Sequence alignment for CL0156

PF00973

NCAP_MEASA/1-524MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF
H8ZYX3_PPRV/1-524MATLLKSLALFKRNKDKAPTASGSGGAIRGIKNVIIVPIPGDSSIITRSRLLDRLVRLAGDPDINGSKLTGVMISMLSLF
Q66412_9PARA/1-522MATLLRSLALFKRNKDRTPLIAGSGGAIRGIKHVIVVPVPGDSSIVTRSRLLDRLVRLAGDPYISGPKLTGVMISILSLF
NCAP_CDVO/1-522MASLLKSLTLFKRTRDQPPLASGSGGAIRGIKHVIIVLIPGDSSIVTRSRLLDRLVRLVGDPKINGPKLTGILISILSLF
NCAP_RINDR/1-524MASLLKSLALFKRAKDKPPLAAGSGGAIRGIKHVIVVPIPGDSSITTRSRLLDRLVKMVGDPDISGPKLTGALISILSLF
F7IX94_9PARA/1-524MASLLKSLALFKKNKDKPPLAAGSGGAIRGIKHVIIVPIPGDSSITTRSRLLDCLVKMVGDPDISGPKLTGALISILSLF
NCAP_PHODV/1-522MASLLKSLSLFKKTREQPPLASGSGGAIRGIKHVIIVLIPGDSSIVTRSRLLDRLVRMVGDPEVSGPKLTGVLISILSLF
NCAP_MEASE/1-523MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF
NCAP_RINDU/1-524MASLLKSLALFKKNKDKPPLAAGSGGAIRGIKHVIIVPIPGDSSITTRSRLLDRLVKMVGDPDISGPKLTGALISILSLF

PF05505

NCAP_EBOZM/19-734MD--YHKI-----------LTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAF-----EAGVDFQESADSFLLMLCLH
NCAP_MABVM/1-691MD--LHSL-----------LELGTKPTAPHVRNKKVILFDTNHQVSICNQIIDAI-----NSGIDLGDLLEGGLLTLCVE

PF00973

NCAP_MEASA/1-524VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADKYFSHDDPISSDQSRFGWFENKEISDIEVQDP
H8ZYX3_PPRV/1-524VESPGQLIQRITDDPDVSIRLVEVVQSTRSQSGLTFASRGADLDNEADMYFSTEGPSSGSKKRINWFENREIIDIEVQDA
Q66412_9PARA/1-522VESPSQLIQRITDDPDVSIRLVEVIQSEKSLSGLTFASRGANMEDEADDYFSIQAGEEGDTRGTHWFENKEIVEIEVQDP
NCAP_CDVO/1-522VESPGQLIQRIIDDPDVSIKLVEVIPSINSACGLTFASRGASLDSEADEFFKIVDEGSKAQGQLGWLENKDIVDIEVDNA
NCAP_RINDR/1-524VESPGQLIQRITDDPDISIKLVEVVQSDKTQSGLTFASRGTSMDDEADRYFTYEEPNDGEERQSYWFENRDIQDIEIQDP
F7IX94_9PARA/1-524VESPGQLIQRITDDPDISIKLVEVIQSDKTQSGLTFASRGASMDDEADRYFTYDEPNGGEERQSYWFENREIQDIEVQDP
NCAP_PHODV/1-522VESPGQLIQRIIDDPDISIKLVEVIPSINSTCGLTFASRGASLDAEADEFFGTMDEGSKDHNQMGWLENKDIIDIEVNDA
NCAP_MEASE/1-523VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFENKEISDIEVQDP
NCAP_RINDU/1-524VESPGQLIQRITDDPDISIKLVEVVQSDKTQSGLTFASRGTSMDDEADRYFTYDEPNDGEERQSYWFENREIQDIEVQDP

PF05505

NCAP_EBOZM/19-734HAYQGDY-KLFLESG--AVKYLE-------GHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANA---
NCAP_MABVM/1-691HYYNSDK-DKFNTSP--VAKYLR-------DAGYEFDVIKNADATRFLDVSPNEPHYSPLILALKTLESTESQRGRI---

PF00973

NCAP_MEASA/1-524EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALIL--
H8ZYX3_PPRV/1-524EEFNMLLASILAQVWILLAKAVTAPDTAADSELRRWVKYTQQRRVIGEFRLDKGWLDAVRNRIAEDLSLRRFMVSLIL--
Q66412_9PARA/1-522EEFNILLASILAQIWILLAKAVTAPDTAADSETRRWIKYTQQRRVVGEFRLDKGWLDAVRNRIAEDLSLRRFMVALIL--
NCAP_CDVO/1-522EQFNILLASILAQIWILLAKAVTAPDTAADSEMRRWIKYTQQRRVVGEFRMNKIWLDIVRNRIAEDLSLRRFMVALIL--
NCAP_RINDR/1-524EGFNMILATILAQIWILLAKAVTAPDTAAESELRRWVKYTQQRRVIGEFRLDKGWLDTVRNRVAEDLSLRRFMVALIL--
F7IX94_9PARA/1-524EGFNMILATILAQIWILLAKAVTTPDTAADSELRRWVKYTQQRRVIGEFRLDKGWLDTVRNRIAEDLSLRRFMVALIL--
NCAP_PHODV/1-522EQFNILLASILAQIWILLAKAVTAPDTAADSEMRRWIKYTQQRRVIGEFRMNKIWLDIVRNRIAEDLSLRRFMVALIL--
NCAP_MEASE/1-523EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNIIAEDLSLRRFMVALIL--
NCAP_RINDU/1-524EGFNMILATILAQIWILLAKAVTAPDTAADSELRRWVKYTQQRRVIGEFKLDKGWLDTVRNRIAEDLSLRRFMVALIL--

PF05505

NCAP_EBOZM/19-734-------GQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQ----GLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIH
NCAP_MABVM/1-691-------GLFLSFCSLFLPKLVVGDRASIEKALRQVTVHQEQ----GIVTYPNHWLTTGHMKVIFGILRSSFILKFVLIH

PF00973

NCAP_MEASA/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLMNLYQQMGETAP
H8ZYX3_PPRV/1-524-DIKRTPGNKPRIAEMICDIDN------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQLGEVAP
Q66412_9PARA/1-522-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTVESLMNLYQQMGETAP
NCAP_CDVO/1-522-DIKRSPGNKPRIAEMICDIDN------YIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTIESLMMLYQQMGETAP
NCAP_RINDR/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQMGELAP
F7IX94_9PARA/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQMGELAP
NCAP_PHODV/1-522-DIKRSPGNKPRIAEMICDIDN------YIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTIESLMVLYQQMGETAP
NCAP_MEASE/1-523-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLMNLYQQMGKPAP
NCAP_RINDU/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQMGELAP

PF05505

NCAP_EBOZM/19-734QGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGV-RLHPLARTAKVKNEVNSFKAALSSLAKHGEYAP
NCAP_MABVM/1-691QGVNLVTGHDAYDSIISNSVGQTRFSGLLIVKTVLEFILQKTDSGV-TLHPLVRTSKVKNEVASFKQALSNLARHGEYAP

PF00973

NCAP_MEASA/1-524YMVNLENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFD---------------------------------
H8ZYX3_PPRV/1-524YMVILENSIQNKFSAGAYPLLWSYAMGVGVELENSMGGLNFGRSYFD---------------------------------
Q66412_9PARA/1-522YMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFD---------------------------------
NCAP_CDVO/1-522YMVILENSVQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFD---------------------------------
NCAP_RINDR/1-524YMVILENSIQNKFSAGAYPLLWSYAMGIGVELENSMGGLNFGRSYFD---------------------------------
F7IX94_9PARA/1-524YMVILENSIQNKFSAGAYPLLWSYAMGVGVELESSMGGLNFGRSYFD---------------------------------
NCAP_PHODV/1-522YMVILENSVQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFD---------------------------------
NCAP_MEASE/1-523YMVNLENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFD---------------------------------
NCAP_RINDU/1-524YMVILENSIQNKFSAGAYPLLWSYAMGVGVELENSMGGLNFGRSYFD---------------------------------

PF05505

NCAP_EBOZM/19-734FARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKI
NCAP_MABVM/1-691FARVLNLSGINNLEHGLYPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAAHDAEVKLQRRHEHQEIQAIAEDDEERKI

PF00973

NCAP_MEASA/1-524------------------------PAYFRLGQEMV---------RRSAGKVSSTLASE------LGITAEDARL------
H8ZYX3_PPRV/1-524------------------------PAYFRLGQEMV---------RRSAGKVSSVIAAE------LGITAEEAKL------
Q66412_9PARA/1-522------------------------PAYFRLGQEMV---------RRSAGKVSSSLAAE------LGITAEDAKL------
NCAP_CDVO/1-522------------------------PAYFRLGQEMV---------RRSAGKVSSALAAE------LGITKEEAQL------
NCAP_RINDR/1-524------------------------PAYFRLGQEMV---------RRSAGKVSSNLASE------LGITEEEARL------
F7IX94_9PARA/1-524------------------------PAYFRLGQEMV---------RRSAGKVSSNLASE------LGITEEEAKL------
NCAP_PHODV/1-522------------------------PAYFRLGQEMV---------RRSAGKVSSTFAAE------FGITKEEAQL------
NCAP_MEASE/1-523------------------------PAYFRLGQEMV---------RRSAGKVSSTLASE------LGITAEDARL------
NCAP_RINDU/1-524------------------------PAYFRLGQEMV---------RRSAGKVSSNLASE------LGITEEEARL------

PF05505

NCAP_EBOZM/19-734LMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAIT.........AASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDP
NCAP_MABVM/1-691LEQFHLQKTEITHSQTLAVLSQKREKLARLAAEIENNIVEDQGFKQSQNRVSQSFLND...PTPVEVTVQARPM......

PF00973

NCAP_MEASA/1-524------------VSEIAMHTTEDKISRAVGPR-QAQVSFLHGDQSENELPRLGGK---------------------EDRR
H8ZYX3_PPRV/1-524------------VSEIASQTGDERTVRGTGPR-QAQVSFLQHKTDEGESPTPATR---------------------EEVK
Q66412_9PARA/1-522------------VSEIAAQANDDRANRAIGPK-QNQISFLHPDRGDASTPGNILR---------------------ANEG
NCAP_CDVO/1-522------------VSEIASKTTEDRTIRATGPK-QSQITFLHSERSEVANQQPPTI---------------------NKRS
NCAP_RINDR/1-524------------VSEIAAYTSDDRNNRTSGPK-QAQVSFLRTDQGSEAQHSASKK---------------------DEAR
F7IX94_9PARA/1-524------------VSEIAAYTGDDRNSRTSGPK-QTQVSFLRTDQGGEIQHNASKK---------------------DEAR
NCAP_PHODV/1-522------------VSEIVSRTTEDRTTRATGPK-QSQITFLHSERNEAPNQRLPPI---------------------TMKS
NCAP_MEASE/1-523------------VSEIAMHTTEDKISRAVGPR-QAQVSFLQGDQSENELPRLGGK---------------------EDRR
NCAP_RINDU/1-524------------VSEIAAYTGDDRNNRTSGPK-QAQVSFLRTDQGGETQNNASKR---------------------DEAR

PF05505

NCAP_EBOZM/19-734TDSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDEDD.EDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSR
NCAP_MABVM/1-691..NRPTALPPPVDDKIEHESTEDSSSSSSFVDLNDPFALLNEDEDTLDDSVMIPG.....................TTSR

PF00973

NCAP_MEASA/1-524VKQSRGEARE------------------------------SYRETGPSRASDARAAHLPTGTPLDID-------------
H8ZYX3_PPRV/1-524AAIPNGSEGR------------------------------DTKRTRSGKPRGETPGQLLPEIMQEDE-------------
Q66412_9PARA/1-522DGSTRMK.RG------------------------------GNIATPKGTSIDQTSTTLSKDT.LDID-------------
NCAP_CDVO/1-522ENQGGDKYPI------------------------------HFSDERLPGYTPDVNSSEWSESRYDTQ-------------
NCAP_RINDR/1-524APQVKKETRT------------------------------SSKSDKHKEGTDKEPVSSSAMTLIDVD-------------
F7IX94_9PARA/1-524VLQVRKETWA------------------------------SSRSDRYKEDTDNEAVSPSVKTLIDVD-------------
NCAP_PHODV/1-522EFQGGDKYSN------------------------------QLIDDRLSGYTSDVQSSEWDESRQITQ-------------
NCAP_MEASE/1-523VKQSRGEARE------------------------------SYRETGPSRASDARAAHLPTGTPLDID-------------
NCAP_RINDU/1-524APQIRKEART------------------------------SSKSDKYKEDTDKEPMSPSVKTLIDVD-------------

PF05505

NCAP_EBOZM/19-734PIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQ.........DRDG
NCAP_MABVM/1-691EFQGIPEPPR....QSQDLNNSQGKQE.............DESTNRIKKQFLRYQELPPVQEDDESEYTTDSQESIDQPG

PF00973

NCAP_MEASA/1-524--------------TASESSQDPQ----------------------------DSRRSADALLRLQAMAG-----------
H8ZYX3_PPRV/1-524--------------LSRESSQNPR----------------------------EAQRSAEALFRLQAMAK-----------
Q66412_9PARA/1-522--------------EQSDNTDDPI----------------------------SIQKSAEALAKMRAMAK-----------
NCAP_CDVO/1-522--------------IIQDDGND..----------------------------DDRKSMEAIAKMRMLTK-----------
NCAP_RINDR/1-524--------------TTLEADTDPL----------------------------ESKKSAEALLRLQAMAG-----------
F7IX94_9PARA/1-524--------------TTPEADTDPL----------------------------GNKKSAEALLKLQAMAS-----------
NCAP_PHODV/1-522--------------LTQEGDHD..----------------------------NDQQSMDGLAKMRQLTK-----------
NCAP_MEASE/1-523--------------TASESSQDPQ----------------------------DSRRSAEPLLSCKPWQ.-----------
NCAP_RINDU/1-524--------------TTPEVDTDPL----------------------------GSKKSAEALIRLQAMAS-----------

PF05505

NCAP_EBOZM/19-734TSNRTPTVAPPAPVYRDHSEKKEL......PQDE.....QQDQDHTQEARNQDSDNT.QSEHSFEEMYRHILRSQGPFDA
NCAP_MABVM/1-691SDNEQGVDLPPPPLYAQEKRQDPIQHPAANPQDPFGSIGDVNGDILEPIRSPSSPSAPQEDTRMREAYE...........

PF00973

NCAP_MEASA/1-524-----ISEEQ----------------------GSDTDTPIVYNDRNLL----------------------------
H8ZYX3_PPRV/1-524-----ILEDQ----------------------EEGEDNSQIYNDKDLL----------------------------
Q66412_9PARA/1-522-----LLENQ----------------------GPRDVTAHVYNDKDLL----------------------------
NCAP_CDVO/1-522-----MLSQP----------------------GTSEDNSPVYSDKELL----------------------------
NCAP_RINDR/1-524-----ILGDS----------------------TLGNDSLRAYNDKDIL----------------------------
F7IX94_9PARA/1-524-----ILEDP----------------------TLGNDSPRTYNDKDLL----------------------------
NCAP_PHODV/1-522-----ILNQS----------------------DTNGEVSPAHNDRDLL----------------------------
NCAP_MEASE/1-523-----ESRKN----------------------KAQTRTPLQCTMTEIF----------------------------
NCAP_RINDU/1-524-----ILEDS----------------------TFGNDSPRAYNDRDLL----------------------------

PF05505

NCAP_EBOZM/19-734VLYYHMMKDE......PVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAI
NCAP_MABVM/1-691.LSPDFTNDEDNQQNWPQRVVTKKGRTFLYPNDLLQTNPPESLITALVEEYQNPVSAKELQADWPDMSFDER.RHV

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window