Sequence alignment for CL0153

PF00692

DUT_HUMAN/121-250--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------
F4B717_ACIHW/46-166--------------------------------------------------------------------------------
DUT_CANAL/28-157--------------------------------------------------------------------------------
DUT_VACCW/18-145--------------------------------------------------------------------------------
DUT_HHV6U/242-365--------------------------------------------------------------------------------
Q6TVW3_ORFSA/26-154--------------------------------------------------------------------------------
Q8V3S4_SWPV1/13-141--------------------------------------------------------------------------------
PRO_MMTVC/620-741--------------------------------------------------------------------------------
Q9TTD4_SHEEP/13-133--------------------------------------------------------------------------------

PF04797

VG11_EHV2/74-450--PGDPFWSFSVYATYVKVTNK-----IRFVPGMLADC....TLPYLPNLKNILAG------RYPNFHFTTTA-HGGN.L
LF2_EBVA8/37-401--FMRGVWKYEIFPSYVRVTNK-----QVLQLDAQCQE.....LPPCPSVGQILSF------KLPSFSFNTTT-YGSR.Y
VG10_EHV2/21-391--FFVENWKVEVTPAALTVVNT-----SEVPVQDPRCTI..ITLPFSVWSA..MEC------MLCRFQPANQL-HVACKL
VG10_ALHV1/6-378--APMNMWSVRIVNGIFVLSNK-----KPLNLPAHLSQ...LNIPYSVHF...IVD------SLASFGLLSSL-FSLDQV
LF1_EBVB9/5-442--TDTQAWRVEIGTRGLMFSNC-----VPLHLPEGQYH....KLRLPVSAYEALA.------.VARYGLVGSL-WEVPAV
VG11_ALHV1/22-387--LQLSHWDFTIYDTYIKMTNI-----HHITTTSNDSC.....LPTCPPLAEILKD------KIPGYAFYSSA-WQCQ.T
VG11_SHV21/24-388--FNYSFWNCSVHEHFISITNN-----REIHILPDDLL.....LPRCPSIRAILFK------QIPSFKFSGSR-SGPP.G
ORF11_HHV8P/26-387--...PVWDSVIHPSHIVISNR-----VPLLLREQNIC.....LPSCPSVGQILHR------AYPNFTFDNTH-RKQQTE
ORF10_HHV8P/7-387--FILGDWEITVSNCRFTCSSL-----TCGPLYRSSGDYTRLRIPFSLDR...LIR------DHAIFGLVPNI-EDLLTH

PF06559

B0T2H0_CAUSK/6-336------------------------------------------------AAGILPCQ------SIEDLIAQEAI.TSQTPF
A6WVX6_OCHA4/5-363------------------------------------------------DAGILADA------DISALFESGLL.ASPRPL
A7ICI7_XANP2/10-371------------------------------------------------KPGILPAE------AISALKATGAI.SCRRPL
D9QL85_BRESC/7-337------------------------------------------------VPGILPCQ------SIEALIAGGAI.TSATPF
E3I262_RHOVT/9-354------------------------------------------------ASGILPSQ------AIAKLVAEGAI.AASAPI
S0EVQ5_CHTCT/8-380------------------------------------------------NNGVFPAQ------WIRQAFEKGWI.DAEEPL
U6B352_9RHIZ/4-360------------------------------------------------..VILPDK------SIVKLFDTGEI.ISELAL
E3F1H9_KETVY/2-356------------------------------------------------.TGVLPHT------QIQAMIDAAHI.RPERPL
Q0ASF2_MARMM/3-337------------------------------------------------DTGILPDH------HLAALAGRGIL.TTAAPL
J9ZEW7_LEPFM/2-359------------------------------------------------..GTLSDV------QISRLIDAGAI...VDPF
Q11M73_CHESB/3-361------------------------------------------------STGILPDK------EIAALFEAGAL.AAPRPL
Q1GI72_RUEST/2-356------------------------------------------------.TGVLPSQ------TIETMLARADI.KIDAPL
I0IM71_LEPFC/2-351------------------------------------------------..GTLSDR------EILGLVAEGHI..RSRRY
F8J4V2_HYPSM/17-374------------------------------------------------AVGILPSQ------AISHMIADGEI.VLAEPP
D5BMT1_PUNMI/8-370------------------------------------------------NDGILPVQ------ALRAAADAGIILSGDNDF
A1B368_PARDP/7-360------------------------------------------------VNGVLPDT------SLRQLIASGAI.SADQPI
E0TCQ3_PARBH/11-366------------------------------------------------PLGVFAED------DLAALVAAETI.TLSAQC
F2IY64_POLGS/9-367------------------------------------------------PEGILPAH------MIEDMFRNGAI.RSETPL
D5AUM0_RHOCB/3-361------------------------------------------------.HGVLPDS------ALRAMIARGEI.AAARPV
Q28RG4_JANSC/9-360------------------------------------------------PQGVLPDH------AISAMIESGAI.TATMPV
W8S3S8_9RHOB/5-358------------------------------------------------VSGVLPDH------RLRAMIDAGQI.TADRPV
V5SAL4_9RHIZ/10-372------------------------------------------------ADGILPAQ------AIRALAEAGGI.TPSEPF
M9RD28_9RHOB/2-357------------------------------------------------KNGVLSDT------QISALIDGGAI.TASAGF
C6XMA9_HIRBI/10-342------------------------------------------------PIGVLPDT------QIQSLCDSEVI.SSVDGL
Q0BYT8_HYPNA/2-334------------------------------------------------.SGVIPDF------EIEALLQSGAI.RCDEAP
Q3J368_RHOS4/2-356------------------------------------------------.AGVLASQ------RIRSLIASGAI.AADIPP
B8IN71_METNO/5-360------------------------------------------------RDGIQSAE------SIAALHAAGVI.RTEAPF
A8ILD7_AZOC5/12-371------------------------------------------------KAGILPAQ------AIAALVESGGI.STRRAL
V9TRV1_9PROT/16-380------------------------------------------------TSGIMPYQ------EIKRMIKGGQI.KCAIPF
G8PHJ6_PSEUV/2-361------------------------------------------------.TGILPAK------AIEAMFANNAI.KADRAP
B2III7_BEII9/27-392------------------------------------------------QFGLLPRQ------KIEVMVRRGMI.MSPE.L
I7DZH0_PHAIB/12-367------------------------------------------------TQGVLSDR------QIRQMITGAAI.AASSPI
D8PJ22_9BACT/7-382------------------------------------------------SKGILPYQ------HITQLIARRSI.TSEHPI
G4R8T6_PELHB/6-364------------------------------------------------PTGVFSAR------LIQNLSDEGAI.SAGRPY
C6XF01_LIBAP/2-364------------------------------------------------NKGVLPDK------AIATLAERGDI.VSEHPL
Q92S94_RHIME/4-363------------------------------------------------DTGILADR------AIAALYASGRL.KSEKVL
B8ELJ2_METSB/17-383------------------------------------------------.FGLLSRQ------KIELMATRRMI.QAADAL
Q3SWD3_NITWN/9-367------------------------------------------------ANGILPDR------MIAAMADAGLI.LPEYPF
D7A3W4_STAND/8-367------------------------------------------------GEGILPGH------AIQALADRGSI.RIARPF
J7Q6T1_METSZ/2-364------------------------------------------------.GGVLSSR------QIQAMADAGQI.RLAAPL
C5B418_METEA/18-375------------------------------------------------.PGTQPDS------AIRLMASSGLL.TAREPL
C5AS03_METEA/8-364------------------------------------------------ASGILPAQ------AITALTQAGAI.RPATAY
A7HQ50_PARL1/26-383------------------------------------------------ATGILPSH------GIQALIREKEI.WGGLEI

PF06088

O92445_NPVBM/1-181--------------------------------------------------------------------------------
Q8JM51_9ABAC/1-193--------------------------------------------------------------------------------
Q80PB1_NPVST/1-191--------------------------------------------------------------------------------
Q91GH9_NPVEP/1-154--------------------------------------------------------------------------------
Q06KI7_NPVAG/1-153--------------------------------------------------------------------------------
Q9DVU8_9BBAC/1-138--------------------------------------------------------------------------------
TLP20_NPVOP/1-155--------------------------------------------------------------------------------
A1YJ70_NPVSF/1-194--------------------------------------------------------------------------------
Q461Z1_9ABAC/34-277--------------------------------------------------------------------------------
Q8B9H2_NPVR1/1-180--------------------------------------------------------------------------------
Q9PYS5_GVXN/1-160--------------------------------------------------------------------------------
Q9YMN7_NPVLD/34-223--------------------------------------------------------------------------------
Q287I3_NPVAS/1-185--------------------------------------------------------------------------------
Q9J859_9ABAC/1-194--------------------------------------------------------------------------------
Q6QXL3_GVAS/1-174--------------------------------------------------------------------------------
Q7TLS0_NPVCF/1-155--------------------------------------------------------------------------------
Q4KT00_9ABAC/1-234--------------------------------------------------------------------------------
Q2NP03_NPVHC/1-155--------------------------------------------------------------------------------
Q1HH27_NPVAP/1-152--------------------------------------------------------------------------------
A1YRC7_9ABAC/1-176--------------------------------------------------------------------------------
Q80LN1_NPVAH/1-194--------------------------------------------------------------------------------

PF06284

UL84_HCMVM/1-586--MPRVDPNLRNRARRPRARRGGGGGVGSNSSRHSGKCRRQRRALSTPPLTFLATTTTTTMMGVASTDDDSLLLKTPDEL

PF06501

VU55_HHV6U/3-432--SPQLNHVLQLVFDCNH.IVS-----N.SYQEIILKCRISS----TKPGILFITD------GTESETEDVLFDVQF---
V55B_HHV7J/5-430--TSDILKYVQIEIPYKEEFQG-----KDNVTLLFDEYVQSK----TEPVLLLSAE------.INSRNSDSFFSARP---
O56289_9BETA/6-427--VSELSQLIQFTVDFND.LQP-----ELNFSPAEITCILSH----ERPVLLLITD------GTENNAECVTLVGHV---

PF05784

VU54_HHV6U/4-339ATLQWSSYVLQLRV.TTTAILK-----PGELRLFKCGLGITP----PSSAVVCICR------DESSFTSSP.........
PP71_HCMVM/28-371SFGRLHCQVLRLITNVEGGSLE-----AGRLRLLDLRTNIEV----SRPSVLCCFQ------EN.KSPHDTVDLTDLNIK
PP65_HCMVM/15-357.LGPISGHVLKAVFSRGDTPVL-----PHETRLLQTGIHVRV----SQPSLILVSQ------YTPDSTPCHRGDNQLQVQ

PF00692

DUT_HUMAN/121-250--------------------------------EHATAPTRGSA-----RAAGYDL-----------YSAYD--YTIP---
DUT_ICHVA/62-187--------------------------------ADVSIPKISSP-----GSAGFDL-----------SVLED--REFI---
DUT_EBVB9/119-240--------------------------------DKGPINHPQYP-----GDVGLDV-----------SLPKD--LALF---
DUT_SHV21/120-244--------------------------------DYSDLCPPRYS-----KDAGFDL-----------YLPTD--VTVK---
DUT_HAEIN/15-149--------------------------------NEFPLPTYATE-----GSAGLDL-----------RALID--ESFE---
DUT_HHV11/206-337--------------------------------REAIAFLPKRE-----EDAGFDI-----------VVRRP--VTVP---
DUT_YEAST/16-146--------------------------------ASATVPTKGSA-----TAAGYDI-----------YASQD--ITIP---
DUT_ECOLI/15-149--------------------------------KEFPLPTYATS-----GSAGLDL-----------RACLN--DAVE---
DUT_VZVD/225-354--------------------------------TYKHIINPKRQ-----EDAGYDI-----------CVPYN--LYLK---
DUT_SOLLC/39-168--------------------------------ENAVLPSRASS-----LAAGYDL-----------SSAAE--TKVP---
F4B717_ACIHW/46-166--------------------------------.TDEIYEDGKD-----PRSFYEI-----------EKGDE--FIIY---
DUT_CANAL/28-157--------------------------------..GKVPTKGSA-----LAAGYDL-----------YSAEA--ATIP---
DUT_VACCW/18-145--------------------------------.RAKSPTRQSP-----YAAGYDL-----------YSAYD--YTIP---
DUT_HHV6U/242-365--------------------------------.PWEMINLSPP-----EFAIFHL-----------KASRE--FIAK---
Q6TVW3_ORFSA/26-154--------------------------------.NATIPTRGSP-----GAAGLDL-----------CSAYD--CVVP---
Q8V3S4_SWPV1/13-141--------------------------------.NAIIPNRSTS-----GSAGYDL-----------YSAYS--YTVK---
PRO_MMTVC/620-741--------------------------------..IHDLPRGTP-----GSAGLDL-----------SSQKD--LILS---
Q9TTD4_SHEEP/13-133--------------------------------..IADLCRATR-----GSAGLDL-----------CATSY--TVLT---

PF04797

VG11_EHV2/74-450SE-----VAFLAVEC....P--------RNPVRAAPTVVRCSL-----NEIAISL-----------MRPLE--GPVP---
LF2_EBVA8/37-401FT-----VAFLFFGA....E--------DNEVFLKPFFVMHSD-----QDIVLSV-----------LNPRS--LFIE---
VG10_EHV2/21-391FD-----TTFILQNQ..DLD--------QSRYVVVETVVSDLK-----KPISFSL-----------VSEGR--A.LA---
VG10_ALHV1/6-378KQ-----SCALLVQH...KP--------NDQCTVLPTCVLDLE-----FDITVYV-----------RSRQR--V.LQ---
LF1_EBVB9/5-442NS-----ALQCLAAA...AP--------CKDVKIYPSCIFQVH-----APMFVTI-----------KTSLR--C.LN---
VG11_ALHV1/22-387MW-----MRFLIFGD....E--------DNCIKTQLMFIDRSA-----ENINIRL-----------QHASY--QMAP---
VG11_SHV21/24-388TV-----TSLYVYGH....S--------KNLIKIKPMVVSECE-----QELIFKI-----------TFALE--CTIP---
ORF11_HHV8P/26-387TY-----TAFYAFGD....Q--------NNKVRILPTVVESSS-----SVLIFRL-----------RASVS--ANIA---
ORF10_HHV8P/7-387GS-----CVAVVADANATGG--------NARRIVAPGVINNFS-----EPIGIWV-----------RGPPP--Q.TR---

PF06559

B0T2H0_CAUSK/6-336DT.....DQVQPASLDLRLG--------ARCWRVRASFLPGVA-----RRVPERL.......KD..VAMHE..LDLT---
A6WVX6_OCHA4/5-363DP.....DQIQPASLDLRLG--------AKAYRVRASFMPGPG-----TPVLEKL.......ER..LKLHE..IDLT---
A7ICI7_XANP2/10-371DA.....DQIQPASLDLRLG--------RTAWRVRASFLPGAG-----VSVKERL.......AD..LALHD..FDLA---
D9QL85_BRESC/7-337DA.....DQVQPASLDLRLS--------DRAWRVRASFLPGQ.-----RLVADRI.......AD..VSMHS..IDLS---
E3I262_RHOVT/9-354GE.....GQIQPASLDLRLG--------RRAFRVRASFIPGPG-----TKTEDQI.......ER..FKLHT..IDLG---
S0EVQ5_CHTCT/8-380RS.....GQIQPNSLDLRLG--------TVGYRVQCSFLPG.E-----EGMAQKL.......AR..FGWYR..FCLP---
U6B352_9RHIZ/4-360DF.....DQIQPASLDLRLS--------SKGYQVRAAFLPNDG-----YNVLDKI.......EM..FGLNE..FDLS---
E3F1H9_KETVY/2-356AP.....GQLQPASLDLRLG--------TVAYRVRASFLAGTG-----RSVADRL.......AA..FEMHR..VDLT---
Q0ASF2_MARMM/3-337AD.....GQVQPASIDLRLG--------SKAWRLRASFLPGPG-----RTVAERLD......DD..LVMHT..VDLT---
J9ZEW7_LEPFM/2-359EGRDALLSRVQPASLDLALG--------QTAYRIRSSFLP.QG-----DSVSRLL.......PE..LSLYP..VDLS---
Q11M73_CHESB/3-361DS.....DQIQPASLDLRLG--------DVAYRVRASFLPGPG-----SRVEEKL.......ER..LKLHE..IPLG---
Q1GI72_RUEST/2-356SE.....GQIQPASLDLRLG--------KVAYRVRASFLAGQG-----RTVAERL.......EE..FEMHR..IDLS---
I0IM71_LEPFC/2-351KK.....FEVQPASLDLRLG--------SIAYRVRSSFLP.QG-----ESVQTLL.......PE..MTLYQ..IDLN---
F8J4V2_HYPSM/17-374AE.....GQVQPASLDLRLG--------AVAYRVRASFLPRPG-----GKVQGKL.......DE..LALHT..ISLS---
D5BMT1_PUNMI/8-370ID.....GQLQPASLDLRLG--------AEAWRVQASFLPGAD-----STVAQKL.......DK..FAMHK..IDLS---
A1B368_PARDP/7-360LP.....EQVQPASLDLRLG--------ATAWRLRASFLAGRG-----RKVSDRL.......RD..FEMHR..MDLT---
E0TCQ3_PARBH/11-366GE.....CQIQPASFDLTLG--------QRAWRIRAAFLPGPA-----RSVKSCL.......DE.GLGLHV..LDLT---
F2IY64_POLGS/9-367VD.....GQIQPASLDLRLG--------TKAYRVRASFLPGPG-----VTVADRL.......DA..LRLHT..VDLA---
D5AUM0_RHOCB/3-361TP.....EQIQPASLDLRLG--------EVAYRIRASFLAGRG-----QRVETKL.......SD..FEMHR..MRLS---
Q28RG4_JANSC/9-360PD.....GQIQPASLDLRLG--------TKAYRVRASFLTGAG-----RSVAERL.......PE..FTMHE..MDLT---
W8S3S8_9RHOB/5-358TA.....QQIQPASLDLRLG--------HVAYRVRASFLAGKG-----NRLSDRL.......TE..FEMHR..MDLR---
V5SAL4_9RHIZ/10-372GQ.....GQVQPASVDLRLG--------ARAHRVRASFLPGPG-----GAVAEKL.......DD..LTLHT..FDLE---
M9RD28_9RHOB/2-357EL.....GQVQPASLDLRLG--------HVAYRVRASFLTGRG-----QSVTDRL.......AQ..FTMHE..IDLT---
C6XMA9_HIRBI/10-342AN.....DQVQPASIDLRLG--------KTAYRMRASFLPGLG-----KKVSDYFN......DD..LVMHE..LDLT---
Q0BYT8_HYPNA/2-334EP.....GQIQPASLDLRLA--------VDAYRLRASFLPGKD-----RTVAEML.......QEPGIHLHR..VDLT---
Q3J368_RHOS4/2-356IA.....GQIQPASLDLRLG--------RVAYRVRASFLAGAG-----RSVKDRL.......AE..FEMHR..VDLT---
B8IN71_METNO/5-360AD.....DQVQPASLDLRLG--------RKAYRVRASFLPGRL-----RDVTACL.......AK..LKLHE..IDLR---
A8ILD7_AZOC5/12-371DD.....DQIQPASLDLRLG--------RTAWRIRASFLPGAG-----NTVKDRL.......SE..LVLHK..LDLS---
V9TRV1_9PROT/16-380DS.....SQIQPASLDLRLG--------RLAYQVRASFLPGLS-----AAVMDKI.......AQ..LDGGDPVLDLL---
G8PHJ6_PSEUV/2-361DG.....DQIQPASLDLRLG--------AKAWRVRASFLPGPD-----ARVEEKL.......DK..LILHE..IDLS---
B2III7_BEII9/27-392DN.....GQIQPASLDLRLG--------PKAYRIRASFLPGKD-----RTVEGQL.......AN..LNSEE..ISLE---
I7DZH0_PHAIB/12-367LN.....DQIQPASLDLRLS--------DCAYRVRASFLPGLG-----RTVAERL.......ED..LTMHR..VALT---
D8PJ22_9BACT/7-382ED.....RQIQPASLDLRLG--------KKAYRLISSFLP.EL-----SAISSRLNVLDFYQSD..LVMYE..MDLT---
G4R8T6_PELHB/6-364DP.....DQIQPASLDLRLG--------ETAFRVRSSFLPGPG-----KTVTERI.......ET..LKLHE..IDLT---
C6XF01_LIBAP/2-364EK.....NQIQPASIDLRLS--------SKAYRVRASFLPNID-----GLVSDKI.......KH..FKLRE..IDLS---
Q92S94_RHIME/4-363DD.....DQIQPASLDLRLG--------SKAFRVRASFMPGPS-----HLVADKL.......DR..LKLHV..VDLS---
B8ELJ2_METSB/17-383DE.....RQLQPASLDLRLG--------ARAYRVRASFLPGRE-----RTVMEQL.......RA..FARDEDAISLE---
Q3SWD3_NITWN/9-367VE.....SQIQPASLDLRLG--------ATAYRVRASFLPGPD-----ATVAERI.......DE..LKLHE..IDLS---
D7A3W4_STAND/8-367DA.....DQVQPASLDLRLG--------PTAWRIRASFLPGPS-----ETVAERL.......KR..LSLHE..LDLT---
J7Q6T1_METSZ/2-364AH.....GQIQPASLDLRLG--------PKAFRVRASFLPGKR-----RGVDELL.......SA..LKYDE..MSLE---
C5B418_METEA/18-375LD.....SQIQPASVDLRLG--------ARAWRVRASFLPGSG-----ATVEERI.......AR..HGLFE..IDLT---
C5AS03_METEA/8-364AA.....DQIQPASLDLRLG--------RRAYRVRTSFLPGSG-----RSVATCV.......EA..FALHE..IDLT---
A7HQ50_PARL1/26-383DP.....AQIQPASLDLRLG--------ATAYRLRASFLPGPD-----HGVMERV.......EE..LMLHK..IDLT---

PF06088

O92445_NPVBM/1-181------------MANTSNIT--------PD.IIVNAQINSE..-----DENVLDF-----------IIEDE--YYLK---
Q8JM51_9ABAC/1-193------------MATNNSNT--------VD.ISVHVTLDKE.A-----NKNILSF-----------IVREE--YHLK---
Q80PB1_NPVST/1-191------------MATSNSGT--------ID.ISVHVTLDKE.A-----KKNVLSF-----------IVREE--YHLK---
Q91GH9_NPVEP/1-154------------MANTNNTT--------SD.IVVNARFVDTDE-----DTILLKF-----------FTDKE--QRLM---
Q06KI7_NPVAG/1-153------------MASTNSTT--------SD.IVVRARVVPASD-----GETVLEF-----------GAENE--HRLM---
Q9DVU8_9BBAC/1-138------------MVTKM.VE--------TDMIGVYPVFLDD..-----...KIDF-----------KVDNE--YHLQ---
TLP20_NPVOP/1-155------------MANTSSTT--------SD.IVVRARVLIADD-----EGTLLEF-----------EAENE--HCLM---
A1YJ70_NPVSF/1-194------------MATSNSGT--------ID.ISVHVTLDKESS-----KRNVLSF-----------IVREE--YHLK---
Q461Z1_9ABAC/34-277------------MATNNSGT--------VD.IAVYVTLDKE.N-----DKNILSF-----------IVQDE--YHLK---
Q8B9H2_NPVR1/1-180------------MASMSNIT--------PD.IIVNAQINSK..-----DENVLDF-----------IIEDE--YYLK---
Q9PYS5_GVXN/1-160------------MTTSNIVD--------TDNIVLYPILEDN..-----...RITL-----------AVKEE--YFLQ---
Q9YMN7_NPVLD/34-223------------MAANSSDT--------VN.IAAYVTLDKE.E-----FRHTLSF-----------IVQDE--YHLK---
Q287I3_NPVAS/1-185------------MATSNSGT--------VD.ISVHVTLDKE.A-----DKSVLSF-----------IVREE--YHLK---
Q9J859_9ABAC/1-194------------MATNNSGT--------ID.ISVHVTLDKE.A-----KRNVLSF-----------IVREE--YHLK---
Q6QXL3_GVAS/1-174------------MATTS.VD--------RDSIIIYPVLEEE..-----...QIMF-----------KVKED--YNLQ---
Q7TLS0_NPVCF/1-155------------MANTSKTT--------PD.IVVKVRVFFADY-----DVTVLEF-----------EAENE--HCLM---
Q4KT00_9ABAC/1-234------------MATNNSGT--------VD.IAVYVTLDKE.N-----DENILSF-----------IVQDE--YHLK---
Q2NP03_NPVHC/1-155------------MANTNITT--------SD.IVVRARVLVEDD-----DNTVLEF-----------EAENE--HRLM---
Q1HH27_NPVAP/1-152------------MASTNSTT--------SD.IVVKARAVSASD-----GQTVLEF-----------VAENE--HRLM---
A1YRC7_9ABAC/1-176------------MTSMTNTT--------PD.IIVNAQINDD..-----DENVLDF-----------IIEDE--YYLK---
Q80LN1_NPVAH/1-194------------MAHNSSGA--------IAYISVSVMLTRK.K-----NENVLSF-----------TVNDE--THLK---

PF06284

UL84_HCMVM/1-586DKHSGSPQTILTLTDKHDIRQPRVHRGTYHLIQLHLDLRPEELRDPFQILLSTPLQLGEANGESQTAPATS--QEEETAA

PF06501

VU55_HHV6U/3-432------------LEKTTTIK--------IKILPISRTV.PVRI-----HLFSIPIYL----------PSHA--LEID---
V55B_HHV7J/5-430------------LMEEQQLK--------LHLKNLNRHIYPSKV-----LFFGFPLLK----------INSS--IVII---
O56289_9BETA/6-427------------LKNKKVIK--------INVFPMIQSI.NF.V-----NIFALPIFN----------ITSS--LLIQ---

PF05784

VU54_HHV6U/4-339FTYIDPKDYGNIPFAVQNIS--------DLDLDLSR..LPIVL-----NIFALPHAN---------VNISN--LPVQ---
PP71_HCMVM/28-371GRCVVG.EQDRLLVDLNNFG--------PRRLTPGSENNTVSV-----LAFALPLDR---------VPVSG--LHLF---
PP65_HCMVM/15-357HTYFTGSEVENVSVNVHNPT--------GRSICPSQ..EPMSI-----YVYALPLKM---------LNIPS--INVH---

PF00692

DUT_HUMAN/121-250-----------------------------------------P..MEKAVVKTDIQIAL----------------------
DUT_ICHVA/62-187-----------------------------------------R..GCHYRLPTGLAIAV----------------------
DUT_EBVB9/119-240-----------------------------------------P..HQTVSVTLTVPPP.----------------------
DUT_SHV21/120-244-----------------------------------------P..RVPNRYSVNICCPA----------------------
DUT_HAEIN/15-149-----------------------------------------IQPGETKLIPTGLSIYI----------------------
DUT_HHV11/206-337-----------------------------------------A.NGTTVVQPSLRMLHA----------------------
DUT_YEAST/16-146-----------------------------------------A..MGQGMVSTDISFTV----------------------
DUT_ECOLI/15-149-----------------------------------------LAPGDTTLVPTGLAIHI----------------------
DUT_VZVD/225-354-----------------------------------------RNEFIKIVLPIIRDWDL----------------------
DUT_SOLLC/39-168-----------------------------------------A..RGKALVPTDLSIAV----------------------
F4B717_ACIHW/46-166-----------------------------------------P..NEHVLLVTEEYVKL----------------------
DUT_CANAL/28-157-----------------------------------------A..HGQGLVSTDISIIV----------------------
DUT_VACCW/18-145-----------------------------------------P..GERQLIKTDISMSM----------------------
DUT_HHV6U/242-365-----------------------------------------P..NSYTIQYFDAMYVC----------------------
Q6TVW3_ORFSA/26-154-----------------------------------------S..HCSCVVFTDLLIKL----------------------
Q8V3S4_SWPV1/13-141-----------------------------------------P..YNRILVRTDICLMI----------------------
PRO_MMTVC/620-741-----------------------------------------L.EDGVSLVPTLVKGTL----------------------
Q9TTD4_SHEEP/13-133-----------------------------------------P.EMGVQTLATGVFGPL----------------------

PF04797

VG11_EHV2/74-450-----------------------------------------AGGLTFYLLPVTLVKPHGLYLKIQKDRAAVGA..ATTCS
LF2_EBVA8/37-401-----------------------------------------KGKFTWYIVPIRLVKNPYLYLQILPGQSDIQL..TRSCT
VG10_EHV2/21-391-----------------------------------------EGELRLVLTPLRALDYVHVFSVIYNMHNE.....LPPGL
VG10_ALHV1/6-378-----------------------------------------PGALQLALIFIKPVNGSEMAWDVRDPPETMVGQRLYENV
LF1_EBVB9/5-442-----------------------------------------PHDLCLCLICVGAAILDIPLLCAPRDG.......AGARA
VG11_ALHV1/22-387-----------------------------------------AHSLVFYIFPIILLRLDGLYLRVLPDKHPGVM..DASCS
VG11_SHV21/24-388-----------------------------------------PGSMEIFILPITFLKLDGLYLLCLEDYTSRIM..STSCM
ORF11_HHV8P/26-387-----------------------------------------VGGLKIIILALTLVHAQGVYLRCGKDLSTPHC..APAIV
ORF10_HHV8P/7-387-----------------------------------------KEAIKFCIFFVSPLPPREMTTYVFKGGDLPPGAEEPETL

PF06559

B0T2H0_CAUSK/6-336------------------------------------.KGAVLEKGCVYIAEIQERLALPGNIAARGNPKSSTGRVDVFVR
A6WVX6_OCHA4/5-363------------------------------------.AGAVLETGCVYIVPLLEGLALSADLSASANPKSSTGRLDIFTR
A7ICI7_XANP2/10-371------------------------------------.KGAVLETGCVYLVELFERLKLPFDLAAAANPKSSTGRLDVFVR
D9QL85_BRESC/7-337------------------------------------.GGYVLEKGCVYIAELQERLSLPKGLIARANPKSSTGRVDVFVR
E3I262_RHOVT/9-354------------------------------------.PGAVLEVGCVYVAEIDESLALPLFLSGIANPKSSTGRLDVFTR
S0EVQ5_CHTCT/8-380------------------------------------EEGVVLERNQVYIFPLMERLALPQNVRGRANPKSTTGRLDVFCR
U6B352_9RHIZ/4-360------------------------------------.DGVTLNTNCIYIIPLMESLCLRDDISAYVNPKSSTGRIDVFVR
E3F1H9_KETVY/2-356------------------------------------.EGAVLEKGCVYVVPLMEELALPADVSAVANAKSSTGRLDLLTR
Q0ASF2_MARMM/3-337------------------------------------.AGAVLETGCVYLAPLQEGLKLPAGLSAAMNPKSSTGRIDVFTR
J9ZEW7_LEPFM/2-359------------------------------------.THPYLEKGAVYLIPLSEQLSLPPGVEGKTNPKSSTGRVDVFTR
Q11M73_CHESB/3-361------------------------------------.EGAVLETGCVYIVPLMEGLVLPADVSASANPKSSTGRLDIFTR
Q1GI72_RUEST/2-356------------------------------------.EGAVLEKGCVYVVPLMEALDLPDTVSAVANAKSSTGRLDLLTR
I0IM71_LEPFC/2-351------------------------------------.SHPYIEPGAIYIIPLDESLSLPATVGGKANPKSSTGRIDVFTR
F8J4V2_HYPSM/17-374------------------------------------.QGAVLETGCVYIVPLLETLALPADIEASANPKSSTGRLDVFTR
D5BMT1_PUNMI/8-370------------------------------------.AGAVLERGCVYIVKLQESLALSADLSAMANPKSSTGRLDIFTR
A1B368_PARDP/7-360------------------------------------.DGAVLEKGCVYLVPLMERLTLPAGLDAVANAKSSTGRLDLLTR
E0TCQ3_PARBH/11-366------------------------------------.DGAVLETGCVYLVELREGLALPPTLSARANPKSSTGRIDVFVR
F2IY64_POLGS/9-367------------------------------------.HGAVLETGCVYIVPLQEVLDLPAIISATANPKSSTGRLDVFTR
D5AUM0_RHOCB/3-361------------------------------------.EGAVLEKGCVYLVPLMERLALPAGLTAVSNAKSSTGRLDLLTR
Q28RG4_JANSC/9-360------------------------------------.HGAVLEKGCVYVVPLMEGLALPGDITAVCNAKSSTGRVDCLTR
W8S3S8_9RHOB/5-358------------------------------------.EGAVLEKGCVYVVPLMEGLALPAGVSAVANAKSSTGRVDCLTR
V5SAL4_9RHIZ/10-372------------------------------------.DGAVLETGCVYVVPLLEWLALPSGIAASANPKSSTGRLDVFTR
M9RD28_9RHOB/2-357------------------------------------.DGAVLEKNCVYVVPLLESLALPDTMTAAASAKSSTGRLDLLTR
C6XMA9_HIRBI/10-342------------------------------------.KGTVLETGCVYLVPLKEVLNLPEGLSGAANPKSSTGRIDVFVR
Q0BYT8_HYPNA/2-334------------------------------------QEGAVLETGCVYLVPLQESLRLPAGLSARANPKSSTGRIDVFTR
Q3J368_RHOS4/2-356------------------------------------.QGAVLEKGCVYVIPLMESLALPPGVSAVANAKSSTGRLDLLTR
B8IN71_METNO/5-360------------------------------------.QGAVLETGCVYIAELQEGLALPPDLAASANPKSSTGRIDVFTR
A8ILD7_AZOC5/12-371------------------------------------.DGAVLETGGVYLVPLFERLRLPIDVAASTNPKSSTGRLDVFTR
V9TRV1_9PROT/16-380------------------------------------.KGAVLKRGCVYIIEILETLNLPHDVEALANTKSSIGRLDILTR
G8PHJ6_PSEUV/2-361------------------------------------.KSAVLETNCVYIVQLQEALNLPDDLSATANPKSSTGRIDVFTR
B2III7_BEII9/27-392------------------------------------GHGAVLERGCVYVIPLLESLKLPESISAIANPKSSTGRLDIFTR
I7DZH0_PHAIB/12-367------------------------------------.GGAVLEKGCVYVVPLMERIRLPEGMTAAASAKSSIGRLDVMTR
D8PJ22_9BACT/7-382------------------------------------.QGAILEKGHVYLVPLLEQLDLPATLRARANPKSTTGRLDVFTR
G4R8T6_PELHB/6-364------------------------------------.KGAVLERGCVYIVPLLESLDLPETVSASANPKSSTGRLDIFTR
C6XF01_LIBAP/2-364------------------------------------.GGTVLDANCVYIVPLMESLNLKNGISAYANPKSSIGRIDVFAR
Q92S94_RHIME/4-363------------------------------------.EGAVLETGCVYIVPLMESLSLPADMSASANPKSSTGRLDIFTR
B8ELJ2_METSB/17-383------------------------------------.QGAVLERGCVYVIPLIEHLRLPDSIAAFANPKSSTGRLDIFTR
Q3SWD3_NITWN/9-367------------------------------------.DGAVLETNCVYIVPLLESLALPPEIVAAANPKSSTGRLDVFTR
D7A3W4_STAND/8-367------------------------------------.SGEVLETGCVYLVELEEALALPSDIAASTNPKSSTGRLDVFTR
J7Q6T1_METSZ/2-364------------------------------------GDGAVLERGCFYVVPLLESLALGDAVLGAANPKSSTGRLDIFTR
C5B418_METEA/18-375------------------------------------.NGADLETGCVYVAELQERIALPSTMRGIANAKSSTGRLDVFTR
C5AS03_METEA/8-364------------------------------------.QGAVLETGCVYIAELQETLALPPDLSASANPKSSTGRIDVFTR
A7HQ50_PARL1/26-383------------------------------------.DGAVLETGCVYLVPLVEALALSERTSASANPKSSTGRLDVFTR

PF06088

O92445_NPVBM/1-181-----------------------------------------KRGVGAHIIKVASSQQLRLLYKNAY..SAVSCGNYSILC
Q8JM51_9ABAC/1-193-----------------------------------------KLAVGAYSLNILDTQLLNDLAQRAG..TTVACGDYVICY
Q80PB1_NPVST/1-191-----------------------------------------KLAVGAYSINILDTQLLNNLSLYQC..KTIACGDYVIVY
Q91GH9_NPVEP/1-154-----------------------------------------R...GAHDVHVVPSSELEALHNGAY..SKFTNGNYTVDV
Q06KI7_NPVAG/1-153-----------------------------------------K...GAHDVRIMPSDELEALHDSPH..TVITCGEYTVEF
Q9DVU8_9BBAC/1-138-----------------------------------------KQGKGAYAVSVTNNDKI......SRGTLTVESADYNVVY
TLP20_NPVOP/1-155-----------------------------------------R...GAHEVRVIASPELDALHNGPY..NEIALGDYTFHF
A1YJ70_NPVSF/1-194-----------------------------------------KLAVGAYNINILDTQLLNNLSQYKC..NTVACGDYVIVY
Q461Z1_9ABAC/34-277-----------------------------------------KLAVGAYNLNILDTQLLAKLAQNQCRSSTIVGGDYVVVY
Q8B9H2_NPVR1/1-180-----------------------------------------KRGVGAHIIKVASSPQLRLLYKNAY..STVSCGNYGILC
Q9PYS5_GVXN/1-160-----------------------------------------KVGVGAHRVTVLESEQLDHLHYTQHH.IVMERSGCLLLH
Q9YMN7_NPVLD/34-223-----------------------------------------KLTVGAYNINVLDTRLLDGLLEKRC..YTIVCGNYNVIY
Q287I3_NPVAS/1-185-----------------------------------------KLAVGAYSLNILDTQLLNDLARKSC..ATIACGDYVIAY
Q9J859_9ABAC/1-194-----------------------------------------KLAVGAYNITILDTQLLNSLQQHRC..NTIACGDYVVVY
Q6QXL3_GVAS/1-174-----------------------------------------KLSIGAYKLQILESEKLDHLKDIHHH.IVVCNKNYLVVH
Q7TLS0_NPVCF/1-155-----------------------------------------K...GAHDVRVIASPELDALHNGPY..NLITLGNYTFHY
Q4KT00_9ABAC/1-234-----------------------------------------KLAVGAYNLNILDTQLLAKLIQNQSRSSTIVGGDYVVVY
Q2NP03_NPVHC/1-155-----------------------------------------K...GAHEVHVVVSPELDALHNGPY..NEITLGDYTFHY
Q1HH27_NPVAP/1-152-----------------------------------------R...GAHDVRIVPSAELEALHDSPH..SVITCGDYTVEF
A1YRC7_9ABAC/1-176-----------------------------------------KRGVGAHVIKVASSPQLGLLYKNAY..STVSCGNYGILC
Q80LN1_NPVAH/1-194-----------------------------------------QLTCGAYHLKIVETSLLDPLINSYHYYAPQVFGDYTVIY

PF06284

UL84_HCMVM/1-586SHEPEKKKEKEEKKEEEDEDDRNDDRERGILCVVSNEDSDVRPAFSLFPARPGCHILRSVIDQQLTRMAIVRLSLNLFAL

PF06501

VU55_HHV6U/3-432--------------------------DINALCQKENIDPTVYEQYGLTNMPISTTNVINQFKV--VQNDSVEMSLILFNL
V55B_HHV7J/5-430--------------------------P........NHDVKEQEQMGVFPSLIRFKNEKVIVTQ--TPHKVNEITVTMFNI
O56289_9BETA/6-427--------------------------DNCYF..KENMDPLRFHQFAYLEKGLGTTPII..LYS--VKNGDLIVNATVTKI

PF05784

VU54_HHV6U/4-339-------------------------------------RIE.AHDRHIIPHGQCDAKFVI------YG.PLTRIKIQVADI
PP71_HCMVM/28-371-------------------------------------QSQRRGGEENRPRMEARAIIRR------T.AHHWAVRLTVTP.
PP65_HCMVM/15-357-------------------------------------HYPSAAERKHRHLPVADAVIHA------SGKQMWQARLTVSGL

PF00692

DUT_HUMAN/121-250-----------PS.G------CYGRVAPRSGLAAK---------------------------------------------
DUT_ICHVA/62-187-----------PR.G------YVGIITPRSS.QAK---------------------------------------------
DUT_EBVB9/119-240-----------SIPH------HRPTIFGRSGLAMQ---------------------------------------------
DUT_SHV21/120-244-----------QLKS------YKPVLFGRSGLAAK---------------------------------------------
DUT_HAEIN/15-149-----------ADPN------LAAVILPRSGLGHK---------------------------------------------
DUT_HHV11/206-337-----------DAGP------AACYVLGRSSLNAR---------------------------------------------
DUT_YEAST/16-146-----------PV.G------TYGRIAPRSGLAVK---------------------------------------------
DUT_ECOLI/15-149-----------ADPS------LAAMMLPRSGLGHK---------------------------------------------
DUT_VZVD/225-354-----------QHPS------INAYIFGRSSKSRS---------------------------------------------
DUT_SOLLC/39-168-----------PQ.G------TYARIAPRSGLAWK---------------------------------------------
F4B717_ACIHW/46-166-----------PN.D------VMAFVNLRSSFARL---------------------------------------------
DUT_CANAL/28-157-----------PI.G------TYGRVAPRSGLAVK---------------------------------------------
DUT_VACCW/18-145-----------PK.F------CYGRIAPRSGLSLK---------------------------------------------
DUT_HHV6U/242-365-----------AD.E------LKALMIPSKEIAKL---------------------------------------------
Q6TVW3_ORFSA/26-154-----------PP.G------CYGRIAPRSGLAVK---------------------------------------------
Q8V3S4_SWPV1/13-141-----------PD.K------CYGRISPRSGLSLN---------------------------------------------
PRO_MMTVC/620-741-----------PE.G------TTGLIIGRSSNYKK---------------------------------------------
Q9TTD4_SHEEP/13-133-----------PP.G------TAGLLLGRSSASLK---------------------------------------------

PF04797

VG11_EHV2/74-450QDGAHLNSEQ.PQVF------FSGTAAPAREGGEL---------------------------------------------
LF2_EBVA8/37-401QSGDKLNTSE.PQIF------LSGSPVTSQDEC.L---------------------------------------------
VG10_EHV2/21-391ELASVTEYCGSLVKE------LCGTAIRTRANTYT---------------------------------------------
VG10_ALHV1/6-378SQGTVKALETPDHLL------LTGEAIGRSDGTYD---------------------------------------------
LF1_EBVB9/5-442AEGQAAAAQG.GKLR------VWGRLSPSSPTSLS---------------------------------------------
VG11_ALHV1/22-387QTWSCLNTPM.PVVR------LQGGMLSWDDED.M---------------------------------------------
VG11_SHV21/24-388QMGTYLASET.PQVF------LKGGPVLNKHEP.M---------------------------------------------
ORF11_HHV8P/26-387QREVLSSGFE.PQFT------VTGIPVTSSNLNQC---------------------------------------------
ORF10_HHV8P/7-387HSAEAPLPS..RETL------VTGQLRSTSPRTYT---------------------------------------------

PF06559

B0T2H0_CAUSK/6-336LLSDHSKAFDDIEAG------YEGPLYIEIAPQTF---------------------------------------------
A6WVX6_OCHA4/5-363VIADGAQEFDKVPAG------YNGPLYLEVSPRTF---------------------------------------------
A7ICI7_XANP2/10-371VITDGARAFDTIPAG------YNGPLYLEISPRTF---------------------------------------------
D9QL85_BRESC/7-337LLTDRGGSFDDVDEG------YEGPLYLEIAPQTF---------------------------------------------
E3I262_RHOVT/9-354VIADHGPGFDQTGAG------YKGRLWLEICPQTF---------------------------------------------
S0EVQ5_CHTCT/8-380LVTEHGVAFDETPQG------YQGPLYLEVVPRSF---------------------------------------------
U6B352_9RHIZ/4-360VIADKSREFDRIPAG------YKGNLYLEVSPRTF---------------------------------------------
E3F1H9_KETVY/2-356TITDGGAEFDRVPAG------YSGPLYAEICPRSF---------------------------------------------
Q0ASF2_MARMM/3-337VITDHGVAFDQAPVG------YEGPLYAEISPCTF---------------------------------------------
J9ZEW7_LEPFM/2-359VLTEKTHRFDDIPPG------YKGHLYLEVFSRSF---------------------------------------------
Q11M73_CHESB/3-361VMTDHGQEFDKIAAG------YSGPLYLEVSPRTF---------------------------------------------
Q1GI72_RUEST/2-356TITDGGEEFDRIRAG------YTGPLYAEICPRSF---------------------------------------------
I0IM71_LEPFC/2-351VLTENGHRFDDVPYG------YNGPLYLELFSRSF---------------------------------------------
F8J4V2_HYPSM/17-374VIADGVGAFDQIPRG------YHGPLYAEICPQTF---------------------------------------------
D5BMT1_PUNMI/8-370LITDNALEFETVSKG------YHGPLYAEISPRTF---------------------------------------------
A1B368_PARDP/7-360LVTDEGTEFDRLPQG------YDGPIYAEICPRSF---------------------------------------------
E0TCQ3_PARBH/11-366LVTDDGTAYDEVPAG------YTGPLYAEVSPRTF---------------------------------------------
F2IY64_POLGS/9-367VITDDARAFDTVGAG------YSGPLYAEISPLTF---------------------------------------------
D5AUM0_RHOCB/3-361VITDDGTEFDRIPEG------YTGPLYAEICPRSF---------------------------------------------
Q28RG4_JANSC/9-360VIADGGVEFDRIPAG------YTGPLYAEICPRSF---------------------------------------------
W8S3S8_9RHOB/5-358VITDGGTEFDRIAPG------YAGPLYAEICPRSF---------------------------------------------
V5SAL4_9RHIZ/10-372VIADGVTAFDQVPAG------YRGPLYAEICPQTF---------------------------------------------
M9RD28_9RHOB/2-357IITDNGVEFDRVPKG------YAGPLFVEICPRSF---------------------------------------------
C6XMA9_HIRBI/10-342MITDGSDRFDAARAG------YSGPLYVEISPRTF---------------------------------------------
Q0BYT8_HYPNA/2-334LVTNRSRAFDEVPMG------YSGPLYLEVSPRTF---------------------------------------------
Q3J368_RHOS4/2-356TIADGGTEFDRIRDG------YHGPLYAEVCPRSF---------------------------------------------
B8IN71_METNO/5-360VITDQAREFDMVEPG------YAGPLFAEISPRTF---------------------------------------------
A8ILD7_AZOC5/12-371VIADGARAFDAIPMG------YAGPLYLEIAPRTF---------------------------------------------
V9TRV1_9PROT/16-380LITDGCIAFDRIDKG------YKGRLFLEILSLSF---------------------------------------------
G8PHJ6_PSEUV/2-361VITDQGKAFDRVEAG------YNGPLYAEISPKTF---------------------------------------------
B2III7_BEII9/27-392LITDRSEVFDRAARA------YEGPLYAEVSPRSF---------------------------------------------
I7DZH0_PHAIB/12-367VITDQGVEFDRVPDG------YDGPLYAEICPQSF---------------------------------------------
D8PJ22_9BACT/7-382VVTDLNAGFDEIRAG------YRGPLYLEVVPRSF---------------------------------------------
G4R8T6_PELHB/6-364VISDAARSFDIVPAG------YKGALYLEISPRTF---------------------------------------------
C6XF01_LIBAP/2-364VIGDRSQEFDSISPN------YSGPLYLEILPRTF---------------------------------------------
Q92S94_RHIME/4-363VITDRAQEFDKIPAG------YSGPLYLEISPRTF---------------------------------------------
B8ELJ2_METSB/17-383LITDNSEVFDRVARA------YEGPLYAEVSPRSF---------------------------------------------
Q3SWD3_NITWN/9-367VIADGTRSFDMIGAG------YHGPLYAEISPKTF---------------------------------------------
D7A3W4_STAND/8-367VIADRSRAFDIVPLG------YEGKLYLEISPRTF---------------------------------------------
J7Q6T1_METSZ/2-364LITDRGDRFDEVAPG------YHGPLYAEVSPRSF---------------------------------------------
C5B418_METEA/18-375VLADRSTTFDSVAPG------YVGPLYAEICPGTF---------------------------------------------
C5AS03_METEA/8-364VITDRASAFDQIEAG------YAGQLYAEISPRTF---------------------------------------------
A7HQ50_PARL1/26-383LITDFCAEFDQVAAG------YKGHLYLEISPRTF---------------------------------------------

PF06088

O92445_NPVBM/1-181NLVQNGEYDLNAIMF------NCAEIKLNKGQMLF---------------------------------------------
Q8JM51_9ABAC/1-193NFTEN.SNKINVILF------NIKPTVLKKGGCIF---------------------------------------------
Q80PB1_NPVST/1-191NFVEN.SNRINVILF------NIKPTILKKGNCIF---------------------------------------------
Q91GH9_NPVEP/1-154NLLKN.DHRAVQVML------FAKEDNVILNDVVF---------------------------------------------
Q06KI7_NPVAG/1-153NLSSR.DRREAQALL------SVKRDDVLVSGGVF---------------------------------------------
Q9DVU8_9BBAC/1-138NYLSS.GDGISVLLI------IKKPISFKAHDTVF---------------------------------------------
TLP20_NPVOP/1-155NLVAA.NRFGAQVML------FAKRDDIKVSGAVF---------------------------------------------
A1YJ70_NPVSF/1-194NFTENTSNRINVILF------NIKPTILKKGNCIF---------------------------------------------
Q461Z1_9ABAC/34-277NFNV..CNNLNVILF------NIKPTVLKKGTSIF---------------------------------------------
Q8B9H2_NPVR1/1-180NLVQNGEYDLNAIMF------NCAEIKLNKGQMLF---------------------------------------------
Q9PYS5_GVXN/1-160NCYS..EGGITAVLI------VTEPFKITKNSVLC---------------------------------------------
Q9YMN7_NPVLD/34-223NFTQ..EKTLRVILF------NASPIVLKKHSCIF---------------------------------------------
Q287I3_NPVAS/1-185NFTEN.SNKINVILF------NIKPSVLKKGKCIF---------------------------------------------
Q9J859_9ABAC/1-194NFVDN.SNKINVILF------NIKPTILKKGNCIF---------------------------------------------
Q6QXL3_GVAS/1-174NAVE..GDAMSAVLI------LLDSVVLKKDQNIF---------------------------------------------
Q7TLS0_NPVCF/1-155NLVDS.DRFGAQVML------YVKSDNIKISGAVF---------------------------------------------
Q4KT00_9ABAC/1-234NFNM..SNNLNVILF------NIKPTILKKGACIF---------------------------------------------
Q2NP03_NPVHC/1-155NLMES.NRFGAQVML------FVKKDDIKIAGPVF---------------------------------------------
Q1HH27_NPVAP/1-152NLSSR.DLRAGQAML------FVKRDDASVAGAVF---------------------------------------------
A1YRC7_9ABAC/1-176NLVQNGEYDLNAIMF------NCAEIKLNKNQLLF---------------------------------------------
Q80LN1_NPVAH/1-194NVNAN.SRQVKMILF------NITSTVFKRDSVIF---------------------------------------------

PF06284

UL84_HCMVM/1-586RIITPLLKRLPLRRKAAHHTALHDCLALHLPELTFEPTLDINNVTENAASVADTAESTDADLTPTLTVRVRHALCW-HRV

PF06501

VU55_HHV6U/3-432NWTESPYQSQKLDRYGRKLLIVFSVFSIDTRECPY----------------------------------------WENLF
V55B_HHV7J/5-430EWKLSTYQRSIERTPGHPLTTLCTVCSVNINNLPF----------------------------------------WFHDV
O56289_9BETA/6-427TWEKNEFQPLLKNSNDQRLETMYCIFTFNTTYCKY----------------------------------------WNVFF

PF05784

VU54_HHV6U/4-339RWIEQTPE.EPTRYS------FKAEIWVNLQNTPL---------------------------------------------
PP71_HCMVM/28-371NWRRRTDSSLEAGQI------FVSQFAFRAGAIPL---------------------------------------------
PP65_HCMVM/15-357AWTRQQNQWKEPDVY------YTSAFVFPTKDVAL---------------------------------------------

PF00692

DUT_HUMAN/121-250--HFIDVG..AGVI------------------------------------------------------------------
DUT_ICHVA/62-187--NFVSTG....II------------------------------------------------------------------
DUT_EBVB9/119-240--GILVKP......------------------------------------------------------------------
DUT_SHV21/120-244--GLTIKV......------------------------------------------------------------------
DUT_HAEIN/15-149--HGIVLGNLVGLI------------------------------------------------------------------
DUT_HHV11/206-337--GLLVVP......------------------------------------------------------------------
DUT_YEAST/16-146--NGIQTG..AGVV------------------------------------------------------------------
DUT_ECOLI/15-149--HGIVLGNLVGLI------------------------------------------------------------------
DUT_VZVD/225-354--GIIVCP......------------------------------------------------------------------
DUT_SOLLC/39-168--YSIDVG..AGVI------------------------------------------------------------------
F4B717_ACIHW/46-166--GLFVPP...TIV------------------------------------------------------------------
DUT_CANAL/28-157--HGISTG..AGVI------------------------------------------------------------------
DUT_VACCW/18-145--GIDIGG...GVI------------------------------------------------------------------
DUT_HHV6U/242-365--GLLIET...YIW------------------------------------------------------------------
Q6TVW3_ORFSA/26-154--HFIDVG..AGVI------------------------------------------------------------------
Q8V3S4_SWPV1/13-141--YNIDIG..GGVI------------------------------------------------------------------
PRO_MMTVC/620-741--GLEVLP...GVI------------------------------------------------------------------
Q9TTD4_SHEEP/13-133--GILIHP...GVI------------------------------------------------------------------

PF04797

VG11_EHV2/74-450--PFLLAQRTPRFER..............................................................---
LF2_EBVA8/37-401--PYLLAQHTPPFLK..............................................................---
VG10_EHV2/21-391--MAFKWEGARQFYRV........................................................TNSYF---
VG10_ALHV1/6-378--MLFKDQKIPCMVN...........................................................YSN---
LF1_EBVB9/5-442--LAFPYAGPPPVAWYRHSINLTRSEGVGIGKDCAQDHACPVPPQGHASSAADQAGVPERGRKRAHEGPGAGEAASA---
VG11_ALHV1/22-387--PFMLGQKTKPFLS..............................................................---
VG11_SHV21/24-388--PYLMAQKTKPFDK..............................................................---
ORF11_HHV8P/26-387--YFLVRKPKSRLAK..............................................................---
ORF10_HHV8P/7-387--GYFHSPVPLSFLDLL.......................................................TFESM---

PF06559

B0T2H0_CAUSK/6-336--SVLVRSGTRLNQ-----------------------------------------------------------LRLK...
A6WVX6_OCHA4/5-363--PIVVRTGSRLSQ-----------------------------------------------------------IRFR...
A7ICI7_XANP2/10-371--PILVRTGSRLSQ-----------------------------------------------------------VRFR...
D9QL85_BRESC/7-337--SILVRPGTRLNQ-----------------------------------------------------------LRLK...
E3I262_RHOVT/9-354--PILVRTGSRLSQ-----------------------------------------------------------IRFR...
S0EVQ5_CHTCT/8-380--AIRVRAGDALAQ-----------------------------------------------------------IRFQ...
U6B352_9RHIZ/4-360--PIIVRSGSRLSQ-----------------------------------------------------------IRFR...
E3F1H9_KETVY/2-356--SVLVRAGMRLNQ-----------------------------------------------------------IRFR...
Q0ASF2_MARMM/3-337--SILAREGDRLSQ-----------------------------------------------------------VRFR...
J9ZEW7_LEPFM/2-359--PLKVKPGLSLSQ-----------------------------------------------------------LRLF...
Q11M73_CHESB/3-361--PIVVRPGSRLSQ-----------------------------------------------------------IRFR...
Q1GI72_RUEST/2-356--SVLARPGMRLNQ-----------------------------------------------------------IRFR...
I0IM71_LEPFC/2-351--PLRISSGLCLSQ-----------------------------------------------------------LRLF...
F8J4V2_HYPSM/17-374--PIVVRKGSRLSQ-----------------------------------------------------------IRFR...
D5BMT1_PUNMI/8-370--SVLVRAGSRLSQ-----------------------------------------------------------LRLR...
A1B368_PARDP/7-360--SVLVRPGMRLNQ-----------------------------------------------------------LRLR...
E0TCQ3_PARBH/11-366--SIVVRPGSSLNQ-----------------------------------------------------------LRIR...
F2IY64_POLGS/9-367--PILVRTGSRLSQ-----------------------------------------------------------IRFR...
D5AUM0_RHOCB/3-361--SVLVRPGMRLNQ-----------------------------------------------------------IRFR...
Q28RG4_JANSC/9-360--SVKIAPGLRLNQ-----------------------------------------------------------IRFR...
W8S3S8_9RHOB/5-358--SVLVKPGLALNQ-----------------------------------------------------------IRFR...
V5SAL4_9RHIZ/10-372--PIVVRKGSKLSQ-----------------------------------------------------------LRFR...
M9RD28_9RHOB/2-357--SVLVRPGLMLNQ-----------------------------------------------------------IIFR...
C6XMA9_HIRBI/10-342--SILAREGDRLLQ-----------------------------------------------------------LRLR...
Q0BYT8_HYPNA/2-334--PIKVRPGDRLAQ-----------------------------------------------------------LRFK...
Q3J368_RHOS4/2-356--SVLVRPGMRLNQ-----------------------------------------------------------IRFR...
B8IN71_METNO/5-360--PVLVRTGSRLSQ-----------------------------------------------------------IRFR...
A8ILD7_AZOC5/12-371--PILVRTGSRLSQ-----------------------------------------------------------VRFR...
V9TRV1_9PROT/16-380--NVVVSYGSRLNQ-----------------------------------------------------------LRFQ...
G8PHJ6_PSEUV/2-361--PVLVREGSRLCQ-----------------------------------------------------------IRFR...
B2III7_BEII9/27-392--SIRVRRGTRLNQ-----------------------------------------------------------IRFRRLN
I7DZH0_PHAIB/12-367--SVVVQPGQLLTQ-----------------------------------------------------------IIFR...
D8PJ22_9BACT/7-382--AIKVRTGDSLNQ-----------------------------------------------------------IRFV...
G4R8T6_PELHB/6-364--PVLVRTGSRLSQ-----------------------------------------------------------MRFR...
C6XF01_LIBAP/2-364--PIVVRVGSRLSQ-----------------------------------------------------------IRFV...
Q92S94_RHIME/4-363--PIVVRRGSRLSQ-----------------------------------------------------------IRFR...
B8ELJ2_METSB/17-383--SVRVRKGSKLNQ-----------------------------------------------------------IRFRRLN
Q3SWD3_NITWN/9-367--PVLLREGSRLSQ-----------------------------------------------------------VRFR...
D7A3W4_STAND/8-367--PILVRQGSRLSQ-----------------------------------------------------------IRFR...
J7Q6T1_METSZ/2-364--SVRVRTGSRLNQ-----------------------------------------------------------LRFR..T
C5B418_METEA/18-375--PIVVRKGSRLSQ-----------------------------------------------------------IRFR...
C5AS03_METEA/8-364--PVRVRTGSRLSQ-----------------------------------------------------------IRFR...
A7HQ50_PARL1/26-383--PILVRPGSRLAQ-----------------------------------------------------------IRFR...

PF06088

O92445_NPVBM/1-181--QTKIYR......------------------------------------------------------------------
Q8JM51_9ABAC/1-193--KIVYDDKSSTNV------------------------------------------------------------------
Q80PB1_NPVST/1-191--KIVHDDTTAPTA------------------------------------------------------------------
Q91GH9_NPVEP/1-154--EIKVWN......------------------------------------------------------------------
Q06KI7_NPVAG/1-153--RLKLWN......------------------------------------------------------------------
Q9DVU8_9BBAC/1-138--SISLPV......------------------------------------------------------------------
TLP20_NPVOP/1-155--RLKVWN......------------------------------------------------------------------
A1YJ70_NPVSF/1-194--KIVYEDDATAIV------------------------------------------------------------------
Q461Z1_9ABAC/34-277--QIVYTDKMTEAV------------------------------------------------------------------
Q8B9H2_NPVR1/1-180--QTKIWP......------------------------------------------------------------------
Q9PYS5_GVXN/1-160--HVAFTN......------------------------------------------------------------------
Q9YMN7_NPVLD/34-223--KIVVPS......------------------------------------------------------------------
Q287I3_NPVAS/1-185--KLIYVD......------------------------------------------------------------------
Q9J859_9ABAC/1-194--KIVYDHDDENIV------------------------------------------------------------------
Q6QXL3_GVAS/1-174--MVTFPR......------------------------------------------------------------------
Q7TLS0_NPVCF/1-155--RLKVWN......------------------------------------------------------------------
Q4KT00_9ABAC/1-234--KIVYTDKMTEAV------------------------------------------------------------------
Q2NP03_NPVHC/1-155--RLHVWN......------------------------------------------------------------------
Q1HH27_NPVAP/1-152--RLRLWN......------------------------------------------------------------------
A1YRC7_9ABAC/1-176--QTKIWQ......------------------------------------------------------------------
Q80LN1_NPVAH/1-194--QIVYPN......------------------------------------------------------------------

PF06284

UL84_HCMVM/1-586EGGISGPRGLTSRI------------------------------------------------------------------

PF06501

VU55_HHV6U/3-432K..SIIPLCRVNMI------------------------------------------------------------------
V55B_HHV7J/5-430RSGSDFPTCKVFSI------------------------------------------------------------------
O56289_9BETA/6-427A..SATPICNVEMI------------------------------------------------------------------

PF05784

VU54_HHV6U/4-339--DQIFKTGNIEFI------------------------------------------------------------------
PP71_HCMVM/28-371--TLV.DALEQLAC------------------------------------------------------------------
PP65_HCMVM/15-357--RHV.VCAHELVC------------------------------------------------------------------

PF00692

DUT_HUMAN/121-250--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------
F4B717_ACIHW/46-166--------------------------------------------------------------------------------
DUT_CANAL/28-157--------------------------------------------------------------------------------
DUT_VACCW/18-145--------------------------------------------------------------------------------
DUT_HHV6U/242-365--------------------------------------------------------------------------------
Q6TVW3_ORFSA/26-154--------------------------------------------------------------------------------
Q8V3S4_SWPV1/13-141--------------------------------------------------------------------------------
PRO_MMTVC/620-741--------------------------------------------------------------------------------
Q9TTD4_SHEEP/13-133--------------------------------------------------------------------------------

PF04797

VG11_EHV2/74-450-----.GGFCKVHVTQGVTCPVNAVKLSK----HYVRLPVCELRGDGGAG----AAAPSQIKV-------------GVTL
LF2_EBVA8/37-401-----..SYARIHTFPGKVCPVNAIRRGK----GYVRVSVDTPDLKREGP----LN....VKV-------------GMTL
VG10_EHV2/21-391-----CEQYNRFKIVRLCVKECKMYRKEG----NVHVLDITVVGDTQPEM----VHGVVSVMG-------------AEVD
VG10_ALHV1/6-378-----VFASYHSPNEEILPRALEITMLGQ----KTARLTFRPGHECPSAT----VSFRAEVRP-------------ILQP
LF1_EBVB9/5-442-----GRGDVALSQSRALLWRGLGWDTGR----GRLAPGLAMSRDAASGS----VHLDIQVDR-------------AEEG
VG11_ALHV1/22-387-----..KAVKVHALADEVCKVNDVCMGD----NYMKIHL.....DFHFA----LDKHLPVDI-------------CMSP
VG11_SHV21/24-388-----..KMARVHTVQNEVCEVNSIYRGE----NHVKVAIQ....KDSED----INFLDTVVV-------------GLTM
ORF11_HHV8P/26-387-----..PFARLSAETTEECRVRSIRLGK----THLRISVT....APAQE----TPVWGLVTT-------------SFSL
ORF10_HHV8P/7-387-----GCENVEGDPEPLTPKYLTFTQTGE----RLYKVTVHNTHSTACKK----ARIRFVYRP-------------TPSA

PF06559

B0T2H0_CAUSK/6-336.....RGEPVKLATR..............----......................SV..GVDL.........TT..GIVG
A6WVX6_OCHA4/5-363.....KGRAQLDEAELAALHHAETLVAAE----.MPN.IS.......GGG....IAL..SVDL...SG...GPD..RLIG
A7ICI7_XANP2/10-371.....RGVSRLSDLELLSLQSAECLVDAP----.QPD.VA.......AGG....IAL..GVDL...AG..EVIP..GLQG
D9QL85_BRESC/7-337.....AGEPPKLETR..............----......................SV..GVDL........QGG..DIVG
E3I262_RHOVT/9-354...DANGGGAAASAE..............----..............AGGQPRDVAL..SVELGGEPG........ALIG
S0EVQ5_CHTCT/8-380.....TGEPRLSAEETRALLDEVPIILSS----..ELLPLRSRDLAISNG....ILL..SIYLPRYSG..QGRQ..ATIG
U6B352_9RHIZ/4-360.....QECNSSSEIDLKSYHDQDPLIVGG----DFNFS.........DEG....VSL..SLDLSDNTG.....D..GIIG
E3F1H9_KETVY/2-356.....RGGAALDDDALRALHRRIPLVDGT----....PVI.......SDG....LAF..SVDL....S..PARG..TLVG
Q0ASF2_MARMM/3-337.....QGAHKALRE...............----.....................VTV..SVDLAGFGD........GIVG
J9ZEW7_LEPFM/2-359.....ENRKILTDLELMNRHRTFPLFWYD----GKHKEETEEF....RDG....VSL..GVDL........SFE..SIVG
Q11M73_CHESB/3-361.....RGNALLTESDLADLHERETLVAAE----.SPN.IS.......GGG....IAL..SIDL...EG...GPD..GLVG
Q1GI72_RUEST/2-356.....DGQSVLDDAALADLHAKTPLVDGE----....AVI.......EDG....LGF..SVDL....R..LPGT..DLVG
I0IM71_LEPFC/2-351.....SSREILSDEDLLLLHKKYSLYSDE----AEGGL.........QDG....LVL..GVDL........SEG..DVVG
F8J4V2_HYPSM/17-374.....NGPAADSDEVLRELHAKERLVSAQ----.DAD..I.......AGG....IAL..TVDL...SG..HG.D..GLVG
D5BMT1_PUNMI/8-370.....RGEPHISDDMMQDLQRKVGLVHGT----DAPD..I.......RDG....IAL..SVNL...AP..DTQS..GMIG
A1B368_PARDP/7-360.....QGQAVLTDTELRDLHVREPLVTGE----....ALI.......DEG....LGF..SVDL....R..PQGG..DLVG
E0TCQ3_PARBH/11-366.....HGETRLSDEALGERARREDLTGPR----HHGH..I.......HQG....LCV..SVDL...SG...DLG..PVAA
F2IY64_POLGS/9-367.....IGNPLISDEDLQEIHAAQRLVDGG----.DER..I.......GGG....VQL..SIDL...KG..SGEG..SLVG
D5AUM0_RHOCB/3-361.....AGQAALSDPELKALHAAEPLVSGI----GHGGAVI.......DHG....LGF..SVDL....R..PAEG..DLVG
Q28RG4_JANSC/9-360.....RGQATLTDAALAERHAQTPLVDQT----....PLI.......DDG....LGF..SVDL....S..PQDT..TLVG
W8S3S8_9RHOB/5-358.....LGEAVLSDDELRARHADHPLVTGT----..EAAVI.......DDG....LGF..SVDL....R..PETG..SLVG
V5SAL4_9RHIZ/10-372.....SGDPRETDDALRRLQAEQTLVSGG----.DAD..I.......QDG....IAL..SVDL...KGFEKGGDGTGLVG
M9RD28_9RHOB/2-357.....NGKTFINDTDLIALHAKTPIVDGE----....AVI.......SDG....LGF..SVDL....K..PQSG..DLVG
C6XMA9_HIRBI/10-342.....NGEQKTIRDEI.............----.......................F..SIDL....K..PGND..DIAG
Q0BYT8_HYPNA/2-334.....KKKPETLREKV.............----.......................V..SIDL....E..PPAG..QPAG
Q3J368_RHOS4/2-356.....AGEATLSDAELADLHGREPLVDGT----....PVI.......SGG....LGF..SVDL....R..PVEG..DLVG
B8IN71_METNO/5-360.....RGAVRLDDAALARLHAETPLVSAA----.DPS..F.......QGG....VAV..SVDL...SG..FD....GLIG
A8ILD7_AZOC5/12-371.....RGVARLSDLELLNLQQEQRLVDSD----.APD.VA.......GGG....IAL..GVDL...AG..AAWN..GILG
V9TRV1_9PROT/16-380.....RGVSKISSKEVRKRHALGHFAKVD----AGDILIS.......PRG....TLLPCSIDL...QG..AGKG..TIVG
G8PHJ6_PSEUV/2-361.....NGGGFIPDEHLLHIHKEHTLVSGG----.NDEHAI.......SNG....VQV..SIDL...KG..NGKD..SLIG
B2III7_BEII9/27-392SQQLERNDFSLDEKELRERHEALPLVDGP----....LNL.......RNG....LVL..RVAL...SR..EPLG..PIIG
I7DZH0_PHAIB/12-367.....QGRTFLSDADLRAVHEATPIVSGD----....PVI.......SDG....LGF..SVDL....R..PERG..DLVG
D8PJ22_9BACT/7-382.....RGDATVSDSALQKLHGTDPLLFHN----ASPPKALPQKEFRTDRG....LFL..RIDL...TG.SARED..AVIG
G4R8T6_PELHB/6-364.....VGDARLDAAGHKALHAEQTLVF..----.DPNMDV.......GEG....VSL..SIDL...VG..EGRN..GLIG
C6XF01_LIBAP/2-364.....KERKFCSQEELSALHELSPLVQDG----LRDFS.........GKG....VAL..SVDL...KGNEIGKK..SIIG
Q92S94_RHIME/4-363.....IGHSVLSEQELLALHESDVLVASD----.RPN.VS.......GGG....IAL..SIDL...KG..TGPD..GLIG
B8ELJ2_METSB/17-383SQQLERTGFAVDDRDLRERHKAASLVDGE----....LNL.......RQG....LVV..RVAL...SAAIQPDG..A.IG
Q3SWD3_NITWN/9-367.....SGDAVLDADELDALHASERLVDSD----.DTD..F.......VNG....VAL..SVDL...SG..AQAH..GFVG
D7A3W4_STAND/8-367.....RGDARLEENELRALDAAEKLVDTP----.RPD.VA.......GAG....IAV..SVDL...SG..EGFG..GLLG
J7Q6T1_METSZ/2-364YAQSESQGGTLGDAALDELHRASPLVDGP----....LNL.......RDG....VVL..RVAL...DA..DAFG..GIIG
C5B418_METEA/18-375.....QGDSRLTDAETAALHAVDPLTDAA----...VPCF.......EGG....VAF..SVDL...EG..FGPD..RIVG
C5AS03_METEA/8-364.....QGDPRLRETELAALHASDPLIDAA----.TPS..L.......QGG....VPV..SVDL...AG..FD....GLIG
A7HQ50_PARL1/26-383.....RGTHTSSDAEMKRLHEELRLVDGE----.AD...I.......DGG....IAL..TVNL...AA..ETED..EVVG

PF06088

O92445_NPVBM/1-181--------------------------------------------------------------------------------
Q8JM51_9ABAC/1-193--------------------------------------------------------------------------------
Q80PB1_NPVST/1-191--------------------------------------------------------------------------------
Q91GH9_NPVEP/1-154--------------------------------------------------------------------------------
Q06KI7_NPVAG/1-153--------------------------------------------------------------------------------
Q9DVU8_9BBAC/1-138--------------------------------------------------------------------------------
TLP20_NPVOP/1-155--------------------------------------------------------------------------------
A1YJ70_NPVSF/1-194--------------------------------------------------------------------------------
Q461Z1_9ABAC/34-277--------------------------------------------------------------------------------
Q8B9H2_NPVR1/1-180--------------------------------------------------------------------------------
Q9PYS5_GVXN/1-160--------------------------------------------------------------------------------
Q9YMN7_NPVLD/34-223--------------------------------------------------------------------------------
Q287I3_NPVAS/1-185--------------------------------------------------------------------------------
Q9J859_9ABAC/1-194--------------------------------------------------------------------------------
Q6QXL3_GVAS/1-174--------------------------------------------------------------------------------
Q7TLS0_NPVCF/1-155--------------------------------------------------------------------------------
Q4KT00_9ABAC/1-234--------------------------------------------------------------------------------
Q2NP03_NPVHC/1-155--------------------------------------------------------------------------------
Q1HH27_NPVAP/1-152--------------------------------------------------------------------------------
A1YRC7_9ABAC/1-176--------------------------------------------------------------------------------
Q80LN1_NPVAH/1-194--------------------------------------------------------------------------------

PF06284

UL84_HCMVM/1-586-----SARLSETTAKTLGPSVFGRLELDPNESPPDLTLSSLTLYQDGILR--FNVTCDRTEAP-------------ADPV

PF06501

VU55_HHV6U/3-432-----SEP---------GISIY-KIEFND---------PFLTVF----LRNVVLPENKRRFPI-------------TKEC
V55B_HHV7J/5-430-----SDP---------TVSVL-KMIFSP---------PLLEIY----LRCYTEVTKNNTYMV-------------PNDC
O56289_9BETA/6-427-----SEH---------NVSVY-KIEYRS---------PVLFVF----LR..YLKVMNSRFCV-------------D.EC

PF05784

VU54_HHV6U/4-339-----SHK---------NVYIS-RILLCG----NLLILK.....----ANYENDYLLDDNFYP-------------E-QL
PP71_HCMVM/28-371-----SDP---------NTYIH-KTETDE----RG...QWIMLF----L.....H.HDSPHPP-------------T-SV
PP65_HCMVM/15-357-----SME---------NTRAT-KMQVIG----DQ....YVKVY----L.....ESFCEDVPS-------------G-KL

PF00692

DUT_HUMAN/121-250--------------------------------------------------------------------------------
DUT_ICHVA/62-187--------------------------------------------------------------------------------
DUT_EBVB9/119-240--------------------------------------------------------------------------------
DUT_SHV21/120-244--------------------------------------------------------------------------------
DUT_HAEIN/15-149--------------------------------------------------------------------------------
DUT_HHV11/206-337--------------------------------------------------------------------------------
DUT_YEAST/16-146--------------------------------------------------------------------------------
DUT_ECOLI/15-149--------------------------------------------------------------------------------
DUT_VZVD/225-354--------------------------------------------------------------------------------
DUT_SOLLC/39-168--------------------------------------------------------------------------------
F4B717_ACIHW/46-166--------------------------------------------------------------------------------
DUT_CANAL/28-157--------------------------------------------------------------------------------
DUT_VACCW/18-145--------------------------------------------------------------------------------
DUT_HHV6U/242-365--------------------------------------------------------------------------------
Q6TVW3_ORFSA/26-154--------------------------------------------------------------------------------
Q8V3S4_SWPV1/13-141--------------------------------------------------------------------------------
PRO_MMTVC/620-741--------------------------------------------------------------------------------
Q9TTD4_SHEEP/13-133--------------------------------------------------------------------------------

PF04797

VG11_EHV2/74-450VREAML..........AFRYNPYLFSPWCWAEAT.VPIHYYGPPVIVPAGQAARVVYGNVYYAPMLDELTA.VIAPPLDG
LF2_EBVA8/37-401LDDVII..........AFRYNPYPKSHWRWDGES.TDIRYFGSPVIIPPNFITELEYNNTYEAPLSSKITA..VVVSHSS
VG10_EHV2/21-391...SML..........VTDRYISPLYNQAWGW...ALPLYAPTQVVVPPKKTLKVPVDGMFFRGTVPGAQPVCLIGGSNI
VG10_ALHV1/6-378KV..............LFSHFLNWIRVNYDCQ...VMPLYPEQEEVVNAHDWVRFQVNNKFLVSTAVDTPLKVFICGLGQ
LF1_EBVB9/5-442WVCDVLLEPGPPTAREGCSLSMDPGLVTLKDAWT.LFPLHPEHDAVVPPKEEIHVMAQGHLQGGTPSLWGF...TFQEAA
VG11_ALHV1/22-387TNNTVL..........SFKFNPFVKTPWEPTPAK.VPIVYMGEPVLIPGSCSTIVEYCNRYYVAKGLRITA.IIVSVETD
VG11_SHV21/24-388TNRALV..........AFEYNPYFSCPWDWKRQS.IPIIYDGPCIRIPAGRLAPVKYNNTYSSIYPNATAI...ITNSDS
ORF11_HHV8P/26-387TPTAPL..........AFDRNPYNHETFACNARHYIPVIYSGPKITLAPRGRQVVWHNNSYTSSLPCKVTA..IVSNHCC
ORF10_HHV8P/7-387...RQL..........VMGQASPLITTPLGAR...VFAVYPDCEKTIPPQETTTLRIQLLFEQHGANAGECAFVIMGLAR

PF06559

B0T2H0_CAUSK/6-336FRGRRHAGVIDLDHEDGHDPRDFWEPLETRHGE...LLLDPGEFYILASKDNIEIPVL-----EAAEMTPIDPSVGEFRV
A6WVX6_OCHA4/5-363YRGKHHTAVVDVDKRAAHDVLDFWEPIYDR.GARE.LVLDPDEFYILVSREAVHVPPL-----YAAEMTPFDPLVGEFRV
A7ICI7_XANP2/10-371FRAKKHTGVIDVDEAGVLDVEDFWEPIRLRPGRTAGLVLDPDAFYILASREAVHVPPD-----YAAEMVPFDPLVGEFRV
D9QL85_BRESC/7-337FRGRRHAGVVDLDKIDGHDPKDFWEPLSLRRGE...LLLDPGEFYILASNEAVEIPVM-----QAAEMTPIDPSVGEFRV
E3I262_RHOVT/9-354YRAKRHTGVIDVDRAGAYDIEEFWEPIAATHHHR..LILDPDEFYILASKEAVRVPAT-----HAAEMEPFNALMGEFRV
S0EVQ5_CHTCT/8-380YQARKNTPPIDLRAIGQARKRHYWDRLYADGKP...IILEPDEFYIFRSRELVCLPPT-----ICAEMVAFDAGSGELRT
U6B352_9RHIZ/4-360YKAKRHTASIDIDAKGKYDIADFWEVIHYHGLEK..ILIDPNEFYILSSRETVRIPPS-----FAAEMIPYDPRIGEFRS
E3F1H9_KETVY/2-356YRAKPHTGVIDLDLIGHYDPADYWEEIHSKQGQ...IILDPGAFYILVSRESVCIPPD-----YAAEMSPYLAMVGEFRV
Q0ASF2_MARMM/3-337YRARRHSGLVDLSRIGGHAAGRYWEPLTAPDRR...LVLDPGEFYILASREAVTIGCD-----EAAEMAPIATEIGEFRA
J9ZEW7_LEPFM/2-359YKARPNTRVLDLTVSSENPAEPFWEPIMRPSSGD..LILEPESFYLFASRAKIRIPSD-----MAGEMVEFDAQSGELRT
Q11M73_CHESB/3-361YRAKHHTSLIDVDRKAAHEIHDFWEPLYNY.GSKD.LILDPDEFYILVSREAVHVPPG-----YAAEMTPFDPLVGEFRV
Q1GI72_RUEST/2-356YRAKPHTGVIDLDRISAYDPRDYWEEVRSDKGR...IILDPGAFYILVSREAVHIPPE-----YAAEMAPYLAMVGEFRV
I0IM71_LEPFC/2-351YRARKNSGILDLSSLTPLSPEAFWEPIKTPSGGA..LILEPEEFYLFASRSRLKIPKN-----FAAEMLEFDAQSGELRT
F8J4V2_HYPSM/17-374FRARRHTGVVDVDRVGAYPIEDYWDPIHVK.DKHR.LILDPDQFYILASKEAVHVPPT-----HAAEMVPFNPLVGEFRV
D5BMT1_PUNMI/8-370WRARKHAGLIDIDAPASVSVNEFWEQLTPDDLTAGGLVLNPDEFYILASREFVTVPKD-----HAAEMRAYDTRVGEFRA
A1B368_PARDP/7-360YRARPHSGVIDLDRIGAYRARDFWDELRTTDGQ...LILDPGAFYILVSREAVAIPPD-----YAAEMAPYLAMVGEFRV
E0TCQ3_PARBH/11-366WRAKKHTGLIDVDRVAALRPEAYFDPLPVMQDQF..LILDPGEFYILASQEELRLPDD-----LAAEMAPIDADLGAFRV
F2IY64_POLGS/9-367YRAKHHTAVIDVDLRAVHHPLDFWEPIHRR.DEAS.LILDPNEFYILVSREAVHVPPD-----FAAEMVPFDPLVGEFRV
D5AUM0_RHOCB/3-361YRAKPHAGVVDLDRIAHYPASDFWEEVRTREGR...IILDPGAFYILVSREAVVIPPD-----FAAEMAPYLAMVGEFRV
Q28RG4_JANSC/9-360YRAKPHAGVIDLTQIGAHKTAEFWEDIHSDTGQ...IILDPGAFYILVSREAVTIPPD-----CAAEMAPYLAMVGEFRV
W8S3S8_9RHOB/5-358YRAKPHAGVIDLTRIAAHDIAEFWEEVRSETGR...IILDPGAFYILVSQEAVTIPPD-----CAAEMAPYLAMVGEFRV
V5SAL4_9RHIZ/10-372YRAKRHTGVVDVDQPGACAIADYWEPVFAD.SKRR.LILDPDQFYILASKEAVHIPPT-----HAAEMMPFNPLVGEFRV
M9RD28_9RHOB/2-357YRAKPHTGVIDLAQVAHYEPADFWEEVRTTDGH...IILDPGAFYILVSRESIAIPPD-----CAAEMAPYIAMVGEFRV
C6XMA9_HIRBI/10-342YRAKRHSRVLDLKNINGHKIEDFWEPVRPYNGA...LVLDPGEFYILASKEKVVIPVD-----EAAEMAPIAPEFGEFRA
Q0BYT8_HYPNA/2-334YRAKAHSGVVDLRGLGAHEVSQFWEPVYPKSGR...IVLNPEEFYILVSRETVKVAAN-----EAAEMAAIAPELGEFRA
Q3J368_RHOS4/2-356YRAKPHTGLIDLDRIGHYPASDFWEEVRARDGR...IILDPGAFYILVSREAVTIPPD-----HAAEMAPYLAMVGEFRV
B8IN71_METNO/5-360YRAKRHTGLVDVDRPRSYAVSEFWEPLRAD.GSGT.LILDPGQFYILASKECVQVPPD-----FAAEMVPFDPLVGEFRV
A8ILD7_AZOC5/12-371FRAKKHTGVVDVDKRAALDVEDFWEPIRAR.GHSS.LVLDPDAFYILASREAVQVPPE-----HAAEMVPFDPLVGEFRV
V9TRV1_9PROT/16-380YKARKNTCVIDVDRKYTYPASKFWEQLYWDHGQ...LILEKDEFYILGTREELAVPPD-----LAAEMLPFNNQFGEFRV
G8PHJ6_PSEUV/2-361YRAKRHTGVIDVDRKDAQDPADFWEPIYNR.GDAT.LILDPNEFYILVSQEAVHVPPN-----YAAEMVPFDPLVGEFRV
B2III7_BEII9/27-392YRAQKHADILDVDRVGAYAVSDYWEPILAREDQR..LILDPGEFYILASHEKLHIPPD-----LAAEMVPIDPAMGEFRV
I7DZH0_PHAIB/12-367YRAKHHTGVVDLSKLGHYDPAEYWEEVRTTKGQ...IILDPGAFYILVSREAIAIPPD-----YAAEMAPYLAMVGEFRV
D8PJ22_9BACT/7-382YRAKKNSHVIDLAKIGHYAALDFWEPLKRHRQDS..LLLEPEEFYILASKERIRVPPG-----YAAEMVAYEAACGELRT
G4R8T6_PELHB/6-364FRSKRHTAVVDVDKKNALDVLDYWDPLVNR.GSGE.LILDPDEFYILVSRESVHVPPD-----YAAEMVPFDPLVGEFRV
C6XF01_LIBAP/2-364YRAKRHTAAIDVDSENKYDESDFWDPLFSWDAPEGQFILDPNEFYIFASREFIQIPPS-----LVAEMIPYDHSIGEFRV
Q92S94_RHIME/4-363YRGKHHTSVVDVDKKAQHAVFDFWEPLYSR.GRDD.LVLDPDEFYILVSREAVHVPPR-----YAAEMTPFDPLVGEFRV
B8ELJ2_METSB/17-383YRAQKHADIIDVDRAGGYRLDDYWDRIFARPDGR..LILDPGEFYILASQERLHIPSD-----LAAEMVPIDPAMGEFRV
Q3SWD3_NITWN/9-367YRAKRHTGVIDIDRRGGYAVGEFWEPIAAR.PDAS.LILDPGEFYILASKEAVQVPPD-----YAAEMVPFDPLVGEFRV
D7A3W4_STAND/8-367FRAKRHTGLIDVDKRAACEVEDYWEPLYTR.GRRE.LVLDPDAFYILASKEAVHVPPS-----HAAEMVPFDPLVGEFRV
J7Q6T1_METSZ/2-364YRAQKHTDVIDVDRIGAYRIDDYWDRLPSR.DGR..LILDPGDFYILASHERLAIPPD-----LAAEMAPMDAAIGEFRV
C5B418_METEA/18-375YRARQHAGIVDVDKVGAHRWKEFWTPIHAAEGAE..IVLDPGAFYIMASKEAVSVPPE-----YSAEMVPFDPLLGELRC
C5AS03_METEA/8-364YRAKRHTGLIDVDRPRGHRTRDFWEPLPAD.GSRT.LILDPGQFYILASKEAVRVPAD-----YAAEMVPFDPLVGEFRV
A7HQ50_PARL1/26-383YRAKRHSGVIDIDKIGVYDVRDFWDPVHVRPGKG..LILDPDEFYILASREALHIPAT-----HAAEMVAYNPLVGEFRV

PF06088

O92445_NPVBM/1-181------.....................................PDNNKTDAAVNTSS............PKRAVETENDD
Q8JM51_9ABAC/1-193------NNNKNIVTSDKMLVEPLKDLN................SHHADSQHSHTAYVPESDGS......SSSSSSSSSDT
Q80PB1_NPVST/1-191------.......ATDKMLDAPVAHQ.................EQHANSQLFKSAFASNSDSG......SSSSSEDEYEE
Q91GH9_NPVEP/1-154------..........................................SKKLADASV............PHHGLAIS..E
Q06KI7_NPVAG/1-153------..........................................NKKLADTPV............PHHGPAE...E
Q9DVU8_9BBAC/1-138------...................................................................EEVVVEE
TLP20_NPVOP/1-155------..........................................SKKRAVAP.............PHHEPEPVPAE
A1YJ70_NPVSF/1-194------.......TTDKMLDEPVKQHH................QEHANSQLFKSAFTRDSDDA......ASSSSSASSDE
Q461Z1_9ABAC/34-277------PKNEI..NLKNNFVEGINNNIVDTAVVNGNDTDLA.LKKSTNSQLFLKTFG......KRSQHEENDDEDDEDDD
Q8B9H2_NPVR1/1-180------.....................................SDNSKTDAAVHTPS............PKRTVETENDD
Q9PYS5_GVXN/1-160------...........................................DKNMLVPV............EVHRADEPTVE
Q9YMN7_NPVLD/34-223------..........................................NKMRESSPQ..........PCRILQENDENDS
Q287I3_NPVAS/1-185------......ATTDKMLDEPVEQQ.................EQHANSQLFKSAFAPDTDGT..........SSDESDE
Q9J859_9ABAC/1-194------NAN....TTDKMLAEPVAHQ.................EQHANSQLFKSAFAPGSDDS......DNGSALSEDDR
Q6QXL3_GVAS/1-174------...........................................PFKFSVPI...............SVEKEQEE
Q7TLS0_NPVCF/1-155------..........................................SKKRVVAP.............PQHEPESARAE
Q4KT00_9ABAC/1-234------LKNEI..NLKNNFVEDINNNI...TAVDVNGINIEPLRKSTNSQLFLKTFG..............NKSQDEDDD
Q2NP03_NPVHC/1-155------..........................................SKKSVVAP.............PHYDTEAAPAE
Q1HH27_NPVAP/1-152------..........................................SKKFADAPA............PHHGPA....E
A1YRC7_9ABAC/1-176------.....................................SDNSKTDVVVDASS............PKSIVETENDD
Q80LN1_NPVAH/1-194------......YKMLTDSKSPIKHYD.........APFFSQQQGSLGKRHDSSSPS............PTASSAGNGDD

PF06284

UL84_HCMVM/1-586AFRLRLRRETVRRPFFSDAPLPYFVPPRSGAADEGLEVRVPYELTLK-NSHTLRIYRR--FYGP--YLGVFVPHNRQGLK

PF06501

VU55_HHV6U/3-432YLRLTF.SPPDRSTVTLNMNMPYF---KICADGKNLEVFFPNDMSLV-SNTNKEITLRGEFTNKK-IVGIFIPVQTHVFK
V55B_HHV7J/5-430MLKLGFVNEIIPNEISLTVHMHYF---KICSDKRKIDVFFQDTMLFD-EGETKKLHFKGTFYNFN-ANALYVPDPNSKVQ
O56289_9BETA/6-427SLRLRF.SKPNMQSVALNICMPYF---NISEEFKTMEIYFPERMTLT-PNHITQINLRGTFENPA-AVGLFIPKKSNVLS

PF05784

VU54_HHV6U/4-339AIQISL.TPQTADITLSQNQETLL---K.CNT-HSITVCATKNIIPN.TVTPVHCSFNTIFNSNSNFTGLFIPKLLLGIS
PP71_HCMVM/28-371FLHFSV.YTHRAEVVARHNPYPHL---RRLPD-NGFQLLIPKSFTLTRIHPEYIVQIQNAFETNQTHDTIFFPENIPGVS
PP65_HCMVM/15-357FMHVTLGSDVEEDLTMTRNPQPFM---RPHER-NGFTVLCPKNMIIK.PGKISHIMLDVAFTSHE.HFGLLCPKSIPGLS

PF00692

DUT_HUMAN/121-250-----------DED---YRG.NVGVVLFNFGKE.KFEVKKGDRIAQLICE------------------------------
DUT_ICHVA/62-187-----------DSD---FRG...HIHIMVSAIA.DFSVKKNQRIAQLVVT------------------------------
DUT_EBVB9/119-240-----------CRW---RRG.GVDVSLTNFSDQ.TVFLNKYRRFCQLVY.------------------------------
DUT_SHV21/120-244-----------.SR---WQN.QLQIIFYNYTKS.QITYTARTRIAQVVFM------------------------------
DUT_HAEIN/15-149-----------DSD---YQG.PLMVSMWNRGNE.PFKIEVGDRIAQLVFV------------------------------
DUT_HHV11/206-337-----------TRW---LPGHVCAFVVYNLTGV.PVTLEAGAKVAQLLVA------------------------------
DUT_YEAST/16-146-----------DRD---YTG.EVKVVLFNHSQR.DFAIKKGDRVAQLILE------------------------------
DUT_ECOLI/15-149-----------DSD---YQG.QLMISVWNRGQD.SFTIQPGERIAQMIFV------------------------------
DUT_VZVD/225-354-----------TAW---PAGEHCKFYVYNLTGD.DIRIKTGDRLAQVLLI------------------------------
DUT_SOLLC/39-168-----------DAD---YRG.PVGVVLFNHSEV.DFEVKVGDRIAQLIVQ------------------------------
F4B717_ACIHW/46-166-----------DAG---FEG...QLTIEVLGSAFPVKIKRGTRFLHLIFA------------------------------
DUT_CANAL/28-157-----------DAD---YRG.EVKVVLFNHSEK.DFEIKEGDRIAQLVLE------------------------------
DUT_VACCW/18-145-----------DED---YRG.NIGVILINNGKC.TFNVNTGDRIAQLIYQ------------------------------
DUT_HHV6U/242-365-----------NKD---TIP...SIKIFNSTRK.TIYIPTGICIARIIFT------------------------------
Q6TVW3_ORFSA/26-154-----------DED---YRG.NVGVVLFNFGNS.DFEVKKGDRIAQLICE------------------------------
Q8V3S4_SWPV1/13-141-----------DSD---YRG.EIGIVFINNGCS.DFNIKVGDRIAQIIFE------------------------------
PRO_MMTVC/620-741-----------DSD---FQG.EIKVMVKAAKN..AVIIHKGERIAQLLLL------------------------------
Q9TTD4_SHEEP/13-133-----------DSD---YTG.EIKILASAPNK..IIVINAGQRIAQLLLV------------------------------

PF04797

VG11_EHV2/74-450DGDRRFGLMGCCEW---PKGGHAELAVENRTCF-LQVLRTGDRLGYAIFF------------------------------
LF2_EBVA8/37-401NPVFYVYP...QEW---KPGQTLKLTVRNISNN-PITIVTGQSMAQAFFI------------------------------
VG10_EHV2/21-391NPDLVVRP...VVW---KPMTSLVLTLYNNSER-PLAIRRGDLAALAVPV------------------------------
VG10_ALHV1/6-378PSFLVADP...GIW---NPSSTCLLTLHNISNQ-PVKLRTCEPVAVGLLL------------------------------
LF1_EBVB9/5-442CDQWVLRP...RVW---TAHSPIKMTVYNCGHK-PLHIGPSTRLGLALFW------------------------------
VG11_ALHV1/22-387DTEFETDV...CEW---ASECTAKIMVSNKSLF-PRTLAPGTHIANAHFL------------------------------
VG11_SHV21/24-388CADFHISD...CEW---KPGKTACIVVTNTSTI-SVTISSGTHLGEAVFI------------------------------
ORF11_HHV8P/26-387NCDIFLED...SEW---RPNKPAPLKLVNTSDH-PVILEPDTHIGNALFI------------------------------
ORF10_HHV8P/7-387ETKFVSFP...AVL---LPGKHEHLTVFNPQTH-PLTIQRDTIVGVAMAC------------------------------

PF06559

B0T2H0_CAUSK/6-336HYAGFFDPGFGTEE...AGAVGSKGVLEVRSHETPFLLEDGQIVARLVYE------------------------------
A6WVX6_OCHA4/5-363HYAGFFDPGFGHSA...AGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYE------------------------------
A7ICI7_XANP2/10-371HYAGFFDPGFGNPA...AGGRGARAVLEVRSREVPFILEHGQTVGRLVYE------------------------------
D9QL85_BRESC/7-337HYAGFFDPGFGTDE...AHGAGSKGVLEVRTHDTPFLLEHGQIVARLVYE------------------------------
E3I262_RHOVT/9-354HYAGFFDPGFGMAE...AGGHGSRAVLEVRSHKVPFILEDGQLIGRLSYE------------------------------
S0EVQ5_CHTCT/8-380HYAGFFDSGFGYAAALPATETAAAVVLEVRSRDVPFLIEDGQPLFRIHLL------------------------------
U6B352_9RHIZ/4-360HYAGFFDSGFGHS....PECFVTKAVLEVRSLLLPFILEDGQVIARLKYE------------------------------
E3F1H9_KETVY/2-356HYAGFFDPGFGYAA...AGGAGSRGVLEVRCHESPFVLEHGQIVGRLVYE------------------------------
Q0ASF2_MARMM/3-337HYAGFFDPGFGTTE...AGGTGARAVLEVRGRDVPFLLEHGQPIARLVYE------------------------------
J9ZEW7_LEPFM/2-359HYAGFFDPGFGLVE...E...GARAVLEIRPHDVPFRVVDGQKIFRLRFE------------------------------
Q11M73_CHESB/3-361HYAGFFDPGFGHSA...SGGTGSRAVLEVRSHEVPFILEHGQIVGRLVYE------------------------------
Q1GI72_RUEST/2-356HYAGFFDPGFGHAA...AGGAGSRGVLEVRCHEAPFVLEHGQVVGRLVYE------------------------------
I0IM71_LEPFC/2-351HYAGFFDPGFGFSE...E...GAKAVLEVRPHDVPFRIVDGQRIFRLRYE------------------------------
F8J4V2_HYPSM/17-374HYAGFMDPGFGHAA...AGGNGSRVVLEVRSHKVPFILEDGQIIGRLIYE------------------------------
D5BMT1_PUNMI/8-370HYAGFFDPGFGVAE...IGATPTRAVLEVRSHDVPFLIEQDQTVCRLVYE------------------------------
A1B368_PARDP/7-360HYAGFFDPGFGHGS...A.GQGARGVLEVRCHEAPFALEHGQVVGRLVYE------------------------------
E0TCQ3_PARBH/11-366HYAGFFDPGFGLEA...P....SRAVLEVRGYDAPFLIRHGQTMARLTFE------------------------------
F2IY64_POLGS/9-367HYAGFFDPGFGHGQ...AGGTGSRAVLEVRSHDVPFLVEHGQTVGRLVYE------------------------------
D5AUM0_RHOCB/3-361HYAGFFDPGFGHGA...AGGEGSRGVLEVRCHEAPFVLEHGQVVGRLVYE------------------------------
Q28RG4_JANSC/9-360HYAGFFDPGFGH.......GVPARGVLEVRCHEAPFVLEHGQTVGRLVYE------------------------------
W8S3S8_9RHOB/5-358HYAGFFDPGFGH.......GIPARGVLEVRCHEAPFVLEHGQVVGRLVYE------------------------------
V5SAL4_9RHIZ/10-372HYAGFMDPGFGHSA...AGGSGSRVVLEVRSHKVPFILEDGQIVGRLVYE------------------------------
M9RD28_9RHOB/2-357HYAGFFDPGFGWDS...AGGAGSRGVLEVRCHEAPFVLEHGQIVGRLVYE------------------------------
C6XMA9_HIRBI/10-342HYAGFFDPGFG......VEGLEGKAVLEVRSREVPFILTDGQPMGRLVFE------------------------------
Q0BYT8_HYPNA/2-334HYAGFFDPGFGTNK...A...GSRAVLEVRSRDVPFILEHGQPVAKLIYE------------------------------
Q3J368_RHOS4/2-356HYAGFFDPGFGHAQ...AGGTGSRGVLEVRCHEAPFALEHGQVVGRLVYE------------------------------
B8IN71_METNO/5-360HYAGFFDPGFGHAA...AGGTGARAVLEVRSRDVPFMLEDGQIVGRLVYE------------------------------
A8ILD7_AZOC5/12-371HYAGFFDPGFGHPA...AGGSGARAVLEVRSREVPFILEHGQTVGRLVYE------------------------------
V9TRV1_9PROT/16-380HYAGFFDPGFGWAN...GQAQGSRAVLEVRSYGAPFALEHGQIVSCLDYR------------------------------
G8PHJ6_PSEUV/2-361HYAGFFDPGFGHST...VGGTGSRAVLEVRSHDVPFIVEHGQTVGRLVYE------------------------------
B2III7_BEII9/27-392HYAGFFDPGFGHTV...SNLPGARAVLEVRSREVPFILENGQVVGRLVYE------------------------------
I7DZH0_PHAIB/12-367HYAGFFDPGFGYAA...AGGAGSRGVLEVRCHDAPFVLEHGQVVGRLVYE------------------------------
D8PJ22_9BACT/7-382HYAGFFDPGFGYGD...GKMRGTQVVLEVRPHDVPFLIHDGQTFFKVVYD------------------------------
G4R8T6_PELHB/6-364HYAGFFDPGFGHSA...AGGTGSRAVLEVRSREVPFLLGHGQTIGRLIYE------------------------------
C6XF01_LIBAP/2-364HYAGFFDPGFGCVL...PQEVGAKAVLEVRS.SVPFVLEHGQIIGRLKYE------------------------------
Q92S94_RHIME/4-363HYAGFFDPGFGHAS...AGGSGSRAVLEVRSHEVPFILEHGQIVGRLVYE------------------------------
B8ELJ2_METSB/17-383HYAGFFDPGFGASP...DNRPGARAVLEVRSHEVPFVLEDGQIIGRLVYE------------------------------
Q3SWD3_NITWN/9-367HYAGFFDPGFGYAG...AGGEGSRAVLEVRSREVPFILEHGQIVGRLVYE------------------------------
D7A3W4_STAND/8-367HYAGFFDPGFGHSA...AGGSGARAVLEVRSREVPFILEDGQIVGRLVYE------------------------------
J7Q6T1_METSZ/2-364HYAGFFDPGFGAGP...DGRPGARAVLEVRSREVPFILEDGQFIGRLVYE------------------------------
C5B418_METEA/18-375HYAGLFDAGFGHAT...ANGEGSRGVLEVRCRDVPFVISHGQVLGRLVYE------------------------------
C5AS03_METEA/8-364HYAGFFDPGFGLSE...AGGAGARAVLEVRSRDVPFLLEDGQIVGRLVYE------------------------------
A7HQ50_PARL1/26-383HYAGFFDPGFGARE...AGGAGSRIVLEVRSHEVPFILEHGQIIGRFVLE------------------------------

PF06088

O92445_NPVBM/1-181DD.....----------DEDDAASAIDEQKENTDAVGIDFE.........------------------------------
Q8JM51_9ABAC/1-193DD.....----------............NDTDTN...............------------------------------
Q80PB1_NPVST/1-191DN.....----------............NDGGKQKSRSDD.........------------------------------
Q91GH9_NPVEP/1-154EY.....----------.............VVAERLGAESG.........------------------------------
Q06KI7_NPVAG/1-153EN.....----------.............VVAERFGSESG.........------------------------------
Q9DVU8_9BBAC/1-138DE.....----------............PEEVQSMEISSN.........------------------------------
TLP20_NPVOP/1-155EG.....----------.............AVADRAEPESG.........------------------------------
A1YJ70_NPVSF/1-194SD.....----------............EDGNVASRTAAN.........------------------------------
Q461Z1_9ABAC/34-277NDSEIEE----------KGSNNRVGTHKSSDGNNNNKFNSNGFGSDAMDY------------------------------
Q8B9H2_NPVR1/1-180DG.....----------.NAASVAAIDEQEGNADAVGLDFE.........------------------------------
Q9PYS5_GVXN/1-160NE.....----------.............PTPDSTTPTMN.........------------------------------
Q9YMN7_NPVLD/34-223DEPQAVS----------HGDSNADSGSRSEEDDDAAGGADGAGGAGGA..------------------------------
Q287I3_NPVAS/1-185DD.....----------.............DGDKRKSISES.........------------------------------
Q9J859_9ABAC/1-194DD.....----------............DDDDDDRNGSEN.........------------------------------
Q6QXL3_GVAS/1-174EELEGIN----------NSRMVTEIDQEEIVSSTDIDIEMP.........------------------------------
Q7TLS0_NPVCF/1-155EG.....----------.............AFAERPGPEFG.........------------------------------
Q4KT00_9ABAC/1-234EDSNDED----------DEIRKDTRVDSREDRDENNKINGNGIGSDAMEY------------------------------
Q2NP03_NPVHC/1-155EG.....----------.............PVAERFGAESS.........------------------------------
Q1HH27_NPVAP/1-152ES.....----------.............ADTECAGSELG.........------------------------------
A1YRC7_9ABAC/1-176DG.....----------.....TAAVDEQKGNDVVSGLDLE.........------------------------------
Q80LN1_NPVAH/1-194DN.....----------.............NNYDDDNASNG.........------------------------------

PF06284

UL84_HCMVM/1-586MPV--------TVW---LPRSWLELTVLVSDEN-GATFPRDALLGRLYFISSKHTLNRGCLSAMTHQVKSTLHSRSTSHS

PF06501

VU55_HHV6U/3-432LYP--------FLW---FAQE--PLKLRISCER-TVSVTEHDMLGRVFFV-TKKLFRKPFRSLSNSDMKSLLT--HTENT
V55B_HHV7J/5-430SIA--------SFW---SPTT--SFTTKVTSDR-SQRVTTNDIIGSIYFI-PTHILRTKFDPNYTDSFAAEIE--LNSED
O56289_9BETA/6-427.FP--------FIW---QPRE--TFRIYVYCRN-ETFVTEHDIIGHVYFI-SREQFPHSFHPTAHADCKSKVE--AAFNS

PF05784

VU54_HHV6U/4-339TTT--------GIW---DETRPLYITMKAFKK.-NRRINYSQPIGVVYFF------------------------------
PP71_HCMVM/28-371IEA--------GPL---PDRVRITLRVTLTGDQ-AVHLEHRQPLGRIHFF------------------------------
PP65_HCMVM/15-357ISG--------NLL---MNGQQIFLEVQAIRE.-TVELRQYDPVAALFFF------------------------------

PF00692

DUT_HUMAN/121-250--------------RIFY...PEIEEVQAL.DDTERGS-GGFGSTG------------
DUT_ICHVA/62-187--------------PCLT..QSEVVPYETL.ERTRRGT-GGFGSSG------------
DUT_EBVB9/119-240--------------..LHK.HHLTSFYS...PHSDAGV-LGP.RSL------------
DUT_SHV21/120-244--------------HKKH.....LPTTLTRLKPTMHLS-ENIKYSW------------
DUT_HAEIN/15-149--------------PVVQ...AEFNIVEDF.QQTERGE-GGFGHSG------------
DUT_HHV11/206-337--------------GADALPWIPPDNFHGT.KALRNYP-RGVPDST------------
DUT_YEAST/16-146--------------KIVD..DAQIVVVDSL.EESARGA-GGFGSTG------------
DUT_ECOLI/15-149--------------PVVQ...AEFNLVEDF.DATDRGE-GGFGHSG------------
DUT_VZVD/225-354--------------DHNT....QIHLKHNVLSNIAFPY-AIRGKCG------------
DUT_SOLLC/39-168--------------KIVT...PEVEQVDDL.DSTVRGS-GGFGSTG------------
F4B717_ACIHW/46-166--------------RTLT.......PVENPYHGKYQGQ-QGVT...------------
DUT_CANAL/28-157--------------QIVNA.DIKEISLEEL.DNTERGE-GGFGSTG------------
DUT_VACCW/18-145--------------RIYY...PELEEVQSL.DSTNRGD-QGFGSTG------------
DUT_HHV6U/242-365--------------.CGHF.CLSLMPERAI.NRLQVLD-ANSS...------------
Q6TVW3_ORFSA/26-154--------------RISH...PAVQEVNRL.DDTDRGD-SGFGSTG------------
Q8V3S4_SWPV1/13-141--------------RVEY...PIMEEVKCL.EDTERGN-SGFGSSG------------
PRO_MMTVC/620-741--------------PYLK.......LPNPI.IKEERGS-EGFGST.------------
Q9TTD4_SHEEP/13-133--------------PLVI.......QGKT..INRDRQD-KGFGSS.------------

PF04797

VG11_EHV2/74-450--------------I.APRIPMVNLLPARY-RENLSVA-VTVVGGV------------
LF2_EBVA8/37-401--------------Y..AGDPSISTIMRRY-IQRQGCA-LTLPGNI------------
VG10_EHV2/21-391--------------.......NSTDIRTVY-SDNSGTL-ITWDTGT------------
VG10_ALHV1/6-378--------------YC...NDAHLPSRDVC-FCSETGR-LEWRNCV------------
LF1_EBVB9/5-442--------------..PAERSDNLDAGRIF-YQLTSGE-LYWGRTV------------
VG11_ALHV1/22-387--------------L.AERHFFSRILSDKN-LKKLSTC-IKLPGGF------------
VG11_SHV21/24-388--------------L.APKFFCRKIMSKTH-VQKLSSA-ICLPGNV------------
ORF11_HHV8P/26-387--------------I.....APKARGLRRL-TRLTTKT-IELPGGV------------
ORF10_HHV8P/7-387--------------Y.IHPGKAASQAPYSF-YDCKEES-WHVG...------------

PF06559

B0T2H0_CAUSK/6-336--------------PLTA.RPDRLYGEG.G.SHYQRQG.LKLSKHFK-----------
A6WVX6_OCHA4/5-363--------------HMLH.RPSALYGVDLG.SNYQAQQ.LKLSKHFR-----------
A7ICI7_XANP2/10-371--------------RMAG.RPGTLYGADMR.SHYQGQG.LKLSKHFK-----------
D9QL85_BRESC/7-337--------------PLTE.RPTRLYGEG.G.SHYQRQG.LKLSKHFR-----------
E3I262_RHOVT/9-354--------------PLSE.PPARLYGHDIG.SHYQAQS.LKLSKHFR-----------
S0EVQ5_CHTCT/8-380--------------RCTE.EPEFLYGAQAG.SSYQSQRDVRLSKQFT-----------
U6B352_9RHIZ/4-360--------------SMME.KPDRLYGDNLG.SNYQYQR.LKLSKHFR-----------
E3F1H9_KETVY/2-356--------------RMDA.APQQLYGAGIA.SNYQGQG.LKLSKHFR-----------
Q0ASF2_MARMM/3-337--------------PMLD.VPHTVYGQ.VA.SNYQAQG.LKLSKFFA-----------
J9ZEW7_LEPFM/2-359--------------WMES.PPRHPYGLEIG.SNYSRQA.LKLSKYF.-----------
Q11M73_CHESB/3-361--------------RMGD.LPRALYGADLK.SNYQGQA.LKLSKHFR-----------
Q1GI72_RUEST/2-356--------------RMAE.LPEQLYGAGIA.SNYQGQG.LKLSKHFR-----------
I0IM71_LEPFC/2-351--------------RMNC.PPDKIYGQDIG.SNYSAQG.LKLSKYFS-----------
F8J4V2_HYPSM/17-374--------------RMIE.TPATLYGQGLK.SNYQGQG.LKLSKHFK-----------
D5BMT1_PUNMI/8-370--------------PMSA.IPETLYGSGGSGSNYQSQG.LRLAKHF.-----------
A1B368_PARDP/7-360--------------RMAA.RPERLYGSGIA.SNYQGQG.LKLAKQF.-----------
E0TCQ3_PARBH/11-366--------------RLTR.PVSRRYGEALK.SHYHGQG.LRLSKHFA-----------
F2IY64_POLGS/9-367--------------HMAE.RPRRLYGEGIG.SNYQGQA.LKLSKHFK-----------
D5AUM0_RHOCB/3-361--------------RMAG.RPERLYGAGIA.SNYQGQG.LKLAKHFR-----------
Q28RG4_JANSC/9-360--------------TMAS.APSQLYGTDIA.SNYQGQG.LKLSKHFA-----------
W8S3S8_9RHOB/5-358--------------RMAH.APEQLYGADLA.SNYQGQG.LKLSKHFK-----------
V5SAL4_9RHIZ/10-372--------------RMTE.LPDQLYGSDLG.SHYQAQG.LKLSKHFK-----------
M9RD28_9RHOB/2-357--------------HMSQ.TPAALYGQDIK.SNYQGQG.LKLSKHFK-----------
C6XMA9_HIRBI/10-342--------------PMVA.NPKVPYGAAGSFSNYQGQG.LKLSKHF.-----------
Q0BYT8_HYPNA/2-334--------------PMTE.KPRHLYG.GQG.SNYQGQG.LKLSKHFA-----------
Q3J368_RHOS4/2-356--------------RMEE.RPDMLYGAGIA.SNYQGQG.LKLAKHFR-----------
B8IN71_METNO/5-360--------------RMAE.RPAALYGAQAG.SNYQAQG.LKLSKHF.-----------
A8ILD7_AZOC5/12-371--------------RMAA.RPDHLYGEALG.SNYQGQG.LKLSKHFR-----------
V9TRV1_9PROT/16-380--------------RIASGKTKIIYGTALK.SNYQGQK.MTLAKHF.-----------
G8PHJ6_PSEUV/2-361--------------HMQE.VPETLYGEGIG.SNYQGQA.LKLSKHFR-----------
B2III7_BEII9/27-392--------------KMAE.APLSVYGQLEG.AHYQGQG.LKLSKHFQ-----------
I7DZH0_PHAIB/12-367--------------KMSE.VPEQLYGVDIA.SNYQGQG.LKLSKHFK-----------
D8PJ22_9BACT/7-382--------------RMLT.VPTQVYGTALG.SSYQRQA.LTLSKHFK-----------
G4R8T6_PELHB/6-364--------------KMAE.RPEMLYGSALG.SNYQAQS.LKLSKHFK-----------
C6XF01_LIBAP/2-364--------------SMDG.EPERLYGEARG.SHYQSQA.LKLSKHFH-----------
Q92S94_RHIME/4-363--------------HMLE.RPEGLYGLDLG.SNYQAQG.LKLSKHFR-----------
B8ELJ2_METSB/17-383--------------KMAE.APHALYGEGEG.SNYQGQG.LKLSKHF.-----------
Q3SWD3_NITWN/9-367--------------KMLA.RPDAMYGQRIG.SNYQAQG.LKLSKHFR-----------
D7A3W4_STAND/8-367--------------RMQE.LPRTLYGEGLG.SNYQAQG.LKLSKHFR-----------
J7Q6T1_METSZ/2-364--------------RMAE.TPKALYGQSGV.SNYQGQG.LKLSKHFM-----------
C5B418_METEA/18-375--------------RMAA.RPDALYGTAKA.SHYQGQS.IRLGKVFD-----------
C5AS03_METEA/8-364--------------RMLE.RPATLYGAGAG.SNYQAQG.LKLSKHFA-----------
A7HQ50_PARL1/26-383--------------RLTD.RPTVLYGAGLG.SNYQRQG.LKLSKHFR-----------

PF06088

O92445_NPVBM/1-181--------------..ENIDDGDVSAPKKQKLDNAEQN--------------------
Q8JM51_9ABAC/1-193--------------.....ELSEPVPIKRQKLDESDQG--------------------
Q80PB1_NPVST/1-191--------------.....EQSNSVPAKRQKLDDSVES--------------------
Q91GH9_NPVEP/1-154--------------.......DAPTSPKKQKLDEHAQD--------------------
Q06KI7_NPVAG/1-153--------------.......DAPSSPKKQKLDESEQD--------------------
Q9DVU8_9BBAC/1-138--------------.......EEIKTNKPSLFDKYYVG--------------------
TLP20_NPVOP/1-155--------------.......DAPPSPKKQKLDEREQD--------------------
A1YJ70_NPVSF/1-194--------------.....DLSEAVPAKRQKLDNFVES--------------------
Q461Z1_9ABAC/34-277--------------SDSDYDSSGELSNKRQKLDNNLES--------------------
Q8B9H2_NPVR1/1-180--------------..ENIDDGDAPTPKKQKLDNAEQD--------------------
Q9PYS5_GVXN/1-160--------------.PVISIEVKPAPRKPSVFDKFLQE--------------------
Q9YMN7_NPVLD/34-223--------------.AIDSEDELPAPFKKQRLDDVESN--------------------
Q287I3_NPVAS/1-185--------------.DPNIGMVEDVPAKRQKLDDHVES--------------------
Q9J859_9ABAC/1-194--------------.....QLSGVVPAKRQKLDDSISG--------------------
Q6QXL3_GVAS/1-174--------------.EFKIPEPKPSTSKLSVFDRFNVE--------------------
Q7TLS0_NPVCF/1-155--------------.......DASPSPKKQKLDEHEQD--------------------
Q4KT00_9ABAC/1-234--------------SDSDDDSSGELSIKRQKLDNDPQS--------------------
Q2NP03_NPVHC/1-155--------------.......DAPPSPKKQKLDEHEQN--------------------
Q1HH27_NPVAP/1-152--------------.......DAPPSPKKQKLDEREQD--------------------
A1YRC7_9ABAC/1-176--------------..EDVYDGNVPAAKKQKLDNAEQS--------------------
Q80LN1_NPVAH/1-194--------------.SHDESISCASKPKIKKRNHSQSD--------------------

PF06284

UL84_HCMVM/1-586PSQQQLSVLGASIALEDLLPMRLASPETEPQDCKLTEN-TTEKTSPVTLAMVCGD---

PF06501

VU55_HHV6U/3-432DKPFDVHFMGNCF-PAYLLPELTLHPL...EYEDKPAR-GNPQTLPSVEKHSIIKIRI
V55B_HHV7J/5-430PESDALYFLADKI-FISDLPDLILRKGWSARKKKLQSG-SNIN....NHAPSKSRLRF
O56289_9BETA/6-427...FRINFLGNDF-FSDSLPILTVHPMTDFPYEQIQET-ENIRHNSMNITPRFKRMQL

PF05784

VU54_HHV6U/4-339--------------PKQILPP-------------------------------------
PP71_HCMVM/28-371--------------RRGFWT.-------------------------------------
PP65_HCMVM/15-357--------------DIDLLL.-------------------------------------

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window