Sequence alignment for CL0156

PF00973

NCAP_MEASA/1-524MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF
NCAP_PPRV/1-524MATLLKSLALFKRNKDKAPTASGSGGAIRGIKNVIIVPIPGDSSIITRSRLLDRLVRLAGDPDINGSKLTGVMISMLSLF
Q66412_9PARA/1-522MATLLRSLALFKRNKDRTPLIAGSGGAIRGIKHVIVVPVPGDSSIVTRSRLLDRLVRLAGDPYISGPKLTGVMISILSLF
NCAP_CDVO/1-522MASLLKSLTLFKRTRDQPPLASGSGGAIRGIKHVIIVLIPGDSSIVTRSRLLDRLVRLVGDPKINGPKLTGILISILSLF
NCAP_RINDR/1-524MASLLKSLALFKRAKDKPPLAAGSGGAIRGIKHVIVVPIPGDSSITTRSRLLDRLVKMVGDPDISGPKLTGALISILSLF
NCAP_RINDL/1-524MASLLKSLALFKKNKDKPPLAAGSGGAIRGIKHVIIVPIPGDSSITTRSRLLDCLVKMVGDPDISGPKLTGALISILSLF
NCAP_PHODV/1-522MASLLKSLSLFKKTREQPPLASGSGGAIRGIKHVIIVLIPGDSSIVTRSRLLDRLVRMVGDPEVSGPKLTGVLISILSLF
NCAP_MEASE/1-523MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF
NCAP_RINDU/1-524MASLLKSLALFKKNKDKPPLAAGSGGAIRGIKHVIIVPIPGDSSITTRSRLLDRLVKMVGDPDISGPKLTGALISILSLF

PF05505

NCAP_MABVM/1-692-------MDLHSL------LELGTKPTAPHVRNKKVILFDTNHQVSICNQIIDAI-----NSGIDLGDLLEGGLLTLCVE
NCAP_EBOZ5/19-734-------MDYHKI------LTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAF-----EAGVDFQESADSFLLMLCLH
NCAP_EBOSB/19-734-------LDYHKI------LTAGLSVQQGIVRQRVIPVYVVNDLEGICQHIIQAF-----EAGVDFQDNADSFLLLLCLH
NCAP_EBORR/19-734-------LDYHKI------LTAGLTVQQGIVRQKIISVYLVDNLEAMCQLVIQAF-----EAGIDFQENADSFLLMLCLH

PF00973

NCAP_MEASA/1-524VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADKYFSHDDPISSDQSRFGWFENKEISDIEVQDP
NCAP_PPRV/1-524VESPGQLIQRITDDPDVSIRLVEVVQSTRSQSGLTFASRGADLDNEADMYFSTEGPSSGSKKRINWFENREIIDIEVQDA
Q66412_9PARA/1-522VESPSQLIQRITDDPDVSIRLVEVIQSEKSLSGLTFASRGANMEDEADDYFSIQAGEEGDTRGTHWFENKEIVEIEVQDP
NCAP_CDVO/1-522VESPGQLIQRIIDDPDVSIKLVEVIPSINSACGLTFASRGASLDSEADEFFKIVDEGSKAQGQLGWLENKDIVDIEVDNA
NCAP_RINDR/1-524VESPGQLIQRITDDPDISIKLVEVVQSDKTQSGLTFASRGTSMDDEADRYFTYEEPNDGEERQSYWFENRDIQDIEIQDP
NCAP_RINDL/1-524VESPGQLIQRITDDPDISIKLVEVIQSDKTQSGLTFASRGASMDDEADRYFTYDEPNGGEERQSYWFENREIQDIEVQDP
NCAP_PHODV/1-522VESPGQLIQRIIDDPDISIKLVEVIPSINSTCGLTFASRGASLDAEADEFFGTMDEGSKDHNQMGWLENKDIIDIEVNDA
NCAP_MEASE/1-523VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSDQSRFGWFENKEISDIEVQDP
NCAP_RINDU/1-524VESPGQLIQRITDDPDISIKLVEVVQSDKTQSGLTFASRGTSMDDEADRYFTYDEPNDGEERQSYWFENREIQDIEVQDP

PF05505

NCAP_MABVM/1-692HYYNSD--KDKFNTSPVAKYL--------RDAGYEFDVIKNADATRFLDVSPNEPHYSPLILALKTLESTESQRGRI---
NCAP_EBOZ5/19-734HAYQGD--YKLFLESGAVKYL--------EGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANA---
NCAP_EBOSB/19-734HAYQGD--HRLFLKSDAVQYL--------EGHGFRFEVREKENVHRLDELLPNVTGGKNLRRTLAAMPEEETTEANA---
NCAP_EBORR/19-734HAYQGD--YKLFLESNAVQYL--------EGHGFKFELRKKDGVNRLEELLPAATSGKNIRRTLAALPEEETTEANA---

PF00973

NCAP_MEASA/1-524EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALIL--
NCAP_PPRV/1-524EEFNMLLASILAQVWILLAKAVTAPDTAADSELRRWVKYTQQRRVIGEFRLDKGWLDAVRNRIAEDLSLRRFMVSLIL--
Q66412_9PARA/1-522EEFNILLASILAQIWILLAKAVTAPDTAADSETRRWIKYTQQRRVVGEFRLDKGWLDAVRNRIAEDLSLRRFMVALIL--
NCAP_CDVO/1-522EQFNILLASILAQIWILLAKAVTAPDTAADSEMRRWIKYTQQRRVVGEFRMNKIWLDIVRNRIAEDLSLRRFMVALIL--
NCAP_RINDR/1-524EGFNMILATILAQIWILLAKAVTAPDTAAESELRRWVKYTQQRRVIGEFRLDKGWLDTVRNRVAEDLSLRRFMVALIL--
NCAP_RINDL/1-524EGFNMILATILAQIWILLAKAVTTPDTAADSELRRWVKYTQQRRVIGEFRLDKGWLDTVRNRIAEDLSLRRFMVALIL--
NCAP_PHODV/1-522EQFNILLASILAQIWILLAKAVTAPDTAADSEMRRWIKYTQQRRVIGEFRMNKIWLDIVRNRIAEDLSLRRFMVALIL--
NCAP_MEASE/1-523EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNIIAEDLSLRRFMVALIL--
NCAP_RINDU/1-524EGFNMILATILAQIWILLAKAVTAPDTAADSELRRWVKYTQQRRVIGEFKLDKGWLDTVRNRIAEDLSLRRFMVALIL--

PF05505

NCAP_MABVM/1-692-------GLFLSFCSLFLPKLVVGDRASIEKALRQVTVHQEQ----GIVTYPNHWLTTGHMKVIFGILRSSFILKFVLIH
NCAP_EBOZ5/19-734-------GQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQ----GLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIH
NCAP_EBOSB/19-734-------GQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQ----GLIQYPTSWQSVGHMMVIFRLMRTNFLIKFLLIH
NCAP_EBORR/19-734-------GQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQ----GLIQYPTAWQSVGHMMVIFRLMRTNFLIKYLLIH

PF00973

NCAP_MEASA/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLMNLYQQMGETAP
NCAP_PPRV/1-524-DIKRTPGNKPRIAEMICDIDN------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQLGEVAP
Q66412_9PARA/1-522-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTVESLMNLYQQMGETAP
NCAP_CDVO/1-522-DIKRSPGNKPRIAEMICDIDN------YIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTIESLMMLYQQMGETAP
NCAP_RINDR/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQMGELAP
NCAP_RINDL/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQMGELAP
NCAP_PHODV/1-522-DIKRSPGNKPRIAEMICDIDN------YIVEAGLASFILTIKFGIETMYPALGLHEFSGELTTIESLMVLYQQMGETAP
NCAP_MEASE/1-523-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTLESLMNLYQQMGKPAP
NCAP_RINDU/1-524-DIKRTPGNKPRIAEMICDIDT------YIVEAGLASFILTIKFGIETMYPALGLHEFAGELSTIESLMNLYQQMGELAP

PF05505

NCAP_MABVM/1-692QGVNLVTGHDAYDSIISNSVGQTRFSGLLIVKTVLEFILQKTDSGV-TLHPLVRTSKVKNEVASFKQALSNLARHGEYAP
NCAP_EBOZ5/19-734QGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGV-RLHPLARTAKVKNEVNSFKAALSSLAKHGEYAP
NCAP_EBOSB/19-734QGMHMVAGHDANDTVISNSVAQARFSGLLIVKTVLDHILQKTDLGV-RLHPLARTAKVKNEVSSFKAALGSLAKHGEYAP
NCAP_EBORR/19-734QGMHMVAGHDANDAVIANSVAQARFSGLLIVKTVLDHILQKTDQGV-RLHPLARTAKVRNEVNAFKAALSSLAKHGEYAP

PF00973

NCAP_MEASA/1-524YMVNLENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDA
NCAP_PPRV/1-524YMVILENSIQNKFSAGAYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSVIAAELGITAEEA
Q66412_9PARA/1-522YMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSSLAAELGITAEDA
NCAP_CDVO/1-522YMVILENSVQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSALAAELGITKEEA
NCAP_RINDR/1-524YMVILENSIQNKFSAGAYPLLWSYAMGIGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSNLASELGITEEEA
NCAP_RINDL/1-524YMVILENSIQNKFSAGAYPLLWSYAMGVGVELESSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSNLASELGITEEEA
NCAP_PHODV/1-522YMVILENSVQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTFAAEFGITKEEA
NCAP_MEASE/1-523YMVNLENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDA
NCAP_RINDU/1-524YMVILENSIQNKFSAGAYPLLWSYAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSNLASELGITEEEA

PF05505

NCAP_MABVM/1-692FARVLNLSGINNLEHGLYPQLSAIALGVATAHGSTLAGVNVGEQY--QQLREAAHDAEVKLQRRHEHQEIQAIAEDDEER
NCAP_EBOZ5/19-734FARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQY--QQLREAATEAEKQLQQYAESRELDHLGLDDQEK
NCAP_EBOSB/19-734FARLLNLSGVNNLEHGLYPQLSAIALGVATAHGSTLAGVNVGEQY--QQLREAATEAEKQLQQYAETRELDNLGLDEQEK
NCAP_EBORR/19-734FARLLNLSGVNNLEHGLYPQLSAIALGVATAHGSTLAGVNVGEQY--QQLREAATEAEKQLQQYAESRELDSLGLDDQER

PF00973

NCAP_MEASA/1-524RLVSEIAMHTTE--------------DKISRAVGP-----------RQAQVSFLHGDQSENELPRLGGKEDRRVKQSRGE
NCAP_PPRV/1-524KLVSEIASQTGD--------------ERTVRGTGP-----------RQAQVSFLQHKTDEGESPTPATREEVKAAIPNGS
Q66412_9PARA/1-522KLVSEIAAQAND--------------DRANRAIGP-----------KQNQISFLHPDRGDASTPGNILRANEGDGSTRMK
NCAP_CDVO/1-522QLVSEIASKTTE--------------DRTIRATGP-----------KQSQITFLHSERSEVANQQPPTINKRSENQGGDK
NCAP_RINDR/1-524RLVSEIAAYTSD--------------DRNNRTSGP-----------KQAQVSFLRTDQGSEAQHSASKKDEARAPQVKKE
NCAP_RINDL/1-524KLVSEIAAYTGD--------------DRNSRTSGP-----------KQTQVSFLRTDQGGEIQHNASKKDEARVLQVRKE
NCAP_PHODV/1-522QLVSEIVSRTTE--------------DRTTRATGP-----------KQSQITFLHSERNEAPNQRLPPITMKSEFQGGDK
NCAP_MEASE/1-523RLVSEIAMHTTE--------------DKISRAVGP-----------RQAQVSFLQGDQSENELPRLGGKEDRRVKQSRGE
NCAP_RINDU/1-524RLVSEIAAYTGD--------------DRNNRTSGP-----------KQAQVSFLRTDQGGETQNNASKRDEARAPQIRKE

PF05505

NCAP_MABVM/1-692KILEQFHLQKTEITHSQTLAVLSQKREKLARLAAEIENNIVEDQGFKQSQNRVSQSFLND.....PTPVEVTVQARPMN.
NCAP_EBOZ5/19-734KILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAIT.........AASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDD
NCAP_EBOSB/19-734KILMSFHQKKNEISFQQTNAMVTLRKERLAKLTEAIT.........TASKIKVGDRYPDDNDIPFPGPIYDDTHPNPSDD
NCAP_EBORR/19-734RILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAIT.........LASRPNLGSRQDDGNEIPFPGPISNNPDQDHLED

PF00973

NCAP_MEASA/1-524ARESYRETGPSRASDARAAHLPTG----------TPLDIDTASESSQDPQDSR---------------------------
NCAP_PPRV/1-524EGRDTKRTRSGKPRGETPGQLLPE----------IMQEDELSRESSQNPREAQ---------------------------
Q66412_9PARA/1-522.RGGNIATPKGTSIDQTSTTLSKD----------T.LDIDEQSDNTDDPISIQ---------------------------
NCAP_CDVO/1-522YPIHFSDERLPGYTPDVNSSEWSE----------SRYDTQIIQDDGND..DDR---------------------------
NCAP_RINDR/1-524TRTSSKSDKHKEGTDKEPVSSSAM----------TLIDVDTTLEADTDPLESK---------------------------
NCAP_RINDL/1-524TWASSRSDRYKEDTDNEAVSPSVK----------TLIDVDTTPEADTDPLGNK---------------------------
NCAP_PHODV/1-522YSNQLIDDRLSGYTSDVQSSEWDE----------SRQITQLTQEGDHD..NDQ---------------------------
NCAP_MEASE/1-523ARESYRETGPSRASDARAAHLPTG----------TPLDIDTASESSQDPQDSR---------------------------
NCAP_RINDU/1-524ARTSSKSDKYKEDTDKEPMSPSVK----------TLIDVDTTPEVDTDPLGSK---------------------------

PF05505

NCAP_MABVM/1-692.....RPTALPPPVDDKIEHESTEDSSSSSSFVDLNDPFALLNEDEDTLDDSVMIP..............GTTSREFQGI
NCAP_EBOZ5/19-734DPTDSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDEDD.EDTKPVPNRSTKGGQQKNSQKGQHTEGRQTQ
NCAP_EBOSB/19-734NPDDSRDTTIPGGVVDPYDDESNNYPDYEDSAEGTTGDLDLFNLDDDD.DDSRPGPPDRGQNKERAARTYGLQDPTLDGA
NCAP_EBORR/19-734DPRDSRDTIIPNGAIDPEDGDFENYNGYHDDEVGTAGDLVLFDLDDHE.DDNKAFE.......PQDSSPQSQREIERERL

PF00973

NCAP_MEASA/1-524--------------------------------------------RSADALLRLQAMAGISEEQGSDTDT-----------
NCAP_PPRV/1-524--------------------------------------------RSAEALFRLQAMAKILEDQEEGEDN-----------
Q66412_9PARA/1-522--------------------------------------------KSAEALAKMRAMAKLLENQGPRDVT-----------
NCAP_CDVO/1-522--------------------------------------------KSMEAIAKMRMLTKMLSQPGTSEDN-----------
NCAP_RINDR/1-524--------------------------------------------KSAEALLRLQAMAGILGDSTLGNDS-----------
NCAP_RINDL/1-524--------------------------------------------KSAEALLKLQAMASILEDPTLGNDS-----------
NCAP_PHODV/1-522--------------------------------------------QSMDGLAKMRQLTKILNQSDTNGEV-----------
NCAP_MEASE/1-523--------------------------------------------RSAEPLLSCKPWQ.ESRKNKAQTRT-----------
NCAP_RINDU/1-524--------------------------------------------KSAEALIRLQAMASILEDSTFGNDS-----------

PF05505

NCAP_MABVM/1-692PEPP............RQSQDLNNSQGKQEDESTN.........RIKKQFLRYQELPPVQEDDESEYTTDSQ.......E
NCAP_EBOZ5/19-734SRPTQNVPGPHRTIH.HASAPLTDNDRRNE..............PSGSTSPRM..LTPINEEADPLDDADDETSSLPPLE
NCAP_EBOSB/19-734KKVPELTPGSHQPGNLHITKSGSNTNQ.................PQGNMSSTLHSMTPIQEESEPDDQKDNDDESLTSLD
NCAP_EBORR/19-734IHPP...PGNNKDDN.RAS....DNNQQSADSEEQGGQYNWHRGPERTTANRR..LSPVHEEDTLMDQGDDDPSSLPPLE

PF00973

NCAP_MEASA/1-524--------------------------PIVYND------------------------------------------------
NCAP_PPRV/1-524--------------------------SQIYND------------------------------------------------
Q66412_9PARA/1-522--------------------------AHVYND------------------------------------------------
NCAP_CDVO/1-522--------------------------SPVYSD------------------------------------------------
NCAP_RINDR/1-524--------------------------LRAYND------------------------------------------------
NCAP_RINDL/1-524--------------------------PRTYND------------------------------------------------
NCAP_PHODV/1-522--------------------------SPAHND------------------------------------------------
NCAP_MEASE/1-523--------------------------PLQCTM------------------------------------------------
NCAP_RINDU/1-524--------------------------PRAYND------------------------------------------------

PF05505

NCAP_MABVM/1-692SIDQPGSDNEQGVDL.........PPPPLYAQEKRQDPIQHPAANPQDPFGSIGDVNGDILEPIRSPSSPSAPQEDTRMR
NCAP_EBOZ5/19-734SDDE.....EQDRDGTSNRTPTVAPPAPVYRDHSEKRELPQDEQQDQDHTQEARNQDSD.......NTQPEHSFEEMYRH
NCAP_EBOSB/19-734SEGD.....EDGESISEENTPTVAPPAPVYKD....TGVDTNQQNGPSSTVDSQGSESEALP...INSKKSSALEETYYH
NCAP_EBORR/19-734SDDDDASSSQQDPDYTA.....VAPPAPVYRS.AEAHEPPHKSSNEPAETSQL.NEDPDI.....GQSKSMQKLEETYHH

PF00973

NCAP_MEASA/1-524------------------------------------------------RNLL----------------------------
NCAP_PPRV/1-524------------------------------------------------KDLL----------------------------
Q66412_9PARA/1-522------------------------------------------------KDLL----------------------------
NCAP_CDVO/1-522------------------------------------------------KELL----------------------------
NCAP_RINDR/1-524------------------------------------------------KDIL----------------------------
NCAP_RINDL/1-524------------------------------------------------KDLL----------------------------
NCAP_PHODV/1-522------------------------------------------------RDLL----------------------------
NCAP_MEASE/1-523------------------------------------------------TEIF----------------------------
NCAP_RINDU/1-524------------------------------------------------RDLL----------------------------

PF05505

NCAP_MABVM/1-692EAYELSP.DFTNDEDNQQNWPQRVVTKKGRTFLYPNDLLQTNPPESLITALVEEYQNPVSAKELQADWPDMSFDERRHVA
NCAP_EBOZ5/19-734ILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAI
NCAP_EBOSB/19-734LLKTQGPFEAINYYHLMSDEPIAFSTESGKEYIFPDSLEEAYPPWLSEKEALEKENRYLVIDGQQFLWPVMSLRDKFLAV
NCAP_EBORR/19-734LLRTQGPFEAINYYHMMKDEPVIFSTDDGKEYTYPDSLEEAYPPWLTEKERLDKENRYIYINNQQFFWPVMSPRDKFLAI

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window