Sequence alignment for CL0153

PF06501

VU55_HHV6U/3-432--------------------------------------------------------------------------------
V55B_HHV7J/5-430--------------------------------------------------------------------------------
O56289_9BETA/6-427--------------------------------------------------------------------------------

PF05784

Q91CJ4_9BETA/14-353--------------------------------------------------------------------------------
VU54_HHV6U/4-339--------------------------------------------------------------------------------
PP65_HCMVA/14-358--------------------------------------------------------------------------------
Q8QS17_9BETA/27-369--------------------------------------------------------------------------------
Q9DWB8_RCMVM/44-408--------------------------------------------------------------------------------
Q9DWB9_RCMVM/14-350--------------------------------------------------------------------------------
B7TPY7_9BETA/1-346--------------------------------------------------------------------------------
Q918H3_9BETA/11-349--------------------------------------------------------------------------------
Q918H5_9BETA/23-363--------------------------------------------------------------------------------
Q8QS16_9BETA/14-358--------------------------------------------------------------------------------
PP71_HCMVA/28-372--------------------------------------------------------------------------------
Q91TL4_TUHV1/30-399--------------------------------------------------------------------------------
O56288_9BETA/3-339--------------------------------------------------------------------------------
Q91CJ3_9BETA/14-354--------------------------------------------------------------------------------
Q9DWC0_RCMVM/15-359--------------------------------------------------------------------------------
Q91CJ2_9BETA/24-364--------------------------------------------------------------------------------
Q918H4_9BETA/14-355--------------------------------------------------------------------------------
Q98330_MUHV1/18-359--------------------------------------------------------------------------------

PF06284

Q91CJ5_9BETA/40-498MPRADKTLRNGPR.GRPRKTP...........................................................
Q8QS15_9BETA/1-573MPRGDPTLRNRAR.SRARKGPLTPSRQAHRRYRLHGSGGGGSGAGGNHHSDALLPAHAV.....................
UL84_HCMVT/1-587MPRADPNLRNRARRPRARRG.................GGGGVGSNSSRHSGKCRRQRRALSAPPLTFLATTTTTTMMGVA
Q918H2_9BETA/1-462MPRANKTMRNGPR.GRPRKAS...........................................................

PF04489

VU10_HHV6U/8-436--------------------------------------------------------------------------------
UL31_HCMVA/127-550--------------------------------------------------------------------------------
Q9DWF8_RCMVM/314-728--------------------------------------------------------------------------------
VU10_HHV7J/1-412--------------------------------------------------------------------------------

PF00692

DUT_CANAW/26-157--------------------------------------------------------------------------------
DUT_HUMAN/121-250--------------------------------------------------------------------------------
VPRT_JSRV/11-134--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
GAG_IPMA/542-670--------------------------------------------------------------------------------
VPRT_SRV2/36-160--------------------------------------------------------------------------------
DUT_EHV4/165-292--------------------------------------------------------------------------------
VPRT_MMTVB/32-156--------------------------------------------------------------------------------
POL_FIVT2/712-841--------------------------------------------------------------------------------
VPRT_SMRVH/41-165--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
POL_FIVPE/713-841--------------------------------------------------------------------------------
DUT_ORFN2/16-145--------------------------------------------------------------------------------
POL_OMVVS/675-803--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
E431_ADE02/14-141--------------------------------------------------------------------------------
VPRT_MPMV/36-160--------------------------------------------------------------------------------
DUT_HHV6G/241-368--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_SWPVK/12-141--------------------------------------------------------------------------------
DCD_ACIAM/45-169--------------------------------------------------------------------------------
POL_EIAV9/745-873--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VACCP/17-145--------------------------------------------------------------------------------
POL_CAEVC/699-827--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------

PF04797

LF2_EBVA8/37-401--------------------------------------------------------------------------------
Q8JJR5_9GAMA/8-374--------------------------------------------------------------------------------
VG10_EHV2/21-391--------------------------------------------------------------------------------
P88908_HHV8/7-390--------------------------------------------------------------------------------
Q8UZD9_9GAMA/5-437--------------------------------------------------------------------------------
Q8JJR4_9GAMA/23-387--------------------------------------------------------------------------------
Q9YTQ2_ATHV3/24-388--------------------------------------------------------------------------------
Q993K4_9GAMA/5-437--------------------------------------------------------------------------------
O39235_9GAMA/8-388--------------------------------------------------------------------------------
Q993K3_9GAMA/39-404--------------------------------------------------------------------------------
Q99D19_BHV4/8-396--------------------------------------------------------------------------------
VG10_ALHV1/6-378--------------------------------------------------------------------------------
O39236_9GAMA/25-391--------------------------------------------------------------------------------
O41932_MHV68/21-376--------------------------------------------------------------------------------
Q8AZ09_9GAMA/23-387--------------------------------------------------------------------------------
LF1_EBVB9/5-442--------------------------------------------------------------------------------
VG11_ALHV1/22-387--------------------------------------------------------------------------------
Q8B411_9GAMA/7-373--------------------------------------------------------------------------------
O41931_MHV68/8-389--------------------------------------------------------------------------------
Q9YTQ3_ATHV3/7-377--------------------------------------------------------------------------------
P88909_HHV8/23-387--------------------------------------------------------------------------------
VG11_SHV21/24-388--------------------------------------------------------------------------------
VG11_EHV2/74-450--------------------------------------------------------------------------------

PF06559

Q0G3Q2_9RHIZ/19-385--------------------------------------------------------------------------------
A3WSL0_9BRAD/1-368--------------------------------------------------------------------------------
Q9A657_CAUCR/23-363--------------------------------------------------------------------------------
A1B368_PARDP/1-361--------------------------------------------------------------------------------
A4EMM0_9RHOB/5-363--------------------------------------------------------------------------------
A3VLC8_9RHOB/1-361--------------------------------------------------------------------------------
E0TCQ3_PARBH/2-367--------------------------------------------------------------------------------
B1ZJ40_METPB/1-365--------------------------------------------------------------------------------
A3JU06_9RHOB/1-362--------------------------------------------------------------------------------
A3UGF0_9RHOB/1-339--------------------------------------------------------------------------------
Q0ASF2_MARMM/1-338--------------------------------------------------------------------------------
A7ICI7_XANP2/2-372--------------------------------------------------------------------------------
Q1YJY6_MOBAS/4-370--------------------------------------------------------------------------------
Q28RG4_JANSC/1-361--------------------------------------------------------------------------------
A7HQ50_PARL1/20-384--------------------------------------------------------------------------------
A0NR82_9RHOB/9-376--------------------------------------------------------------------------------
A6U5R4_SINMW/1-364--------------------------------------------------------------------------------

PF06501

VU55_HHV6U/3-432---------------------SPQLNHVLQLVFDCNH.I-----VSN.SYQEIILKCRISS--TKPGILFITD-------
V55B_HHV7J/5-430---------------------TSDILKYVQIEIPYKEEF-----QGKDNVTLLFDEYVQSK--TEPVLLLSAE-------
O56289_9BETA/6-427---------------------VSELSQLIQFTVDFND.L-----QPELNFSPAEITCILSH--ERPVLLLITD-------

PF05784

Q91CJ4_9BETA/14-353------------------DLGPTSGHLVKLIFNANKEHL-----NPHTTYIADTHLNVRVN--Q.PSVILATQ-------
VU54_HHV6U/4-339------------------ATLQWSSYVLQLRV.TTTAIL-----KPGELRLFKCGLGITPP--S.SAVVCICR-------
PP65_HCMVA/14-358------------------VLGPISGHVLKAVFSRGDTPV-----LPHETRLLQTGIHVRVS--Q.PSLILVSQ-------
Q8QS17_9BETA/27-369------------------TFGRMHCQVLRLVTN.HDSSL-----EPDRLKILDLRTSVEVS--R.TSVLCLFQ-------
Q9DWB8_RCMVM/44-408------------------AGTQNRLSYTLELLIDLDVSF-----DPYETKLLDTGVRVTPH--T.ACILFCTK-------
Q9DWB9_RCMVM/14-350------------------SSSPCGLTKILLGRLAPRTQF-----QVREWKRLATGATVMLT--R.PSVLCVCD-------
B7TPY7_9BETA/1-346------------------MERYVGLGTTLHLALQVEGPF-----GPHETRFVHFDATFTVP--RTPSVVIVAE-------
Q918H3_9BETA/11-349------------------FLTVISGNVVKAVFNKSTVTI-----QPHQSYTLRTGIKVEVS--Q.PAIILATQ-------
Q918H5_9BETA/23-363------------------TFERLSCQVMRVI.STQNTTL-----EADAVKVVNWHTHVQVA--N.PAVICAFQ-------
Q8QS16_9BETA/14-358------------------VLGPISGHVLKAVFSRGETPL-----QPHETKSLQTGIDVKVS--Q.HSLILISQ-------
PP71_HCMVA/28-372------------------SFGRLHCQVLRLITNVEGGSL-----EAGRLRLLDLRTNIEVS--R.PSVLCCFQ-------
Q91TL4_TUHV1/30-399------------------ATPPARAASLIQLRYRQDVTF-----RPREVKLLRTGLSLLNL--PAEHLVCVTA-------
O56288_9BETA/3-339------------------SCYVVWSSYFLQLKLTAPILL-----KPREIRCLRTGLSILSQ--Q.STFVCMCR-------
Q91CJ3_9BETA/14-354------------------ELGPIAGKVIQSVFDEAREPV-----KPHETKIVKTGLRVQVH--R.PSIIFLTQ-------
Q9DWC0_RCMVM/15-359------------------SPYAYGKTQCLNLSLTNGPVF-----RPGESKRLKSGLSVATK--S.PAVICVAE-------
Q91CJ2_9BETA/24-364------------------TFERLTCQILRLV.CTQHSPL-----DVDAVQTMNWHTSVEVA--N.RAVICAFQ-------
Q918H4_9BETA/14-355------------------EIGPISGKIFKNVLSEAHEPV-----NSEETKVVKTGIDVQVS--Q.HSIIFVTQ-------
Q98330_MUHV1/18-359------------------TSSMVGSTKILLASFLQRVFF-----EPEELKVFSTGIKILLK--R.PSVLCVCR-------

PF06284

Q91CJ5_9BETA/40-498................PSLLLDETILTLTDQHHVKRPLP-----RQGTYRLIQLHVDFQPSDLQHPFQILLSTLLQL...
Q8QS15_9BETA/1-573..................GPDDDTILTLTDKHNAKQPLT-----HRGTYHLIQLHIDLRPEELQHPFQILLSAPLQLVE.
UL84_HCMVT/1-587STDDDSLLLKTPDELDKHSGSPQTILTLTDKHDIRQPRV-----HRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEA
Q918H2_9BETA/1-462................VLLQSDETILTLTDQHHIKNPLT-----RHGTFRLIQLHVDFQPADLQHPFQILLSAPLKL...

PF04489

VU10_HHV6U/8-436------------------TVSA..RSPTVTWSSGFGRAI..ASIQKRNQDNI..RKPLRFY--TGLLHCLIKQ-------
UL31_HCMVA/127-550------------------TSWIEALRDA..DRDNYGRCV....RHAKIHRSA...SHLTAY--ESYLVSITEQ-------
Q9DWF8_RCMVM/314-728------------------DTSGECMREICDNLTKYTNSIDFATQDSRFQTNASPRRHINSY--RGRLLTIVCQ-------
VU10_HHV7J/1-412------------------MAIA..ESGAFEINVNLGKSI..ASIQKNPIIYM..RRHLSFY--VELLKFIIHQ-------

PF00692

DUT_CANAW/26-157--------------------------------------------PKGKVPTKGSALAA----------------------
DUT_HUMAN/121-250--------------------------------------------EHATAPTRGSARAA----------------------
VPRT_JSRV/11-134--------------------------------------------RTIADLCRATRGSA----------------------
DUT_ICHVA/62-187--------------------------------------------ADVSIPKISSPGSA----------------------
GAG_IPMA/542-670--------------------------------------------GPRKQSERRPRKTH----------------------
VPRT_SRV2/36-160--------------------------------------------QSISKLNRASPGSA----------------------
DUT_EHV4/165-292--------------------------------------------IFYDYFAPKRDEDA----------------------
VPRT_MMTVB/32-156--------------------------------------------FTIHDLPRGTPGSA----------------------
POL_FIVT2/712-841--------------------------------------------IEGEGILEKRSEDA----------------------
VPRT_SMRVH/41-165--------------------------------------------RYVTDLWRATAGSA----------------------
DUT_EBVB9/119-240--------------------------------------------DKGPINHPQYPGDV----------------------
DUT_SHV21/120-244--------------------------------------------DYSDLCPPRYSKDA----------------------
DUT_HAEIN/15-149--------------------------------------------NEFPLPTYATEGSA----------------------
POL_FIVPE/713-841--------------------------------------------IEGDGILDKRSEDA----------------------
DUT_ORFN2/16-145--------------------------------------------QNATIPARGSPGAA----------------------
POL_OMVVS/675-803--------------------------------------------REGSGILPKRAEDA----------------------
DUT_HHV11/206-337--------------------------------------------REAIAFLPKREEDA----------------------
E431_ADE02/14-141--------------------------------------------REGAILPRQEGFSG----------------------
VPRT_MPMV/36-160--------------------------------------------QPISKLTRATPGSA----------------------
DUT_HHV6G/241-368--------------------------------------------EPWEMINLSPPEFA----------------------
DUT_YEAST/16-146--------------------------------------------ASATVPTKGSATAA----------------------
DUT_SWPVK/12-141--------------------------------------------NNAIIPNRSMSGSA----------------------
DCD_ACIAM/45-169--------------------------------------------KTDEIYEDGKDPRS----------------------
POL_EIAV9/745-873--------------------------------------------YQGTQIKEKRDEDA----------------------
DUT_ECOLI/15-149--------------------------------------------KEFPLPTYATSGSA----------------------
DUT_VACCP/17-145--------------------------------------------NRAKSPTRQSPGAA----------------------
POL_CAEVC/699-827--------------------------------------------KEGEGILPKREEDA----------------------
DUT_VZVD/225-354--------------------------------------------TYKHIINPKRQEDA----------------------
DUT_SOLLC/39-168--------------------------------------------ENAVLPSRASSLAA----------------------

PF04797

LF2_EBVA8/37-401------------------FMRGV----WKYEIFPSYVRV----.TNKQVLQLDAQCQE......LPPCPSVGQ-------
Q8JJR5_9GAMA/8-374------------------LDLGL----WTVKANFGRFIL----.VNNYDMNFRPTMTH....FNLPFSVTH..-------
VG10_EHV2/21-391------------------FFVEN----WKVEVTPAALTV----.VNTSEVPVQDPRCT...IITLPFSVWSA.-------
P88908_HHV8/7-390------------------FILGD----WEITVSNCRFTC----.SSLTCGPLYRSSGDY.TRLRIPFSLDR..-------
Q8UZD9_9GAMA/5-437------------------TDLSA----WRVEIGSRGLAF----.SNCLPLDLPEGQYH.....KLRLPVSAYE-------
Q8JJR4_9GAMA/23-387------------------TTESL----WTFTVFNTYVKF----.TNNRGFKLTSNDTH......LPTCMCLAN-------
Q9YTQ2_ATHV3/24-388------------------FNYLF----WSSSVHEHFITI----.TNNQEIQILPDDVL......LARCPSIRE-------
Q993K4_9GAMA/5-437------------------QRLGE----WVVNIIPSGLTI----.HNADVIYPSCHNGG...ICVLPLSFSVYE-------
O39235_9GAMA/8-388------------------VVLGD----WEVTFHRGRFSF----.VNLTRLQTFKGHGGY.ARVRLPFSLDQ..-------
Q993K3_9GAMA/39-404------------------FTRGM----WKYELYKSHVKI----.TNKQVLELDATCQE......LPPCPSVGQ-------
Q99D19_BHV4/8-396------------------FSIEG----WQVNICNGNIIL----MTNLKDIPVQGGYGMLVKKVFLPLSLNQ..-------
VG10_ALHV1/6-378------------------APMNM----WSVRIVNGIFVL----.SNKKPLNLPAHLSQ....LNIPYSVHF..-------
O39236_9GAMA/25-391------------------YSSLV----WAATIHDGYLTL----.VNRSELCVTERSPC......LPACPSIGR-------
O41932_MHV68/21-376------------------FANYA----WKHTIKPNRILI----.RNARPLVINFATDR......LPIIKPVDQ-------
Q8AZ09_9GAMA/23-387------------------LTANA----WTFTIYRTYIRF----.TNNKKLKLTANDGC......LPPCSSLEN-------
LF1_EBVB9/5-442------------------TDTQA----WRVEIGTRGLMF----.SNCVPLHLPEGQYH.....KLRLPVSAYE-------
VG11_ALHV1/22-387------------------LQLSH----WDFTIYDTYIKM----.TNIHHITTTSNDSC......LPTCPPLAE-------
Q8B411_9GAMA/7-373------------------IDLGL----WTLRASFGRFIL----.VNNYDMDFKLKITH....FNLPFSVKH..-------
O41931_MHV68/8-389------------------IILNH----WCVTWQGHHFLC----.RNLSNIKILNRRNGY.TTLDLPLTLGD..-------
Q9YTQ3_ATHV3/7-377------------------FIWGR----WTVTVSSGLFSI----.SNNEEIAPPATPVAR..PVHLPFSIES..-------
P88909_HHV8/23-387------------------RGEPV----WDSVIHPSHIVI----.SNRVPLLLREQHIC......LPSCPSVGQ-------
VG11_SHV21/24-388------------------FNYSF----WNCSVHEHFISI----.TNNREIHILPDDLL......LPRCPSIRA-------
VG11_EHV2/74-450------------------PGDPF----WSFSVYATYVKV----.TNKIRFVPGMLADC.....TLPYLPNLKN-------

PF06559

Q0G3Q2_9RHIZ/19-385------------------VANEQ.AKPQGGILPDRDIAE----LFETGSIAIPRARDE---DQIQPASLDLRL-------
A3WSL0_9BRAD/1-368------------------MSFSL.PPDANGILPDRMIAA----MADAGLILPEYPFVE---SQIQPASLDLRL-------
Q9A657_CAUCR/23-363------------------APMTD..AHSAGILPCQTIEE----LIAEEAITSATPFDV---DQVQPASLDLRL-------
A1B368_PARDP/1-361------------------MPKGF...RVNGVLPDTSLRQ----LIASGAISADQPILP---EQVQPASLDLRL-------
A4EMM0_9RHOB/5-363------------------MTQT.......GVLADHQIRD----MIAAGSIAAEAAIED---GQIQPASLDLRL-------
A3VLC8_9RHOB/1-361------------------MTMTG.....TGVLPSQTLRQ----MIDAGTLAADPVIIP---EQIQPASLDLRL-------
E0TCQ3_PARBH/2-367------------------RRRSLDTPHPLGVFAEDDLAA----LVAAETITLSAQCGE---CQIQPASFDLTL-------
B1ZJ40_METPB/1-365------------------MSGDV..PAASGILPAQAITV----LTEAGAIRPATVYAA---DQIQPASLDLRL-------
A3JU06_9RHOB/1-362------------------MRQEM....NNGVLPSQTLTA----MIANGEITADPAVDP---AQIQPASVDMRL-------
A3UGF0_9RHOB/1-339------------------MTLAP......GILPDRALLD----ALAQGWIRSGVDLEP---GQIQPASLDLRL-------
Q0ASF2_MARMM/1-338------------------MADT.......GILPDHHLAA----LAGRGILTTAAPLAD---GQVQPASIDLRL-------
A7ICI7_XANP2/2-372------------------TVRAT.EHQKPGILPAEAISA----LKATGAISCRRPLDA---DQIQPASLDLRL-------
Q1YJY6_MOBAS/4-370------------------QPMSD.TYAQGGILPDQEIAG----LFAAGAIAVPIERDG---DQIQPASLDLRL-------
Q28RG4_JANSC/1-361------------------MTDST.QTHPQGVLPDHAISA----MIESGAITATMPVPD---GQIQPASLDLRL-------
A7HQ50_PARL1/20-384------------------GPGQL...HATGILPSHGIQA----LIREKEIWGGLEIDP---AQIQPASLDLRL-------
A0NR82_9RHOB/9-376------------------LNGSA.ILTANGILPERVIQA----MFAAGEISADAPPVT---GQIQPASLDLRL-------
A6U5R4_SINMW/1-364------------------MGRET......GILADRAIAA----LFGSGRLKSEKALDG---DQIQPASLDLRL-------

PF06501

VU55_HHV6U/3-432----------------------------------GTESETEDV-------------------LFDVQFLE----------
V55B_HHV7J/5-430----------------------------------.INSRNSDS-------------------FFSARPLM----------
O56289_9BETA/6-427----------------------------------GTENNAECV-------------------TLVGHVLK----------

PF05784

Q91CJ4_9BETA/14-353----------------------------------FTPESQPCQRYDTN..........LQIKHTAFEPR.----------
VU54_HHV6U/4-339----------------------------------DESSFTSSP...................FTYIDPK.----------
PP65_HCMVA/14-358----------------------------------YTPDSTPCHRGDNQ..........LQVQHTYFTGS.----------
Q8QS17_9BETA/27-369----------------------------------EN.KSQHDTVDLTD..........LNVKGHCAVG..----------
Q9DWB8_RCMVM/44-408----------------------------------ISSAASPPHAVDFV.........ALGPNARDADEGK----------
Q9DWB9_RCMVM/14-350----------------------------------MWAFEQRPY...............LRGTFHVVDSTH----------
B7TPY7_9BETA/1-346----------------------------------EQVGSHLPPSSP............LRMKFRAIHSQE----------
Q918H3_9BETA/11-349----------------------------------FTPESQPCQRYDTD..........IQIKHAALEAR.----------
Q918H5_9BETA/23-363----------------------------------ESTCTRDALQLTD...........ISIKGRSSSTL.----------
Q8QS16_9BETA/14-358----------------------------------YTPESTPCHRGDNH..........LMVQHTYHTGE.----------
PP71_HCMVA/28-372----------------------------------EN.KSPHDTVDLTD..........LNIKGRCVVG..----------
Q91TL4_TUHV1/30-399----------------------------------NVSDDERGRGDDDDDDGAGAAGPPIQPKFTVLDGET----------
O56288_9BETA/3-339----------------------------------DEGSFTAAY...................FTYIDLR.----------
Q91CJ3_9BETA/14-354----------------------------------FARNLKPDPRYEHN.........TLQIKHMTFEDQ.----------
Q9DWC0_RCMVM/15-359----------------------------------RTPHPRRRRP..............FAVKFTYLDGQE----------
Q91CJ2_9BETA/24-364----------------------------------EMKSSRDALQLTD...........LNLKGHCSSTF.----------
Q918H4_9BETA/14-355----------------------------------LTSRSQAEYYHEPN..........LQIKHTVFEEQ.----------
Q98330_MUHV1/18-359----------------------------------DEGMMVPFQENKKR.........FLHTMFYAVNTQF----------

PF06284

Q91CJ5_9BETA/40-498..................................EPLSPHRDPEEQGLLCAVANPDSDIFPILSPFPAQA----------
Q8QS15_9BETA/1-573NSAARRQHATASEERTAGNEEKEGAGE.....EEEDEDDRNEDRERGILCVVSNEDSDIRPAFSLFPARP----------
UL84_HCMVT/1-587NGESQTAPATSQEEETAASHELEKKKEKEEKKEEEDEDDRNDDRERGILCVVSNEDSDVRPAFSLFPARP----------
Q918H2_9BETA/1-462..................................ESITPHRDPEERGLLCAVANGDSDIFPNLTLFPAQA----------

PF04489

VU10_HHV6U/8-436----------------------------------YEHCLVPPNKSIRFDKGKIEVAALILDLGHQVLGRQIHVRQRIYSW
UL31_HCMVA/127-550----------------------------------YNT.ASNVTEKASYVQGCIFLSFPVIYNNTQGCGYK.......YDW
Q9DWF8_RCMVM/314-728----------------------------------YNQ.LVPDELRARYHKGGIHFSTTVMASPFHLPDGT......LHNW
VU10_HHV7J/1-412----------------------------------YEQCFLPPKGTILYHNGLIELNTLIIDLNQQITSK.....QQIYSW

PF00692

DUT_CANAW/26-157--------------------------------------------------------------------------------
DUT_HUMAN/121-250--------------------------------------------------------------------------------
VPRT_JSRV/11-134--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
GAG_IPMA/542-670--------------------------------------------------------------------------------
VPRT_SRV2/36-160--------------------------------------------------------------------------------
DUT_EHV4/165-292--------------------------------------------------------------------------------
VPRT_MMTVB/32-156--------------------------------------------------------------------------------
POL_FIVT2/712-841--------------------------------------------------------------------------------
VPRT_SMRVH/41-165--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
POL_FIVPE/713-841--------------------------------------------------------------------------------
DUT_ORFN2/16-145--------------------------------------------------------------------------------
POL_OMVVS/675-803--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
E431_ADE02/14-141--------------------------------------------------------------------------------
VPRT_MPMV/36-160--------------------------------------------------------------------------------
DUT_HHV6G/241-368--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_SWPVK/12-141--------------------------------------------------------------------------------
DCD_ACIAM/45-169--------------------------------------------------------------------------------
POL_EIAV9/745-873--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VACCP/17-145--------------------------------------------------------------------------------
POL_CAEVC/699-827--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------

PF04797

LF2_EBVA8/37-401----------------------------------ILSFKLPSFSFNTTTYGSR.YFTVAFLFFGA....ED---------
Q8JJR5_9GAMA/8-374----------------------------------.LVDELVSFGLVQSFFDISEIQMSCALILQC...GQS---------
VG10_EHV2/21-391----------------------------------.MECMLCRFQPANQLHVACKLFDTTFILQNQ..DLDQ---------
P88908_HHV8/7-390----------------------------------.LIRDHAIFGLVPNIEDLLTHGSCVAVVADANATGGN---------
Q8UZD9_9GAMA/5-437----------------------------------ALA..VARYGLVGSLWEVPAVNSGLPCLAAA...DTR---------
Q8JJR4_9GAMA/23-387----------------------------------ILQDVIPGYFYSSELIKYK.QTVLKFLIFGD....PD---------
Q9YTQ2_ATHV3/24-388----------------------------------IVGKQLPNFKFSGSRYGPP.GTITSFYVYGH....CE---------
Q993K4_9GAMA/5-437----------------------------------ALS..VARYGLVKSLWDTEEIKSTLQCILPH...KPS---------
O39235_9GAMA/8-388----------------------------------.LLHQHFAFGLVTRLKELPPFSDCVALIAPLDSGGDA---------
Q993K3_9GAMA/39-404----------------------------------IIRYQFPAFNFNSATYGSR.YFTCAFVIFGD....TE---------
Q99D19_BHV4/8-396----------------------------------.LINNYISFGLVQSIFELEDYAQCTAMLVQCRFPGIR---------
VG10_ALHV1/6-378----------------------------------.IVDSLASFGLLSSLFSLDQVKQSCALLVQH...KPN---------
O39236_9GAMA/25-391----------------------------------LVGKRFPGFAFASATLGDR.GTRTVFYAFGH....RD---------
O41932_MHV68/21-376----------------------------------IILEDAGTVGSALNLPSESICTRPGLLLFGH....YN---------
Q8AZ09_9GAMA/23-387----------------------------------ILHEEIPGYFYNSILMEHK.QITLKFLLFGD....SG---------
LF1_EBVB9/5-442----------------------------------ALA..VARYGLVGSLWEVPAVNSALQCLAAA...APC---------
VG11_ALHV1/22-387----------------------------------ILKDKIPGYAFYSSAWQCQ.TMWMRFLIFGD....ED---------
Q8B411_9GAMA/7-373----------------------------------.LADELVSFGLVKSLFDVSTVRASCAVILQC...GHC---------
O41931_MHV68/8-389----------------------------------.LTQYRLAHGLSENLMALSPYSWTIPFLVSS...SET---------
Q9YTQ3_ATHV3/7-377----------------------------------.IIDKRVSHGLVPTLLQFQQYTNSVPAVFSDT.SEQP---------
P88909_HHV8/23-387----------------------------------ILHRAYPNFTFDNTHRKQQTETYTAFYAFGD....QN---------
VG11_SHV21/24-388----------------------------------ILFKQIPSFKFSGSRSGPP.GTVTSLYVYGH....SK---------
VG11_EHV2/74-450----------------------------------ILAGRYPNFHFTTTAHGGN.LSEVAFLAVEC....PR---------

PF06559

Q0G3Q2_9RHIZ/19-385----------------------------------GDRAYRVRASFLPGIERTVEDKL.KRFSLHEFSLEDG---------
A3WSL0_9BRAD/1-368----------------------------------GTMAYRVRASFLPGPDATVAERI.DELKLHEVDLTDG---------
Q9A657_CAUCR/23-363----------------------------------GARAWRIRASFLPGLSRRVPERL.KDVAMHELDLTKG---------
A1B368_PARDP/1-361----------------------------------GATAWRLRASFLAGRGRKVSDRL.RDFEMHRMDLTDG---------
A4EMM0_9RHOB/5-363----------------------------------GQTAYRVRASFLAGRQRTVKERL.EDFQMHAVELEGG---------
A3VLC8_9RHOB/1-361----------------------------------GTVAYRVRASFLAGEGRTVADRL.DEFEMHRIDLTHG---------
E0TCQ3_PARBH/2-367----------------------------------GQRAWRIRAAFLPGPARSVKSCLDEGLGLHVLDLTDG---------
B1ZJ40_METPB/1-365----------------------------------GTRAYRVRTSFLPGSGRSVAACV.EAFALHEIDLTHG---------
A3JU06_9RHOB/1-362----------------------------------GNVAYRVRASFLAGAGRKVADRL.PEFQMHEVDLTNG---------
A3UGF0_9RHOB/1-339----------------------------------ARRAWRLRASFLPGPERTVTDCLDDDVVMHELDLEGG---------
Q0ASF2_MARMM/1-338----------------------------------GSKAWRLRASFLPGPGRTVAERLDDDLVMHTVDLTAG---------
A7ICI7_XANP2/2-372----------------------------------GRTAWRVRASFLPGAGVSVKERL.ADLALHDFDLAKG---------
Q1YJY6_MOBAS/4-370----------------------------------GPKAYRVRASFLPGQGQSVVDKL.DRFSLHEFSLADG---------
Q28RG4_JANSC/1-361----------------------------------GTKAYRVRASFLTGAGRSVAERL.PEFTMHEMDLTHG---------
A7HQ50_PARL1/20-384----------------------------------GATAYRLRASFLPGPDHGVMERV.EELMLHKIDLTDG---------
A0NR82_9RHOB/9-376----------------------------------GQQAYRVRASFLPGPEIQVAARL.EQMKLHTVDLSEG---------
A6U5R4_SINMW/1-364----------------------------------GSTAFRVRASFMPGPSHLVADKL.DRLKLHVIDLSDG---------

PF06501

VU55_HHV6U/3-432---------KTTT-IKIKILPISRTV----------.PV-RIHLF---------SIPIYLPSHALEIDDINALCQKENID
V55B_HHV7J/5-430---------EEQQ-LKLHLKNLNRHI----------YPS-KVLFF---------GFPLLKINSSIVIIP........NHD
O56289_9BETA/6-427---------NKKV-IKINVFPMIQSI----------.NF-.VNIF---------ALPIFNITSSLLIQDNCYF..KENMD

PF05784

Q91CJ4_9BETA/14-353---------SLEP.LVVHVHNPTDRP...IPTTA..EPL.SMYVY---------ALPL----DPVTPPELILRQ.....G
VU54_HHV6U/4-339---------DYGN.IPFAVQNISDLD...LDLSR..LPI.VLNIF---------ALPH----ANVNISNLPVQRIE....
PP65_HCMVA/14-358---------EVEN.VSVNVHNPTGRS...ICPSQ..EPM.SIYVY---------ALPL----KMLNIPSINVHHYP.SAA
Q8QS17_9BETA/27-369---------ERDQ.LKADLINYSQRR...MSPGS.STPI.SVLAF---------GLPL----ERVPVSGIHLFQAHP...
Q9DWB8_RCMVM/44-408---------DRDRAISMEVSNPSGKT...LPPQG..TPL.RLILF---------ALPL----APVRLDLLWIQKRP....
Q9DWB9_RCMVM/14-350---------GAGD.LTIAVRNLRKKA...VKTHRMTIRSPTFCAF---------ALAL----DAIDTMPLQLTRVPAR..
B7TPY7_9BETA/1-346---------ELDL.LNLEVRNASDQP...LPAKS.FYDL.NVVVF---------ALPL----PRVHAAPLHIFFNSAL..
Q918H3_9BETA/11-349---------SIEN.VTVQVHNPTDRP...LSPAT..GPL.SLYVY---------AIPL----EPVSIPQLVLQRG.....
Q918H5_9BETA/23-363---------.RDQ.LRTDVGNYANKR...LKSGT..HTK.SMLVF---------ALPL----LRVPVTGIHLFRGK....
Q8QS16_9BETA/14-358---------EVQN.VTVNVHNPTGRA...ICPSQ..EPM.SLYVY---------AMPL----KMVNVPDINVHHYP.TTA
PP71_HCMVA/28-372---------EQDR.LLVDLNNFGPRR...LTPGSENNTV.SVLAF---------ALPL----DRVPVSGLHLFQSQR...
Q91TL4_TUHV1/30-399---------NYEQ.LIVEVRNRDDVP...HRLRD..RPL.ELNVF---------CLPL----PPVSVNPLHLFSPAVARA
O56288_9BETA/3-339---------DCGN.VTLAVQNISDVD...LDLKQ..FPL.IINLF---------AFFL----PSINLVSLPVQIV.....
Q91CJ3_9BETA/14-354---------ELKD.VYLHVHNPTDKP...ITPAD..EPM.SFFLY---------ALLL----RHLVPADLTLHPGG....
Q9DWC0_RCMVM/15-359---------DLVN.VSATVTNESASPR...THRTPESHT.DLSVF---------ALPL----GHVPMNHFHIFLST....
Q91CJ2_9BETA/24-364---------.RDS.LRTDACNYANRR...LSPGS..QTS.AMLVF---------ALPI----VRVPVTGIHLFRG...RG
Q918H4_9BETA/14-355---------EVKN.LTLHVYNPTSKP...IIPSE..EPL.SFYVY---------ALPL----KPVIPPELTLYP......
Q98330_MUHV1/18-359---------GIGS.LPVPAQNSQPRKQTRMLRSN..KYL.GFCVF---------ALAL----DHVPAPPMLIARVNSV..

PF06284

Q91CJ5_9BETA/40-498---------GSCNIIRAIIEEQLTQM--------SIVRL-SLNIF---------ALKT----MPPLRHQLPLRRKVTQHN
Q8QS15_9BETA/1-573---------G.CHIVRSMIDQQLAQM--------AIVRL-SLNLF---------ALRI----ITPLLRRLPLRRKGTHHA
UL84_HCMVT/1-587---------G.CHILRSVIDQQLTRM--------AIVRL-SLNLF---------ALRI----ITPPLKRVPLRRKAAHHT
Q918H2_9BETA/1-462---------GSCNIIRALVDEHMTQM--------SIIRL-SLNIF---------ALKI----MPPLRHQLPLRRKIAQHT

PF04489

VU10_HHV6U/8-436TSITLPKLFTPKE-LYFLIASPEEENIAFNPTITKGGWISGSFSY...PVDYRSNFSLTGMSANILMVPFVPYKYPLNYA
UL31_HCMVA/127-550SNVVTPKA.AYAE-LFFLLCSTSESSVVLQPLITKGGLCSSMAVYDEETMRQSQAVQIGFLHTQLVMVPFVPHACPHYAV
Q9DWF8_RCMVM/314-728ATMLTPRATGIPG-GFFLLTSLKGNAAVCQPFITRGGTRAALVTY...PSASSAPPPKKIVKLDLTCMFFTPFRIPEFGV
VU10_HHV7J/1-412TSITLPKIFSTKE-LYFIVASPESENITLNPAVTKGGWLSGSFSF...PLSLSCAYALTGVSSTIYMLPFIPYKFPMTY.

PF00692

DUT_CANAW/26-157--------------------------------------------------------------------------------
DUT_HUMAN/121-250--------------------------------------------------------------------------------
VPRT_JSRV/11-134--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
GAG_IPMA/542-670--------------------------------------------------------------------------------
VPRT_SRV2/36-160--------------------------------------------------------------------------------
DUT_EHV4/165-292--------------------------------------------------------------------------------
VPRT_MMTVB/32-156--------------------------------------------------------------------------------
POL_FIVT2/712-841--------------------------------------------------------------------------------
VPRT_SMRVH/41-165--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
POL_FIVPE/713-841--------------------------------------------------------------------------------
DUT_ORFN2/16-145--------------------------------------------------------------------------------
POL_OMVVS/675-803--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
E431_ADE02/14-141--------------------------------------------------------------------------------
VPRT_MPMV/36-160--------------------------------------------------------------------------------
DUT_HHV6G/241-368--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_SWPVK/12-141--------------------------------------------------------------------------------
DCD_ACIAM/45-169--------------------------------------------------------------------------------
POL_EIAV9/745-873--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VACCP/17-145--------------------------------------------------------------------------------
POL_CAEVC/699-827--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------

PF04797

LF2_EBVA8/37-401---------NEVFLKPFFVMHSDQDIVLSVLNPRSLFIEKGKFTW---------YIVPIRLVKNPYLYLQILPGQSDIQL
Q8JJR5_9GAMA/8-374---------QQYRILPSCVLDYSSDISIFIKTNSRT.IKAGELSI---------ALLFVTPIHHSKVSCTIATYQGDDVV
VG10_EHV2/21-391---------SRYVVVETVVSDLKKPISFSLVSEGRA.LAEGELRL---------VLTPLRALDYVHVFSVIYNMHNE...
P88908_HHV8/7-390---------ARRIVAPGVINNFSEPIGIWVRGPPPQ.TRKEAIKF---------CIFFVSPLPPREMTTYVFKGGDLPPG
Q8UZD9_9GAMA/5-437---------KDVKIYPSCVFQVHAPMFVTIKTSLRR.LNPNDLCL---------CLICVGAAVLDLPLLCAPGEG.....
Q8JJR4_9GAMA/23-387---------NQVATNLQFLTNSFSDINIEVKHPQYVNVVEGSLVF---------YIVPLDIVIPQGLNLKCLYDKTPCHM
Q9YTQ2_ATHV3/24-388---------NVIKIKPMTISDCDQELIFKITFALECIIPPGSMKI---------FILPITFLKLDGLYLLCLEDETSSIM
Q993K4_9GAMA/5-437---------KDVRIIPSCAFDIHAPLFACIQTGTGV.LQRGAIQM---------TLVCLRSTPIKLPITFHSSPS.....
O39235_9GAMA/8-388---------DAARVAPGFVLDSSRPLTVWVNASGRH.....TIRF---------CLLFLKPIDLERAVTYVFGENGGARS
Q993K3_9GAMA/39-404---------NEVYLKPVFVLNSEQEVELQVLNPRNLYIDKGKFIW---------YMVPLRLVKTPYLYLRIFPNKGNINL
Q99D19_BHV4/8-396---------TPLEITPIHVTEFNMPLFLFVKTQNTI.INSLSLSL---------AIIFMKPTCPTGICSYISTAPPET..
VG10_ALHV1/6-378---------DQCTVLPTCVLDLEFDITVYVRSRQRV.LQPGALQL---------ALIFIKPVNGSEMAWDVRDPPETMVG
O39236_9GAMA/25-391---------NPLDIVPAVVERADRELVLRVHAPQTTRVSRYGLKV---------FVAIVTVVRPPGVFLHFPQDRVPIAL
O41932_MHV68/21-376---------NDVPVTPLVDFKPDEPLQVVLTAHKTIVVPPGEFVM---------IIVCVNFEKIKSLDLIIHEMSTSNIP
Q8AZ09_9GAMA/23-387---------NAVATKLQFICDSVSEINIEIKRPKYVDIAEGALVF---------YIVPLDIVTPRGLHLKCLGDKHDCIM
LF1_EBVB9/5-442---------KDVKIYPSCIFQVHAPMFVTIKTSLRC.LNPHDLCL---------CLICVGAAILDIPLLCAPRDG.....
VG11_ALHV1/22-387---------NCIKTQLMFIDRSAENINIRLQHASYQMAPAHSLVF---------YIFPIILLRLDGLYLRVLPDKHPGVM
Q8B411_9GAMA/7-373---------ELYRVLPSCILDYTTDISVFIKTNTAT.LRAGELSL---------VLLFITPIPSSKVSCTIVATKSERDL
O41931_MHV68/8-389---------PGIELLPKVINDFGTPLSLAIKTNLPS.IPAHQLLF---------YIIFLRPSPLTSMSCYARPLSLASTP
Q9YTQ3_ATHV3/7-377---------CKPYVLPMFISDFINPLVVFVKGGPII.LRKNELKF---------YIVFISPLTRTDISSFIFPPDND...
P88909_HHV8/23-387---------NKVRILPTVVESSSSVLIFRLRASVSANIAVGGLKI---------IILALTLVHAQGVYLRCGKDLSTPHC
VG11_SHV21/24-388---------NLIKIKPMVVSECEQELIFKITFALECTIPPGSMEI---------FILPITFLKLDGLYLLCLEDYTSRIM
VG11_EHV2/74-450---------NPVRAAPTVVRCSLNEIAISLMRPLEGPVPAGGLTF---------YLLPVTLVKPHGLYLKIQKDRAAVGA

PF06559

Q0G3Q2_9RHIZ/19-385---------AVLETGCVYIVPLQEKLRLPDDVRATANPKSSTGRL---------DIFTRVLTDRGREFDKVAAGYDGPLY
A3WSL0_9BRAD/1-368---------AVLETNCVYIVPLLESLALPPEIVAAANPKSSTGRL---------DVFTRVIADGTRRFDMIGAGYHGPLY
Q9A657_CAUCR/23-363---------AVLEKGCVYIAEIQERLALPMTVSARGNPKSSTGRV---------DVFVRLLTDHSRAFDDVDAGYTGPLY
A1B368_PARDP/1-361---------AVLEKGCVYLVPLMERLTLPAGLDAVANAKSSTGRL---------DLLTRLVTDEGTEFDRLPQGYDGPIY
A4EMM0_9RHOB/5-363---------AVLEKGCVYVVPLMERLTLPQGMTAAASAKSSIGRL---------DLLTRIITDHGIEFDRVPEGYDGPLY
A3VLC8_9RHOB/1-361---------AVLEKGAVYVVPLMERLALPDGIQAVANAKSSTGRL---------DLLTRTITDGGVEFDRIAPGYTGPLY
E0TCQ3_PARBH/2-367---------AVLETGCVYLVELREGLALPPTLSARANPKSSTGRI---------DVFVRLVTDDGTAYDEVPAGYTGPLY
B1ZJ40_METPB/1-365---------AVLETGCVYIAELQEALALPADLSASANPKSSTGRI---------DVFTRVITDRASAFDQIEAGYAGKLY
A3JU06_9RHOB/1-362---------AVLEKGCVYVVPLMEGLALPDDIQAVANAKSSTGRL---------DLLTRTISDDSVEFDRIAPGYDGPLY
A3UGF0_9RHOB/1-339---------AVLETGCVYLAELQEGLSLPEAVAAFANPKSSTGRL---------DVFTRVIGDRSSAFDQVCAGYDGPLY
Q0ASF2_MARMM/1-338---------AVLETGCVYLAPLQEGLKLPAGLSAAMNPKSSTGRI---------DVFTRVITDHGVAFDQAPVGYEGPLY
A7ICI7_XANP2/2-372---------AVLETGCVYLVELFERLKLPFDLAAAANPKSSTGRL---------DVFVRVITDGARAFDTIPAGYNGPLY
Q1YJY6_MOBAS/4-370---------AVLETGCVYVVPLLESFRLPADIRATANPKSSTGRL---------DIFTRVLADGAQEFDKLPAGYDGPLY
Q28RG4_JANSC/1-361---------AVLEKGCVYVVPLMEGLALPGDITAVCNAKSSTGRV---------DCLTRVIADGGVEFDRIPAGYTGPLY
A7HQ50_PARL1/20-384---------AVLETGCVYLVPLVEALALSERTSASANPKSSTGRL---------DVFTRLITDFCAEFDQVAAGYKGHLY
A0NR82_9RHOB/9-376---------AVLETGCVYIVPLQESLALAPDISATANPKSSTGRL---------DVFTRVITDNGLAFDTIPAGYTGPLY
A6U5R4_SINMW/1-364---------AVLETGCVYIVPLMESLSLPANMSASANPKSSTGRL---------DIFTRVITDRAQEFDKIPAGYSGPLY

PF06501

VU55_HHV6U/3-432PTVYE---------QYGLTNMPISTT---------------NVINQFKVVQNDSVEMSLILFNLNWTESPYQSQKLDRYG
V55B_HHV7J/5-430VKEQE---------QMGVFPSLIRFK---------------NEKVIVTQTPHKVNEITVTMFNIEWKLSTYQRSIERTPG
O56289_9BETA/6-427PLRFH---------QFAYLEKGLGTT---------------PII..LYSVKNGDLIVNATVTKITWEKNEFQPLLKNSND

PF05784

Q91CJ4_9BETA/14-353ESHKR---------.........RTT---------------VADAVVQQIDDKKWHTRLTASRLVWSRNQ------SRYT
VU54_HHV6U/4-339.....---------..AHDRHIIPHG---------------QCDAKFVIYG.PLTRIKIQVADIRWIEQT------PE.E
PP65_HCMVA/14-358ERKHR---------........HLP.---------------VADAVIHASGKQMWQARLTVSGLAWTRQQ------NQWK
Q8QS17_9BETA/27-369.....---------..RGDEENRLRT---------------EARVDIRRT.AYHWGVRTTVSP.RWRRKV------DRSL
Q9DWB8_RCMVM/44-408.....---------...EDPRNRPRF---------------PISILSVTPGVHSLDVELVATGLSWRAYP------RDRR
Q9DWB9_RCMVM/14-350.....---------..RRDERKIAAA---------------KVTTASTRSGQKI..LRLAVSRLKWLPHA------PDAR
B7TPY7_9BETA/1-346.....---------...KPSRETFPT---------------CSKTVVRRACGAIWGVRTALSNMAWTEGV------GNRA
Q918H3_9BETA/11-349.....---------....ENRKHRLP---------------VADAVIQQID.SAWHSRLTVSRLIWTRNQ------SRYR
Q918H5_9BETA/23-363.....---------..AKNENRPLKA---------------NARATIRRC.QYMWKVKLNLDKIIWNRRR------DPNI
Q8QS16_9BETA/14-358ERKYR---------.........HLP---------------VADTIIHQSGKQVWQARLTVSNLSWARQQ------NQWK
PP71_HCMVA/28-372.....---------..RGGEENRPRM---------------EARAIIRRT.AHHWAVRLTVTP.NWRRRT------DSSL
Q91TL4_TUHV1/30-399ATAAR---------PASLESDASPRA---------------RITA.VTRKAGSVWVLRLAMSELQWTAKR------DANL
O56288_9BETA/3-339.....---------.ERMEHNYIPHG---------------ECRAQFILYGSQT.KLRAHIKRIRWTELQ------HE.E
Q91CJ3_9BETA/14-354.....---------.....TYNPELP---------------TYDAAVQAF.AQGYHTRFNAYHLQWTQRY------NRWM
Q9DWC0_RCMVM/15-359.....---------...RPESRLKTD---------------AAPFRVTPGNAAKNLVKVVLRNQRWERTP------SAAF
Q91CJ2_9BETA/24-364NSQNR---------........PPRA---------------NARTTIRR.AQYTWTVKVNVSAITWTRKR------DQYV
Q918H4_9BETA/14-355.....---------..SGSAKKHNPA---------------RARVSVEAF.TGGWHTQIYVKDLLWTQRE------SHWL
Q98330_MUHV1/18-359.....---------..KVDASAVRQA---------------SVSATTTRTGMK..TVRMTVHKVRWANDP------DSKR

PF06284

Q91CJ5_9BETA/40-498ALHDC---------VSLHLPDLTFVN....................DKISNTSELTIPVK-SALCWHTA-------EGGI
Q8QS15_9BETA/1-573ALHDC---------LALHLPELTFEATRIAGGSGDD.....DTPPATDTELTPSLTVQVR-HALCWHRV-------EGGI
UL84_HCMVT/1-587ALHDC---------MALHLPELTFESTLDINNVTENAASVADAAESTDADLTPTLTVRVR-HAVCWHRV-------EGGI
Q918H2_9BETA/1-462TLHDC---------VSLNMPDLDFTT...............DENNNGNDTSTPELTIRVK-SALCWHTA-------EGGI

PF04489

VU10_HHV6U/8-436RFISS.........IDLMILNEQFPE---------------HECGDIQILKQRNYLYLGVIKNLTWKKSVTG----TGQT
UL31_HCMVA/127-550PFTTPGKPGCGGAPSGVAGLEEAAP.---------------..FGRVS.VTRHGATLLCRVDHLTWISKRVT----TYGH
Q9DWF8_RCMVM/314-728RMIALDDPMF............RAGG---------------IAFGIMSPVKRTGATTVALFSGLTWCIRTAI----GEHG
VU10_HHV7J/1-412..............VDFSTLRTYEVT---------------SEYGSIQIIKQRNFLFLGIIRDLSWKSQ...----..RD

PF00692

DUT_CANAW/26-157--------------------------------------------------------------------------------
DUT_HUMAN/121-250--------------------------------------------------------------------------------
VPRT_JSRV/11-134--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
GAG_IPMA/542-670--------------------------------------------------------------------------------
VPRT_SRV2/36-160--------------------------------------------------------------------------------
DUT_EHV4/165-292--------------------------------------------------------------------------------
VPRT_MMTVB/32-156--------------------------------------------------------------------------------
POL_FIVT2/712-841--------------------------------------------------------------------------------
VPRT_SMRVH/41-165--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
POL_FIVPE/713-841--------------------------------------------------------------------------------
DUT_ORFN2/16-145--------------------------------------------------------------------------------
POL_OMVVS/675-803--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
E431_ADE02/14-141--------------------------------------------------------------------------------
VPRT_MPMV/36-160--------------------------------------------------------------------------------
DUT_HHV6G/241-368--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_SWPVK/12-141--------------------------------------------------------------------------------
DCD_ACIAM/45-169--------------------------------------------------------------------------------
POL_EIAV9/745-873--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VACCP/17-145--------------------------------------------------------------------------------
POL_CAEVC/699-827--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------

PF04797

LF2_EBVA8/37-401..TRS------------------------------------CTQSGDKLNTSE.PQIFLSGSPVTSQDEC.LPYLLAQHT
Q8JJR5_9GAMA/8-374.DASP------------------------------------QLDVTYSGY....KSSEISGLAKRNDKNVYQLLVRGKFP
VG10_EHV2/21-391..LPP------------------------------------GLELASVTEYCGSLVKELCGTAIRTRANTYTMAFKWEGA
P88908_HHV8/7-390AEEPE------------------------------------TLHSAEAPLPS..RETLVTGQLRSTSPRTYTGYFHSPVP
Q8UZD9_9GAMA/5-437..APV------------------------------------CAAAGSTAAAEN.GGLRVWGPLSPSSPTSLSLAFPYAGT
Q8JJR4_9GAMA/23-387..GKS------------------------------------CSQEASELCSDE.PVLHVCGQLVWSKQEE.FPFLMTQRT
Q9YTQ2_ATHV3/24-388..TTS------------------------------------CMQMGTYLTSET.PQVFLKGSPVLTKNEP.LPHLMAQKT
Q993K4_9GAMA/5-437..LTE------------------------------------CGELLDVEQTG..KQLKFSGIPTTTSPTTLSMCFKTHTL
O39235_9GAMA/8-388EGTPK------------------------------------PTCATESLPG...GPLRVSGEASQTSPHSFVAYFPTANS
Q993K3_9GAMA/39-404..ETS------------------------------------CSQWGDKLSTNE.PQIFLSGVPVSTQDES.LPFLLAQRT
Q99D19_BHV4/8-396..IPP------------------------------------QHSLAHHLPSTDQGHLTLSGQAIKCNHKTYTMYFRGPPS
VG10_ALHV1/6-378QRLYE------------------------------------NVSQGTVKALETPDHLLLTGEAIGRSDGTYDMLFKDQKI
O39236_9GAMA/25-391..TDA------------------------------------CSQEGSRLTSEE.PWIKIQGFPVLSDETA.HPFLLTQKT
O41932_MHV68/21-376.LPPT------------------------------------CGQTFKNFNTAT.PSLEIYGDVIECNDDQKTCVFTAVFP
Q8AZ09_9GAMA/23-387..NRS------------------------------------CVQEASEICSGE.PIVHVFGQVGWSMQEE.FPYLLTQKT
LF1_EBVB9/5-442..AGA------------------------------------RAAEGQAAAAQG.GKLRVWGRLSPSSPTSLSLAFPYAGP
VG11_ALHV1/22-387..DAS------------------------------------CSQTWSCLNTPM.PVVRLQGGMLSWDDED.MPFMLGQKT
Q8B411_9GAMA/7-373.KITT------------------------------------LDGVPNYFN....IGTDISGRIQRSRENIYELVIRGEFP
O41931_MHV68/8-389.STNG------------------------------------LCQSVSVLDNKP.GLLITTPLHRDPASGKYTSNVQSPTT
Q9YTQ3_ATHV3/7-377..TDK------------------------------------TLALAGFGTRIE.NEVNIRGTPTKTNTGSYVMLFRCEKI
P88909_HHV8/23-387..APA------------------------------------IVQREVLSSGFE.PQFTVTGIPVTSSNLNQCYFLVRKPK
VG11_SHV21/24-388..STS------------------------------------CMQMGTYLASET.PQVFLKGGPVLNKHEP.MPYLMAQKT
VG11_EHV2/74-450..ATT------------------------------------CSQDGAHLNSEQ.PQVFFSGTAAPAREGGELPFLLAQRT

PF06559

Q0G3Q2_9RHIZ/19-385LEISP------------------------------------RTFPVLVRQGSRLSQIRFRRGEPTLSGADLEALHGEHRL
A3WSL0_9BRAD/1-368AEISP------------------------------------KTFPVLLREGSRLSQVRFRTGDAVLDADELDELHTRERL
Q9A657_CAUCR/23-363IEIAP------------------------------------QTFSVLVRAGTRLNQLRLKRGEPAKLATR..........
A1B368_PARDP/1-361AEICP------------------------------------RSFSVLVRPGMRLNQLRLRQGQAVLTDTELRDLHVREPL
A4EMM0_9RHOB/5-363VEICP------------------------------------RSFSVVAQPGQMLNQIIFRQGKTLMSDDDLRGLHAQTPI
A3VLC8_9RHOB/1-361AEICP------------------------------------RSFSVLVRPGMRLNQIRFRQGQAVLSDADLRTRHAADPL
E0TCQ3_PARBH/2-367AEVSP------------------------------------RTFSIVVRPGSSLNQLRIRHGETRLSDEALGERARREDL
B1ZJ40_METPB/1-365AEISP------------------------------------RTFPVRVRTGSRLSQIRFRRGDPRLRETELAALHASDPL
A3JU06_9RHOB/1-362AEICP------------------------------------RSFSVLVRPGMRLNQIRFRQGNAKLDDAALEALHNTTPL
A3UGF0_9RHOB/1-339VEISP------------------------------------RTFSVLARPGDRLVQVRLRAGEMTALDA...........
Q0ASF2_MARMM/1-338AEISP------------------------------------CTFSILAREGDRLSQVRFRQGAHKALRE...........
A7ICI7_XANP2/2-372LEISP------------------------------------RTFPILVRTGSRLSQVRFRRGVSRLSDLELLSLQSAECL
Q1YJY6_MOBAS/4-370LEISP------------------------------------RTFPILVRQGSRLSQIRFRGGEPLLNEAELAALHGEQVL
Q28RG4_JANSC/1-361AEICP------------------------------------RSFSVKIAPGLRLNQIRFRRGQATLTDAALAERHAQTPL
A7HQ50_PARL1/20-384LEISP------------------------------------RTFPILVRPGSRLAQIRFRRGTHTSSDAEMKRLHEELRL
A0NR82_9RHOB/9-376AEISP------------------------------------LTFPILVRSGSRLSQIRFRRGQSLIPDADLEEVHKAHTL
A6U5R4_SINMW/1-364LEISP------------------------------------RTFPIVVRRGSRLSQIRFRVGHAVLSEQELLALHESDVL

PF06501

VU55_HHV6U/3-432RKLLI-----------------------------------------------------------------VFSVFSIDTR
V55B_HHV7J/5-430HPLTT-----------------------------------------------------------------LCTVCSVNIN
O56289_9BETA/6-427QRLET-----------------------------------------------------------------MYCIFTFNTT

PF05784

Q91CJ4_9BETA/14-353ANSVY-----------------------------------------------------------------HTTSFIFNSQ
VU54_HHV6U/4-339PTRYS-----------------------------------------------------------------FKAEIWVNLQ
PP65_HCMVA/14-358EPDVY-----------------------------------------------------------------YTSAFVFPTK
Q8QS17_9BETA/27-369EAEQI-----------------------------------------------------------------FTTEFIFRAG
Q9DWB8_RCMVM/44-408LMTVI-----------------------------------------------------------------RLDMFRADIR
Q9DWB9_RCMVM/14-350SALTS-----------------------------------------------------------------AA......LD
B7TPY7_9BETA/1-346HVDRA-----------------------------------------------------------------LTVTVLLSVK
Q918H3_9BETA/11-349PHGVF-----------------------------------------------------------------HTTSFVFNPQ
Q918H5_9BETA/23-363EGGQF-----------------------------------------------------------------FTTDFIFSTE
Q8QS16_9BETA/14-358EPDVY-----------------------------------------------------------------YTTSFIFNTK
PP71_HCMVA/28-372EAGQI-----------------------------------------------------------------FVSQFAFRAG
Q91TL4_TUHV1/30-399HPTLH-----------------------------------------------------------------YVTKVTVQTR
O56288_9BETA/3-339PTHYM-----------------------------------------------------------------YACEFWIDLQ
Q91CJ3_9BETA/14-354PHGVH-----------------------------------------------------------------HTASFYVNTS
Q9DWC0_RCMVM/15-359GT...-----------------------------------------------------------------HITTVVFQVP
Q91CJ2_9BETA/24-364EGGYT-----------------------------------------------------------------FATDFTFLTG
Q918H4_9BETA/14-355QNGTF-----------------------------------------------------------------FYTSFLVKIY
Q98330_MUHV1/18-359.....-----------------------------------------------------------------FKKAIV..SL

PF06284

Q91CJ5_9BETA/40-498SGPRG-----------------------------------------------------------------LASRISVRLS
Q8QS15_9BETA/1-573SGPRG-----------------------------------------------------------------LTSRLSVRLS
UL84_HCMVT/1-587SGPRG-----------------------------------------------------------------LTSRISARLS
Q918H2_9BETA/1-462SGPRG-----------------------------------------------------------------LTSRISVKLS

PF04489

VU10_HHV6U/8-436APHRI-----------------------------------------------------------------LKASFIGSWP
UL31_HCMVA/127-550KKITR-----------------------------------------------------------------YLAQFRGTMD
Q9DWF8_RCMVM/314-728QMITT-----------------------------------------------------------------YAAWFECTQD
VU10_HHV7J/1-412NKNFI-----------------------------------------------------------------LKAMFVGNWL

PF00692

DUT_CANAW/26-157--------------------------------------------------------------------------------
DUT_HUMAN/121-250--------------------------------------------------------------------------------
VPRT_JSRV/11-134--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
GAG_IPMA/542-670--------------------------------------------------------------------------------
VPRT_SRV2/36-160--------------------------------------------------------------------------------
DUT_EHV4/165-292--------------------------------------------------------------------------------
VPRT_MMTVB/32-156--------------------------------------------------------------------------------
POL_FIVT2/712-841--------------------------------------------------------------------------------
VPRT_SMRVH/41-165--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
POL_FIVPE/713-841--------------------------------------------------------------------------------
DUT_ORFN2/16-145--------------------------------------------------------------------------------
POL_OMVVS/675-803--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
E431_ADE02/14-141--------------------------------------------------------------------------------
VPRT_MPMV/36-160--------------------------------------------------------------------------------
DUT_HHV6G/241-368--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_SWPVK/12-141--------------------------------------------------------------------------------
DCD_ACIAM/45-169--------------------------------------------------------------------------------
POL_EIAV9/745-873--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VACCP/17-145--------------------------------------------------------------------------------
POL_CAEVC/699-827--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------

PF04797

LF2_EBVA8/37-401PPFLK..........................................................................S
Q8JJR5_9GAMA/8-374WDFMN......................................................................VKDIV
VG10_EHV2/21-391RQFYRVT..................................................................NSYFCEQ
P88908_HHV8/7-390LSFLDLL.................................................................TFESIGCD
Q8UZD9_9GAMA/5-437WPIAWYRHSIKLTRREAMGGEDCAQPLLPQGR...............ATFPPGRVGEPERGRKRTREELETGEASSPWRG
Q8JJR4_9GAMA/23-387K.FMK..........................................................................G
Q9YTQ2_ATHV3/24-388KPFNK..........................................................................K
Q993K4_9GAMA/5-437PTGLSGYLFRLTPRGGNNPAYWTHQGGAREAPPRELPSQGTRTHDGAADDGSDNRGPVMRSNTHGFWDPHPTADVDKDRV
O39235_9GAMA/8-388VACLSLLR................................................................LQVRPFSD
Q993K3_9GAMA/39-404RPFSK..........................................................................P
Q99D19_BHV4/8-396MQFFKMEHTM............................................................ASGRGDLQDA
VG10_ALHV1/6-378PCMVN.....................................................................YSNVFA
O39236_9GAMA/25-391KPFTE.........................................................................RK
O41932_MHV68/21-376GLHRR...........................................................................
Q8AZ09_9GAMA/23-387K.FMK..........................................................................S
LF1_EBVB9/5-442PPVAWYRHSINLTRSEGVGIGKDCAQDHACPVPPQ..........GHASSAADQAGVPERGRKRAHEGPGAGEAASAGRG
VG11_ALHV1/22-387KPFLS..........................................................................K
Q8B411_9GAMA/7-373KDFIN......................................................................VNEIF
O41931_MHV68/8-389FNLFR.........................................................................VL
Q9YTQ3_ATHV3/7-377PLFYN.........................................................................II
P88909_HHV8/23-387SRLAK..........................................................................P
VG11_SHV21/24-388KPFDK..........................................................................K
VG11_EHV2/74-450PRFER.........................................................................GG

PF06559

Q0G3Q2_9RHIZ/19-385TSDTA-------------------------------------------------------------------ANITGGGI
A3WSL0_9BRAD/1-368VDADD-------------------------------------------------------------------ADF.VNGV
Q9A657_CAUCR/23-363.....-------------------------------------------------------------------........
A1B368_PARDP/1-361VTG..-------------------------------------------------------------------EALIDEGL
A4EMM0_9RHOB/5-363VSG..-------------------------------------------------------------------EPVISDGL
A3VLC8_9RHOB/1-361VDG..-------------------------------------------------------------------APVIDNGL
E0TCQ3_PARBH/2-367TGPRH-------------------------------------------------------------------HGHIHQGL
B1ZJ40_METPB/1-365IDAAM-------------------------------------------------------------------PSL.QGGV
A3JU06_9RHOB/1-362VDG..-------------------------------------------------------------------TPQIDDGL
A3UGF0_9RHOB/1-339.....-------------------------------------------------------------------.......V
Q0ASF2_MARMM/1-338.....-------------------------------------------------------------------.......V
A7ICI7_XANP2/2-372VDAPQ-------------------------------------------------------------------PDVAAGGI
Q1YJY6_MOBAS/4-370TTAAE-------------------------------------------------------------------ANISGGGI
Q28RG4_JANSC/1-361VDQ..-------------------------------------------------------------------TPLIDDGL
A7HQ50_PARL1/20-384VDG..-------------------------------------------------------------------EADIDGGI
A0NR82_9RHOB/9-376MSGGN-------------------------------------------------------------------ERI.GNGV
A6U5R4_SINMW/1-364VASDR-------------------------------------------------------------------PNVSGGGI

PF06501

VU55_HHV6U/3-432E--CPYWENLFK..SIIPLCRVNMISEP-----GISIYKIEFNDPF-LTVFLRNVVLP----ENKRRFPITKE-CYLRLT
V55B_HHV7J/5-430N--LPFWFHDVRSGSDFPTCKVFSISDP-----TVSVLKMIFSPPL-LEIYLRCYTEV----TKNNTYMVPND-CMLKLG
O56289_9BETA/6-427Y--CKYWNVFFA..SATPICNVEMISEH-----NVSVYKIEYRSPV-LFVFLR..YLK----VMNSRFCVD.E-CSLRLR

PF05784

Q91CJ4_9BETA/14-353Q--MPLG-------SM.NTASELVCSIP-----HTHVTNIRKISKD-E....VKVYL.....ECLQEDTPETK-CFVHLA
VU54_HHV6U/4-339N--TPLD-------QIFKTGNIEFISHK-----NVYISRILLCGNL-LILK.....ANYENDYLLDDNFYPEQ-LAIQIS
PP65_HCMVA/14-358D--VALR-------HV.VCAHELVCSME-----NTRATKMQVIGDQ-....YVKVYL.....ESFCEDVPSGK-LFMHVT
Q8QS17_9BETA/27-369A--IPLR-------LV.DAVELLSCSDR-----NTYIHKAETDARG-...QWVNVHL.....QH.ETLHPPPS-VFLHFS
Q9DWB8_RCMVM/44-408R--....-------..YCTAEIRSCTQK-----GVYVHEVTTTQTT-GNAYLTLL.......TRTEEEVPPSS-LVLRIV
Q9DWB9_RCMVM/14-350S--VDVR-------KI.AGFDVKTVSDP-----NTAVAEAEIQKGT-ATVVLRLSH.......HANHGQPPDS-LVLLLV
B7TPY7_9BETA/1-346P--ACMT-------HV.DSLTEINCSHE-----DIQVFKAEVFQKG-RPNVLGLTL.......QTTAKPPPKK-LTLFFQ
Q918H3_9BETA/11-349N--MPLD-------AV.NMASELVCSLP-----DTHVTNVQKVSRQ-E....IKVYL.....ECLQEEAPDTK-AFIHLS
Q918H5_9BETA/23-363L--IPLT-------VV.DAMDQLACSDG-----YTHVQKAETVGSE-...NLVRVFL.....INLSH.HPPQE-LFLQLS
Q8QS16_9BETA/14-358D--VALR-------QV.VSASQLVCSLE-----NTRVVKMQVVAEH-....YMKVYL.....ESFHEDVPACK-LFLHLS
PP71_HCMVA/28-372A--IPLT-------LV.DALEQLACSDP-----NTYIHKTETDERG-...QWIMLFL......HHDSPHPPTS-VFLHFS
Q91TL4_TUHV1/30-399P--ARLH-------AV.DGLVLQMCSDP-----QVQLLKAQTLQPD-QYSGPIELHL.....RRLDNNPPPPD-LFMQVA
O56288_9BETA/3-339T--TPPD-------QIFNSAKVEFISSR-----NVYFKQIMLHEKI-LVIR.....ASYENNYLLNPDNFPSD-IFFQVN
Q91CJ3_9BETA/14-354P--MPLW-------SI.NVANELVCSLR-----STHVRKIQLVDKV-K..GLVRIFL.....ESFQEETPDDK-VFIHLA
Q9DWC0_RCMVM/15-359G--LRYS-------EY.DTVHPTAASDP-----GVRLDRAELIGAA-A..DVLRLYLIFDPRAPGSSQSPPSS-LTLQLN
Q91CJ2_9BETA/24-364L--IPLT-------LV.DAIDQLACSNG-----DTYVQKVETIGEE-...NLILVSLIH......FSLHPPTE-VFLQLS
Q918H4_9BETA/14-355P--MPIQ-------FM.NTAKELVCSLR-----DARVTKVQLVDKD-K..GLVKIYM.....ECLQQETPKTT-AFIHLA
Q98330_MUHV1/18-359E--LPRA-------RA.ATLDPKTCSDP-----HVNFYQMTAQRNS-PTIYLTLRYAK.......ANGTPPDS-LTAILA

PF06284

Q91CJ5_9BETA/40-498D--ATIQ-------NMGPATFGQLYTDT.DCP.DLILSSLILYQDN-ILRFNVTF-------RSAQHQLPSNPIVSFKLR
Q8QS15_9BETA/1-573E--ATAA-------ALGPSVFGRLELDA.ESPADLTLSSLTLYQDC-VLRFNVTC-------DRSEG..PSDP.VSFRLR
UL84_HCMVT/1-587E--TTAK-------TLGPSVFGRLELDPNESPPDLTLSSLTLYQDG-MLRFNVT.-------.CDRTEAPADP.VAFRLR
Q918H2_9BETA/1-462E--SAIQ-------NMGPAIFGQLYTDE.DSP.ELVLSSLILYQDN-LLRFNVTF-------RSAQHQLPSNPIVSFRLR

PF04489

VU10_HHV6U/8-436D..TSLP.DRVALRFFNNTRFTIHCHEF-----SINIENLGLVKNKEKVFGTLATVCCEQIPSLLTTENLPKY-LIVQFE
UL31_HCMVA/127-550DDEAALPGEDEAWIASKNVQYEFMGLIF-----TVNVDSLCVDAEQRQLLGTVATSFCHRVSDKITARNMPR.-.AFSFY
Q9DWF8_RCMVM/314-728N..AY..GTCKFWRPGPPAVYECGEHEV-----TITVENMYVIHGGRKLIGTLAVRSDYFTAPSLRTEMMPSM-LVLRFE
VU10_HHV7J/1-412G..IQIP.EAFALRLFNNTRFSIQDFEF-----SINIQNINLTRDN.KILGSLSTVSCDQMPPNLSPENLPNY-LVIQFE

PF00692

DUT_CANAW/26-157--------------------------------------------------------------------------------
DUT_HUMAN/121-250--------------------------------------------------------------------------------
VPRT_JSRV/11-134--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
GAG_IPMA/542-670--------------------------------------------------------------------------------
VPRT_SRV2/36-160--------------------------------------------------------------------------------
DUT_EHV4/165-292--------------------------------------------------------------------------------
VPRT_MMTVB/32-156--------------------------------------------------------------------------------
POL_FIVT2/712-841--------------------------------------------------------------------------------
VPRT_SMRVH/41-165--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
POL_FIVPE/713-841--------------------------------------------------------------------------------
DUT_ORFN2/16-145--------------------------------------------------------------------------------
POL_OMVVS/675-803--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
E431_ADE02/14-141--------------------------------------------------------------------------------
VPRT_MPMV/36-160--------------------------------------------------------------------------------
DUT_HHV6G/241-368--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_SWPVK/12-141--------------------------------------------------------------------------------
DCD_ACIAM/45-169--------------------------------------------------------------------------------
POL_EIAV9/745-873--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VACCP/17-145--------------------------------------------------------------------------------
POL_CAEVC/699-827--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------

PF04797

LF2_EBVA8/37-401Y--ARIH-------TFPGKVCPVNAIRR-----GKGYVRVSVDTPDLKREGPLN....VKVGMT--LLDDVII-......
Q8JJR5_9GAMA/8-374C--IDHN-------AEVAAVKTLLVERI-----DHEMLRFSMTLFNPEK.....DNVHVVATVS--FDISPEI-......
VG10_EHV2/21-391Y--NRFK-------IVRLCVKECKMYRK-----EGNVHVLDITVVGDTQPEMVHGVVSVMGAEV--D...SML-......
P88908_HHV8/7-390N--VEGD-------PEQLTPKYLTFTQT-----GERLCKVTVYNTHSTACKKARVRFVYRPTPS--A...RQL-......
Q8UZD9_9GAMA/5-437D--AAPS-------QARALRWRGLAWDA-----GRGRLAPGLYLSRDSASGVVRLDVHVDRAEE--GWACEVL-LGPGPP
Q8JJR4_9GAMA/23-387V--CRIH-------ISEGSICAINAVRY-----GHNYCKIYM.....NVDLPVKSKEIVHVKMS--MIKRALL-......
Q9YTQ2_ATHV3/24-388M--ARVH-------TVQNEVCEVNSIYK-----GKDHIRLALQ....KKSEDVNFFEPVIIGLT--MTNKALI-......
Q993K4_9GAMA/5-437K--VRDP-------KEWGFVCISAYCHE-----ASNLCRVDIELPDARGSWLVTASMEIHSGPL--SS.....-......
O39235_9GAMA/8-388D--AAHR-------DARISPKYVTFSNS-----GGNVCKASVHTLSPSRCKTAQMEIIYAPGDP--N...AEI-......
Q993K3_9GAMA/39-404F--ARIH-------TFPGKVCPVNALRL-----DKTCVRVSVDVPTEKPKAREE...PIKIGMT--LLNDVIL-......
Q99D19_BHV4/8-396C--VKGM-------VSYDIKNIMMEVVN-----PNGLYKVSVNITNPHKPDHIWITLKFTVMVK--P...TDL-......
VG10_ALHV1/6-378S--YHSP-------NEEILPRALEITML-----GQKTARLTFRPGHECPSATVSFRAEVRPILQ--PKV....-......
O39236_9GAMA/25-391F--CRLI-------MDNDQRSAVNTVYL-----GKQHVRVTVT....RPPETIVTDGPVTATLS--LTGNAPI-......
O41932_MHV68/21-376.--CSLH-------GPLNFMGFVNSVNI-----TGTILRVYYSGVSEAAPDSILVKFKTSSAV.--.......-......
Q8AZ09_9GAMA/23-387V--CRIH-------TPEGNVCPVHAIRY-----GDNYCKIYI.....NKSWACDHKETVHVRMS--MVKDALL-......
LF1_EBVB9/5-442D--VALS-------QSRALLWRGLGWDT-----GRGRLAPGLAMSRDAASGSVHLDIQVDRAEE--GWVCDVL-LEPGPP
VG11_ALHV1/22-387A--VKVH-------ALADEVCKVNDVCM-----GDNYMKIHL.....DFHFALDKHLPVDICMS--PTNNTVL-......
Q8B411_9GAMA/7-373C--MDDN-------AEIVEIKTLLIERI-----DHESVRISITTFNSEK.....DSLEIRAKFS--FENKPEV-......
O41931_MHV68/8-389Y--IKLS-------GEEGMVS.......-----.QKVKHLTIDKDSLQEGFLQLCLNMCGVSYE--TLQCEIL-LELVQG
Q9YTQ3_ATHV3/7-377N--FNVK-------DSELIFESLLIQEV-----TLNTYIMTIHMCGSPKPDQIEVQVHLNVINT--P...TEL-......
P88909_HHV8/23-387F--ARLS-------AETTEECRVRSIRL-----GKTHLRISVT....APAQETPVWGLVTTSFS--LTPTAPL-......
VG11_SHV21/24-388M--ARVH-------TVQNEVCEVNSIYR-----GENHVKVAIQ....KDSEDINFLDTVVVGLT--MTNRALV-......
VG11_EHV2/74-450F--CKVH-------VTQGVTCPVNAVKL-----SNDYVRLPVCELRGDGGAGAAAPSQIKVGVT--LVREAML-......

PF06559

Q0G3Q2_9RHIZ/19-385A--LSID-------LMGN.ADDLVGYRG-----KRHTGVVDVDKRGTNAVADFWEPLYRQGRGE..LVLDPDE-------
A3WSL0_9BRAD/1-368A--LSVD-------LSGDHANGFVGYRA-----KRHTGVIDIDRRGGYPVGEFWEPIAARPDAS..LILDPGE-------
Q9A657_CAUCR/23-363S--VGVD-------LLSETG..IVGFRG-----RRHAGVVDLDHEDGHDPRDFWEPLEARRGE...LLLDPGE-------
A1B368_PARDP/1-361G--FSVD-------LRPQGGD.LVGYRA-----RPHSGVIDLDRIGAYRARDFWDELRTTDGQ...LILDPGA-------
A4EMM0_9RHOB/5-363G--FSVD-------LRPNDGT.LVGYRA-----KPHTGVVDLSKLNHYDPAEFWEEVHTKDGW...IILDPGA-------
A3VLC8_9RHOB/1-361G--FSVD-------LKPAQGD.LVGYRA-----KPHTGVIDLDKIGHYDPAEFWEPIHTTEGR...IILDPGA-------
E0TCQ3_PARBH/2-367C--VSVD-------LSGDLGP.VAAWRA-----KKHTGLIDVDRVAALRPEAYFDPLPVMQDQF..LILDPGE-------
B1ZJ40_METPB/1-365P--VSVD-------LAGF..DGLIGYRA-----KRHTGLIDVDRPRGHRTRDFWEPLPADGSRT..LILDPGQ-------
A3JU06_9RHOB/1-362G--FSVD-------LKPAKGN.LVGYRA-----KPHTGVIDLDRIAAYNPADFWEEVRTDNGQ...IILDPGA-------
A3UGF0_9RHOB/1-339T--LSVD-------LKAGEGE.PVGYRA-----KRHSPLVDLVKVGEHDPERFWEPIYAPNGR...IVLDPGE-------
Q0ASF2_MARMM/1-338T--VSVD-------LAGF.GDGIVGYRA-----RRHSGLVDLSRIGGHAAGRYWEPLTAPDRR...LVLDPGE-------
A7ICI7_XANP2/2-372A--LGVD-------LAGEVIPGLQGFRA-----KKHTGVIDVDEAGVLDVEDFWEPIRLRPGRTAGLVLDPDA-------
Q1YJY6_MOBAS/4-370A--LSID-------LVGN.QDGLVGYRG-----KRHTGVVDVDRRGAYALTDFWEPVLRSKAGE..LVLDPDE-------
Q28RG4_JANSC/1-361G--FSVD-------LSPQDTT.LVGYRA-----KPHAGVIDLTQIGAHKTAEFWEDIHSDTGQ...IILDPGA-------
A7HQ50_PARL1/20-384A--LTVN-------LAAETEDEVVGYRA-----KRHSGVIDIDKIGVYDVRDFWDPVHVRPGKG..LILDPDE-------
A0NR82_9RHOB/9-376Q--LSID-------LEGTGPNSLIGYRA-----KHHSGLIDVDVVGAQDVLDFWEPIYRRQRAE..LILDPDA-------
A6U5R4_SINMW/1-364A--LSID-------LKGTGPDGLIGYRG-----KHHTSVVDVDKKAQHAVFDFWEPLYSRGRDD..LILDPDE-------

PF06501

VU55_HHV6U/3-432F.SPPDR----------------------STVTLNMNMPYFKI------------CAD----GK---NLEVFFPNDMSLV
V55B_HHV7J/5-430FVNEIIP----------------------NEISLTVHMHYFKI------------CSD----KR---KIDVFFQDTMLFD
O56289_9BETA/6-427F.SKPNM----------------------QSVALNICMPYFNI------------SEE----FK---TMEIYFPERMTLT

PF05784

Q91CJ4_9BETA/14-353W-.ENGN......................HDIVMNRNPKPYLR------------AHD----RN---GFTILCPQTLHLK
VU54_HHV6U/4-339L-.TPQT......................ADITLSQNQETLLK------------.CN----TH---SITVCATKNIIPN
PP65_HCMVA/14-358L-GSDVE......................EDLTMTRNPQPFMR------------PHE----RN---GFTVLCPKNMIIK
Q8QS17_9BETA/27-369L-.YTHG......................AEVVLRHNPYPHLT------------RHG----DN---GFTLHAPRGFTLS
Q9DWB8_RCMVM/44-408F-REEETLGTTPPIAVTGRRGFPPAAPSQRWVAFNTSPDPTFC------------VPH----GY---GITITCPRNVHLF
Q9DWB9_RCMVM/14-350V-.VTKK......................ANVALRRGTDNVLQ------------KLP----PN---GFRVQPQRPLRAG
B7TPY7_9BETA/1-346L-.LASH......................AQVVMRHNPYPALQ------------SHP----SN---GFTIHCPGDIRLQ
Q918H3_9BETA/11-349W-.TQGR......................YDITPSRNPKPFLV------------PHD----RN---GFAILCPQTFHLK
Q918H5_9BETA/23-363V-.YSHR......................AEVMCRHNPEPFFQ------------RHS----DN---GFIVKNTKGVTIP
Q8QS16_9BETA/14-358L-GSDEE......................EDLTMTRNPQPFMR------------KHQ----RN---GFTIMAPKSLVIK
PP71_HCMVA/28-372V-.YTHR......................AEVVARHNPYPHLR------------RLP----DN---GFQLLIPKSFTLT
Q91TL4_TUHV1/30-399L-.YAHR......................GPVVLRHHPGPFLA------------PHP----HN---GFVVQSPRSLRLR
O56288_9BETA/3-339F-.IQTI......................PHIVMERNQEPVMT------------.YD----GT---CITVGSTKNINSN
Q91CJ3_9BETA/14-354W-.EQSS......................GIITMNRNPKPFLT------------PQQ----RN---GYTILNPKRLHLK
Q9DWC0_RCMVM/15-359F-.VVHG......................TTNVLRRNPEPLLS------------RRH----DN---GYEVRCPRTLYVK
Q91CJ2_9BETA/24-364V-.YAHR......................AEVMWRHNPNPFFE------------RHS----EN---GFLVKCPLHVTIP
Q918H4_9BETA/14-355W-.EQGD......................ASITMSRNPKPFLR------------PNE----RN---GYTILSPKRLHLR
Q98330_MUHV1/18-359V-.GNRA......................KKVNLKRSLDPFLK------------PLP----VN---GFRVVMPRTVQLR

PF06284

Q91CJ5_9BETA/40-498L-RQQTV----------------------TRPFFSDTPLPYFL------------PRKQP..GG---GLDVCLPYDLSLK
Q8QS15_9BETA/1-573L-RRETV----------------------RRPFFSDAPLPYFV------------QRP.G..ED---GLEVRVPYELCLK
UL84_HCMVT/1-587L-RRETV----------------------RRPFFSDAPLPYFV------------PPRSGAADE---GLEVRVPYELTLK
Q918H2_9BETA/1-462L-RRHTV----------------------ARPFFSDTPLPYFL------------PRHDD..NG---GLDVCLPYDLSLK

PF04489

VU10_HHV6U/8-436VVTQIEE---------------------PEPLLFSSNPKLYFTGDVLNATIQLQHNPN----YY---ELLVHAPYDIHFY
UL31_HCMVA/127-550LLTSAQR---------------------GYDLRFSRNPSLFFSGDALNCP..LLNEPN----VF---SLTVHAPYDIHFG
Q9DWF8_RCMVM/314-728LYGVRHR---------------------EPEIMFATNPTCHLAWPL.........GES----EH---EIHVYSPYDVQFK
VU10_HHV7J/1-412LVSTLAN---------------------PDHLLFSCNPKLFFTGDILNSAINLQHSPN----HY---ELTVYAPHNLHFY

PF00692

DUT_CANAW/26-157-------------------------------------------------------------------GYDLYSAEAATIP
DUT_HUMAN/121-250-------------------------------------------------------------------GYDLYSAYDYTIP
VPRT_JSRV/11-134-------------------------------------------------------------------GLDLCATSYTVLT
DUT_ICHVA/62-187-------------------------------------------------------------------GFDLSVLEDREFI
GAG_IPMA/542-670-------------------------------------------------------------------KVDLRAASDFLLM
VPRT_SRV2/36-160-------------------------------------------------------------------GLDLCSTTHTVLT
DUT_EHV4/165-292-------------------------------------------------------------------GYDISAQTNATIE
VPRT_MMTVB/32-156-------------------------------------------------------------------GLDLSSQKDLILS
POL_FIVT2/712-841-------------------------------------------------------------------GYDLLAAAQETHF
VPRT_SMRVH/41-165-------------------------------------------------------------------GLDLCTTTDTILT
DUT_EBVB9/119-240-------------------------------------------------------------------GLDVSLPKDLALF
DUT_SHV21/120-244-------------------------------------------------------------------GFDLYLPTDVTVK
DUT_HAEIN/15-149-------------------------------------------------------------------GLDLRALIDESFE
POL_FIVPE/713-841-------------------------------------------------------------------GYDLLAAK.EIHL
DUT_ORFN2/16-145-------------------------------------------------------------------GLDLCSAYDCVIP
POL_OMVVS/675-803-------------------------------------------------------------------GYDLICPQ.EVCI
DUT_HHV11/206-337-------------------------------------------------------------------GFDIVVRRPVTVP
E431_ADE02/14-141-------------------------------------------------------------------VYVFFSPINFVIP
VPRT_MPMV/36-160-------------------------------------------------------------------GLDLCSTSHTVLT
DUT_HHV6G/241-368-------------------------------------------------------------------IFHLKASREFIAK
DUT_YEAST/16-146-------------------------------------------------------------------GYDIYASQDITIP
DUT_SWPVK/12-141-------------------------------------------------------------------GYDLYSAYSYTVK
DCD_ACIAM/45-169-------------------------------------------------------------------FYEIEKGDEFIIY
POL_EIAV9/745-873-------------------------------------------------------------------GFDLCVPY.DIMI
DUT_ECOLI/15-149-------------------------------------------------------------------GLDLRACLNDAVE
DUT_VACCP/17-145-------------------------------------------------------------------GYDLYSAYDYTIP
POL_CAEVC/699-827-------------------------------------------------------------------GYDLICPE.EVTI
DUT_VZVD/225-354-------------------------------------------------------------------GYDICVPYNLYLK
DUT_SOLLC/39-168-------------------------------------------------------------------GYDLSSAAETKVP

PF04797

LF2_EBVA8/37-401.----------------------------...AFRYNPYPKSH------------WRW----DGES.TDIRYFGSPVIIP
Q8JJR5_9GAMA/8-374.----------------------------...IFLHYFGWMSC------------GYD----SK...ALPIYLEQQKTMK
VG10_EHV2/21-391.----------------------------...VTDRYISPLYN------------QAW----GW...ALPLYAPTQVVVP
P88908_HHV8/7-390.----------------------------...VMGQASPLITT------------PLG----AR...VFAVYPDCEKTIP
Q8UZD9_9GAMA/5-437T----------------------------AREGCFLTMDPGLV------------TLA----GGWT.LFPLHPERDVVVP
Q8JJR4_9GAMA/23-387.----------------------------...SFKFNPYVNMP------------WRW----NEHS.TPIVYMGPNVLIP
Q9YTQ2_ATHV3/24-388.----------------------------...AFQHNPYYFCP------------WDW----GRQS.IPIIYVGPSIRIP
Q993K4_9GAMA/5-437.----------------------------.....AWEKDMGVV------------TRG----TDWT.LVPLYPDTTTMIS
O39235_9GAMA/8-388.----------------------------...VLGQSGPVLPT------------HTG----GR...VLGVYADAEKTIQ
Q993K3_9GAMA/39-404.----------------------------...AFKYNPYPKST------------WRW----DGES.TEIRYFGSPVIIP
Q99D19_BHV4/8-396.----------------------------...VLVSVLPSTTL------------PSC----GK...VWNIYTDSEKILK
VG10_ALHV1/6-378.----------------------------...LFSHFLNWIRV------------NYD----CQ...VMPLYPEQEEVVN
O39236_9GAMA/25-391.----------------------------...AFRHNPYFELP------------WSS----TTAIFTPVVYVGLTVCIP
O41932_MHV68/21-376.----------------------------...AFSKNPCQGHV------------PSH----DDTL.IPLVYTGPTLRLL
Q8AZ09_9GAMA/23-387.----------------------------...CFKFNPYVGIQ------------WKW----NENT.IPIVYMGPTVLIP
LF1_EBVB9/5-442T----------------------------AREGCSLSMDPGLV------------TLK----DAWT.LFPLHPEHDAVVP
VG11_ALHV1/22-387.----------------------------...SFKFNPFVKTP------------WEP----TPAK.VPIVYMGEPVLIP
Q8B411_9GAMA/7-373.----------------------------...VFLHYLGWISC------------GYD----SK...AVPIYLDQQKTMR
O41931_MHV68/8-389P----------------------------TNFIFPAAFPPPVS------------LPH----RN...CIELTCDTERCLK
Q9YTQ3_ATHV3/7-377.----------------------------...VFKHALPWELA------------PSG----GS...ILPIYLEADKIIK
P88909_HHV8/23-387.----------------------------...AFDRNPYNHET------------FAC----NAKHYIPVIYSGPKITLA
VG11_SHV21/24-388.----------------------------...AFEYNPYFSCP------------WDW----KRQS.IPIIYDGPCIRIP
VG11_EHV2/74-450.----------------------------...AFRYNPYLFSP------------WCW----AEAT.VPIHYYGPPVIVP

PF06559

Q0G3Q2_9RHIZ/19-385-------------------------------------------------------------------FYILVSKESVHVP
A3WSL0_9BRAD/1-368-------------------------------------------------------------------FYILASKEAVQVP
Q9A657_CAUCR/23-363-------------------------------------------------------------------FYILASKDDIEIP
A1B368_PARDP/1-361-------------------------------------------------------------------FYILVSREAVAIP
A4EMM0_9RHOB/5-363-------------------------------------------------------------------FYILVSREAIVIP
A3VLC8_9RHOB/1-361-------------------------------------------------------------------FYILVSREAVTIP
E0TCQ3_PARBH/2-367-------------------------------------------------------------------FYILASQEELRLP
B1ZJ40_METPB/1-365-------------------------------------------------------------------FYILASKEAVRVP
A3JU06_9RHOB/1-362-------------------------------------------------------------------FYILVSNEAVHIP
A3UGF0_9RHOB/1-339-------------------------------------------------------------------FYILCSREAVSVP
Q0ASF2_MARMM/1-338-------------------------------------------------------------------FYILASREAVTIG
A7ICI7_XANP2/2-372-------------------------------------------------------------------FYILASREAVHVP
Q1YJY6_MOBAS/4-370-------------------------------------------------------------------FYILVSKEAVHVP
Q28RG4_JANSC/1-361-------------------------------------------------------------------FYILVSREAVTIP
A7HQ50_PARL1/20-384-------------------------------------------------------------------FYILASREALHIP
A0NR82_9RHOB/9-376-------------------------------------------------------------------FYILVSQEAVHVP
A6U5R4_SINMW/1-364-------------------------------------------------------------------FYILVSREAVHVP

PF06501

VU55_HHV6U/3-432-S--NTNKEITLRGEFTNKK-IVGIF----I--PVQTHVFKLYP------FLWFAQEPLKLRISCER-------------
V55B_HHV7J/5-430-E--GETKKLHFKGTFYNFN-ANALY----V--PDPNSKVQSIA------SFWSPTTSFTTKVTSDR-------------
O56289_9BETA/6-427-P--NHITQINLRGTFENPA-AVGLF----I--PKKSNVLS.FP------FIWQPRETFRIYVYCRN-------------

PF05784

Q91CJ4_9BETA/14-353.P--GKTSHLMFDVCFESDK.YVAII----C--PRTIPGISMSC------NPLLPLQNLFMEIKAVHE.-----------
VU54_HHV6U/4-339.T--VTPVHCSFNTIFNSNSNFTGLF----I--PKLLLGISTTT------GIWDETRPLYITMKAFKK.-----------
PP65_HCMVA/14-358.P--GKISHIMLDVAFTSHE.HFGLL----C--PKSIPGLSISG------NLLMNGQQIFLEVQAIRE.-----------
Q8QS17_9BETA/27-369RL--HREYIVQVQNAFETNNTHDVIF----F--PADIPGVSMEA------GPLPDRVRITIRLTWTGEN-----------
Q9DWB8_RCMVM/44-408.P--GHQSRVDISVSFCSERAHLGLF----I--PAPRENVSCQI------VAWKERQTLSLALTAT..V-----------
Q9DWB9_RCMVM/14-350.R--GDEMNIATDATYVSDR.YVAFF----L--PYLIAGLNLSV------SVWLPGAPLDIRLAAT..E-----------
B7TPY7_9BETA/1-346.S--GQTYRLTLRNGFDSTS.HAALF----F--PADFPNADISG------GQWKARHNMDIVIRSHGE.-----------
Q918H3_9BETA/11-349.P--GKISHIMLDVYFESDD.YVGLI----C--PKSIPGVSFTC------NPLMNTQPVFLEVRAEHE.-----------
Q918H5_9BETA/23-363.A--HHTHVAHFNNAFETQNTCSFLF----F--PVDIPGLSIEC------GPLQNRMKITIKMQNLTKT-----------
Q8QS16_9BETA/14-358.P--GKTAHVMLDVAFTSHE.HFGLI----C--PKVIPGLSISS------NLLMSGQHIFLELRALRE.-----------
PP71_HCMVA/28-372RI--HPEYIVQIQNAFETNQTHDTIF----F--PENIPGVSIEA------GPLPDRVRITLRVTLTGDQ-----------
Q91TL4_TUHV1/30-399.P--GQRATVVIPNGFSANQQYRAIF----F--PTDLAGLNVQA------GPWPEKCNLQIELEAYNQ.-----------
O56288_9BETA/3-339.T--TDPFSCTFPTFFDSKQKFAGLF----I--PRLINGISLNT------FTWKERTHLQVTMRAYKK.-----------
Q91CJ3_9BETA/14-354.P--REHANVMIDTYFESDK.YIGFI----C--PKSVPGCSISC------NPIMSTQCIFMEIRSLHD.-----------
Q9DWC0_RCMVM/15-359.A--GQTTALVIDTAYSAHGSLTAVF----F--PKDIPDAEMSL------ALWPEKRPLIVTLTAR..R-----------
Q91CJ2_9BETA/24-364.A--HQTYVVQFNNALETQDTCYAVF----F--PLELPGISMDA------GPLPNRMKITINVQNLTAN-----------
Q918H4_9BETA/14-355.P--KKIAQVFIDMYFESDE.YIGLI----C--PKNIPGVSISC------NPLMSAQPIYMEVRSMSR.-----------
Q98330_MUHV1/18-359.T--GQSVVLTSTAMYHASN.HAALF----I--PYLIPGLDIHP------SVWMPNSNLSFTITGMK..-----------

PF06284

Q91CJ5_9BETA/40-498-T--SHLIRI-YRRFYGP---FLGLF----I--PHNRQELNMPV------TIWLPRTWLEISVIGDNTH...........
Q8QS15_9BETA/1-573-A--SHTLRI-YRRFYGP---YLGLF----V--PQNRQGLKMPV------TVWLPRTWLEITVLVSGNHSNAADSSNASG
UL84_HCMVT/1-587-N--SHTLRI-YRRFYGP---YLGVF----V--PHNRQGLKMPV------TVWLPRSWLELTVLVSDEN...........
Q918H2_9BETA/1-462-S--SHLIRI-YRRFYGP---FLGLF----L--PHNRQDLVMPV------TIWLPRTWLEINVVGENAH...........

PF04489

VU10_HHV6U/8-436-P--SRCHIVILPIRYFTKPDKQ.IL----ISGYQNEGFFETQV------MLWAPGTPLHITLRSFSP------------
UL31_HCMVA/127-550-V--QPRQTVELDLRYVQITDR.CFL----VANLPHEDAFYTGL------SVWRGGEPLKVTLWTRTR------------
Q9DWF8_RCMVM/314-728-G--GRHHF.SLDLRYFKPQHRRCFL----VSVPQDETRFHTAM------TVWRPDAPLRLTLVSHLP------------
VU10_HHV7J/1-412-P--SCFHIVTLPIQFSSRNDRQ.ML----VSSYPNEGYFEVQM------CPWVQNSPLQIVIKSFSK------------

PF00692

DUT_CANAW/26-157-A..HGQGLVSTDISIIVPI.GTYGR-VAPRSGL.AVKHGISTG..AGVIDADYRG.EVKVVLFNHSEK.----------
DUT_HUMAN/121-250-P..MEKAVVKTDIQIALPS.GCYGR-VAPRSGL.AAKHFIDVG..AGVIDEDYRG.NVGVVLFNFGKE.----------
VPRT_JSRV/11-134-P.EMGVQTLATGVFGPLPP.GTVGL-LLGRSSA.SLKGILIHP...GVIDSDYTG.EIKILASAPNK..----------
DUT_ICHVA/62-187-R..GCHYRLPTGLAIAVPR.GYVGI-ITPRSS..QAKNFVSTG....IIDSDFRG...HIHIMVSAIA.----------
GAG_IPMA/542-670-P.QMSIQPVPVEPIPSLPL.GTMGL-ILGRGSASTLQGLVVHP......ELWIVNIPQKYQVLCSSPKG----------
VPRT_SRV2/36-160-P.EMGPQTLATGVYGPLPP.NTFGL-ILGRGST.TVKGLQIYP...GVIDNDYTG.EFKIMARAISS..----------
DUT_EHV4/165-292-P..DESYFVELPIVFSSSNPAVTPC-IFGRSSM.NRRGLIVLP......TRWVTGRTCCFFILNINKY.----------
VPRT_MMTVB/32-156-L.EDGVSLVPTLVKGTLPE.GTTGL-IIGRSSN.YKKGLEVLP...GVIDSDFQG.EIKVMVKAAKN..----------
POL_FIVT2/712-841-L.PGEVRIVPTKTRIMLPK.GHWGL-IMGKSSI.GSKGVDVLG...GVIDEGYRG.ELGVIMINLTKK.----------
VPRT_SMRVH/41-165-T.QNSPLTLPVGIYGPLPP.QTFGL-ILAEPAL.PSKGIQVLP...GILDNDFEG.EIHIILSTTKD..----------
DUT_EBVB9/119-240-P..HQTVSVTLTVPPP.SIPHHRPT-IFGRSGL.AMQGILVKP......CRWRRG.GVDVSLTNFSDQ.----------
DUT_SHV21/120-244-P..RVPNRYSVNICCPAQLKSYKPV-LFGRSGL.AAKGLTIKV.......SRWQN.QLQIIFYNYTKS.----------
DUT_HAEIN/15-149-IQPGETKLIPTGLSIYIADPNLAAV-ILPRSGL.GHKHGIVLGNLVGLIDSDYQG.PLMVSMWNRGNE.----------
POL_FIVPE/713-841-L.PGEVKVIPTGVKLMLPK.GYWGL-IIGKSSI.GSKGLDVLG...GVIDEGYRG.EIGVIMINVSRK.----------
DUT_ORFN2/16-145-S..HCSRVVFTDLLIKPPS.GCYGR-IAPRSGL.AVKHFIDVG..AGVIDEDYRG.NVGVVLFNFGNS.----------
POL_OMVVS/675-803-P.AGQVRKIPINLRINLKE.DQWAM-VGTKSSF.ASKGVFVQG...GIIDSGYQG.IIQVVVYNSNDK.----------
DUT_HHV11/206-337-A.NGTTVVQPSLRMLHADAGPAACY-VLGRSSL.NARGLLVVP......TRWLPGHVCAFVVYNLTGV.----------
E431_ADE02/14-141-P..MGAVMLSLRLRVCIPP.GYFGR-FLALTDV.NQPDVFTES...YIMTPDMTE.ELSVVLFNHGDQ.----------
VPRT_MPMV/36-160-P.EMGPQALSTGIYGPLPP.NTFGL-ILGRSSI.TMKGLQVYP...GVIDNDYTG.EIKIMAKAVNN..----------
DUT_HHV6G/241-368-P..NSYTIQYFDAMYVCAD.ELKAL-MIPSKEI.AKLGLLIET...YIWNKDTIP...SIKIFNSTRK.----------
DUT_YEAST/16-146-A..MGQGMVSTDISFTVPV.GTYGR-IAPRSGL.AVKNGIQTG..AGVVDRDYTG.EVKVVLFNHSQR.----------
DUT_SWPVK/12-141-P..YNRILVRTDICLMIPD.KCYGR-ISPRSGL.SLNYNIDIG..GGVIDSDYRG.EIGIVFINNGCS.----------
DCD_ACIAM/45-169-P..NEHVLLVTEEYVKLPN.DVMAF-VNLRSSF.ARLGLFVPP...TIVDAGFEG...QLTIEVLGSAF----------
POL_EIAV9/745-873-P.VSDTKIIPTDVKIQVPP.NSFGW-VTGKSSM.AKQGLLING...GIIDEGYTG.EIQVICTNIGKS.----------
DUT_ECOLI/15-149-LAPGDTTLVPTGLAIHIADPSLAAM-MLPRSGL.GHKHGIVLGNLVGLIDSDYQG.QLMISVWNRGQD.----------
DUT_VACCP/17-145-P..GERQLIKTDISMSMPK.ICYGR-IAPRSGL.SLKG.IDIG..GGVIDEDYRG.NIGVILINNGKC.----------
POL_CAEVC/699-827-E.PGQVKCIPIELRLNLKK.SQWAM-IATKSSM.AAKGVFTQG...GIIDSGYQG.QIQVIMYNSNKI.----------
DUT_VZVD/225-354-RNEFIKIVLPIIRDWDLQHPSINAY-IFGRSSK.SRSGIIVCP......TAWPAGEHCKFYVYNLTGD.----------
DUT_SOLLC/39-168-A..RGKALVPTDLSIAVPQ.GTYAR-IAPRSGL.AWKYSIDVG..AGVIDADYRG.PVGVVLFNHSEV.----------

PF04797

LF2_EBVA8/37-401-P--NFITELEYNNTYEAPLSSKITA...VVVSHSSNPVFYVYP---...QEWKPGQTLKLTVRNISNN-----------
Q8JJR5_9GAMA/8-374-P--HESIKVKIKTMYATYESSSKGT.KIAICGLSESSLWIAES---...KTWQPMTPLVLTIHNISDR-----------
VG10_EHV2/21-391-P--KKTLKVPVDGMFFRGTVPGAQP.VCLIGGSNINPDLVVRP---...VVWKPMTSLVLTLYNNSER-----------
P88908_HHV8/7-390-P--QETTTLRIQLLFEQHGANAGDC.AFVIMGLARETKFVSFP---...AVLLPGKHEHLIVFNPQTH-----------
Q8UZD9_9GAMA/5-437-P--REELQVVAQGQLQGAAPSLSGF....TFQEAACNQWVLRP---...RVWTAHSPIKLAIYNCGDK-----------
Q8JJR4_9GAMA/23-387-G--NCATIVEYTNKYFCMKGIYITA..FIVNIPKGDVDFEIET---...CQWLPESTAQILVKNNSPF-----------
Q9YTQ2_ATHV3/24-388-A--DRHAVVKYNNMYSSTYANITAM....ITNCETCPDFHISD---...CEWKPESPVYINVTNTLNI-----------
Q993K4_9GAMA/5-437-P--GEEAVIKAAGQVINGPPMQGHT..GFVFQDACCDRWVLRP---...NMWHAPGTLFMTVYNPGTT-----------
O39235_9GAMA/8-388-P--GSSAEVRVQLIFQQGAAARGDL.AFLVTGVAPEPLFVVTP---...ALLLSGCTTHLRLFNPNGT-----------
Q993K3_9GAMA/39-404-P--NFITSVDYNNTYETPLSTKITA...LILSHPNNQVFYIYP---...QEWKPGQTIKLMVRNISNF-----------
Q99D19_BHV4/8-396-P--GETLNLKLKYTYTRGNESTKAV..MFITGTNTNPMVTIEP---...TIWLPMTPLQVTIKNPTNM-----------
VG10_ALHV1/6-378-A--HDWVRFQVNNKFLVSTAVDTPL.KVFICGLGQPSFLVADP---...GIWNPSSTCLLTLHNISNQ-----------
O39236_9GAMA/25-391-P--NCSKFVRYGNTYVSAFNRKLTA...IISNHAHNGGFRIQD---...CEWPPNREIEILVTNVSQA-----------
O41932_MHV68/21-376-P--LETISIPFNTSFVAQNPDLKAI.....IYDNNLKDIRISA---...TMW.TGEQTPILAHNLTAA-----------
Q8AZ09_9GAMA/23-387-G--CCATSIEYTNKYYCMNGTYITA..FIVNISSGDVDFEIET---...CQWMPESTAEIMVKNNSPF-----------
LF1_EBVB9/5-442-P--KEEIHVMAQGHLQGGTPSLWGF....TFQEAACDQWVLRP---...RVWTAHSPIKMTVYNCGHK-----------
VG11_ALHV1/22-387-G--SCSTIVEYCNRYYVAKGLRITA..IIVSVETDDTEFETDV---...CEWASECTAKIMVSNKSLF-----------
Q8B411_9GAMA/7-373-P--FESIKVKLKTMYGIYDSSARGT.KIAVCGLSDTSFWIAES---...KIWQPMSIIVLTIHNISDR-----------
O41931_MHV68/8-389-P--GDVMKLKHRLLYELGQRGDTPQNAFLIVGAHSPETVWISP---...SLWLPGQPLYINIINLSHK-----------
Q9YTQ3_ATHV3/7-377-P--GSSVEISFSFVFNRGLVDTNQS.ALFVASSNHTTKYVVKP---...QIWYPITPLSITVYNPGNR-----------
P88909_HHV8/23-387-P--RGRQVVWHNNSYTSSLPCKVTA...IVSNHCCNCDIFLED---...SEWRPNKPAPLKLVNTSDH-----------
VG11_SHV21/24-388-A--GRLAPVKYNNTYSSIYPNATAI....ITNSDSCADFHISD---...CEWKPGKTACIVVTNTSTI-----------
VG11_EHV2/74-450-A--GQAARVVYGNVYYAPMLDELTA..VIAPPLDGDGDRRFGL---MGCCEWPKGGHAELAVENRTCF-----------

PF06559

Q0G3Q2_9RHIZ/19-385-P-AYAAEMTPFDPLVGEFRVHYAGF---------FDPGFGHDA---------AGGSGSRAVLEVRSHEV----------
A3WSL0_9BRAD/1-368-P-DYAAEMVPFDPLVGEFRVHYAGF---------FDPGFGYAG---------AGGEGSRAVLEVRSREV----------
Q9A657_CAUCR/23-363-V-LEAAEMTPIDPSVGEFRVHYAGF---------FDPGFGTEE---------AAAVGSKGVLEVRSHET----------
A1B368_PARDP/1-361-P-DYAAEMAPYLAMVGEFRVHYAGF---------FDPGFGHGS---------A.GQGARGVLEVRCHEA----------
A4EMM0_9RHOB/5-363-P-MQAAEMAPYLAMVGEFRVHYAGF---------FDPGFGYAD---------AGGSGSRGVLEVRCHEA----------
A3VLC8_9RHOB/1-361-P-DCAAEMAPYLAMVGEFRVHYAGF---------FDPGFGHDT---------AGGTGSRGVLEVRCHEA----------
E0TCQ3_PARBH/2-367-D-DLAAEMAPIDADLGAFRVHYAGF---------FDPGFGLEA---------P....SRAVLEVRGYDA----------
B1ZJ40_METPB/1-365-A-DHAAEMVPFDPLVGEFRVHYAGF---------FDPGFGLSE---------AGGAGARAVLEVRSRDV----------
A3JU06_9RHOB/1-362-P-QYAAEMAPYVAMVGEFRVHYAGF---------FDPGFGNAE---------AGGAGSRGVLEVRCHEA----------
A3UGF0_9RHOB/1-339-V-GQAAEMAPIAPEIGEFRAHYAGF---------FDPGFGVDA---------AGGAGSRAVLEVRGRDV----------
Q0ASF2_MARMM/1-338-C-DEAAEMAPIATEIGEFRAHYAGF---------FDPGFGTTE---------AGGTGARAVLEVRGRDV----------
A7ICI7_XANP2/2-372-P-DYAAEMVPFDPLVGEFRVHYAGF---------FDPGFGNPA---------AGGRGARAVLEVRSREV----------
Q1YJY6_MOBAS/4-370-P-AFAAEMTPFDPLVGEFRVHYAGF---------FDPGFGHSA---------AGGSGSRAVLEVRSHDV----------
Q28RG4_JANSC/1-361-P-DCAAEMAPYLAMVGEFRVHYAGF---------FDPGFGH..---------..GVPARGVLEVRCHEA----------
A7HQ50_PARL1/20-384-A-THAAEMVAYNPLVGEFRVHYAGF---------FDPGFGARE---------AGGAGSRIVLEVRSHEV----------
A0NR82_9RHOB/9-376-P-DYAAEMVPFDPLVGEFRVHYAGF---------FDPGFGHAG---------AGGVGSRAVLEVRSHDV----------
A6U5R4_SINMW/1-364-P-LYAAEMTPFDPLVGEFRVHYAGF---------FDPGFGHAS---------AGGSGSRAVLEVRSHEV----------

PF06501

VU55_HHV6U/3-432---------------------TVSVTEHDMLGRVFFVTKKLFRKPFRSLSNSDMKSLLTHTENTDKPFDVHFMGNCFPAY
V55B_HHV7J/5-430---------------------SQRVTTNDIIGSIYFIPTHILRTKFDPNYTDSFAAEIELNSEDPESDALYFLADKIFIS
O56289_9BETA/6-427---------------------ETFVTEHDIIGHVYFISREQFPHSFHPTAHADCKSKVEAAFNS...FRINFLGNDFFSD

PF05784

Q91CJ4_9BETA/14-353---------------------SLYIEQYEELGWLYFFDRKMILT------------------------------------
VU54_HHV6U/4-339---------------------NRRINYSQPIGVVYFFPKQILPP------------------------------------
PP65_HCMVA/14-358---------------------TVELRQYDPVAALFFFDIDLLLQ------------------------------------
Q8QS17_9BETA/27-369---------------------SVRIEHMQILGTIHLFKRGVLNL------------------------------------
Q9DWB8_RCMVM/44-408---------------------STDLARGDLLGDAYFLPSNAPRV------------------------------------
Q9DWB9_RCMVM/14-350---------------------DVNLPPNTPIGEIRFVSAASVRV------------------------------------
B7TPY7_9BETA/1-346---------------------.TTVRKDEVLGIVHFFDNDLLTF------------------------------------
Q918H3_9BETA/11-349---------------------SIYLEKFELIGWLHFIKRKSLLV------------------------------------
Q918H5_9BETA/23-363---------------------EISVSFMQTIGLIHFFPRGTLYT------------------------------------
Q8QS16_9BETA/14-358---------------------TVEIRQYDALAALFFFDRDMLML------------------------------------
PP71_HCMVA/28-372---------------------AVHLEHRQPLGRIHFFRRGFWTL------------------------------------
Q91TL4_TUHV1/30-399---------------------PVHLDRLQRLGTVHFFPEDVFVP------------------------------------
O56288_9BETA/3-339---------------------NCRIDYSQELGKLIFLPSQIVTH------------------------------------
Q91CJ3_9BETA/14-354---------------------SVYIEPFQAIASLHFFDRNLFL.------------------------------------
Q9DWC0_RCMVM/15-359---------------------DLGIRAHAVLGRVHLFPADSAMF------------------------------------
Q91CJ2_9BETA/24-364---------------------AITLAHMQMLGFIHLFRRGSVGV------------------------------------
Q918H4_9BETA/14-355---------------------NADIKLFQPLASLHFIERKLLFR------------------------------------
Q98330_MUHV1/18-359---------------------DMEVSVETAIGELRFVSRSWMTV------------------------------------

PF06284

Q91CJ5_9BETA/40-498........................IPKNTVLGQLYFISSKHSLNRGRLSALANQVKSSLHGTP.......HQVSLLGASF
Q8QS15_9BETA/1-573DGVVNHSNHHNQSGQDDDGSGGVSLPRDSVLGRLYFISSKHTLNRGCLSALTYQVKSALHNRP......APQLSVLGASI
UL84_HCMVT/1-587.....................GATFPRDALLGRLYFISSKHTLNRGCLSAMTHQVKSTLHSRSTSHSPSQQQLSVLGASI
Q918H2_9BETA/1-462........................IPKNTVLGQLYFISSKHTLNRGRMSALTHQVKSAVHNVP.......HQLSLLGASL

PF04489

VU10_HHV6U/8-436---------------------NLILPQSTKRRNRKAV-------------------------------------------
UL31_HCMVA/127-550---------------------SIVIPQGTPIATLYQI-------------------------------------------
Q9DWF8_RCMVM/314-728---------------------NLQLHRGTQVATLYLI-------------------------------------------
VU10_HHV7J/1-412---------------------NLVLPQGTPIAILLYM-------------------------------------------

PF00692

DUT_CANAW/26-157---------------------DFEIKEGDRIAQLVLEQ-IVNA.DIKEISLEEL.DNTERGEGGFGSTG-----------
DUT_HUMAN/121-250---------------------KFEVKKGDRIAQLICER-IFY...PEIEEVQAL.DDTERGSGGFGSTG-----------
VPRT_JSRV/11-134---------------------IIVINAGQRIAQLLLVP-LVI.......QGKTI.NRDRQ.DKGFGSSD-----------
DUT_ICHVA/62-187---------------------DFSVKKNQRIAQLVVTP-CLT..QSEVVPYETL.ERTRRGTGGFGSSG-----------
GAG_IPMA/542-670---------------------VFSISKGDRIPQLLLLL-PDN.....TREKSAGPEIKKMGSSGNDSAY-----------
VPRT_SRV2/36-160---------------------IITIPQGERIAQLVLLP-LLR.......TAHKI.QHPYRGDKNFGSSD-----------
DUT_EHV4/165-292---------------------PVYITKGQRVAQLVLTE-DIDE.ALIPTNVN...YNTPFPTYSPTGAV-----------
VPRT_MMTVB/32-156---------------------AVIIHKGERIAQLLLLP-YLK.......LPNPV.IKEERGSEGFGSTS-----------
POL_FIVT2/712-841---------------------SITILEKQKIAQLIILP-CRH...EGLQQGEIQ.MNSERGEKGFGSAG-----------
VPRT_SMRVH/41-165---------------------LVTIPKGTRLAQIVILP-LQQ.......INSNF.HKPYRGASAPGSSD-----------
DUT_EBVB9/119-240---------------------TVFLNKYRRFCQLVY..-.LHK.HHLTSFYS...PHSDAGVLGP.RSL-----------
DUT_SHV21/120-244---------------------QITYTARTRIAQVVFMH-KKH.....LPTTLTRLKPTMHLSENIKYSW-----------
DUT_HAEIN/15-149---------------------PFKIEVGDRIAQLVFVP-VVQ...AEFNIVEDF.QQTERGEGGFGHSG-----------
POL_FIVPE/713-841---------------------SITLMERQKIAQLIILP-CKH...EVLEQGKVV.MDSERGDNGYGSTG-----------
DUT_ORFN2/16-145---------------------DFEVKKGDRIAQLICER-ISC...PAVQEVNCL.DNTDRGDSGFGSTG-----------
POL_OMVVS/675-803---------------------EVIIPQGRKFAQLILMP-LIH...EDLEAWGET.RRTERGNQGFGSTG-----------
DUT_HHV11/206-337---------------------PVTLEAGAKVAQLLVAG-ADALPWIPPDNFHGT.KALRNYPRGVPDST-----------
E431_ADE02/14-141---------------------FFYGHAGMAVVRLMLIR-VVF....PVEPADMF.ERKMVSFSVVVPEL-----------
VPRT_MPMV/36-160---------------------IVTVSQGNRIAQLILLP-LIE.......TDNKV.QQPYRGQGSFGSSD-----------
DUT_HHV6G/241-368---------------------TIYIPTGICIARIIFT.-CGHF.CLSLMPERAI.NRLQVLDANSSFLF-----------
DUT_YEAST/16-146---------------------DFAIKKGDRVAQLILEK-IVD..DAQIVVVDSL.EESARGAGGFGSTG-----------
DUT_SWPVK/12-141---------------------DFNIKVGDRIAQIIFER-VEY...PIMEEVKCL.EDTERGNSGFGSSG-----------
DCD_ACIAM/45-169---------------------PVKIKRGTRFLHLIFAR-TLT.......PVENPYHGKYQGQQGVTLPK-----------
POL_EIAV9/745-873---------------------NIKLIEGQKFAQLIILQ-HHS...NSRQPWDEN.KISQRGDKGFGSTG-----------
DUT_ECOLI/15-149---------------------SFTIQPGERIAQMIFVP-VVQ...AEFNLVEDF.DATDRGEGGFGHSG-----------
DUT_VACCP/17-145---------------------TFNVNTGDRIAQLIYQR-IYY...PELEEVQSL.DSTNRGDQGFGSTG-----------
POL_CAEVC/699-827---------------------AVVIPQGRKFAQLILMD-KKH...GKLEPWGES.RKTERGEKGFGSTG-----------
DUT_VZVD/225-354---------------------DIRIKTGDRLAQVLLID-HNT....QIHLKHNVLSNIAFPYAIRGKCG-----------
DUT_SOLLC/39-168---------------------DFEVKVGDRIAQLIVQK-IVT...PEVEQVDDL.DSTVRGSGGFGSTG-----------

PF04797

LF2_EBVA8/37-401---------------------PITIVTGQSMAQAFFIY....AGDPSISTIMRRYIQRQGCALTLPGNI-----------
Q8JJR5_9GAMA/8-374---------------------WVTLNDNQPVALGLII....SCQDSACEPADSIYFDIANNSLHWQEIN-----------
VG10_EHV2/21-391---------------------PLAIRRGDLAALAVPV.........NSTDIRTVYSDNSGTLITWDTGT-----------
P88908_HHV8/7-390---------------------PLTIQRDTIVGVAMACY...IHPGKAASQAPYSFYDCKEESWHVGLFQ-----------
Q8UZD9_9GAMA/5-437---------------------PLHVGPGVRLGFALFW....PAKRSDSLDAGRIFYQLTSGELHWGRHV-----------
Q8JJR4_9GAMA/23-387---------------------PKRLTSGIQLGQAYFIL...SEKYILADVLPKSLLGKLSTCIVLPGNI-----------
Q9YTQ2_ATHV3/24-388---------------------AITISSGTKLGEAVFLL...APKFLCKKIISKKHVQTLPSAVTLPGNV-----------
Q993K4_9GAMA/5-437---------------------YLTINRRDRLGFAIFW.....PTDGVNTSEGLIYYDRISRCIHWGAAV-----------
O39235_9GAMA/8-388---------------------PTTIKRDTLVAAAAPCP..VVRLSSADDAPRDLVASPDTGALSINAFT-----------
Q993K3_9GAMA/39-404---------------------PITIITGQPLAQAFFIY....NSGEGLSTMMKRAVHRHQHVLTLPGNI-----------
Q99D19_BHV4/8-396---------------------IITIKKDLAIAACVPYY..STLEDRQPPASPSVYFNPQDLTITWEDSM-----------
VG10_ALHV1/6-378---------------------PVKLRTCEPVAVGLLLY..C...NDAHLPSRDVCFCSETGRLEWRNCV-----------
O39236_9GAMA/25-391---------------------PVYISTGTQLGQAIFVF....APRFGGPAKLRQLLGHRSRALELPGGV-----------
O41932_MHV68/21-376---------------------VKLIHSGTVFARAAFFS.......TKENKKACTLKLCPSTILLPGGEL-----------
Q8AZ09_9GAMA/23-387---------------------PRRLDMGTQLGQAYFIL...AERYVLGDMLPESMLKRLSTCVILPGNI-----------
LF1_EBVB9/5-442---------------------PLHIGPSTRLGLALFW....PAERSDNLDAGRIFYQLTSGELYWGRTV-----------
VG11_ALHV1/22-387---------------------PRTLAPGTHIANAHFLL...AERHFFSRILSDKNLKKLSTCIKLPGGF-----------
Q8B411_9GAMA/7-373---------------------SITLYNNQPVAIALII....RCKTVEGRQGDGTYFDAIHNSLYWQDSE-----------
O41931_MHV68/8-389---------------------PLLLSRHSILALAIPISYTRAPASAHEATDTTICYSGNSRVLTCGAAH-----------
Q9YTQ3_ATHV3/7-377---------------------IIFIKRGFCVAVAVPCF..FYLKAPGQDCEDKVTLDSQTSSIHWSDVL-----------
P88909_HHV8/23-387---------------------PVILEPDTHIGNALFII.......APKARGLRRLTRLTTKTIELPGGV-----------
VG11_SHV21/24-388---------------------SVTISSGTHLGEAVFIL...APKFFCRKIMSKTHVQKLSSAICLPGNV-----------
VG11_EHV2/74-450---------------------LQVLRTGDRLGYAIFFI...APRIPMVNLLPARYRENLSVAVTVVGGV-----------

PF06559

Q0G3Q2_9RHIZ/19-385---------------------PFILEDGQIVGRLVYEH-MASLPDRLYGADLKSNYQAQGLKLSKHF.A-----------
A3WSL0_9BRAD/1-368---------------------PFILEHGQIVGRLVYEK-MLARPDAMYGQRIGSNYQAQGLKLSKHFRL-----------
Q9A657_CAUCR/23-363---------------------PFLLEDGQTVARLVYEP-LTARPARLYGEG.GSHYQRQGLKLSKHFKA-----------
A1B368_PARDP/1-361---------------------PFALEHGQVVGRLVYER-MAARPERLYGSGIASNYQGQGLKLAKQF.A-----------
A4EMM0_9RHOB/5-363---------------------PFVLEHGQVVGRLVYEH-MAAMPAALYGREIKSNYQGQGLKLSKHFRG-----------
A3VLC8_9RHOB/1-361---------------------PFVLEHGQVVGRLVYEK-MSETPETLYGADLKSNYQGQGLKLSKHFRA-----------
E0TCQ3_PARBH/2-367---------------------PFLIRHGQTMARLTFER-LTRPVSRRYGEALKSHYHGQGLRLSKHFAA-----------
B1ZJ40_METPB/1-365---------------------PFLLEDGQIVGRLVYER-MLERPATLYGAGAGSNYQAQGLKLSKHFAT-----------
A3JU06_9RHOB/1-362---------------------PFVLEHGQSVGRLVYEK-MTEVPDTLYGAGIASNYQGQGLKLSKHFKA-----------
A3UGF0_9RHOB/1-339---------------------PFILDHGQAVARLVYEP-MSSEVKTPYGV.AGSNYQAQGLKLAKHFKS-----------
Q0ASF2_MARMM/1-338---------------------PFLLEHGQPIARLVYEP-MLDVPHTVYGQ.VASNYQAQGLKLSKFFAS-----------
A7ICI7_XANP2/2-372---------------------PFILEHGQTVGRLVYER-MAGRPGTLYGADMRSHYQGQGLKLSKHFKP-----------
Q1YJY6_MOBAS/4-370---------------------PFILEDGQIVGRLVYER-MQALPEKLYGSDLKSNYQAQGLKLSKHF.V-----------
Q28RG4_JANSC/1-361---------------------PFVLEHGQTVGRLVYET-MASAPSQLYGTDIASNYQGQGLKLSKHFAP-----------
A7HQ50_PARL1/20-384---------------------PFILEHGQIIGRFVLER-LTDRPTVLYGAGLGSNYQRQGLKLSKHFRT-----------
A0NR82_9RHOB/9-376---------------------PFIVEHGQTIGRLVYEH-MAERPATLYGEGIGSNYQGQALKLSKHFKA-----------
A6U5R4_SINMW/1-364---------------------PFILEHGQIVGRLIYEH-MLDRPEGLYGLDLGSNYQAQGLKLSKHFRA-----------

PF06501

VU55_HHV6U/3-432LLPELTLHPL...--EYEDKPARGNPQTLPSVEKHSIIKIRI
V55B_HHV7J/5-430DLPDLILRKGWSA--RKKKLQSGSNIN....NHAPSKSRLRF
O56289_9BETA/6-427SLPILTVHPMTDF--PYEQIQETENIRHNSMNITPRFKRMQL

PF05784

Q91CJ4_9BETA/14-353------------------------------------------
VU54_HHV6U/4-339------------------------------------------
PP65_HCMVA/14-358------------------------------------------
Q8QS17_9BETA/27-369------------------------------------------
Q9DWB8_RCMVM/44-408------------------------------------------
Q9DWB9_RCMVM/14-350------------------------------------------
B7TPY7_9BETA/1-346------------------------------------------
Q918H3_9BETA/11-349------------------------------------------
Q918H5_9BETA/23-363------------------------------------------
Q8QS16_9BETA/14-358------------------------------------------
PP71_HCMVA/28-372------------------------------------------
Q91TL4_TUHV1/30-399------------------------------------------
O56288_9BETA/3-339------------------------------------------
Q91CJ3_9BETA/14-354------------------------------------------
Q9DWC0_RCMVM/15-359------------------------------------------
Q91CJ2_9BETA/24-364------------------------------------------
Q918H4_9BETA/14-355------------------------------------------
Q98330_MUHV1/18-359------------------------------------------

PF06284

Q91CJ5_9BETA/40-498SLQDLAPMRVSNP..SPETAQQQQSPTNNNKPVTIAMVCNQR
Q8QS15_9BETA/1-573ALQDLLPMRLLSA..EPTQEQQQTPATEKPSPVTLAMICGDL
UL84_HCMVT/1-587ALEDLLPMRLASPETEPQDCKLTENTTEKTSPVTLAMVCGDL
Q918H2_9BETA/1-462SLQDLVPIQVSRP..DPEAERQQQQASQ..KPVTFAMVCDHQ

PF04489

VU10_HHV6U/8-436------------------------------------------
UL31_HCMVA/127-550------------------------------------------
Q9DWF8_RCMVM/314-728------------------------------------------
VU10_HHV7J/1-412------------------------------------------

PF00692

DUT_CANAW/26-157------------------------------------------
DUT_HUMAN/121-250------------------------------------------
VPRT_JSRV/11-134------------------------------------------
DUT_ICHVA/62-187------------------------------------------
GAG_IPMA/542-670------------------------------------------
VPRT_SRV2/36-160------------------------------------------
DUT_EHV4/165-292------------------------------------------
VPRT_MMTVB/32-156------------------------------------------
POL_FIVT2/712-841------------------------------------------
VPRT_SMRVH/41-165------------------------------------------
DUT_EBVB9/119-240------------------------------------------
DUT_SHV21/120-244------------------------------------------
DUT_HAEIN/15-149------------------------------------------
POL_FIVPE/713-841------------------------------------------
DUT_ORFN2/16-145------------------------------------------
POL_OMVVS/675-803------------------------------------------
DUT_HHV11/206-337------------------------------------------
E431_ADE02/14-141------------------------------------------
VPRT_MPMV/36-160------------------------------------------
DUT_HHV6G/241-368------------------------------------------
DUT_YEAST/16-146------------------------------------------
DUT_SWPVK/12-141------------------------------------------
DCD_ACIAM/45-169------------------------------------------
POL_EIAV9/745-873------------------------------------------
DUT_ECOLI/15-149------------------------------------------
DUT_VACCP/17-145------------------------------------------
POL_CAEVC/699-827------------------------------------------
DUT_VZVD/225-354------------------------------------------
DUT_SOLLC/39-168------------------------------------------

PF04797

LF2_EBVA8/37-401------------------------------------------
Q8JJR5_9GAMA/8-374------------------------------------------
VG10_EHV2/21-391------------------------------------------
P88908_HHV8/7-390------------------------------------------
Q8UZD9_9GAMA/5-437------------------------------------------
Q8JJR4_9GAMA/23-387------------------------------------------
Q9YTQ2_ATHV3/24-388------------------------------------------
Q993K4_9GAMA/5-437------------------------------------------
O39235_9GAMA/8-388------------------------------------------
Q993K3_9GAMA/39-404------------------------------------------
Q99D19_BHV4/8-396------------------------------------------
VG10_ALHV1/6-378------------------------------------------
O39236_9GAMA/25-391------------------------------------------
O41932_MHV68/21-376------------------------------------------
Q8AZ09_9GAMA/23-387------------------------------------------
LF1_EBVB9/5-442------------------------------------------
VG11_ALHV1/22-387------------------------------------------
Q8B411_9GAMA/7-373------------------------------------------
O41931_MHV68/8-389------------------------------------------
Q9YTQ3_ATHV3/7-377------------------------------------------
P88909_HHV8/23-387------------------------------------------
VG11_SHV21/24-388------------------------------------------
VG11_EHV2/74-450------------------------------------------

PF06559

Q0G3Q2_9RHIZ/19-385------------------------------------------
A3WSL0_9BRAD/1-368------------------------------------------
Q9A657_CAUCR/23-363------------------------------------------
A1B368_PARDP/1-361------------------------------------------
A4EMM0_9RHOB/5-363------------------------------------------
A3VLC8_9RHOB/1-361------------------------------------------
E0TCQ3_PARBH/2-367------------------------------------------
B1ZJ40_METPB/1-365------------------------------------------
A3JU06_9RHOB/1-362------------------------------------------
A3UGF0_9RHOB/1-339------------------------------------------
Q0ASF2_MARMM/1-338------------------------------------------
A7ICI7_XANP2/2-372------------------------------------------
Q1YJY6_MOBAS/4-370------------------------------------------
Q28RG4_JANSC/1-361------------------------------------------
A7HQ50_PARL1/20-384------------------------------------------
A0NR82_9RHOB/9-376------------------------------------------
A6U5R4_SINMW/1-364------------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window