------------------------------------------AML..TAYDAASASL
B8LYN4_TALSN/78-338-----------KKN.....E-PI------------------------------------------AML..TAHDFPSAFV
K9RDA0_9CYAN/11-264-----------QQQ.....R-PI------------------------------------------VVL..TAWDYLIAQL
PANB_METRJ/10-267-----------AEG.....R-KI------------------------------------------IAL..TAYHAHTAGI
A9UP51_MONBE/1-268-----------RQG.....E-PI------------------------------------------VMV..TAYDYTSARI
PANB_PROA2/11-273-----------SEG.....E-KI------------------------------------------SML..TAYDYTTARI
F2UAL1_SALR5/62-329-----------AQG.....T-PL------------------------------------------SMI..TAYDYTSARL
V2XXG0_MONRO/40-299-----------TKK.....T-PI------------------------------------------SMI..TAYDYPAAVA
G2IQV3_9SPHN/23-282-----------ADG..ETAE-PL------------------------------------------VVL..TAYTARQAQL
PANB_CLONN/2-260-----------NNG.....E-KL------------------------------------------TML..TAYDYSTAKL
PANB_WIGBR/3-260-----------EQN.....K-KF------------------------------------------ASI..TAYDATFANL
M1FDT2_9ALTE/4-264-----------KSG.....D-KI------------------------------------------VGI..VAWDYQMANI
E4TII1_CALNY/9-264-----------HK......E-KI------------------------------------------VSL..TAYDYTSAKI
K0I9Q1_NITGG/2-255-----------GM......E-KI------------------------------------------SVL..TAYDYSTSLI
C7MD29_BRAFD/11-267-----------VEG.....R-PF------------------------------------------TML..TAYDQFSAQI
G8PQN3_PSEUV/9-264-----------..G....HH-KL------------------------------------------VCL..TAYTAPIAQM
PANB_LEPCP/16-279-----------QRG.....E-KI------------------------------------------AML..TAYESTLARV
K1VYW4_TRIAC/1535-1794-----------ASG.....T-PI------------------------------------------SVL..TAYDYPTSRL
B8I2Z4_CLOCE/9-266-----------RNG.....D-KI------------------------------------------SML..TAYDYSTAKL
I0AFM0_IGNAJ/3-258-----------QLN.....I-PI------------------------------------------SMV..TCYDYWSAQI
I4CAV2_DESTA/3-261-----------ARK.....E-PM------------------------------------------TFL..TGYDYPFALL
PANB_SULDN/4-259-----------GV......H-