Sequence alignment for CL0158

PF01522

NODB_AZOC5/9-134-----RITQNQSSIYITF----DD------------------------------GP........................
Q9A5L9_CAUCR/35-168-----KVALERPMVSFSF----DD------------------------------AP........................
O69838_STRCO/70-214-----GGTKDGKPVALTF----DA------------------------------DMTADQGP..................
Q9XAP6_STRCO/96-224-----TVSVPDKTIVLTF----DD------------------------------GP........................
CDA2_YEAST/112-232-----DDVYTCSKLSQTF----DD------------------------------GP........................
Q98GK8_RHILO/808-946-----RQPFVGRPVLITF----DD------------------------------GF........................
ICAB_STAEQ/107-248-----KGKFPKRSVWINF----DD------------------------------MD........................
Q97ET9_CLOAB/86-214-----KRTDNKKVAYLTF----DD------------------------------GP........................
YHEN_BACSU/79-203-----KQNMGDKTVYLTF----DD------------------------------GP........................
Q9CHP6_LACLA/96-236-----KKEVIGKAVVITF----DD------------------------------ID........................
Q9RVF2_DEIRA/33-157-----EGRRARREVALTF----DD------------------------------GP........................
Q982X7_RHILO/88-291-----AGGKGGRFATITA----DD------------------------------AY........................
Q97K82_CLOAB/62-192-----SNTKTEKTAYLTF----DD------------------------------GP........................
O53444_MYCTU/41-164-----LSCSVIKCVALTF----DD------------------------------GP........................
PDAA_BACSU/60-185-----LGNTKEKTIYLTF----DN------------------------------GY........................
Q985U0_RHILO/77-213-----PAASGAGRVALTL----DA------------------------------CD........................
Q9WXW8_THEMA/27-151-----GEENGVKLVALTF----DD------------------------------GP........................
P73597_SYNY3/44-199-----DNIRLPISLSLMF----ET------------------------------GSQPAKGAPTPFGNFTPPPDYYDMPT
Q9L1T3_STRCO/85-207-----SLSVPDHRLVLTF----DD------------------------------GP........................
Q9A6E1_CAUCR/17-152-----AYAADKPVIAVTW----DD------------------------------LPAHSAL...................
Q97TP4_CLOAB/83-210-----KAPMPKKPVMLTF----DD------------------------------CT........................
Q97JC7_CLOAB/83-211-----KREDGKKVAYLTF----DD------------------------------GP........................
Q9X8Z4_STRCO/86-212-----ASDAGPNGVNITI----DD------------------------------GP........................
Q9KEF7_BACHD/63-188-----IGDTSRKELYLTF----DN------------------------------GY........................
Q9PF00_XYLFA/74-213-----RGERSGKVMVVTL----DD------------------------------GY........................
Q97LW8_CLOAB/106-234-----GKKVPKKSVLITF----DD------------------------------GY........................
Q9KEJ5_BACHD/75-214-----KLDTKEQVIALTL----DA------------------------------CGGP......................
Q9CCZ2_MYCLE/73-201-----KIPGRGDLLALTV----DD------------------------------GV........................
Q9KBK9_BACHD/74-199-----AGPTTANRIALTF----DD------------------------------GP........................
Q9KSH6_VIBCH/26-172-----ANSTPKGTIYLTF----DD------------------------------GP........................
Q9P9U2_XYLFA/249-384-----GNELPPKTLVLTF----DD------------------------------GP........................
Q9FBM6_STRCO/131-288-----GRTPGPRTVHLTF----DD------------------------------GT........................
Q9RV08_DEIRA/33-148-----GAGTAADRVALTF----DD------------------------------GP........................
Y4760_STRCO/62-184-----HVRTDDPVVFLTY----DD------------------------------GA........................
Q983K0_RHILO/61-197-----PAHGADRIIYLTF----DD------------------------------GP........................
Q97MV1_CLOAB/82-216-----YKNDGKKIAYLTF----DD------------------------------GP........................
Q9K630_BACHD/116-243-----DGTHDKKIVYLTF----DD------------------------------GP........................
Q9R7V4_YERPE/101-271-----GPTLPDKAVLLTF----DD------------------------------GY........................
Q9ZBN1_STRCO/59-183-----VDCAHTKCIALTF----DA------------------------------GP........................
Q9PAV0_XYLFA/97-222-----QLDSTPPLVWLTI----DD------------------------------GP........................
Q9KDB2_BACHD/39-162-----HVATNEPVIALTF----DD------------------------------GP........................
Q9KA84_BACHD/124-248-----RGNPEKPMVTLLV----NV------------------------------AW........................
Q9KVA7_VIBCH/402-543-----RLQPGKRFIIITV----DD------------------------------GY........................
PDAB_BACSU/51-176-----KGETDSKDISLTF----DI------------------------------SW........................
NODB_RHILO/15-140-----ADGTGRRSVYLTF----DD------------------------------GP........................
NODB_RHIME/15-140-----DYGTEDRSIYLTF----DD------------------------------GP........................
Q9EWZ7_STRCO/52-176-----AGRGSPGHVALTF----DD------------------------------GP........................
Q9PDB0_XYLFA/55-223-----GQPVPRKSIVITF----DD------------------------------GY........................
YXKH_BACSU/113-240-----DKKPSEKCVLITF----DD------------------------------GY........................
Q97DU4_CLOAB/83-214-----QKNNPKKTAYLTF----DD------------------------------GP........................
Q9JWQ7_BACHD/50-175-----KAETDEKVAALTF----NI------------------------------SW........................
Q9KYG2_STRCO/47-184-----ARGGGGDLVGLTF----DD------------------------------GY........................
YADE_ECOLI/226-368-----KINLPARAVVITF----DD------------------------------GL........................
CDA1_YEAST/102-222-----DDVTSCFKLSQTF----DD------------------------------GP........................
PDAC_BACSU/272-393-----TVDPNQKVIALTF----DD------------------------------GP........................
Q97GQ0_CLOAB/126-253-----KKPFSIKPILITF----DD------------------------------GY........................
Q9CJ95_LACLA/136-266-----KEKPSDKMVWLTF----DD------------------------------GS........................
Q97EU7_CLOAB/97-223-----IGDSSKKVIYLTF----DE------------------------------GY........................
Q99Z68_STRP1/235-356-----KEQHPKKLVALTF----DD------------------------------GP........................
NODB_RHISN/12-137-----RSGTGAPSVYLTF----DD------------------------------GP........................
Q9RCX4_STRCO/8-132-----RMTGRGRTMLLTF----DD------------------------------GP........................
PGAB_ECOLI/101-271-----GKPLPEKAVVLTF----DD------------------------------GY........................
CDA1_SCHPO/63-190-----NRPVRERSIESCF----EY------------------------------GS........................
Q99ZT1_STRP1/154-283-----NELPAKKVVWLTF----DD------------------------------SM........................
O86800_STRCO/103-225-----TVPTKEKVVFLTI----DD------------------------------GA........................
Q97GI4_CLOAB/50-174-----SVDTKDKKIAITF----DS------------------------------NW........................
Q97M42_CLOAB/8-133-----FPDGKFKVLTMSY----DD------------------------------GK........................
Q9CIS3_LACLA/170-291-----NQYANKKLIALTF----DD------------------------------GP........................
B3PIN1_CELJU/396-514-----....CSGYVGITF----DD------------------------------GP........................
D8Q165_SCHCM/200-314-----.......HWGVSF----DD------------------------------GP........................
E6UBP6_RUMA7/470-592-----..DKDKPMVAIAF----DD------------------------------GASA......................
F4GY46_CELFA/213-331-----....TGDVSALTF----DD------------------------------GP........................
F4H710_CELFA/356-474-----.....AGYVGLTF----DD------------------------------GP........................
Q326Y8_SHIDS/46-204-----.GKLPRKSVMLTF----DD------------------------------GY........................
Q7AQ13_MYCLE/46-161-----.....VKCIALTF----DD------------------------------GP........................
Q81Z49_BACAN/63-186-----.GDTKKKDIYLTF----DN------------------------------GY........................
PGDA_STRR6/264-377-----..KKHQKVVALTF----DD------------------------------GP........................
Q9RKN7_STRCO/46-161-----......GYVGLTF----DD------------------------------GP........................
ICAB_STAA8/109-248-----.GKFPKRSVWINF----DD------------------------------MD........................
S2JG56_MUCC1/153-273-----..CPEPETWGLTY----DD------------------------------GP........................

PF03065

AMY1_DICT6/8-294-----SLGIHNHQP....----...............................VGN------------------------
O66934_AQUAE/7-429-----VFWWHMHQPLYRE----PY.......TGEYLLPWTFFH...........AV------------------------
Q8TZQ1_PYRFU/35-537-----IIVWHQHQPYYYD----PV.......QGIYTRPWVRLH...........AA------------------------
MALQ_THEKO/7-291-----IFGIHNHQPL...----................................GN------------------------
Q9HLU6_THEAC/262-747-----AIIYNDHQPLYKI----VG.......SNNYVLPWTEVH...........AT------------------------
Q8ZT36_PYRAE/22-486-----IFIFHNHQPWYLD----FS.......KNELALPWVRMH...........AV------------------------
I6TXK5_9EURY/6-395-----TFVLHSHIPYVRK----HG.KWPFGEEWVFEA.................IA------------------------
Q8YXA5_NOSS1/8-473-----AFIWHQHQPLYKS----PGSSLSTPSSQQYRLPWVRLH...........GT------------------------
F7URR6_SYNYG/8-468-----AFVWHQHQPCYQS----YG..MVGNGHGYYQLPWVRLH...........GT------------------------
Q97BM4_THEVO/7-311-----YFEIHQPFRLRPT----NL........YDVKSEQNVFWDEKNEEIFRRVAE------------------------
AMYA_PYRHO/7-291-----IFGVHNHQPL...----................................GN------------------------
O58106_PYRHO/3-316-----ALIFHGNLQYAEI----PKHEISKV........................IE------------------------
AMYA_METJA/6-319-----NFEVHQPHRLNKE----IN.......QNGNTLWEKYVDTKLNKEVFNKVAN------------------------
Q9KD04_BACHD/7-382-----SLVLHAHLPYVRH----QE.EDRLEERWLFEA.................MS------------------------
Q8TIT8_METAC/38-312-----NHIFSRLLK....----................................TG------------------------
D4G9W5_TREPC/12-351-----AFAAKLTEACVQS----LHAEH...........................DP------------------------
Q9HL91_THEAC/8-289-----VF...........----....................WEEKNEEIFKRIAA------------------------
Q8ZT57_PYRAE/6-321-----FFEVHQPRRLRPD----LY.....RVFPRRPGDLDVFYDELNEHIFRRVAE------------------------
Q8TIT9_METAC/7-321-----YFQVHQPFRLRRF----WP........DDRSGFFRYFDERSNKEIFERVSR------------------------
O50094_PYRHO/6-394-----TFVLHTHIPYVRK----HG.KWPFGEEWLFEA.................MA------------------------
Q973T0_SULTO/7-324-----GFEVHQPFRIRRN----YF....WDPVIRGGPLTKYFDDNLNREIFERVKN------------------------
D0KTV8_SULS9/7-324-----GFEVHQPFRIRRD----FF....WNPRFRQKLEDRFFDTERNKEIFERIKK------------------------

PF01074

MA2A1_MOUSE/166-496QVFVVPHSHNDPGWLKTF----NDY.........FRD-----------------KT------------------------
MA2A2_HUMAN/167-497QVFVVPHSHNDPGWIKTF----DKY.........YTE-----------------QT------------------------
MANA_DICDI/43-353NVHIVAHTHDDVGWLKTV----DEYYYGS.NMSIAFA-----------------GV------------------------
MA2B1_HUMAN/64-381NVHLLPHTHDDVGWLKTV----DQYFYGI.KNDIQHA-----------------GV------------------------
O01574_CAEEL/138-459KVYVLPFTHVDPGWLETF----ERY..........TK-----------------ST------------------------
MA2B2_MOUSE/28-351RAFVVPHSHMDVGWVFTV----QES.........MRA-----------------YA------------------------
MA2C1_RAT/251-510TIHATGHCHIDTAWLWPF----KET..........VR-----------------KC------------------------
MAN1_YEAST/290-559NVYGIGNCHIDTAWLWPF----AET..........RR-----------------KI------------------------
P94078_ARATH/39-350NVHLVPHSHDDVGWLKTV----DQYYVGS.NNSIRGA-----------------CV------------------------
Q20829_CAEEL/37-351TAHLIPHTHDDLGWIKTV----DQYFWGA.KPELVPV-----------------GV------------------------
MAN2_DROME/145-471KVFVVPHSHNDPGWIQTF----EEY.........YQH-----------------DT------------------------
MA2B2_PIG/28-342KVFVVPHSHMDVGWLHTV----QES.........MQV-----------------YV------------------------
Q55528_SYNY3/232-495QINLLGHAHLDMAWLWQL----EET..........WE-----------------VG------------------------
Q7NPH5_GLOVI/217-477TIALLGHSHIDMAWLWTV----PET..........KE-----------------VI------------------------
Q7PMM6_ANOGA/166-493HVFVVPHSHNDPGWIQTF----DEY.........YER-----------------ST------------------------
Q7S1L0_NEUCR/285-549LVFGIGHCHIDSCWLWPW----DET..........KR-----------------KV------------------------
Q7U9I9_SYNPX/234-492AVHWFGHAHLDLAWLWTV----ADT..........WQ-----------------AA------------------------
Q7V4V0_PROMM/221-479LIHWIGHAHLDLAWLWSV----ADT..........WQ-----------------AA------------------------
Q826B6_STRAW/254-513HISAVGHAHIDSAWLWPL----RET..........VR-----------------KV------------------------
Q82MA7_STRAW/254-513TLSGVGHAHIDSAWLWPI----RET..........KR-----------------KT------------------------
Q8A5X3_BACTN/297-572TVYLVQHTHTDIGYTKPQ----TEILS......EHLR-----------------YI------------------------
Q8DM33_THEEB/217-475TIHLCGHAHLDLAWLWPI----AET..........WQ-----------------VA------------------------
Q8G4P9_BIFLO/264-528TLTAMGHSHIDSAWLWPV----RET..........ER-----------------KV------------------------
Q8G4Q0_BIFLO/268-532NHIAIGHAHIDSAWLWPV----RET..........RR-----------------KV------------------------
Q8G4Q1_BIFLO/267-531NVSAIGHAHIDSAWLWPV----RET..........RR-----------------KV------------------------
Q8IPB7_DROME/48-364NVHLVAHTHDDVGWLKTV----DQYYYGS.ETKIQKA-----------------GV------------------------
Q8LPJ3_ARATH/38-350NVHVVPHSHDDVGWLKTV----DQYYVGS.NNSIQVA-----------------CV------------------------
Q8XIN5_CLOPE/235-510VATCVGHTHIDVAWLWTV----AQT..........RE-----------------KV------------------------
Q8XM34_CLOPE/260-519SVSAIGHAHIDLAWLWPI----RET..........IR-----------------KG------------------------
Q8Y5P1_LISMO/243-513KVAAVGHTHIDVAWLWRL----KHT..........RE-----------------KA------------------------
Q8Y9W8_LISMO/5-267KVHVIPHSHWDREWYFTS----SRS..........TI-----------------YL------------------------
Q8YYK0_NOSS1/230-491KIYLLGHAHLDLAWLWPV----SET..........WN-----------------AA------------------------
Q97UK5_SULSO/220-473VLVGTGHAHIDTAWLWPF----DET..........RR-----------------KV------------------------
Q9FKW9_ARATH/48-359NVHLVPHSHDDVGWLKTV----DQYYVGS.NNRIQNA-----------------CV------------------------
Q9KEQ8_BACHD/237-511HIHAIGHSHIDLAWLWQT----KHT..........KE-----------------KA------------------------
Q9LFR0_ARATH/154-493KIFVVPHSHNDPGWKLTV----EEY.........YQR-----------------QS------------------------
MAN1_SCHPO/282-549NVFAIGHCHIDTAWLWPF----AET..........RR-----------------KI------------------------
Q9VLI0_DROME/38-352NIHLVPHSHDDVGWLKTV----DQYYYGH.RNNIQHA-----------------GV------------------------
Q9X2G6_THEMA/247-507TIHLVGHAHIDYAWLWPV----EET..........KR-----------------KI------------------------
B2HSI3_MYCMM/98-400TMFMVSHFHYDPVWWNTQ----GAYTSQWHEDPPGRA-----------------RQ------------------------
C8VJ45_EMENI/284-549.VYGIGHCHIDTCWLWPW----AET..........KR-----------------KV------------------------
H9JRV7_BOMMO/33-353KVIVVPHSHNDPGWLKTF----EHY.........FEW-----------------KT------------------------
Q9VF33_DROME/169-499KIIVVPHSHNDPGWLKTF----TNY.........FQS-----------------DS------------------------
Q9VLH9_DROME/39-352NIHMVPHSHDDVGWLKTV----DQYFYGH.RSNIQHA-----------------GV------------------------
Q9VLI2_DROME/38-351NIHLVPHSHDDLGWLKTV----DQYYYGN.KHNIQHA-----------------GV------------------------

PF10096

Q18AM8_PEPD6/233-467RIFVRIEDV.HA.....F----.R------------------------------EP------------------------
M1UCJ4_BACIU/208-474LLYLRLEDI.SP.....M----.S------------------------------DE------------------------
Q5JH22_THEKO/56-259RLVILVHDV.SP......----.V------------------------------YL------------------------
A9AA29_METM6/35-240EPIILIHDV.SP......----.V------------------------------YL------------------------
A6VGM2_METM7/35-240EPIILIHDV.SP......----.V------------------------------YL------------------------
Q6LXR4_METMP/34-239EPVILIHDV.SP......----.V------------------------------YL------------------------
A4FWP9_METM5/37-242EPIILIHDV.SP......----.V------------------------------YL------------------------
A6UV77_META3/44-251KPIILVHDV.SP......----.A------------------------------YF------------------------
Q7MSW5_WOLSU/4-254RYIVRLDDA.CA.....T----.M------------------------------DR------------------------
B2TDN6_BURPP/5-202KFILRFDDI.TP.....E----.M------------------------------AW------------------------
Q391U9_BURS3/257-532RALVRLEDL.DA.....Y----.T------------------------------TT------------------------
Q39N31_BURS3/258-533RAMVRLEDV.NA.....F----.T------------------------------TT------------------------
A3S0S8_RALSL/270-567RAMVRFEDM.NA.....Y----.T------------------------------ST------------------------
A3RWP7_RALSL/288-565RALIRLEDV.DA.....L----.V------------------------------SV------------------------
B7WV25_COMTE/256-530KAMVRLEDV.SA.....L----.V------------------------------SV------------------------
A1WAM2_ACISJ/315-589QAMMRFEDA.DA.....K----.V------------------------------NP------------------------
Q1AST7_RUBXD/238-462RAVIRLEDV.SV.....H----.V------------------------------PP------------------------
Q1IXI2_DEIGD/311-556QAILRLEDI.SP.....T----.G------------------------------NP------------------------
Q0SST1_CLOPS/180-429KGIIRFEDVASTGTGTEY----DS------------------------------QY------------------------
Q8XK74_CLOPE/180-429KGIIRFEDVASTGAGTEY----DS------------------------------QY------------------------
A5I018_CLOBH/188-437PAFVRLEDI.TSNQRYKT----PE------------------------------EL------------------------
A7GBL6_CLOBL/187-436PAFVRLEDI.TSNQRYKT----PE------------------------------AL------------------------
A6LXX4_CLOB8/129-377VSLIRFEDI.TAGGKYLD----SD------------------------------NL------------------------
A6LS62_CLOB8/199-444IGLIRFEDF.GCGYTNVV----DK------------------------------NQ------------------------
A6LXK7_CLOB8/199-442VALIRLEDF.GCGGNYSS----DK------------------------------NQ------------------------
Q0SV96_CLOPS/198-445AALIRIEDV.SAGGVFSE----DN------------------------------NM------------------------
A5D0J0_PELTS/44-299AALVRLEDV.SPGVYDSA----.D------------------------------KL------------------------
Q897A5_CLOTE/246-480KIFLRIEDL.HP.....L----.R------------------------------DV------------------------
A7GCY7_CLOBL/229-463KVFIRIEDV.HP.....L----.I------------------------------DI------------------------
Q65D17_BACLD/215-481LLYLRLEDI.SP.....M----.S------------------------------DE------------------------
A7Z1H4_BACA2/214-480LLYLRLEDI.SP.....M----.S------------------------------DE------------------------
A8FA31_BACP2/214-479TKYLMLGNI.SP.....A----.S------------------------------DE------------------------
A9VQC2_BACWK/212-474SAYLRLEDV.HP.....A----.V------------------------------DV------------------------
Q3EJ39_BACTI/132-394LAYLRLEDV.HP.....A----.A------------------------------DT------------------------
A3IBG5_9BACI/196-373PAYIVVSDINMK......----.T------------------------------DV------------------------
Q1WTJ8_LACS1/90-295RPLLVINNV.TP.....T----.S------------------------------NL------------------------
A0A037ZQ94_ENTFL/224-427RPFLTISDF.NP.....L----.R------------------------------DM------------------------
Q03HA5_PEDPA/224-420KPLLTITDV.SP.....Y----.S------------------------------NL------------------------
A6M167_CLOB8/134-348ETYLYLDNV.TP.....F----.N------------------------------DL------------------------
A0AFX4_LISW6/211-439NQYVLIKDI.NP.....F----.V------------------------------DF------------------------

PF15421

Q8A8I5_BACTN/62-500AEIIIHTKKEIQTKDINV----EIPHLKYNKTWMLMLTQDDCMQAAFCRTWAAINGKPISSSIPYPTPTPTDQNMKHQLY
Q5LDR1_BACFN/50-470AEITIKTNSTINLELLDV----YFAPLKYNKHLLIMLTQDDCKPSIYPRTWASINGKPLSG................QYY
D4IMW2_9BACT/39-464AEIALSFGPGTDLSAAHI----EIPPLKYNKSLLLLLTQDDCKQAAFSTTWAAINGRPLSD................TYF
R5UTM0_9PORP/51-471VEMVIQTKAGINMEQVKV----EIPPLKYNKSWLFILSQDDCKQASYCCTWAALNGRPLSK................KYY
R6DLU9_9BACE/67-497.DITIHLKKDRQVSGLNA----EIPPLKYNKEWLFMLTQDDCVQSAFCNTWAAIHGRPLSD................NYF

PF03746

D7BG02_MEISD/3-241MDLNADAGESFGSW..KL.G..ND--------------------------------------------------------
W5XZK8_9CORY/7-245FDLNADLGESFGAY..SV.G..ND--------------------------------------------------------
D5QFG9_KOMHA/3-241IDLNSDMGEGFGRW..RI.A..DD--------------------------------------------------------
Q6LSN4_PHOPR/2-250.KLNCDMGESYGLW..QM.G..ND--------------------------------------------------------
I0JJ59_HALH3/4-242VDINCDMGESFGTY..TK.G..RD--------------------------------------------------------
F4C1I4_SPHS2/4-242IDINCDVGESFGAY..TL.P..EQ--------------------------------------------------------
Q2RU90_RHORT/5-243VNVNADLGEGYGAY..RI.G..DD--------------------------------------------------------
D5MN08_9BACT/6-243VDLNSDVGESFGVW..TR.G..ND--------------------------------------------------------
R5XP92_9FIRM/4-242VDLNSDLGESFGNY..TI.G..ND--------------------------------------------------------
L7WC11_NONDD/4-237IDLNCDLGE..........GMKND--------------------------------------------------------
D6Y0B4_BACIE/3-241VDINADLGERFGVY..DL.G..DD--------------------------------------------------------
D5BG15_ZUNPS/4-236IDINCDLGEGGD..........YD--------------------------------------------------------
M3DE22_SPHMS/8-244VHINVDLGEGYGNF..KA.GP..D--------------------------------------------------------
D5EDK5_AMICL/4-242VDLNSDLGESFGVY..VL.G..HD--------------------------------------------------------
G8S4N9_ACTS5/10-248VDLNADLGEGFGAW..RL.G..DD--------------------------------------------------------
F5XPT6_MICPN/6-244IDLNSDLGEGFGTW..RL.G..DD--------------------------------------------------------
Y1143_NATTJ/4-242IDLNCDMGESFGHY..KI.G..CD--------------------------------------------------------
F5XTC9_MICPN/4-241IDLVADLGESFGAW..SM.G..ED--------------------------------------------------------
R5E047_9CLOT/3-241IDLNCDLGESFGNY..VI.G..MD--------------------------------------------------------
E3H7Y1_ILYPC/4-242VDLNSDLGESFGNY..KI.G..MD--------------------------------------------------------
D0IYS7_COMT2/4-242MDLNSDLGESFGAW..RM.G..DD--------------------------------------------------------
Y1384_PEPD6/4-242VDLNSDLGESFGTY..KI.G..LD--------------------------------------------------------
Q4FSQ9_PSYA2/3-236IDLNADVAEG.......C.G..QD--------------------------------------------------------
L0DCE0_SINAD/9-227IDLNADLGE..........GFPND--------------------------------------------------------
E6SM88_THEM7/5-243IDLNCDLGESFGAY..TI.G..MD--------------------------------------------------------
Y2112_KOCRD/4-242MDLNSDVGEPFGAW..GM.G..DD--------------------------------------------------------
A5DMJ6_PICGU/30-269.EINCDMGEGFGPW..KM.GP..D--------------------------------------------------------
A2U3P8_9FLAO/3-236VDINCDVGEGVA..........NE--------------------------------------------------------
B1ZX56_OPITP/4-232LDLNCDLGEG.......G.A..HD--------------------------------------------------------
Y2917_PSESM/3-241IDLNADLGEGFGAW..TM.G..ED--------------------------------------------------------
U4KC78_9VIBR/2-236ININSDMGEGFGIY..KL.GD..D--------------------------------------------------------
R9VRL9_9ENTR/3-236IDLNADLGEG.......C.G..ND--------------------------------------------------------
F5YAB0_TREAZ/4-242VDLNCDLGESFGAW..KM.G..MD--------------------------------------------------------
G3B4G0_CANTC/32-271.EINCDMGEGFGPW..KM.GP..D--------------------------------------------------------
S5XZQ9_PARAH/1-238MDLNSDMGEAFGAW..QM.G..DD--------------------------------------------------------
C5CZ15_VARPS/3-236IDLNADLGEG.......A.G..SD--------------------------------------------------------
D1C8S7_SPHTD/5-240MDINSDMGESFGRY..TI.GN..D--------------------------------------------------------
B4EWE9_PROMH/5-242VDLNSDLGESFGQW..RM.G..ND--------------------------------------------------------
E8NF87_MICTS/3-240VDLNADLGETVDGM..PT.A..DD--------------------------------------------------------
Q1IXD6_DEIGD/5-238IDLNADLGE..........GSPHE--------------------------------------------------------
Y1821_BACHD/4-242VDLNSDLGESFGAY..TI.G..QD--------------------------------------------------------
F6FQW1_ISOV2/4-241VDLNSDLGEGFGRW..NL.G..DD--------------------------------------------------------
U5RSR8_9CLOT/3-239IDINVDMGESFGRY..VL.GD..D--------------------------------------------------------
Y1029_CHRSD/6-245..LNCDMGESFGNW..KM.G..LD--------------------------------------------------------
Y2522_SYMTH/11-249IDLNCDMGESFGVY..RI.G..AD--------------------------------------------------------
G2PME2_MURRD/6-239IDINCDVGEGVG..........NE--------------------------------------------------------
M1MIN5_9CLOT/4-242VDLNCDLGESFGAY..KL.G..LD--------------------------------------------------------
Y2314_ERWT9/3-235VDLNADLGEG.......C.V..HD--------------------------------------------------------
Q0S878_RHOSR/47-285IDLNSDLGESYGAW..TL.G..DD--------------------------------------------------------
U3TWJ9_9ENTR/3-236IDLNADLGEG.......S.A..SD--------------------------------------------------------
D3EM31_GEOS4/4-242VDLNCDMGESYGAY..KL.G..ND--------------------------------------------------------
Y535_KINRD/4-242IDLNSDLGENTPDR..PV.S..DD--------------------------------------------------------
A3UBZ2_CROAH/4-236IDINCDLGE..........GGLYD--------------------------------------------------------
H2IWK8_RAHAC/3-236VDLNADLGEG.......C.G..ND--------------------------------------------------------
C6XL46_HIRBI/7-240IDLNADLGE..........GCATD--------------------------------------------------------
G9MQN1_HYPVG/10-247.EINADMGEGFGRW..KM.GP..D--------------------------------------------------------
Y2112_PSEAE/4-245LLLNCDIGESFGAW..RM.G..LD--------------------------------------------------------
Y4436_RALSO/3-241IDLNADLGEGYGPW..RM.G..DD--------------------------------------------------------
Y2790_CLOK5/4-243IDLNCDLGEGFGVY..KM.G..ND--------------------------------------------------------
D7A9V4_STAND/3-236VVINCDMGEGYGLY..SC.GD..D--------------------------------------------------------
M5A4V0_9ACTN/5-243IDLNADLGEGTEAA..HH.A..SD--------------------------------------------------------
R5QKJ0_9FIRM/3-241VDLNADLGESFGNY..KC.G..MD--------------------------------------------------------
W5TLR8_9NOCA/3-239IDLNSDLGEGFGAW..SM.G..DD--------------------------------------------------------
Y2520_ACIAD/3-241IDLNSDLGESYGSW..IM.G..ND--------------------------------------------------------
D7A110_STAND/4-243IDLNCDMGEGFGVY..SL.G..DD--------------------------------------------------------
I0DPN0_PROSM/5-243IDLNSDLGESFGQW..KM.G..ND--------------------------------------------------------
D2PYH8_KRIFD/4-242VDLNADLGEGYGSW..AM.G..DD--------------------------------------------------------
B7VS04_VIBSL/1-234......MGESFGNW..KM.G..DD--------------------------------------------------------
L0G1R1_ECHVK/3-236IDINCDLGEGME..........SD--------------------------------------------------------
Y2655_BREBN/4-242VDLNCDMGESFGAY..QL.G..ND--------------------------------------------------------
Y1272_PYRFU/3-241VDLNSDLGESFGRY..KL.G..LD--------------------------------------------------------
F4H0L0_CELFA/5-255IDFNCDLGEGLDAWEPGVPG..PE--------------------------------------------------------
A9WUH9_RENSM/280-518VDLNSDLGESFGSW..PM.G..DD--------------------------------------------------------
D6Y403_THEBD/3-248IDLNADLGEGFGIW..RI.G..DD--------------------------------------------------------
F4GUU2_PUSST/5-243IDLNCDMGESFGAW..KM.G..LD--------------------------------------------------------
A5WHM5_PSYWF/13-246IDLNADVAEG.......C.G..QD--------------------------------------------------------
I3Z849_BELBD/30-262LDINCDLGEGMP..........ND--------------------------------------------------------
M4RSN8_9BIFI/4-242IDLNSDMGESFGRW..AL.G..DD--------------------------------------------------------
M9R857_9RHOB/6-244VDLNCDMGEGFGQW..VL.GEAPE--------------------------------------------------------
R7JBC4_9FUSO/13-246IDFNIDLAQSFGIY.....KNNYE--------------------------------------------------------
C5D2N8_GEOSW/3-241VDLNCDFGESFGIY..RL.G..EE--------------------------------------------------------
D5V4N2_ARCNC/3-244IELNCDVGDSFGIW..KM.G..ND--------------------------------------------------------
R5B6J0_9CLOT/6-244VDLNSDLGESFGAY..TI.G..MD--------------------------------------------------------
D8J6F9_HALJB/4-240VDINCDMGESFGNW..EM.GR..D--------------------------------------------------------
Q2KTU9_BORA1/6-244IDLNSDMGEGFGPW..KI.GDGVD--------------------------------------------------------
C5D207_VARPS/3-241IDLNADLGEGFGPW..RM.G..ED--------------------------------------------------------
F8Q293_SERL3/10-254..VNCDMGESFSIY..SV.GD..D--------------------------------------------------------
E9T1F8_COREQ/4-242IDLNSDLGESFGAW..TL.G..DD--------------------------------------------------------
H8KYG9_FRAAD/4-242IDLNADLGEGFGPW..RM.G..AD--------------------------------------------------------
Y1612_LACF3/4-240IDLNSDLGESFGRY..TI.G..ND--------------------------------------------------------
R7AUI2_9FIRM/4-242VDLNCDLGESFGAY..RI.G..MD--------------------------------------------------------
L0A698_DEIPD/4-241LDLNCDMGESYGRF..TL.G..QD--------------------------------------------------------
F5Z8H6_ALTSS/2-241.KLNCDLGESFGAW..QM.P..VD--------------------------------------------------------
E0TF98_PARBH/9-240IDLNADVGEGMG..........DD--------------------------------------------------------
C3AMS1_BACMY/4-240VDLNCDLGEGFGAY..KI.G..ND--------------------------------------------------------
Y1004_CORGL/4-242IDLNSDLGESYGSW..VM.G..ND--------------------------------------------------------
U4KHV1_9VIBR/2-235.KLNCDMGESFGCW..AK.G..QD--------------------------------------------------------
A4X134_SALTO/1-238MDLNADLGEGLGVW..RL.G..DD--------------------------------------------------------
X5DN33_9CORY/5-237.TINADLGEGLGLH..AF.GN..D--------------------------------------------------------
F0RQS5_DEIPM/3-243TDLNADAGESFGNW..TA.G..ND--------------------------------------------------------
R5T180_9GAMM/13-246IDFNCDLAQAYGVY.....KNIQE--------------------------------------------------------
A9I0Z0_BORPD/28-266IDLNCDMGESYGAW..HM.G..ND--------------------------------------------------------
A3Q8T1_SHELP/8-241IDLNADLGE..........GGPQD--------------------------------------------------------
R6NVF4_9CLOT/4-237IDLNSDLGEG.......A.A..FD--------------------------------------------------------
A5D328_PELTS/1-237MDLNVDMGESFGRY..KL.GN..D--------------------------------------------------------
F7QMW8_9BRAD/3-242IDLNSDLGEGFGAW..EM.G..ND--------------------------------------------------------
I2BBK3_SHIBC/7-245IDLNSDLGESYGQW..TL.G..DD--------------------------------------------------------
D5V4P7_ARCNC/3-243IKLNCDMGESFGIW..KM.G..LD--------------------------------------------------------
B1HUZ0_LYSSC/2-236.DINCDLGESYEAF..LT.G..RD--------------------------------------------------------
C5C6S0_MICLC/7-245IDLNSDVGESFGSW..TM.G..DD--------------------------------------------------------
X2GVX0_9BACI/3-237IDINCDMGEGMDVL..TL.D..KD--------------------------------------------------------
A0QXR8_MYCS2/4-236IDLNADLGESFGVY..TY.GA..D--------------------------------------------------------
Y2372_RALPJ/4-237IDLNADLGEG.......C.D..TD--------------------------------------------------------
E6TY73_BACCJ/5-243VDLNSDIGESFGAY..KI.G..ND--------------------------------------------------------
H2G083_OCESG/4-245LLLNADMGESFGPW..SM.G..QD--------------------------------------------------------
Q0RVU6_RHOSR/3-237IDLNADAGESFGRW..VL.G..HD--------------------------------------------------------
F4KPP8_HALH1/2-235IDLNCDLGEGFP..........AD--------------------------------------------------------
E2PUA2_STRC2/26-264IDLNADLGEGFGRW..RL.T..ED--------------------------------------------------------
G0G150_AMYMS/1-239MDLNSDLGEGFGAW..KM.G..DD--------------------------------------------------------
R4LWQ2_9ACTO/1-239MDLNSDLGEGFGTW..RL.G..DD--------------------------------------------------------
D2B933_STRRD/3-241IDLNADLGEGFGIW..RL.G..DD--------------------------------------------------------
Y3392_SYNFM/3-241TDINCDMGESFGSY..RI.G..ED--------------------------------------------------------
B6JF92_OLICO/5-244VDINSDIGEGFGAW..TM.G..DD--------------------------------------------------------
F8IB92_SULAT/6-243IDLNSDMGESFGAW..TM.G..HD--------------------------------------------------------
W1QAN8_OGAPD/24-260..IVCDMGEGFGKW..KM.GP..D--------------------------------------------------------
E3Q2S8_COLGM/10-249.DINADMGEGFGPW..KM.GP..D--------------------------------------------------------
D3PTP5_MEIRD/3-241IDLNADAGESFGNW..KL.G..RD--------------------------------------------------------
E4TP81_MARTH/4-239IDINCDLGESFGQF..IM.G..ND--------------------------------------------------------
A9AYX3_HERA2/3-236IDLNADLGE..........GSDFD--------------------------------------------------------
F4CNG9_PSEUX/4-242IDLNSDVGESYGRW..TL.G..DD--------------------------------------------------------
Y1488_MACCJ/3-241IDLNADLGESFGNY..KI.G..ND--------------------------------------------------------
J5JGM9_BEAB2/14-248.EINADMGEGFGQW..KM.GP..D--------------------------------------------------------
D1BTW0_XYLCX/4-242VDLNADLGEGFGQW..TL.G..DD--------------------------------------------------------
Y407_CORJK/10-248IDLNADLGETTGGN..PV.S..DD--------------------------------------------------------
V5XGL8_MYCNE/4-242VDLNADLGEGFGVW..RL.G..DD--------------------------------------------------------
D5WUZ1_KYRT2/4-242IDLNSDMGESFGVY..TL.G..QD--------------------------------------------------------
C5AT01_METEA/6-244IDLNADLGEGFGPW..RM.G..DD--------------------------------------------------------
B0RI75_CLAMS/3-241IDLNSDLAESFGRW..TL.G..DD--------------------------------------------------------
K4IM75_PSYTT/4-236INLNCDLGE..........GGKYD--------------------------------------------------------
Y3770_BACSK/4-242IDLNSDVGESYGAY..TI.G..ND--------------------------------------------------------
G2NVC5_STRVO/7-244.AVVADLGESFGNY..TI.G..DD--------------------------------------------------------
Q5NI64_FRATT/3-227.LINCDLGER......GV.AHPID--------------------------------------------------------
C5BPU8_TERTT/2-239VKLNCDLGEGLDAL.........D--------------------------------------------------------
Y2634_CROS8/4-237IDLNADLGEG.......C.G..ND--------------------------------------------------------
G0IXS0_CYCMS/5-233VDLNCDLGE..........GMAND--------------------------------------------------------
N1PZT0_MYCP1/8-245VHINVDLGEGYGNF..EC.GP..D--------------------------------------------------------
Q0SB09_RHOSR/3-241VDLNCDLGEGFGQW..TL.A..DD--------------------------------------------------------
M1E8N0_9FIRM/3-239VDLNSDVGESFGVY..KY.G...S--------------------------------------------------------
C7NIG6_KYTSD/4-242IDLNADLGEGLGMW..RM.G..DD--------------------------------------------------------
D9QUX4_ACEAZ/4-242VDLNSDIGESFGNY..KL.G..FD--------------------------------------------------------
G8RT09_MYCRN/15-253VDLNADLGESFGVW..KL.G..DD--------------------------------------------------------
R5C385_9FIRM/4-242IDLNSDLGEGFGAY..KM.G..AD--------------------------------------------------------
E1VFF3_9GAMM/4-235LELNADVGE..........GGRYD--------------------------------------------------------
W6EGN0_SULMU/3-242IKLNCDAGESFGSW..KM.G..LD--------------------------------------------------------
E4RUB2_LEAB4/3-231IEINCDMGERAETQ........LD--------------------------------------------------------
D5DCK3_BACMD/4-242VDLNCDLGESFGNY..RL.G..ND--------------------------------------------------------
D9RZ18_THEOJ/5-243VDLNSDIGESFGAY..KL.G..MD--------------------------------------------------------
E2SG17_9ACTO/9-231VDLNADLGESVERW..ES.G..ED--------------------------------------------------------
Y1541_CAMJE/4-242VDLNSDLGESFGAY..KM.G..MD--------------------------------------------------------
D3Q482_STANL/5-243IDLNCDLGEGFGVW..TL.G..DD--------------------------------------------------------
D6ZAE9_SEGRD/6-231VDLNADLGESLGVW..RI.G..DD--------------------------------------------------------
C0ZM31_RHOE4/5-242IDLVADLGEGFGTW..TM.G..AD--------------------------------------------------------
M3B8E6_MYCFI/8-245VHINVDLGEAYGNY..KC.GP..D--------------------------------------------------------
G4R9N3_PELHB/5-238IDLNADLGEAIG..........DD--------------------------------------------------------
Q0C0C1_HYPNA/5-242ICLNADIGELPGEA.....GRALD--------------------------------------------------------
X5EC88_9CORY/4-241IDLNADLGETTGGI..AV.A..DD--------------------------------------------------------
W0HWN7_9ENTR/4-243VDINADLGEGLGRW..KM.G..DD--------------------------------------------------------
Y4486_PECAS/3-241IDVNSDMGEGFGVW..RV.C..DD--------------------------------------------------------
D4MW94_9FIRM/4-242IDLNSDLGESFGHY..TI.G..ND--------------------------------------------------------
F4HE29_GALAU/4-237VDLNVDLAEG.......C.S..ND--------------------------------------------------------
K0B3I8_CLOA9/8-246VDLNSDIGESFGIY..KI.G..LD--------------------------------------------------------
Y2450_CARHZ/4-240IDLNADIGESYGNF..KV.G..ED--------------------------------------------------------
D7CXP4_TRURR/5-245VDLNADLGEAFGVW..QL.G..QD--------------------------------------------------------
Y1858_TOLAT/4-242VDLNCDMGESFGIY..QM.G..TD--------------------------------------------------------
F8KSZ7_HELBC/4-242VDLNSDIGEGFGVY..KM.G..DD--------------------------------------------------------
A1RBG9_ARTAT/5-242IDLVADLGEGFGAY..TI.G..DD--------------------------------------------------------
D8IRE9_HERSS/3-236IDLNADLGEG.......C.D..TD--------------------------------------------------------
A4CKX7_ROBBH/8-240IDLNCDVGEGVG..........NE--------------------------------------------------------
K0L0G1_WICCF/20-257.EINCDMGEGFGRY..QI.AD..D--------------------------------------------------------
H0Q289_9RHOO/5-243INLNADLGESFGAW..RM.G..DD--------------------------------------------------------
V5UEX5_9BURK/3-235IDLNVDLGEG.......C.D..ND--------------------------------------------------------
Q1GEX9_RUEST/5-243VDLNADMGESFGPW..VM.G..RD--------------------------------------------------------
G3JBY9_CORMM/25-269IRIHCDMGEAFGNW..TM.GD..D--------------------------------------------------------
C0ZPT0_RHOE4/5-243VDLNSDLGEGFGAW..TL.G..DD--------------------------------------------------------
Y2677_OCEIH/5-243VDLNSDIGESYGAY..TI.G..QD--------------------------------------------------------
B8ESL6_METSB/13-251VDLNCDCGEGFGPY..AM.G..DD--------------------------------------------------------
A0M393_GRAFK/5-237IHINCDLGEGRK..........FD--------------------------------------------------------
Y3659_RUEPO/4-242VDLNADMGESFGPW..KM.G..DD--------------------------------------------------------
W0PB55_9BURK/4-242IDLNCDMGESFGAW..TM.G..DD--------------------------------------------------------
Y228_NEIMB/4-237VDLNADLAEG.......C.G..SD--------------------------------------------------------
M9LS18_PSEA3/10-256IEINSDMGEAFGRW..QL.GP..D--------------------------------------------------------
Y5076_MYCMM/4-242IDLNADLGEGFGIW..QL.G..DD--------------------------------------------------------
E4TEH0_CALNY/3-241IDLNCDLGESFGAY..KI.G..ND--------------------------------------------------------
C0S3Y3_PARBP/10-245..INCDMGEAYGNW..AC.GP..D--------------------------------------------------------
Q03XI2_LEUMM/7-243VDFNSDLGESFGNY..KI.G..LD--------------------------------------------------------
C7MY76_SACVD/5-243IDLNSDLGEGFGAW..PL.G..DD--------------------------------------------------------
Y870_ALBFT/3-241MDLNSDLGESLGAW..RM.G..DD--------------------------------------------------------
D5WT32_KYRT2/3-240VDLNCDMGESFGAW..TM.GR..D--------------------------------------------------------
G7V6Q9_THELD/4-242IDLNSDLGESFGAY..KI.G..ND--------------------------------------------------------
W0K188_9EURY/4-239IDINCDMGESFGNW..TM.GR..D--------------------------------------------------------
C8WJT5_EGGLE/4-242IDLNSDLGESFGRY..TL.G..LD--------------------------------------------------------
F8A3C2_CELGA/1-238MDLNCDLGEGLDPWQPGVVG..TD--------------------------------------------------------
D5USV9_TSUPD/5-243IDLNADCGESYGAW..RL.G..DD--------------------------------------------------------
C7MA67_BRAFD/8-245LDLNADLGEGVGAW..SM.G..DD--------------------------------------------------------
R6ZG54_9CLOT/4-242VDLNSDLGESFGNY..TI.G..MD--------------------------------------------------------
E3I0X6_RHOVT/3-241IDLNADMGEGFGVY..RI.G..HD--------------------------------------------------------
R6WIY8_9FIRM/4-242VDLNCDLGESFGNY..KC.G..MD--------------------------------------------------------
Y3193_STRGG/2-240MDLNADLGEGFGNW..TL.T..DD--------------------------------------------------------
J9Z0K8_9PROT/6-239INFNSDLAERDLSF..YQ.SV..D--------------------------------------------------------
L0A0G9_DEIPD/6-244VDINADAGESYGAW..PM.G..RD--------------------------------------------------------
D2SFX6_GEOOG/1-239MDLNSDLGEGFGQW..RL.G..DD--------------------------------------------------------
F2IVP4_POLGS/3-236VTINCDMGESFGLY..RI.GD..D--------------------------------------------------------
Y5378_PSESM/4-242IDLNSDLGESFGAW..SM.G..DD--------------------------------------------------------
R5D7F4_9FIRM/4-242VDLNCDLGESFGNY..KC.G..LD--------------------------------------------------------
A1WRL8_VEREI/23-261IDLNSDMGEGFGPW..RI.GDGID--------------------------------------------------------
Y492_PSEAE/4-242VDLNSDMGEGFGPW..TI.GDGVD--------------------------------------------------------
G4KUC6_OSCVS/4-242VDLNSDLGESFGAY..TI.G..LD--------------------------------------------------------
B9K5U5_AGRVS/3-241IDLNSDMGEGFGPY..RL.C..DD--------------------------------------------------------
Y2936_PSESM/3-241IDFNSDMGESFGAW..TI.GDGVD--------------------------------------------------------
E0SL44_DICD3/5-243IDLNSDMGENFGPW..KI.GDDVD--------------------------------------------------------
C5C2F0_BEUC1/8-228VDLNADLGEGVG..........DD--------------------------------------------------------
E6WID8_PANSA/3-241IDVNSDMGEGFGVY..QL.C..DD--------------------------------------------------------
C5AIE4_BURGB/6-244VDLNSDLGEGFGLW..TI.GDGVD--------------------------------------------------------
Y126_CUPNH/3-236IDLNADLGEG.......C.A..ND--------------------------------------------------------
Y1315_CHLAA/4-242IDINCDCGESYGAF..QV.G..DD--------------------------------------------------------
B9L4Q4_THERP/5-240IDINCDMGESFGRW..TL.GN..D--------------------------------------------------------
Y4277_AGRT5/3-241IDLNSDMGEGFGPY..RL.C..DD--------------------------------------------------------
H6RAT6_NOCCG/3-241LDLNSDLGEGFGPW..TM.G..DD--------------------------------------------------------
A4YUI8_BRASO/5-244VDLNCDLGESFGPW..EM.G..ND--------------------------------------------------------
C6WEW0_ACTMD/3-240LDLNSDLGEGFGIW..RL.G..DD--------------------------------------------------------
B8IQH8_METNO/3-241ININADIGESFGRF..KV.G..HD--------------------------------------------------------
U3GU40_9CORY/2-237VDLNADLGERFGLW..PM.G..DD--------------------------------------------------------
H6NIN3_9BACL/8-246IDLNGDMGESFGVY..RL.G..AD--------------------------------------------------------
Q223B3_ALBFT/22-260MDLNSDMGEGFGPW..SI.GEGAD--------------------------------------------------------
Y4304_PHOLL/4-242IDLNSDLGEGFGQW..KM.G..DD--------------------------------------------------------
M1FEE9_9ALTE/2-242.LLNCDIGESYGAW..AM.G..LD--------------------------------------------------------
Y3634_BRADU/3-241IGINSDMGEGFGNY..RI.C..DD--------------------------------------------------------
C6CWI5_PAESJ/6-244VDLNCDFGEGYGSY..SF.G..QD--------------------------------------------------------
B9JN39_AGRRK/3-241IDLNSDMGEGFGPY..RL.C..DD--------------------------------------------------------
Y1066_COREF/7-245IDLNSDLGESYGSW..VM.G..ND--------------------------------------------------------
X4ZHZ1_9BACL/4-242VDLNCDMGESFGAY..II.G..AD--------------------------------------------------------
Y4198_BURPS/6-244VDLNSDMGEGFGPW..KI.GDGVD--------------------------------------------------------
Y3173_CHRVO/3-236IDLNADLGEG.......C.G..DD--------------------------------------------------------
W0HX68_9ENTR/3-242IDLNSDMGESFGPW..AM.G..DD--------------------------------------------------------
G7ZEN3_AZOL4/4-243IDLNCDMGEGYGAW..AM.G..DD--------------------------------------------------------
Y439_FUSNN/5-242VDLNSDIGEGYGAY..KL.G..MD--------------------------------------------------------
B1VIF3_CORU7/7-244IDLNADLGESNAGN..PV.S..DD--------------------------------------------------------
I1XMA4_METNJ/11-252LLLNCDMGESLGQW..SM.G..MD--------------------------------------------------------
C1DQ20_AZOVD/7-248ILLNCDMGESFGVW..KM.G..ND--------------------------------------------------------
F4FA66_VERMA/1-238MDLNADLGEGFGVW..QL.G..DD--------------------------------------------------------
I4BYP2_ANAMD/4-242IDLNSDLGESFGAW..KM.G..ND--------------------------------------------------------
E8QYT2_ISOPI/17-247IDLNADLGE..........GLPWD--------------------------------------------------------
D7A1T1_STAND/3-241ININADIGESYGKF..HV.G..ND--------------------------------------------------------
A6VS70_MARMS/2-241MKLNCDMGEAFGAW..KM.G..LD--------------------------------------------------------
D1BL87_VEIPT/5-243VDLNSDLGESFGNY..TL.G..MD--------------------------------------------------------
V9XKP0_9NOCA/4-242IDLNSDLGESYGRW..RL.G..DD--------------------------------------------------------
E1VTB5_ARTAR/4-242IDLNSDVGESFGNW..KM.G..DD--------------------------------------------------------
D1B9J1_THEAS/5-243IDLNSDLGESFGAY..RI.G..DD--------------------------------------------------------
Y1708_STAA8/3-241VDLNCDLGEAFGNY..SF.G..GD--------------------------------------------------------
R6QJ24_9FIRM/4-236INLNCDLGEG.......A.A..YD--------------------------------------------------------
Q02CY7_SOLUE/3-225IDLNCDMGELDDAA........HE--------------------------------------------------------
A1R1R8_ARTAT/1-239MDLNADLGESFGSW..TM.G..DD--------------------------------------------------------
M4R6T5_BIBTR/4-237IDLNVDLAEG.......C.A..ND--------------------------------------------------------
W0JZF2_9EURY/4-240IDINCDMGESFGNW..RM.GN..D--------------------------------------------------------
Y2905_BURP8/3-236IDLNADLGEG.......C.G..SD--------------------------------------------------------
D8PCF2_9BACT/7-245IDLNCDLGEAATPE..QL.D..VE--------------------------------------------------------
Y4778_VIBVY/6-245VTLNCDMGESFGNW..KM.G..SD--------------------------------------------------------
R5BE93_9FIRM/4-242VDMNSDLGESFGTY..TL.G..MD--------------------------------------------------------
A1T0G5_PSYIN/2-241.KLNCDMGESFGIW..EM.G..LD--------------------------------------------------------
W0IZ00_9BACT/3-248VDLNADLGE..........GSPAD--------------------------------------------------------
C3KLX3_RHISN/4-241IDLNSDLGESFGPW..PM.G..DD--------------------------------------------------------
F2G9I8_ALTMD/2-244.KLNCDLGESFGAW..SM.P..VE--------------------------------------------------------
J7KY74_NOCAA/3-241IDLNSDLGESFGRW..EL.G..DD--------------------------------------------------------
F3ZDL6_9ACTO/6-244IDLNADLAESFGHW..EL.G..DD--------------------------------------------------------
G0HCZ7_CORVD/4-242IDLNSDLGETTNGV..AV.A..DD--------------------------------------------------------
D5DEN3_BACMD/4-242VDLNCDLGESFGAY..RI.G..ND--------------------------------------------------------
B6QNE9_PENMQ/10-244..INVDMGEAYGNY..VC.GP..D--------------------------------------------------------
W5XWZ0_9CORY/6-242IDLNADLGETTAGN..PV.A..DD--------------------------------------------------------
G7ZD33_AZOL4/6-244VDLNCDLGEGYGQW..TL.GEASD--------------------------------------------------------
F2JVE0_MARM1/2-240.KLNCDMGEAFGAW..AM.G..MD--------------------------------------------------------
W5WPA4_9CORY/7-245IDLNADLGETTGGN..PV.S..DD--------------------------------------------------------
X2H6N5_9GAMM/7-245IDLNSDLGESFGQW..KM.G..ND--------------------------------------------------------
D7WE68_9CORY/5-242IDLNADLGETTAGN..PV.A..DD--------------------------------------------------------
D8MPR3_ERWBE/3-236VDLNADLGEG.......C.A..ND--------------------------------------------------------
E3EYK5_KETVY/5-244VDLNADMGESFGAW..QM.G..DD--------------------------------------------------------
A4F9Z7_SACEN/1-239MDLNSDLAEGFGRW..EL.G..DD--------------------------------------------------------
G7XL47_ASPKW/8-245VFINVDLGEGYGNF..KC.GP..D--------------------------------------------------------
A8LPR1_DINSH/5-243VDLNADMGESFGPW..PM.G..DD--------------------------------------------------------
C7JDH8_ACEP3/3-240IDLNADIGEGFGRW..TV.A..ND--------------------------------------------------------
N4VLC9_COLOR/6-246VEVNCDMGEGFGKW..KM.GP..D--------------------------------------------------------
G0L477_ZOBGA/6-239IDLNSDVGEGIG..........LE--------------------------------------------------------
B1MGY8_MYCA9/4-228IDLNADLGEGFGAW..RL.G..DD--------------------------------------------------------
Q483Q3_COLP3/2-240.KLNCDLGESFGAW..SM.G..LD--------------------------------------------------------
R5KN94_9CLOT/4-237INLNCDLGEG.......A.G..AD--------------------------------------------------------
R0K0K3_SETT2/8-244VKINVDLGEGYGNF..KC.GP..D--------------------------------------------------------
D0L462_GORB4/8-241IDLNADLGEG.......V.G..DD--------------------------------------------------------
Y441_STRCO/2-240IDLNADLGEGFGRW..TL.T..DD--------------------------------------------------------
H5X6J3_9PSEU/1-239MDLNSDLAEGFGRW..TL.G..DD--------------------------------------------------------
Q2KUF2_BORA1/5-243LDLNCDMGESYGAW..PM.G..ND--------------------------------------------------------
Y3066_BACCR/4-242IDLNCDLGESFGAY..KM.G..ND--------------------------------------------------------
B9JHF9_AGRRK/4-243IDLNCDMGEGFGAY..TI.G..DD--------------------------------------------------------
B0UCC0_METS4/4-242IDLNSDLGEGFGDY..RC.G..DD--------------------------------------------------------
Q0SBI7_RHOSR/9-246IDLVADLGESFGAW..TM.G..DD--------------------------------------------------------
A0JRP4_ARTS2/1-239MDLNADLGESFGSW..TM.G..DD--------------------------------------------------------
F8KRQ1_HELBC/5-243IDLNSDMGECFGPW..II.GDGVD--------------------------------------------------------
D5UJL7_CELFN/4-244IDLNADLGEGDGPW..RL.EPPAD--------------------------------------------------------
Y2700_YERPE/3-236IDLNADLGEG.......C.A..ND--------------------------------------------------------
V4IFZ2_9ACTO/6-244IDLNADLAEGFGRW..EL.G..DD--------------------------------------------------------
Y4074_AZOC5/4-242VDLNSDLAEGFGIW..HL.T..ED--------------------------------------------------------
Y2695_THET8/3-241VDLNADAGESYGAF..AY.G..HD--------------------------------------------------------
Q16DH1_ROSDO/4-242VDLNADMGESFGPW..KM.G..DD--------------------------------------------------------
K7TCZ9_GLUOY/7-242VDLNADLGESFGQF..KI.G..ND--------------------------------------------------------
D5EIJ1_CORAD/3-232ILLNCDLGENEPTT........RT--------------------------------------------------------
K0FF24_9NOCA/3-241LDLNSDLGEGFGPW..PM.G..DD--------------------------------------------------------
E8U5L2_DEIML/4-237IDLNADLGE..........GSPHE--------------------------------------------------------
B4EQJ0_BURCJ/4-237IDLNVNLGE..........GRAHD--------------------------------------------------------
Q2W2X4_MAGSA/5-238VDLNSDLGEA.......M.G..DD--------------------------------------------------------
F8DZP5_CORRG/4-242IDFNADLGETTAGN..PV.A..DD--------------------------------------------------------
J9S8D4_9ACTO/8-241IDLNADLGEG.......I.G..DD--------------------------------------------------------
B1M8C8_METRJ/3-241VDLNCDMGEGFGVY..RL.G..DD--------------------------------------------------------
E8MYL0_ANATU/1-235MDLNCDLGESFGNY..RL.G..ND--------------------------------------------------------
R5C931_9FIRM/3-241IDLNCDMGESFGNY..KI.G..MD--------------------------------------------------------
H6C6W1_EXODN/8-246LEINCDMGEGFGRW..KM.GP..D--------------------------------------------------------
F0Y460_AURAN/32-276INLNADLAEGYGPW..TM.T..AD--------------------------------------------------------
H0UJ33_9BACT/4-242VDLNSDLGESFGPW..VM.G..RD--------------------------------------------------------
Y4511_PSEAE/8-249ILLNCDMGESFGAW..RM.G..DD--------------------------------------------------------
E1VBZ3_HALED/5-245.LLNADMGESFGAW..TM.G..MD--------------------------------------------------------
D4M7W6_9BACT/4-242IDLNSDMGESFGAY..TI.G..GD--------------------------------------------------------
G2LEC2_CHLTF/4-242IDLNADLGESFGAW..SM.G..AD--------------------------------------------------------
C7RQK9_ACCPU/6-244INLNADLGEAFGVW..QM.G..ND--------------------------------------------------------
Y4877_VIBPA/8-246LTLNCDMGESFGSW..KM.G..AD--------------------------------------------------------
Y1531_COPPD/5-243VDLNADMGESFGAY..KL.G..LD--------------------------------------------------------
V2WV16_MONRO/9-250.TVNCDMGEGYSLY..TI.GN..D--------------------------------------------------------
M7WMG6_RHOT1/6-247.TLNCDCGESYGQY..TI.G..DD--------------------------------------------------------
A3HS16_9BACT/7-235..INCDLGE..........GISHE--------------------------------------------------------
Y043_AZOSB/4-242INLNADLGESFGAW..KM.G..ED--------------------------------------------------------
F0M0F6_VIBFN/6-245IKLNCDMGESFGAW..TM.G..AD--------------------------------------------------------
Y2984_DEIRA/7-247TDLNADAGESFGHW..PL.G..DD--------------------------------------------------------
C7R8W9_KANKD/7-245IDINCDLGESINPQ.....QWEAD--------------------------------------------------------
Y1502_GEOKA/4-241IDLNCDFGESFGVY..RL.G...Q--------------------------------------------------------
Y150_BORPE/5-243IDLNCDMGESYGAW..RM.G..ND--------------------------------------------------------
Y2042_NITHX/3-242IDLNCDLGESFGVW..SM.G..ND--------------------------------------------------------
A0R539_MYCS2/5-243VDLNADLGESFGVW..QL.G..DD--------------------------------------------------------
Y2038_STACT/3-241VDLNCDLGEAFGNY..SF.G..GD--------------------------------------------------------
K1VQ76_TRIAC/63-302..LISDMGEGYYRW..AL.G..PD--------------------------------------------------------
Y498_BACLD/4-242VDLNCDLGESFGAY..KI.G..LD--------------------------------------------------------
G2J1V4_PSEUL/3-236IDLNADLGEG.......C.G..DD--------------------------------------------------------
D8MWR7_ERWBE/4-242LDLNADIGEGYGDY..QI.A..DD--------------------------------------------------------
Q3ICU0_PSEHT/2-237.LLNCDLGESFGAW..KM.G..LD--------------------------------------------------------
Y3910_AGRT5/4-242IDLNSDLGESYGAW..RM.G..DD--------------------------------------------------------
S8E0A5_FOMPI/4-241.SVNCDMGEGFALY..TI.GD..D--------------------------------------------------------
F6EKD4_AMYSD/4-242IDLNCDLGESFGIW..AL.G..DD--------------------------------------------------------
Y3576_VIBCH/6-245IQLNCDMGESFGVW..TM.G..AD--------------------------------------------------------
D3UZ92_XENBS/5-243IDLNSDLGESFGQW..KM.G..ND--------------------------------------------------------
C1CZR4_DEIDV/6-239IDLNADLGE..........GSEHE--------------------------------------------------------
K7TD01_GLUOY/6-244IDLNADLGESFGAY..TI.G..ND--------------------------------------------------------
YBGL_SHIDS/3-236IDLNADLGEG.......C.A..SD--------------------------------------------------------
H1YGF4_9SPHI/5-243IDLNCDMGEAFGNY..PM.P..ND--------------------------------------------------------
Q5QXP9_IDILO/9-254ITLNSDIGESFGAW..KM.G..AD--------------------------------------------------------
Q47NG6_THEFY/3-241IDLNSDLGESFGRW..EL.G..DD--------------------------------------------------------
U5LAF3_9BACI/4-242IDLNCDLGESFGSF..KI.G..SD--------------------------------------------------------
E1QDN4_DESB2/3-244IDLNCDMGEGFGPY..RL.G..DD--------------------------------------------------------
X4ZYD6_9BACL/5-242IDICSDLGEGYGNY..KV.A..DD--------------------------------------------------------
Y4577_PSEPK/13-254LLLNCDMGESFGSW..RM.G..LD--------------------------------------------------------
B5ICJ8_ACIB4/3-241VDLNADLGESFSIY..KI.G..ND--------------------------------------------------------
Q1DC03_MYXXD/8-229.LLNVDLGELPG..........ED--------------------------------------------------------
C7MLY6_CRYCD/7-245IDLNSDLGESFGRY..NL.G..MD--------------------------------------------------------
W8X9N3_CASDE/1-239MDLNSDLGESYGAW..RM.G..DD--------------------------------------------------------
Q5E525_VIBF1/3-242..INCDMGESFGLW..QL.G..ND--------------------------------------------------------
A4ASE2_MARSH/6-239VDINCDVGEGVG..........NE--------------------------------------------------------
W5W979_9PSEU/4-242IDLNSDLGEGFGIW..QL.G..DD--------------------------------------------------------
R5MQI6_9FIRM/5-243VDLNCDMGESFGAY..KI.G..LD--------------------------------------------------------
R7XYL9_9ACTO/8-246IDLNADLGEGFGQW..RL.G..DD--------------------------------------------------------
F2K8V1_PSEBN/4-245LLLNCDIGESFGSW..TM.G..LD--------------------------------------------------------
C0QGD0_DESAH/1-241MDLNCDMGESFGTY..TI.G..MD--------------------------------------------------------
E5AMR8_BURRH/21-254VDLNADLGEG.......C.G..ND--------------------------------------------------------
B8LZW7_TALSN/11-246..INVDMGEGYGNW..AI.GP..D--------------------------------------------------------
G2TJB6_BACCO/4-242IDLNCDMGESFGAY..TI.G..RD--------------------------------------------------------
R5H7E1_9SPIR/13-244IDFNIDLAQSFGIY.....KNNSE--------------------------------------------------------
Q3SF52_THIDA/2-233IELNADIGEGH...........ED--------------------------------------------------------
Q4FMV7_PELUB/11-249ININCDLGEKSKFH.....SIKND--------------------------------------------------------
B9JN49_AGRRK/11-248VDINCDMGEAFGRW..RI.GDTRD--------------------------------------------------------
Y1729_HAEIN/4-237IDLNADIAEG.......F.P..FD--------------------------------------------------------
I7F001_PHAIB/5-243VDLNADMGESFGAW..TM.G..DD--------------------------------------------------------
K5WPA6_AGABU/8-248.TVNCDLGEGYSLY..RM.GD..D--------------------------------------------------------
F2F1B3_SOLSS/4-242VDLNCDLGESFGRY..QL.G..EQ--------------------------------------------------------
Y486_MYCPA/4-242IDLNADLGEGFGVW..RL.G..DD--------------------------------------------------------
D5ATU4_RHOCB/3-236LDLNSDMGEGAGA..........D--------------------------------------------------------
A4XXR4_PSEMY/4-245LLLNCDIGESYGAW..TM.G..LD--------------------------------------------------------
B1LSM8_METRJ/4-242VDLNSDLGEGYGAY..AC.G..DD--------------------------------------------------------
E6X9V0_CELAD/3-235IDINSDVGEGVG..........NE--------------------------------------------------------
L0EBQ1_THECK/9-247IDLNGDVGEGFGPY..AI.G..RD--------------------------------------------------------
Q28NJ3_JANSC/23-261IDLNSDLGEGFGPW..SM.G..DD--------------------------------------------------------
Q21NC0_SACD2/2-238.KLNCDLGEGLDHA.........D--------------------------------------------------------
G8AQ87_AZOBR/366-604VNLNADLGEGFGAY..DI.G..DD--------------------------------------------------------
A1S1H7_SHEAM/4-236LQLNADVGE..........GYPFD--------------------------------------------------------
R5XTA1_9FIRM/4-237IDLNCDLGEG.......A.K..HD--------------------------------------------------------
F8I999_SULAT/1-233......MGESFGVY..RY.GA..D--------------------------------------------------------
G0AE74_COLFT/9-243VDLNADLGEQ.......SNG..SD--------------------------------------------------------
W0LH49_SERFO/3-236VDLNADLGEG.......C.A..ND--------------------------------------------------------
Q2J8R2_FRASC/53-290LDLNADLGEGFGVW..RL.T..ED--------------------------------------------------------
E4PKH3_MARAH/2-242.KLNCDMGESFGTW..TK.G..MD--------------------------------------------------------
R7JWG6_9CLOT/4-242VDLNCDLGESFGNY..KI.G..MD--------------------------------------------------------
H6RUE6_BLASD/9-247IDLNADLGEGFGVW..RL.G..DD--------------------------------------------------------
B8IGM4_METNO/4-242IDVNSDLGEGFGPY..KA.A..DD--------------------------------------------------------
Y333_MYCLE/4-242IDLNADLGEGFGVW..RL.G..DD--------------------------------------------------------
A9BP88_DELAS/14-252IDLNSDMGESFGPW..AI.GDGVD--------------------------------------------------------
E4U7W9_OCEP5/4-242IDLNADAGESFGPW..KM.G..SD--------------------------------------------------------
Y093_ARTS2/4-242MDLNSDVGESFGRW..TL.G..DD--------------------------------------------------------
J7QRE0_METSZ/8-246IDLNADLGEGFGHW..RM.G..DD--------------------------------------------------------
C8WUH6_ALIAD/4-242VDLNADLGEDFGAY..RL.A..ND--------------------------------------------------------
Y1168_STAEQ/5-243IDLNCDLGEAFGNY..TF.G..GD--------------------------------------------------------
A1WEV7_VEREI/4-242IDLNSDVGESYGRY..QL.G..DD--------------------------------------------------------
C4ZLA9_THASP/5-243INLNADLGESFGPW..TM.G..ED--------------------------------------------------------
D7BRG6_STRBB/6-245IDLNADLGEGFGRW..QL.T..DD--------------------------------------------------------
F4AY60_KROS4/4-236IDLNSDVGEGVG..........NE--------------------------------------------------------
A9H2F5_GLUDA/7-245IDLNADLGESFGHY..TI.G..ND--------------------------------------------------------
D3FTL6_BACPE/4-242VDLNCDLGESFGAY..KI.G..QD--------------------------------------------------------
Y282_PROAC/4-246VDLNADMGESFGSW..KA.G..DD--------------------------------------------------------
E0SEY7_DICD3/3-236IDLNADLGEG.......G.Q..HD--------------------------------------------------------
M1MW29_9CORY/4-241IDLNADVGETTAGD..PV.A..DD--------------------------------------------------------
D5BMH2_PUNMI/3-237IDINCDMGESFGIY..KM.GN..D--------------------------------------------------------
R7MJT0_9CLOT/13-245IDFNCDLAQSFGIY.....KNSSE--------------------------------------------------------
A0LSF5_ACIC1/16-254VDLNADVGESFGAY..RI.G..SD--------------------------------------------------------
Y379_BACP2/4-242VDINCDLGESFGQY..TI.G..SD--------------------------------------------------------
B6HFB9_PENCW/10-245..INVDLGEGFGNW..TI.TS..D--------------------------------------------------------
H5WZE4_9PSEU/3-241IDLNSDLGEGFGAW..FS.G..DD--------------------------------------------------------
I0GX05_ACTM4/4-242IDLNADLGEGFGAW..TL.G..DD--------------------------------------------------------
E1SWB7_FERBD/3-239IDLNCDVGELEGSA.....N..LD--------------------------------------------------------
C0ZBV3_BREBN/4-239LDINCDMAEGFSRG..RQ.S..ED--------------------------------------------------------
E6SBM1_INTC7/6-244IDLNSDLGESLGTW..RL.G..DD--------------------------------------------------------
A7IFF2_XANP2/3-241VDLNSDLGEGFGAY..AI.T..DD--------------------------------------------------------
F8K454_STREN/34-272VDLNADLGEGFGRW..RL.T..DD--------------------------------------------------------
H6N0G5_GORPV/18-251VDLNADLGEG.......V.G..DD--------------------------------------------------------
S3BUE6_OPHP1/51-290.EINADMGEGFGRW..KM.GP..D--------------------------------------------------------
D4M7F2_9BACT/5-243VDLNSDLGESFGAW..KM.G..MD--------------------------------------------------------
G8T834_NIAKG/4-244IDINCDMGESTHLWPYDI.E..KD--------------------------------------------------------
B5HGL3_STRPR/6-244IDLNADLGEGFGRW..TL.T..DD--------------------------------------------------------
E4N888_KITSK/2-244IDLNADLGEGFGRW..SL.T..DD--------------------------------------------------------
E8SIF4_STAPH/3-241VDLNCDLGESFGNY..QI.G..ND--------------------------------------------------------
B9K212_AGRVS/6-244VDINCDLGEAFGRW..RV.GDTAD--------------------------------------------------------
K4RDP3_9ACTO/4-242IDLNADLGEGFGRW..RL.T..DD--------------------------------------------------------
D4ZD86_SHEVD/10-243IDLNADLGE..........GGAND--------------------------------------------------------
Y3513_ACIAC/3-241IDLNSDLGESLGAW..RM.G..DD--------------------------------------------------------
Y2681_RHOPA/3-242IDLNCDLGEGFGVW..QM.G..DD--------------------------------------------------------
I2EPH3_EMTOG/6-243IDLNCDMGEAFGSW..PM.G..ND--------------------------------------------------------
K0KCJ9_SACES/2-239IDLNSDLGEGFGIW..RL.G..DD--------------------------------------------------------
F2NR58_MARHT/3-241VDLNADAGESFGAW..RM.G..QD--------------------------------------------------------
Y2977_ALKMQ/4-242VDLNSDIGESFGAY..EL.G..MD--------------------------------------------------------
Y5654_NOCFA/3-240LDLNSDLGEGFGSW..TM.G..DD--------------------------------------------------------
D3F024_CONWI/21-259LDVNVDMGESFGRW..RL.GD..D--------------------------------------------------------
K7RR83_PROA4/1-239MDLNSDSGESFSSW..RM.G..DD--------------------------------------------------------
G9WFM7_9LACT/4-240IDLNSDLGESFGRY..SL.G..ND--------------------------------------------------------
B9L7F1_NAUPA/2-239IKLNADLGESFGHY..RL.G..MD--------------------------------------------------------
I4C5I2_DESTA/3-239IDLNADMGESFGMY..KL.GN..D--------------------------------------------------------
E3CXI0_9BACT/4-242MDMNSDLGESFGTY..VL.G..DD--------------------------------------------------------
Y1066_HELMI/3-241IDLNCDIGESFGAY..RI.G..CD--------------------------------------------------------
D2RMC2_ACIFV/3-241IDLNSDLGESFGAY..KI.G..MD--------------------------------------------------------
Q1GM83_RUEST/5-243VDLNCDMGEGFGHW..VL.GEAPD--------------------------------------------------------
E0SJD9_DICD3/3-241IDVNADMGEGFGVY..QL.C..DD--------------------------------------------------------
F7YS87_VIBA7/10-249ITLNCDMGESFGAW..QM.G..AD--------------------------------------------------------
Q6ANH3_DESPS/2-232.LLNCDMGESFGNY..SI.S..QD--------------------------------------------------------
E3F040_KETVY/2-233IDINADMGEGFGAY..QI.A..DD--------------------------------------------------------
B2ICA4_BEII9/9-247VDLNCDCGEGFGPY..QM.G..DD--------------------------------------------------------
A1AYU0_PARDP/5-242IDLNSDLGEGYGAW..KM.G..DD--------------------------------------------------------
F0RCU6_CELLC/6-239IDINVDVGEGVG..........NE--------------------------------------------------------
K4L056_SIMAS/4-242.LLNCDLGESFGSW..TM.G..MD--------------------------------------------------------
C7QHB5_CATAD/2-244IDLNADLGEGFGRW..RL.G..DD--------------------------------------------------------
Y476_METCA/5-243IDLNADLGESFGPW..RM.G..QD--------------------------------------------------------
G4QKJ0_GLANF/2-240.KLNADLGESYGHW..QF.D..AD--------------------------------------------------------
A1U0R3_MARAV/2-242.KLNCDLGESYGAW..QM.G..QD--------------------------------------------------------
Q3IWM6_RHOS4/5-244IDLNCDMGESFGAY..VM.G..DD--------------------------------------------------------
D5CHF5_ENTCC/4-237IDLNADLGEG.......G.S..AD--------------------------------------------------------
U4KH28_9VIBR/6-245LKLNCDMGESFGSW..KM.G..LD--------------------------------------------------------
Q6D7H2_PECAS/3-236IDLNADLGEG.......G.E..HD--------------------------------------------------------

PF01522

NODB_AZOC5/9-134.......HPSV--T----------PAV---CEILREHS--------A.L--ATF--FQIGR.F...AKEY-....-----
Q9A5L9_CAUCR/35-168........ATA--C----------EAG---ARALEARG--------L.R--GTY--YFAAG.LTGRDG..-PMG.-----
O69838_STRCO/70-214..RAASGERFD--N----------PGL---ITALRELK--------V.P--ATV--FMTGR.W...AEEY-....-----
Q9XAP6_STRCO/96-224.......DPTW--T----------PQV---LDILEKYD--------V.P--GTF--FLVGS.M...VSRH-....-----
CDA2_YEAST/112-232...........--S----------AST---TKLLDRLK--------H.N--STF--FNLGV.N...IVQH-....-----
Q98GK8_RHILO/808-946........QNF--A----------DHA---WPTLRAND--------L.T--AEV--FLVTD.L...VGKG-AQWD-----
ICAB_STAEQ/107-248........QTI--Y----------DNA---FPVLKKYH--------I.P--ATG--FLITN.H...IGST-NFHN-----
Q97ET9_CLOAB/86-214........SNN--T----------KKI---LSILDANQ--------I.K--ATF--FLIGQ.N...AERY-....-----
YHEN_BACSU/79-203........SAV--T----------TRL---LDVLKSAD--------V.K--ATF--FMLSP.R...MNEF-....-----
Q9CHP6_LACLA/96-236........KSL--P----------ENA---YPIMKKLD--------L.P--FTQ--FIITG.K...VGQT-IDGS-----
Q9RVF2_DEIRA/33-157.......DPQT--T----------PAV---LAALREAD--------M.H--ATF--FVIAG.K...AQAH-....-----
Q982X7_RHILO/88-291........RDN--M----------TEA---LPVLEKHG--------A.P--ITI--YVAPG.LIDGTADL-WWDV-----
Q97K82_CLOAB/62-192.......SSNV--T----------PYI---LDTLKTYD--------V.K--ATF--FVTGK.N...SIIN-....-----
O53444_MYCTU/41-164........GPY--T----------DRL---LHILTDND--------A.K--ATF--FLIGN.K...VAAN-....-----
PDAA_BACSU/60-185.......ENGY--T----------PKV---LDVLKKHR--------V.T--GTF--FVTGH.F...VKDQ-....-----
Q985U0_RHILO/77-213........GQT--D----------TRI---LSALVENK--------I.P--ATI--FVTGIWLKRNAAAV-....-----
Q9WXW8_THEMA/27-151.......DVKL--T----------SAV---LGTLEKHG--------V.V--ATF--FVVGQRL...NEST-....-----
P73597_SYNY3/44-199ITWYRYGYTEG--V----------PRI---LDLLDKYK--------I.K--ITS--HMSGR.T...VEMY-....-----
Q9L1T3_STRCO/85-207.......DPTW--T----------PRV---LDVLKKHD--------A.H--AVF--FVTGT.M...ASRY-....-----
Q9A6E1_CAUCR/17-152..PPGVTRVEV--A----------AEL---LKASAEAG--------A.P--AFG--FINAVQNEREPDSA-....-----
Q97TP4_CLOAB/83-210........EDF--Y----------TNV---YPILRKYH--------M.K--AAE--FAITN.L...IDTY-GH..-----
Q97JC7_CLOAB/83-211........SVN--T----------SKI---IEILNRNN--------I.K--ATF--FLIGK.S...AEEF-....-----
Q9X8Z4_STRCO/86-212.......DPAW--T----------PQV---LDLLEEYG--------V.K--ATF--CMTGL.Q...AEAH-....-----
Q9KEF7_BACHD/63-188.......ENGY--T----------AVI---LDVLKDKQ--------V.P--ATF--FVTGH.Y...LETE-....-----
Q9PF00_XYLFA/74-213........LDN--L----------QAA---LPVLQAHG--------F.S--ATC--YVVSG.SLARFNTW-DAER-----
Q97LW8_CLOAB/106-234........EDH--Y----------KNA---YPVLKKYN--------L.H--ATM--FIITD.Y...LDKG-TL..-----
Q9KEJ5_BACHD/75-214......HGSQF--D----------EEL---LAYLQEKE--------I.P--ATL--FVNER.W...IDEN-....-----
Q9CCZ2_MYCLE/73-201.......NTEV--V----------RSY---VQFVKDTD--------I.R--LTF--FVNGV.YDSWTDNM-....-----
Q9KBK9_BACHD/74-199.......DPRF--T----------PQV---LDVLQEYN--------V.P--ATF--FVMGR.R...AERF-....-----
Q9KSH6_VIBCH/26-172........VNA--S----------VEV---IKVLNQGG--------V.K--ATF--YFNAW.HLDGIGDE-NE..-----
Q9P9U2_XYLFA/249-384.......HRVY--T----------NEI---KEILQHYA--------V.P--AVF--FEVGR.N...IGRF-DRAG-----
Q9FBM6_STRCO/131-288........HGL--W----------THA---DPVLARYG--------M.K--AAA--YLIT..........-GQVG-----
Q9RV08_DEIRA/33-148........SER--T----------PEL---LAVLARHD--------A.Q--ATF--FVLES.H...ARAL-....-----
Y4760_STRCO/62-184.........ER--D----------PAF---VGLIRERR--------L.P--VTL--FLTDTVA...GPAY-....-----
Q983K0_RHILO/61-197........LNG--T----------SNI---LDVLEAEQ--------V.P--ATL--FMVGMHAEAGASNK-....-----
Q97MV1_CLOAB/82-216.......STTV--T----------PKI---LDTLEREN--------V.N--ATF--FLIGS.NIQLSNES-....-----
Q9K630_BACHD/116-243........TPA--T----------KKL---LTLLNEYE--------M.K--ATF--FTLSP.K...VKQY-....-----
Q9R7V4_YERPE/101-271........SSF--Y----------RRV---YPLLKAYK--------W.S--AVL--APVGT.W...IDTA-TDKK-----
Q9ZBN1_STRCO/59-183........SEN--S----------ARL---LDILKEKQ--------V.P--ATF--FLLGKRH...IDTY-....-----
Q9PAV0_XYLFA/97-222........SDD--T----------AAM---LDLLDRHD--------A.R--ATF--FLVGE.R...AARQ-....-----
Q9KDB2_BACHD/39-162........TAL--T----------DDI---LSILQEED--------I.K--ATF--FLTGR.E...IEEH-....-----
Q9KA84_BACHD/124-248.......GNEH--L----------PTM---LKTMNKYD--------V.K--STF--FLDGS.W...VKKH-....-----
Q9KVA7_VIBCH/402-543........RDN--Y----------DLL---LPLLKKYQ--------F.K--AVV--YVVTGENFNRWDVE-VSDN-----
PDAB_BACSU/51-176.......GDER--A----------EPI---LNTLKANG--------I.K--NAT--FFLSASW...AERH-....-----
NODB_RHILO/15-140.......NPCF--T----------PQI---LDVLAQNR--------V.P--ATF--FVIGA.Y...AAEH-....-----
NODB_RHIME/15-140.......NPHC--T----------PEI---LDVLAEYG--------V.P--ATF--FVIGT.Y...AKSQ-....-----
Q9EWZ7_STRCO/52-176.......DPAS--T----------PRF---LDTLDGLG--------V.R--ATF--FVLGE.N...ALRH-....-----
Q9PDB0_XYLFA/55-223........LDN--W----------VYA---HPILQKYH--------M.H--AVV--FIVTS.W...IGDG-PARP-----
YXKH_BACSU/113-240........TDN--Y----------QDA---YPVLKKYG--------M.K--ATI--FMIGK.S...IGHK-HH..-----
Q97DU4_CLOAB/83-214........SPN--T----------TKI---LDILNANK--------I.K--ATF--FILGK.N...AEMH-....-----
Q9JWQ7_BACHD/50-175.......GEQR--V----------KPI---IDVLQSKK--------V.E--EAT--FFISASW...AERH-....-----
Q9KYG2_STRCO/47-184........ADF--V----------EHA---LPCLRRHG--------C.G--ATL--FVLPG.RLGGVNSW-DPLG-----
YADE_ECOLI/226-368........KSV--S----------RYA---YPVLKQYG--------M.K--ATA--FIVTS.R...IKRH-PQKW-----
CDA1_YEAST/102-222...........--A----------PAT---EALLKKLR--------Q.R--TTF--FVLGI.N...TVNY-....-----
PDAC_BACSU/272-393.......NPAT--T----------NQI---LDSLKKYK--------G.H--ATF--FVLGS.R...VQYY-....-----
Q97GQ0_CLOAB/126-253........EDN--Y----------VNA---YPVLKEFG--------F.K--ATV--FAITD.L...INTC-PY..-----
Q9CJ95_LACLA/136-266........VTM--Y----------TEI---FPLLKKYN--------M.H--ATN--FIITG.Y...VNKG-QGG.-----
Q97EU7_CLOAB/97-223.......ERGY--T----------PKI---LDVLKKHK--------A.K--AAF--FVVKP.Y...ITSS-....-----
Q99Z68_STRP1/235-356.......DPTT--T----------PQV---LDILAKYQ--------A.K--GTF--FMIGS.K...VVNN-....-----
NODB_RHISN/12-137.......NPVF--T----------PEV---LDVLAEHR--------V.P--ATF--FVIGA.Y...AKDR-....-----
Q9RCX4_STRCO/8-132.......HPEY--T----------PKI---LDTLAKYE--------V.R--ATF--FVCGE.M...ADYN-....-----
PGAB_ECOLI/101-271........QSF--Y----------TRV---FPILQAFQ--------W.P--AVW--APVGS.W...VDTP-ADKQ-----
CDA1_SCHPO/63-190........RCG--F----------WRI---LNLFKKHK--------V.P--FTC--WAIGQ.A...VEKN-....-----
Q99ZT1_STRP1/154-283........IDF--Y----------NVA---YPILKKYD--------A.K--ATN--NVITG.L...TEMG-SAA.-----
O86800_STRCO/103-225.........EK--D----------PAF---LRMMSELK--------I.P--YTV--FLTDEEI...KDDY-....-----
Q97GI4_CLOAB/50-174.......GNDN--T----------MKI---LDVLDKYN--------A.K--ATF--FLIGR.W...VEDY-....-----
Q97M42_CLOAB/8-133.........LS--D----------KKL---VSIFNKYG--------I.K--GTF--HINSG.L...IGSY-NR..-----
Q9CIS3_LACLA/170-291.......NPNT--T----------PQL---LKIFSDAQ--------V.P--ATF--FALGK.Q...AQAC-....-----
B3PIN1_CELJU/396-514........NSN--T----------ATL---VNLLRQNN--------LTP--VTW--FNQGN.N...VASN-....-----
D8Q165_SCHCM/200-314........ARF--S----------AKV---LKYLDENQ--------L.H--ATF--FVVGS.R...VIER-....-----
E6UBP6_RUMA7/470-592.....AKKGDP--A----------YRI---IDTMADNG--------F.H--ATF--FYIGS.Q...IKTE-....-----
F4GY46_CELFA/213-331.......NGAT--T----------TAL---LDFLAERD--------I.R--ATF--CVIGQ.N...IQAP-G...-----
F4H710_CELFA/356-474.......NTGT--T----------NQI---LSTLTQYG--------A.T--ATV--FPTGQ.N...AQGN-....-----
Q326Y8_SHIDS/46-204........LDN--W----------FQV---YPLLKEFN--------L.K--AHI--FLITG.F...IGNG-PVRH-----
Q7AQ13_MYCLE/46-161........GPY--T----------DRL---VQILKDND--------A.K--ATF--FLIGN.K...VATN-....-----
Q81Z49_BACAN/63-186.......ENGY--T----------GKI---LDVLKEKK--------V.P--ATF--FVTGH.Y...IKTQ-....-----
PGDA_STRR6/264-377.......NPAT--T----------PQV---LETLAKYD--------I.K--ATF--FVLGK.N...VSGN-....-----
Q9RKN7_STRCO/46-161........SGS--T----------QSL---LNALRQNG--------L.R--ATM--FNQGQ.N...AAQN-....-----
ICAB_STAA8/109-248........ETI--Y----------ENA---YPILKKYK--------I.P--ATG--FIITG.H...VGEE-NFHN-----
S2JG56_MUCC1/153-273........NCS--H----------NAF---YDYLQEQK--------L.K--ASM--FYIGS.N...VVDW-....-----

PF03065

AMY1_DICT6/8-294--------FDF--VIERAYEMSYKPLI---NFFFKHPD........F-P--INV--HFSGF-LLLWLEKN-HPEY.....
O66934_AQUAE/7-429--------KDY--Y..........DMP---AYLKDF.E........I-K--LNF--NLTPV-LIDQIQEY-AQGKAKDVF
Q8TZQ1_PYRFU/35-537--------NNY--W..........KMA---HYLTEFPD........I-H--VTI--DLSGS-LIAQLADY-MNGA.KDIY
MALQ_THEKO/7-291--------FGW--VMESAYERSYRPFM---ETLEEYPN........M-K--VAV--HYSGP-LLEWIRDN-KPEH.....
Q9HLU6_THEAC/262-747--------SEY--I..........EQA---LIAHMFPQ........I-N--VTY--ELSGS-LLYQLVNI-STDPYYNNT
Q8ZT36_PYRAE/22-486--------GNY--L..........KVP---LLINQSG.........V-S--VAF--TLSGS-LIEQLNWY-SNGTYTDAR
I6TXK5_9EURY/6-395--------ETY--I..........PLL---MEFEKLRNKGV....NF-K--LVI--SFSPV-LLEQLNDE-YMKKEFEKY
Q8YXA5_NOSS1/8-473--------KDY--L..........DLI---LILEKYPK........L-H--QTV--NLVPS-LILQLEDY-IAGTAFDPY
F7URR6_SYNYG/8-468--------RDY--G..........GLI---KLWARYPS........L-H--QTV--SFTPC-LLAQLEDY-AQGLAIDRH
Q97BM4_THEVO/7-311--------RSY--I..........PAT---RNLMEYG.........I-K--SSF--SITGT-AVEQALMY-NTKV.....
AMYA_PYRHO/7-291--------FEW--IIKRAYEKAYRPFL---ETLEEYPN........M-K--VAV--HISGV-LVEWLERN-RPEY.....
O58106_PYRHO/3-316--------KSY--F..........PTI---SELIKRE.........I-P--FGL--NITGY-SLQFLPQE-L........
AMYA_METJA/6-319--------KCY--I..........PTN---ELILELIDEYD.....F-K--VNY--SITGV-FVEQALEF-NDYV.....
Q9KD04_BACHD/7-382--------ETY--I..........PLL---WALEKLPVK.......H-A--VTI--SFTPP-VMEMLSDP-LVQTRYLNH
Q8TIT8_METAC/38-312--------REL--L..........RLN---DFFLESIEGG......G-S--YAF--DLSGP-FLEQC.RW-DPEL.....
D4G9W5_TREPC/12-351--------SQY--Q..........AFF---SGLCRHEQ........L-P--LTV--HMTGS-FFQFIQKK-NSPY.....
Q9HL91_THEAC/8-289--------NNY--I..........PAT---QSLMDYG.........I-R--SSF--SLSGT-FMEQASKY-CPKV.....
Q8ZT57_PYRAE/6-321--------RVY--R..........KAT---RIILDVAREVP....GL-R--VTY--SVSGL-ALEQFRKW-APDV.....
Q8TIT9_METAC/7-321--------KCY--T..........PAN---RVLLDSIDEHKG...EF-R--FSL--SITGT-LLEQCELW-GEEV.....
O50094_PYRHO/6-394--------ESY--I..........PLL---MELEKLKERGV....RF-E--LVI--SFTPV-LMEQLADE-YIKREFEKY
Q973T0_SULTO/7-324--------KCY--I..........PAT---RILLEEIENGESEGYDF-K--FFF--SLSGT-FIEQAEKW-GKDV.....
D0KTV8_SULS9/7-324--------NCY--I..........PAT---NIILSSIERAEEEGNNV-K--YFF--SISGT-FLEQAERW-GREV.....

PF01074

MA2A1_MOUSE/166-496--------QYI..F----------NNM...VLKLKEDS----------S--RKF..MWSEISYLAKWWDI.IDIPK----
MA2A2_HUMAN/167-497--------QHI..L----------NSM...VSKLQEDP----------R--RRF..LWAEVSFFAKWWDN.INVQK----
MANA_DICDI/43-353--------QYT..L----------DTA...ITCLLANP----------E--RKF..IYVEIAFFQRWWDE.QSTTM----
MA2B1_HUMAN/64-381--------QYI..L----------DSV...ISALLADP----------T--RRF..IYVEIAFFSRWWHQ.QTNAT----
O01574_CAEEL/138-459--------NQI..L----------DNM...HQFMMKNE----------K--MRF..MWAEFVFFERWWSL.QNEQV----
MA2B2_MOUSE/28-351--------ANV..Y----------TTV...VAELVRGG----------Q--RRF..IAVEQEFFRLWWDGVASEQQ----
MA2C1_RAT/251-510--------ARS..W----------STA...VKLMERNT----------E--FTF..ACSQAQQLEWVKNQ.YPGLY----
MAN1_YEAST/290-559--------VRS..W----------SSQ...CTLMDRFP----------E--YKF..VASQAQQFKWLLED.HPEFF----
P94078_ARATH/39-350--------QNV..L----------DSV...IASLLDDE----------N--RKF..IYVEMAFFQRWWRQ.QSNAK----
Q20829_CAEEL/37-351--------QYI..Y----------NTV...IDELLKNP----------D--RRF..SFAETGFLWRWYTS.NSDFD----
MAN2_DROME/145-471--------KHI..L----------SNA...LRHLHDNP----------E--MKF..IWAEISYFARFYHD.LGENK----
MA2B2_PIG/28-342--------PDV..Y----------NSV...VEALTRGK----------R--RRF..IAVEQEYFRLWWDGFASAKR----
Q55528_SYNY3/232-495--------ERT..F----------QSV...INLQTEFA----------D--LVF..GHTSPVLYQWIEEH.LPALF----
Q7NPH5_GLOVI/217-477--------ERT..F----------RSA...LGLMEDHP----------R--LDF..AQSTAQSYQWLERE.RPQLF----
Q7PMM6_ANOGA/166-493--------KNI..F----------ANM...LRHLDENA----------G--MRF..IWAEISYFAQWYDK.LAAEQ----
Q7S1L0_NEUCR/285-549--------ARS..W----------SNQ...CDLMDRYP----------E--LNF..ACSQAQQYKWCKTL.YPHVW----
Q7U9I9_SYNPX/234-492--------ERT..F----------RSA...LALMKRWP----------D--LRF..AHSTPALYAWMEHH.RPELF----
Q7V4V0_PROMM/221-479--------ERT..F----------RSV...LHLMQRFP----------D--FHF..SHSSPALYQWVEHH.RPTLF----
Q826B6_STRAW/254-513--------ART..T----------SNM...TALIEDEP----------D--FVF..AMSQAQQWAWVKEH.RPEVW----
Q82MA7_STRAW/254-513--------SRT..F----------SNV...TSLADEYD----------D--FIF..ACSQAQQYEWVRDN.YPHVW----
Q8A5X3_BACTN/297-572--------DYAIEY----------CEQ...TKDYTNDA----------K--FRW..TCESAWAVDEYLKN.RPEEQ----
Q8DM33_THEEB/217-475--------QST..F----------QSV...LGLKKRYP----------E--LTF..THSTPALYAHLQTH.APELF----
Q8G4P9_BIFLO/264-528--------GRT..V----------SNA...LALMDIDP----------D--FTY..VMSAAQHFAWLEER.HPDLF----
Q8G4Q0_BIFLO/268-532--------ART..V----------SNV...LALMDEDP----------D--FTY..AMSSAQQYAWLEEE.HPDLF----
Q8G4Q1_BIFLO/267-531--------ART..V----------SNA...LALMDADP----------D--FKY..AMSSAQQYAWLEED.HPDIF----
Q8IPB7_DROME/48-364--------QYI..I----------DSV...VEALLRDP----------E--KRF..IYVESAFFFKWWKE.QKPKV----
Q8LPJ3_ARATH/38-350--------QNV..L----------DSI...VPALLADK----------N--RKF..IYVEQAFFQRWWNE.QSEEI----
Q8XIN5_CLOPE/235-510--------ARS..F----------STV...LKLMEEYP----------E--YIF..MSSQPQLYKFLKED.HPKVY----
Q8XM34_CLOPE/260-519--------ART..Y----------STV...LANMEKYS----------E--YVF..GASQPQLYQWMKEY.YPDLY----
Q8Y5P1_LISMO/243-513--------ARS..F----------STV...LHLMEDYP----------E--YLF..LQSQPQLYAYIKED.YPEIY----
Q8Y9W8_LISMO/5-267--------VKH..L----------KEV...IETLEAKE----------D--YHFYLMDAQSSLIEDYLRY.CPEDK----
Q8YYK0_NOSS1/230-491--------QNT..F----------ASV...LKLQQDFP----------E--LIF..CHSTPALYAWIEEH.RPDLF----
Q97UK5_SULSO/220-473--------LRT..F----------STI...LTLLDKY.----------D--FHF..IQSAAIYYEWVKAD.SPELF----
Q9FKW9_ARATH/48-359--------RNV..L----------DSV...VDSLLRDP----------N--RKF..VFAEMAFFTRWWEE.QSPER----
Q9KEQ8_BACHD/237-511--------KRT..F----------STV...LRLMDLYP----------D--YVY..LQSQPQLYQWMKEE.EPKLY----
Q9LFR0_ARATH/154-493--------RHI..L----------DTI...VETLSKDS----------R--RKF..IWEEMSYLERWWRD.ASPNK----
MAN1_SCHPO/282-549--------VRS..W----------ATQ...MNIMDRYP----------E--YQF..VCSQALQYLWLKED.HPDVF----
Q9VLI0_DROME/38-352--------QYI..I----------DTV...ISELIKNP----------D--RRF..IQVETSFFSKWWNE.QSETM----
Q9X2G6_THEMA/247-507--------LRT..F----------ANS...VLLSKLYP----------E--FVY..TQSSAQMYEDLKQN.SPELF----
B2HSI3_MYCMM/98-400--------TNG..F----------ELVHAHLEMARRDP----------D--YKF..VLAEVDYLKPYWDT.HPQDR----
C8VJ45_EMENI/284-549--------ARS..W----------SNQ...CDLMDRYP----------E--HRF..TCSQAQQFKWLKQY.YPSVF----
H9JRV7_BOMMO/33-353--------KNI..I----------NNI...VQKLHQYP----------N--MTF..IWTEISFLNSWWER.SHPIK----
Q9VF33_DROME/169-499--------RQI..L----------NLL...VTKMQEYT----------D--MTF..IWSEISFLQLWWDQ.AHPTK----
Q9VLH9_DROME/39-352--------QYI..I----------DTV...IAELIKDP----------A--RRF..IQVETSFFAKWWAE.QSETA----
Q9VLI2_DROME/38-351--------QYI..F----------DTV...VAELSKDS----------R--RRF..IQVETGFFAKWWED.QSETK----

PF10096

Q18AM8_PEPD6/233-467--------.KN--L----------VEI---ADYLSSKN--------I-P..FTI--ALIPAYVNPKNHK.----------
M1UCJ4_BACIU/208-474--------.KL--L----------LQA---GTYLHKRH--------I-P..FIL--AVIPVYLNPETGD.----------
Q5JH22_THEKO/56-259--------.KE--L----------KEI---TEIIDEYG--------M-ANNTYF--FVIPNHAGKHP...----------
A9AA29_METM6/35-240--------.ED--L----------KEI---DEVISKYG--------Y-SKRTYL--FLIVNHANDNP...----------
A6VGM2_METM7/35-240--------.ED--L----------KEI---DEVISKYG--------Y-SKRTYL--FLIVNHANDNP...----------
Q6LXR4_METMP/34-239--------.ED--L----------KEI---DQVISKYG--------Y-SKRTYL--FLIVNHANEYP...----------
A4FWP9_METM5/37-242--------.DD--L----------KEI---DEVISKYG--------Y-PERTYL--FLIVNHANEYP...----------
A6UV77_META3/44-251--------.NK--L----------KKI---TSIIDKYN--------C-SNNTIL--FVIPDLENPYSGG.----------
Q7MSW5_WOLSU/4-254--------.KK--W----------KRI---EEILDHYS--------I-S..PIV--AVIPSNQDPQMRI.----------
B2TDN6_BURPP/5-202--------.SR--F----------DPF---DELSMDQD--------L-P..LLV--GVVPNCLDQTLVV.----------
Q391U9_BURS3/257-532--------.SS--M----------QLL---TNYMYSKK--------I-P..FTM--ATIPLYTDPNGYYN----------
Q39N31_BURS3/258-533--------.SS--M----------KTL---TDYMYSKR--------I-P..FSI--ATIPRYEDPLGAYN----------
A3S0S8_RALSL/270-567--------.SS--M----------KKL---TDYLYPLH--------I-P..FSM--ATIPVYMDPTGYYN----------
A3RWP7_RALSL/288-565--------.ST--M----------TTL---TDYMYGKK--------I-P..FSV--AAIPLYMDPNGVYN----------
B7WV25_COMTE/256-530--------.TA--M----------KSL---TDYLYQLR--------I-P..FSI--ATIPYYKDPLGVYN----------
A1WAM2_ACISJ/315-589--------.VA--F----------KRV---VDLAFERK--------V-P..FSV--GVVPHYKDPLGAQS----------
Q1AST7_RUBXD/238-462--------.ER--I----------IRI---AGYLHEHR--------V-P..FAV--GVIPAQRFEDGSV.----------
Q1IXI2_DEIGD/311-556--------.EG--L----------RTM---LDVIQDLR--------I-P..FAL--TVIPEAYYQGVKY.----------
Q0SST1_CLOPS/180-429--------LET--I----------RVM---GRYLDKKN--------V-P..YHI--AWIPRYIDPEKKID----------
Q8XK74_CLOPE/180-429--------LET--I----------RVM---GRYLGKKN--------V-P..YHI--AWIPRYIDPEKKID----------
A5I018_CLOBH/188-437--------.EK--L----------RVI---SDYLYSKN--------I-P..FHV--AWVPRYLDPKNNID----------
A7GBL6_CLOBL/187-436--------.EK--L----------RVI---SDYLYSQN--------I-P..FHV--AWVPRYLDPKNNID----------
A6LXX4_CLOB8/129-377--------.EK--L----------RVV---ADYMFSAG--------I-P..FHI--AWIPRFVDHKNGID----------
A6LS62_CLOB8/199-444--------.TK--I----------KIM---ANLLFSQG--------L-K..FHI--SWIPRFVVPSANFD----------
A6LXK7_CLOB8/199-442--------.TK--I----------KLM---ANLFYSQG--------M-K..YHV--SWIPRFKSPTENID----------
Q0SV96_CLOPS/198-445--------.EK--M----------KYL---SDYFKANN--------I-V..FHI--AWIPRYINPEKNID----------
A5D0J0_PELTS/44-299--------.EK--L----------KAI---ADYLHSEG--------V-P..FHV--SVIPVYKDPRKNVE----------
Q897A5_CLOTE/246-480--------.KI--L----------REM---AEYLYKEN--------I-P..YMV--ALIPVFIDTKTGY.----------
A7GCY7_CLOBL/229-463--------.NK--L----------KAI---ADYLYSED--------I-P..FMI--ALIPTFVDTKTGY.----------
Q65D17_BACLD/215-481--------.KL--L----------LQA---GSYLHKRN--------I-P..FIL--SVIPVYVNPETGD.----------
A7Z1H4_BACA2/214-480--------.TL--L----------YEA---GAYLHKRH--------I-P..FIL--AVIPVYLNPENGE.----------
A8FA31_BACP2/214-479--------.KK--L----------LEL---GQYVSAQH--------I-P..YQI--AVTPAWIDRATGD.----------
A9VQC2_BACWK/212-474--------.KQ--L----------KEI---AELLKEKK--------L-P..YMI--TVIPVYKDPDTGK.----------
Q3EJ39_BACTI/132-394--------.YQ--L----------KEI---AELLKEKK--------I-P..YMI--TVIPVYTDPDTGK.----------
A3IBG5_9BACI/196-373--------.GK--L----------EKV---VKAFTKNR--------V-P..IAL--EVTPILLDEYEKN.----------
Q1WTJ8_LACS1/90-295--------.EY--L----------DKL---VDDLYRNN--------V-P..FAV--SATNVEGNTNQFA.----------
A0A037ZQ94_ENTFL/224-427--------.SV--A----------TYL---QEELVKTT--------Y-P..YIL--SSTSVSQNNTILP.----------
Q03HA5_PEDPA/224-420--------.KL--L----------DQL---SVFCEKHG--------I-P..LAI--STSTVAKNTEMHA.----------
A6M167_CLOB8/134-348--------.NN--L----------IDE---VDYLKDKG--------I-K..FFI--EAAPVFVNENLKA.----------
A0AFX4_LISW6/211-439--------.DL--L----------KKT---ADTFYEQG--------V-P..FIV--SAGPIFYNQDFQA.----------

PF15421

Q8A8I5_BACTN/62-500FDIKHLQKGDL--P----------PTI---ISANQSLGCTDGAGNEV-R--FAITTTLAPEEKWMDAETNVLPGFT----
Q5LDR1_BACFN/50-470YHYEQLKQDDL--P----------PDI---YYLGKTLGCTDGTGKEV-R--FSFTATLAADDNYMAEESIINLGYS----
D4IMW2_9BACT/39-464YNAPHLRGGDM--P----------PDT---YSFGKALGSTDGTGREV-R--FSFTTAISPEWGYMDDKAVVRPGFT----
R5UTM0_9PORP/51-471YDVRQYLNDDL--P----------PDV---YTLGKTLGSTDGAGNEV-R--FNFTTTLAPEWDFMNAKTVVSSGFS----
R6DLU9_9BACE/67-497YDLVHLQEGDL--P----------PDY---YYLGKTLGSTDGTGREV-R--FSFATTVAAEWEFMNAHSNVNKGFD----

PF03746

D7BG02_MEISD/3-241------------------------EEL---FKYVTSAN--------L-A--CGF--HAGDPLTLYKSVRL----------
W5XZK8_9CORY/7-245------------------------EEV---LRLVSSAN--------V-A--CGF--HAGDPSVMMRTIEA----------
D5QFG9_KOMHA/3-241------------------------DGL---MDTVSSAN--------I-A--CGF--HAGDYAIMDRTVRL----------
Q6LSN4_PHOPR/2-250------------------------QRV---MPFIDMAN--------I-A--CGF--HASDPDIMAQTVEW----------
I0JJ59_HALH3/4-242------------------------EEI---LKYVTSAN--------I-A--CGF--HAGDPSIMRKTVKL----------
F4C1I4_SPHS2/4-242------------------------DML---FDYISSAN--------I-A--CGF--HAGDPDVMQRTVAR----------
Q2RU90_RHORT/5-243------------------------AAM---LDIVRSAN--------I-A--CGF--HAGDPLVMARTVHL----------
D5MN08_9BACT/6-243------------------------EAL---MPSLTSAS--------I-A--CGW--HGGDPQVMRRTVRL----------
R5XP92_9FIRM/4-242------------------------DKV---IPLITSAN--------V-A--CGY--HASDPVVMDKTLGM----------
L7WC11_NONDD/4-237------------------------AML---MSHISSCN--------I-A--CGG--HYGDENSIALTLQL----------
D6Y0B4_BACIE/3-241------------------------EGL---MDVITSAN--------I-A--CGF--HAGDYRTMAETVAL----------
D5BG15_ZUNPS/4-236------------------------HLL---MPLISSCN--------I-A--CGG--HAGDIKTMRKTLNL----------
M3DE22_SPHMS/8-244------------------------DEL---IPLIDHAN--------I-A--CGF--HAGDPLIMQETVLK----------
D5EDK5_AMICL/4-242------------------------EDV---MKSITSAN--------I-A--CGF--HAGDPQVMLKTVQE----------
G8S4N9_ACTS5/10-248------------------------EAL---LDVVTSAN--------V-A--CGF--HAGDPSTMHRVCRA----------
F5XPT6_MICPN/6-244------------------------DAL---LELVTSAN--------V-A--CGF--HAGDPDILRRVCDR----------
Y1143_NATTJ/4-242------------------------EEV---INYISSAN--------I-A--CGF--HAGDPQVMDYTVKL----------
F5XTC9_MICPN/4-241------------------------EAV---LELLTSAN--------V-A--CGF--HAGDPRTMDQTVAR----------
R5E047_9CLOT/3-241------------------------QEV---IPYVSSVN--------V-A--CGY--HAGDPCVMTKTVKL----------
E3H7Y1_ILYPC/4-242------------------------KEI---LKYVSSAN--------I-A--CGW--HGGDPMVMDKTVEM----------
D0IYS7_COMT2/4-242------------------------AAM---LDIVSSAN--------V-A--CGF--HAGDPAGMLTTLRA----------
Y1384_PEPD6/4-242------------------------EEV---LKYISSAN--------I-A--CGF--HAGDPSHMEKTVQL----------
Q4FSQ9_PSYA2/3-236------------------------DKL---LTIVSSAN--------V-C--CGL--HAGSYSEMLATLQL----------
L0DCE0_SINAD/9-227------------------------RVI---LDFVTSAS--------V-C--CGA--HAADRAVILETLRE----------
E6SM88_THEM7/5-243------------------------EET---LPLVSSAN--------I-A--CGF--HGGDPRVMERTVQR----------
Y2112_KOCRD/4-242------------------------AAV---FRSVSSAN--------V-A--CGF--HAGDPSVMAQTCRD----------
A5DMJ6_PICGU/30-269------------------------AEL---MPLIDTAN--------I-A--CGG--HAGDPRIMRETIQL----------
A2U3P8_9FLAO/3-236------------------------HLI---MPYISSCN--------I-A--CGG--HFGDKQTIDKTIQL----------
B1ZX56_OPITP/4-232------------------------AEL---MPLISSAN--------I-A--CGA--HAGDAQTMQAAVAL----------
Y2917_PSESM/3-241------------------------EAL---MQLISSAN--------V-A--CGF--HAGDPLIMDSTVRR----------
U4KC78_9VIBR/2-236------------------------EAL---MPYITEAN--------V-A--CGF--HASDPNHMKRTVEL----------
R9VRL9_9ENTR/3-236------------------------AAL---LQLVSSAN--------I-A--CGF--HAGDAQTMLSCVRE----------
F5YAB0_TREAZ/4-242------------------------DKI---IPLVSSAN--------I-A--CGF--HAGDPLVMEKTVAL----------
G3B4G0_CANTC/32-271------------------------EDI---MPLIDRAN--------I-A--CGG--HASDPSIMLKTIKL----------
S5XZQ9_PARAH/1-238------------------------AAM---LKIVTSAN--------I-A--CGF--HAGDPAGLLRTLRW----------
C5CZ15_VARPS/3-236------------------------EAL---LGLVSSAN--------I-A--CGW--HAGDAKTMRQCVRW----------
D1C8S7_SPHTD/5-240------------------------AEL---MTVITSAN--------I-A--CGW--HAGDPAVMRETVAL----------
B4EWE9_PROMH/5-242------------------------AAV---LEIVSSAN--------I-A--CGF--HAGSPEGILKTLKA----------
E8NF87_MICTS/3-240------------------------EAM---FAVISSAN--------V-A--CGG--HAGDPASMREAVAR----------
Q1IXD6_DEIGD/5-238------------------------AAI---MPHVTSAN--------I-A--CGG--HAGDAETMRDSLRL----------
Y1821_BACHD/4-242------------------------DRV---LEHVTSAN--------I-A--CGY--HAGDHNVMARTVKL----------
F6FQW1_ISOV2/4-241------------------------AAM---LALVSSAN--------V-A--CGF--HAGDPATIRRTVRL----------
U5RSR8_9CLOT/3-239------------------------EAL---MPYVTSAN--------I-A--TCF--HAGDPLVLERTIKW----------
Y1029_CHRSD/6-245------------------------DEV---MPYVDCAN--------I-A--CGF--HASDPGIMRRTVAL----------
Y2522_SYMTH/11-249------------------------EEI---MPLITSAN--------I-A--CGF--HGGDPQVMRRTVRL----------
G2PME2_MURRD/6-239------------------------ADI---FPYISSCN--------I-A--CGG--HAGNQETMLKVASQ----------
M1MIN5_9CLOT/4-242------------------------EEI---ISYVSSAN--------I-A--CGF--HAADPLVMDHTVKL----------
Y2314_ERWT9/3-235------------------------RAL---LRLVSSAN--------I-A--CGF--HAGDAQTMLQSVRW----------
Q0S878_RHOSR/47-285------------------------LAM---LKLVTSAN--------V-A--CGF--HAGDPTTLSATCSA----------
U3TWJ9_9ENTR/3-236------------------------RAL---LELVSSAN--------I-A--CGF--HVGDAETILQSVRW----------
D3EM31_GEOS4/4-242------------------------KEL---LRSITSAN--------I-A--CGF--HAGDPAVMRATVRQ----------
Y535_KINRD/4-242------------------------AAM---LRIVTSAN--------V-S--CGF--HAGSPEGIRDTVLA----------
A3UBZ2_CROAH/4-236------------------------HKL---MPLITSCS--------I-A--CGG--HFGNIDTMNSAVVL----------
H2IWK8_RAHAC/3-236------------------------EAL---LQLVSSAN--------I-A--CGF--HAGDAQTMQQCVRG----------
C6XL46_HIRBI/7-240------------------------VDI---MPYISSCN--------I-A--CGG--HTGDRESIAEAMTL----------
G9MQN1_HYPVG/10-247------------------------EEL---MPFIDAAN--------I-A--CGF--HAGDPSIMLKTIRL----------
Y2112_PSEAE/4-245------------------------AEV---MPLIDCAN--------I-A--CGF--HAGDPGTMRRTVAL----------
Y4436_RALSO/3-241------------------------EAM---MSLISSAN--------I-A--CGF--HAGDPLIMDRTVRL----------
Y2790_CLOK5/4-243------------------------EEI---LKYITSAN--------I-A--CGF--HAGDPKIMHETVRL----------
D7A9V4_STAND/3-236------------------------AGI---MPHIQIGN--------V-A--CGF--HAADPVVMSKTVRL----------
M5A4V0_9ACTN/5-243------------------------DAM---LDLVSSAN--------V-A--CGG--HAGDPDIMFRTLSN----------
R5QKJ0_9FIRM/3-241------------------------EEV---IQYVSSVN--------V-A--CGF--HASDPVVMAETVRL----------
W5TLR8_9NOCA/3-239------------------------AAL---LGIVTSAN--------I-A--CGF--HAGDPAIMRRTCDL----------
Y2520_ACIAD/3-241------------------------EQI---LPMVSSAN--------I-A--CGF--HAGDPLGIFKTLKQ----------
D7A110_STAND/4-243------------------------KAM---LDIVTSAN--------I-A--CGF--HAGDPLVMADTLAS----------
I0DPN0_PROSM/5-243------------------------TAM---LKIVSSAN--------I-A--CGF--HAGSPEGILRTLKA----------
D2PYH8_KRIFD/4-242------------------------NAL---LDVVTSAN--------V-A--CGF--HAGDPSIMRAVCRR----------
B7VS04_VIBSL/1-234------------------------ESV---MEWVDMAN--------I-A--CGF--HASDPHVMSKTIKL----------
L0G1R1_ECHVK/3-236------------------------ADV---MAYITSCN--------I-A--CGG--HAGDAKSMADTIKL----------
Y2655_BREBN/4-242------------------------QEI---LSYITSAN--------V-A--CGF--HAGDPATMRKTVQM----------
Y1272_PYRFU/3-241------------------------DEV---MKYITSAN--------V-A--CGW--HAGDPLVMRKTVRL----------
F4H0L0_CELFA/5-255------------------------SAL---LDAVTSAN--------V-A--CGF--HAGDERVMAAVCRA----------
A9WUH9_RENSM/280-518------------------------DAL---LAMVTSAN--------V-A--CGF--HAGDPIMMLRTART----------
D6Y403_THEBD/3-248------------------------EAL---LDVVSSAN--------V-A--CGF--HAGDPLIIRRTCAA----------
F4GUU2_PUSST/5-243------------------------EEI---LPYVTSAN--------I-A--CGY--HAGDPAVMRRTVAA----------
A5WHM5_PSYWF/13-246------------------------IAL---MNIISSAN--------V-S--CGL--HAGSYQHMLETLKL----------
I3Z849_BELBD/30-262------------------------SML---MPYLGSCN--------I-A--CGG--HFGDLETIKSAILL----------
M4RSN8_9BIFI/4-242------------------------TAL---LGVVSSAN--------V-A--CGF--HAGDPAGMLRTVGY----------
M9R857_9RHOB/6-244------------------------QEI---MSLISSAN--------I-A--AGF--HAGDPNSMDRVIKL----------
R7JBC4_9FUSO/13-246------------------------FEL---LDYASSVN--------I-S--CGF--HAGDPLTIKNALLK----------
C5D2N8_GEOSW/3-241------------------------KEI---LQYVTSVN--------V-A--CGF--HAGDPLVMRKTVQM----------
D5V4N2_ARCNC/3-244------------------------EEI---MPYINMAN--------L-A--CGF--HAGDALNMAKSVSL----------
R5B6J0_9CLOT/6-244------------------------ADV---LSFVSSAN--------I-A--CGF--HAGDPAVMRKTVAL----------
D8J6F9_HALJB/4-240------------------------EAV---MPYITSAN--------V-A--GGY--HAGDPHVMDRTVAL----------
Q2KTU9_BORA1/6-244------------------------EQI---MPLISSAN--------I-A--TGF--HAGDPNIMSRTVLM----------
C5D207_VARPS/3-241------------------------EAL---LDIVSSAN--------V-A--CGF--HAGDPVIMDRTVRL----------
F8Q293_SERL3/10-254------------------------ENL---MKTIHLAN--------I-A--CGF--HAGDFSVMNQAVIY----------
E9T1F8_COREQ/4-242------------------------AAM---LDLVTSAN--------V-A--GGF--HAGDPATLLRTCRD----------
H8KYG9_FRAAD/4-242------------------------ESL---LPLLSSAN--------I-A--CGF--HAGDSSIMDRTIRT----------
Y1612_LACF3/4-240------------------------DQV---LDLITAAN--------V-A--CGF--HAGDPDVMAQTVAL----------
R7AUI2_9FIRM/4-242------------------------EQI---IPLISSAN--------I-A--CGF--HASDPVVMEKTVKM----------
L0A698_DEIPD/4-241------------------------AAV---MKFITSAN--------I-A--CGF--HAGDFSTMRRTVDL----------
F5Z8H6_ALTSS/2-241------------------------ADI---MKFIDQAN--------I-A--CGF--HAGDPVVMKQALYL----------
E0TF98_PARBH/9-240------------------------RAL---IPLVSSVN--------I-A--CGG--HAGTPETMRRAVDL----------
C3AMS1_BACMY/4-240------------------------DKI---LPFVSSVN--------I-A--CGF--HAGDPTVMRQTVEK----------
Y1004_CORGL/4-242------------------------VAV---LDLVSSAN--------I-A--CGF--HAGDATVLFKTVRA----------
U4KHV1_9VIBR/2-235------------------------SDV---MPFIDMAN--------I-A--CGF--HASDPLTMDTTVRL----------
A4X134_SALTO/1-238------------------------AAL---LDLVTSAN--------V-A--CGF--HAGDAVTMRRVCAG----------
X5DN33_9CORY/5-237------------------------EHL---MEVIDLAN--------V-A--CGF--HASDPQIMDRTVAL----------
F0RQS5_DEIPM/3-243------------------------AAL---FPELTSVN--------L-A--LGF--HAGDPLTLRESVAL----------
R5T180_9GAMM/13-246------------------------YEL---LDYVSSVN--------V-S--CGF--HAGDPVTIKEAMLR----------
A9I0Z0_BORPD/28-266------------------------EAV---LEFVSSAN--------V-A--CGF--HGGDPSTMRKTVAA----------
A3Q8T1_SHELP/8-241------------------------EAL---LTLVTSAN--------I-A--CGG--HAGDRQSMLATVKL----------
R6NVF4_9CLOT/4-237------------------------AQI---IPLITGAN--------I-A--CGF--HAGGSEIMDKTIDL----------
A5D328_PELTS/1-237------------------------GEV---MRYITSAN--------V-A--CGF--HAGDPLVMHETVRL----------
F7QMW8_9BRAD/3-242------------------------DAM---LGLASSVN--------V-A--CGF--HAGDSDIMLKTAKL----------
I2BBK3_SHIBC/7-245------------------------DAI---LALVSSAN--------V-A--CGF--HAGSPDVILATVRA----------
D5V4P7_ARCNC/3-243------------------------EEI---MPYIDMAN--------L-A--CGF--HASDALTMNKSVAL----------
B1HUZ0_LYSSC/2-236------------------------EEI---LDYVTSIN--------I-A--CGY--HAGDHSIMHQTVRN----------
C5C6S0_MICLC/7-245------------------------AAI---MPSVSSAN--------V-A--CGF--HAGDPSGIAQTCRD----------
X2GVX0_9BACI/3-237------------------------DEI---LDYVTSIN--------I-A--CGY--HAGNHTIMHRTVQN----------
A0QXR8_MYCS2/4-236------------------------AEM---MPLITSAN--------I-A--CGG--HGGDPAVMRTSVAL----------
Y2372_RALPJ/4-237------------------------EAL---LALVSSAN--------I-A--CGW--HAGDVNTMRQTVGW----------
E6TY73_BACCJ/5-243------------------------KEI---LQYITSAN--------I-A--CGY--HAGDHNVIFETVKE----------
H2G083_OCESG/4-245------------------------EAV---MPYVDLAN--------V-A--CGF--HAADPDTMRRTVHL----------
Q0RVU6_RHOSR/3-237------------------------EEL---LKHVTSVN--------T-A--CGF--HGGDPGWMRNSVRL----------
F4KPP8_HALH1/2-235------------------------AAL---MPLISSAN--------I-A--CGY--HAGDRVTMRSTIAL----------
E2PUA2_STRC2/26-264------------------------AEL---LSVVTSAN--------V-A--CGF--HAGDAVTMRRVCRL----------
G0G150_AMYMS/1-239------------------------EAM---LDIVTSAN--------V-A--CGF--HAGDPSVMRRVCEL----------
R4LWQ2_9ACTO/1-239------------------------AAM---LDIVSSAN--------I-A--CGF--HAGDPRTLFETCER----------
D2B933_STRRD/3-241------------------------MAL---LDIVTSAN--------I-A--CGF--HAGDPLTIRRTCAA----------
Y3392_SYNFM/3-241------------------------EKV---MPCITSAN--------V-A--CGW--HAGDPMIMARTLEL----------
B6JF92_OLICO/5-244------------------------EAM---LDVATSVN--------V-A--CGF--HAGDPDIMRRIALR----------
F8IB92_SULAT/6-243------------------------ESV---LPYITSAN--------V-A--CGF--HAGDPRVMARTVRL----------
W1QAN8_OGAPD/24-260------------------------EEL---MPLIDVAN--------I-A--CGF--HAGDFNIMAKMVKL----------
E3Q2S8_COLGM/10-249------------------------EEL---MSYIDAAN--------I-A--CGF--HAGDPAIMLKTVRL----------
D3PTP5_MEIRD/3-241------------------------EEL---FPLLSSVN--------V-A--CGF--HAGDPLTMGRTLEL----------
E4TP81_MARTH/4-239------------------------DSV---FPYISSCN--------I-A--CGF--HGGDPLHMENTIKK----------
A9AYX3_HERA2/3-236------------------------AEL---MSLLSSCN--------I-A--CGG--HAGDQASMRTALQL----------
F4CNG9_PSEUX/4-242------------------------DAM---LAIITSAN--------V-A--CGF--HAGDPSTLRATTSV----------
Y1488_MACCJ/3-241------------------------EAI---IPLITSAN--------I-A--CGM--HAGDFNVLNQTIEL----------
J5JGM9_BEAB2/14-248------------------------EEL---MPLIDAAN--------I-A--CGF--HAGDPSIMLKTIRL----------
D1BTW0_XYLCX/4-242------------------------AAM---LDVVSSAN--------V-A--GGF--HAGDPAGIRRTVRL----------
Y407_CORJK/10-248------------------------AAM---VAIVSSAN--------V-A--CGF--HAGDAHAISNTLAA----------
V5XGL8_MYCNE/4-242------------------------DAM---LDIVTSAN--------V-A--CGF--HAGDPAGLLRVCRA----------
D5WUZ1_KYRT2/4-242------------------------GPL---LDVVSSAN--------I-A--CGF--HAGDPAVMRKTVQL----------
C5AT01_METEA/6-244------------------------AAL---LDIVTSAN--------V-A--CGF--HAGDPDIMVETVIA----------
B0RI75_CLAMS/3-241------------------------DAM---LDVVSSAN--------V-A--CGF--HAGDPLVMLHALER----------
K4IM75_PSYTT/4-236------------------------ALL---MPFLSSCN--------I-A--CGG--HYGTVETVRKAVEL----------
Y3770_BACSK/4-242------------------------EKI---MPYISSAN--------I-A--CGF--HAGDAHVMRETVAR----------
G2NVC5_STRVO/7-244------------------------GAL---LTLVTSSN--------I-A--CGF--HAGDPRIMDRTVAG----------
Q5NI64_FRATT/3-227------------------------DRL---VDYIDIAN--------I-A--CGG--HAGDKASVDYYVNL----------
C5BPU8_TERTT/2-239------------------------AQV---MPFLQMAN--------I-A--CGA--HAGNPERLKKSLEL----------
Y2634_CROS8/4-237------------------------ALL---MPLISSAN--------I-A--CGF--HAGDAQTMRESVRL----------
G0IXS0_CYCMS/5-233------------------------NAI---MPFLGSCN--------I-A--AGG--HAGNEKTILKTIKL----------
N1PZT0_MYCP1/8-245------------------------EDL---IPMIDHAN--------I-A--CGF--HAGDPLIMQRTVKL----------
Q0SB09_RHOSR/3-241------------------------EAL---LDIVTSAN--------I-A--CGF--HAGDPMIIRRACEG----------
M1E8N0_9FIRM/3-239------------------------TEI---IGFVSSIN--------V-A--CGM--HAGDPMVMLKTVEM----------
C7NIG6_KYTSD/4-242------------------------DAL---LGVVTSAN--------V-A--TGF--HAGDPLIMRTTCEK----------
D9QUX4_ACEAZ/4-242------------------------EEI---VPHITSAN--------I-A--CGW--HAGDPTVMAHTVDI----------
G8RT09_MYCRN/15-253------------------------DAM---LDVVTSAN--------V-A--CGF--HAGDATLLLRTCRT----------
R5C385_9FIRM/4-242------------------------EEI---IQYVTAAN--------V-A--CGW--HAGDPMIMDRTVKM----------
E1VFF3_9GAMM/4-235------------------------ERL---MPLIQRAN--------I-A--CGG--HAGDNASITNSLRL----------
W6EGN0_SULMU/3-242------------------------EAI---MPYVDMAN--------F-A--CGF--HAGDPLIMDRSIKL----------
E4RUB2_LEAB4/3-231------------------------LEL---MPYVDAVN--------I-S--CGY--HAGSLDILRTTIKN----------
D5DCK3_BACMD/4-242------------------------KEI---LRYVTSAN--------I-A--CGF--HAGDPSVMRETVKL----------
D9RZ18_THEOJ/5-243------------------------EEI---VKYISSAN--------I-A--CGF--HAGDPLVMDRTVMH----------
E2SG17_9ACTO/9-231------------------------LAL---LDVVTSAN--------V-C--CGA--YAGDEGLMFATCLA----------
Y1541_CAMJE/4-242------------------------EEI---LKFVSSVN--------V-A--CGF--HAGDPCVMDETLNL----------
D3Q482_STANL/5-243------------------------EAL---LDIVTSAN--------V-A--CGF--HAGDPSIMRAVCER----------
D6ZAE9_SEGRD/6-231------------------------GAM---LEMVSSAN--------I-A--CGF--HGGDPATLWETCQA----------
C0ZM31_RHOE4/5-242------------------------DAL---LDTLTSAN--------I-A--CGF--HAGDPRTMDATVRG----------
M3B8E6_MYCFI/8-245------------------------DEL---IPLIDHAN--------I-A--CGF--HAGDPLIMQQTVEK----------
G4R9N3_PELHB/5-238------------------------RAM---LEIVTSAS--------I-A--CGG--HAGNEHTMRAAVQD----------
Q0C0C1_HYPNA/5-242------------------------HAI---LDVVSRCS--------I-A--CGG--HAGDAESMAETLRM----------
X5EC88_9CORY/4-241------------------------PAM---IALVSSAN--------V-A--TGF--HAGDPHDIAATVRA----------
W0HWN7_9ENTR/4-243------------------------ETL---MSLISSAN--------I-A--CGF--HAGDPSIMRATLIR----------
Y4486_PECAS/3-241------------------------DAM---MRIVSSAN--------I-A--CGF--HAGDPAIMTRMVRL----------
D4MW94_9FIRM/4-242------------------------DKI---IPLITSAN--------V-A--CGY--HASDPVVMMETIQR----------
F4HE29_GALAU/4-237------------------------QRL---LQLVTSAN--------V-A--CGL--HAGDFNEMRKAIRW----------
K0B3I8_CLOA9/8-246------------------------EEI---VKYITSAN--------I-A--CGW--HAGDPITMEKTIEI----------
Y2450_CARHZ/4-240------------------------EAI---LPLVSSIN--------V-A--CGF--HAGDFMVMAECCKL----------
D7CXP4_TRURR/5-245------------------------EAL---MPQLTSAN--------L-A--CGF--HAGDPLTIRRSVAL----------
Y1858_TOLAT/4-242------------------------TQI---MPLVSSAN--------I-A--CGF--HAGDPSVMRKTLEA----------
F8KSZ7_HELBC/4-242------------------------EAI---LECVSSAN--------V-A--CGW--HAGDALIMEGMAQR----------
A1RBG9_ARTAT/5-242------------------------SEL---LEIVSSAN--------I-A--CGF--HAGDPDIMAATVAE----------
D8IRE9_HERSS/3-236------------------------EQL---LTLVSSAN--------I-A--CGW--HAGDANTMRRSVRW----------
A4CKX7_ROBBH/8-240------------------------QEL---FPHISSCN--------I-A--CGG--HAGNRESMKEIVTL----------
K0L0G1_WICCF/20-257------------------------DEI---IKYIDRAN--------I-A--CGF--HAGDYNIMLKTVQN----------
H0Q289_9RHOO/5-243------------------------AAM---LEVVNSAN--------V-A--CGF--HAGDPLVMQQTVAT----------
V5UEX5_9BURK/3-235------------------------EAL---LALVSSAN--------V-A--CGW--HAGDAGTMQQVVRW----------
Q1GEX9_RUEST/5-243------------------------AEV---LDVVTSAN--------V-A--CGV--HAGDWDVMAQTMAD----------
G3JBY9_CORMM/25-269------------------------EAI---MPHINSCS--------I-A--CGF--HAGDPMVMYKTIQA----------
C0ZPT0_RHOE4/5-243------------------------DAM---LELVTSAN--------I-A--CGF--HAGDPTTLLATCES----------
Y2677_OCEIH/5-243------------------------DEV---MEFITSAN--------I-A--CGY--HAGDHNIIHRTIDL----------
B8ESL6_METSB/13-251------------------------AAM---LEIVSSAS--------V-A--CGF--HAGDPQIMAAVFAT----------
A0M393_GRAFK/5-237------------------------EQL---MPLISACN--------I-A--CGG--HAGNLETMHRTVRL----------
Y3659_RUEPO/4-242------------------------DSL---LKIITSAN--------I-A--CGF--HAGDPDVMAKTMAL----------
W0PB55_9BURK/4-242------------------------AAI---MPYVTSAN--------I-A--CGF--HAGDAHTMRRTMQL----------
Y228_NEIMB/4-237------------------------EAL---LQLITSAN--------I-A--CAQ--HAGSIADIRAALAY----------
M9LS18_PSEA3/10-256------------------------EEL---MKYIDVAN--------V-A--CGF--HASDPVTLHKTVKL----------
Y5076_MYCMM/4-242------------------------DAM---LGIVTSAN--------V-A--CGF--HAGEPAGLLRVCRA----------
E4TEH0_CALNY/3-241------------------------EEV---IKFVDRVN--------I-A--CGF--HAGDPIVMDKTVSL----------
C0S3Y3_PARBP/10-245------------------------LEL---LPMIDQAN--------I-A--CGF--HAGDPLIMMEAVRN----------
Q03XI2_LEUMM/7-243------------------------SEI---LHQVTSAN--------V-A--CGF--HAGDASIMAQTVQL----------
C7MY76_SACVD/5-243------------------------EAL---LDVVTSAN--------V-A--CGF--HAGDPSVLRRVTER----------
Y870_ALBFT/3-241------------------------AAM---LGIVSSAN--------V-A--CGF--HAGDPAGVLRTLRR----------
D5WT32_KYRT2/3-240------------------------EEM---MKYISSAN--------V-A--GGF--HAGDPHVMRRTVEL----------
G7V6Q9_THELD/4-242------------------------EAV---LESVSSAN--------V-A--CGF--HAGDPLVMLKTVRA----------
W0K188_9EURY/4-239------------------------EEV---MPYISSAN--------I-A--GGY--HGGDPHVMRETVAL----------
C8WJT5_EGGLE/4-242------------------------DQI---IPLVSSAN--------I-A--CGQ--HAGDPVVMRKTVGM----------
F8A3C2_CELGA/1-238------------------------EAL---LHVVTSAN--------V-A--CGG--HAGDAATMAAVLRT----------
D5USV9_TSUPD/5-243------------------------DAL---LGIVSSAN--------V-A--CGF--HAGDPSTLRATCAR----------
C7MA67_BRAFD/8-245------------------------AAM---LEVVTTAN--------V-A--CGG--HAGDAGTMRAATRA----------
R6ZG54_9CLOT/4-242------------------------EEI---LKYVSSAN--------V-A--CGW--HAGDPMVMEKTVAL----------
E3I0X6_RHOVT/3-241------------------------EEL---VGIITSAN--------V-A--CGF--HGGDATIMHGLAVA----------
R6WIY8_9FIRM/4-242------------------------EEI---IPYISSAN--------T-A--CGF--HASDPLVMEQTVKL----------
Y3193_STRGG/2-240------------------------DAL---LACVTSAN--------V-A--CGF--HAGDASVMRRVCDA----------
J9Z0K8_9PROT/6-239------------------------LPL---ITQINSAN--------I-G--CLY--HGGVEEVVQKATQE----------
L0A0G9_DEIPD/6-244------------------------HEL---FPFLSSVN--------L-A--CGF--HAGDPLTMQRTVAL----------
D2SFX6_GEOOG/1-239------------------------EAL---LDVVTSAN--------V-A--CGF--HAGDPSIMRRVCAR----------
F2IVP4_POLGS/3-236------------------------AGI---MPFIHIAN--------V-A--CGF--HASDFNHMRETVRL----------
Y5378_PSESM/4-242------------------------AAM---LDIVTSAN--------V-A--CGF--HAGDPAGILRTLKA----------
R5D7F4_9FIRM/4-242------------------------EEV---IPFISSAN--------V-A--CGF--HASDPVVMAKTVAL----------
A1WRL8_VEREI/23-261------------------------EQI---MPLISSAN--------I-A--TGF--HAGDPGTMHRTVAL----------
Y492_PSEAE/4-242------------------------AAI---MPLISSAN--------I-A--TGF--HAGDPSSMRRTVEM----------
G4KUC6_OSCVS/4-242------------------------SEV---IRHVSSVN--------V-A--CGY--HAGDPLVMAQTVAM----------
B9K5U5_AGRVS/3-241------------------------EAL---MDVVSSAN--------I-A--CGF--HAGDPEMMLRMVRL----------
Y2936_PSESM/3-241------------------------TEL---MAFISSAN--------I-A--TGF--HAGDPSTMRRTIEQ----------
E0SL44_DICD3/5-243------------------------REI---MSYISSAN--------I-A--AGF--HAGDPTTIRQTIEW----------
C5C2F0_BEUC1/8-228------------------------AAM---LDVVTSAS--------I-A--CGG--HAGDADTMRVACER----------
E6WID8_PANSA/3-241------------------------AAL---MQVVSSAN--------I-A--CGF--HAGDPAIMTRMVRL----------
C5AIE4_BURGB/6-244------------------------EQI---MPLISSAN--------I-A--TGF--HAGDPNIMARTVQL----------
Y126_CUPNH/3-236------------------------EAL---LALISSAN--------I-A--CGW--HAGDAATMVQTVKW----------
Y1315_CHLAA/4-242------------------------DGI---LPFVSSAN--------V-A--CGG--HAGDPMVMRRTVRR----------
B9L4Q4_THERP/5-240------------------------AAL---MPYITSAN--------I-A--CGW--HAGDPAVMRQTVEL----------
Y4277_AGRT5/3-241------------------------EAM---MKIVSSAN--------I-A--CGF--HGGDPDTMARMVRL----------
H6RAT6_NOCCG/3-241------------------------AAM---LDIVTSAN--------I-A--CGG--HAGDPSIMRKTCAA----------
A4YUI8_BRASO/5-244------------------------AAM---IELATSVN--------V-A--CGF--HAGDADIMRRTVEM----------
C6WEW0_ACTMD/3-240------------------------EAL---LDVVTSAN--------V-A--CGF--HAGDPTIMRRACEL----------
B8IQH8_METNO/3-241------------------------EAL---MPMIGSAN--------V-A--CGM--HAGDPGIMVETIRA----------
U3GU40_9CORY/2-237------------------------AAM---LAVVDRAN--------V-A--CGF--HAGDAATMIDTCTE----------
H6NIN3_9BACL/8-246------------------------EQL---VRVVTSAN--------I-A--CGF--HAGDPQTMRATVRL----------
Q223B3_ALBFT/22-260------------------------EAI---MSQISSAN--------I-A--TGF--HAGDPNIMQRMVSY----------
Y4304_PHOLL/4-242------------------------NTM---LSIVTSAN--------V-A--CGF--HAGDPAGIFQTLKS----------
M1FEE9_9ALTE/2-242------------------------DQV---MPFIDQAN--------I-A--CGF--HAGDPRVMFNTVRL----------
Y3634_BRADU/3-241------------------------EAL---MSIVSSAN--------V-A--CGF--HAGDPIIMDRMVRL----------
C6CWI5_PAESJ/6-244------------------------AEL---LPFITSVN--------I-A--CGF--HAGDPHTMHTAVKQ----------
B9JN39_AGRRK/3-241------------------------EAL---MDVVSSAN--------I-A--CGF--HAGDPETMARMVRL----------
Y1066_COREF/7-245------------------------EAV---LDLVSSAN--------I-A--CGF--HAGDATVLLKTVVA----------
X4ZHZ1_9BACL/4-242------------------------EAL---LAAVTSAN--------I-A--CGF--HAGDPGVMRKAVRA----------
Y4198_BURPS/6-244------------------------EEI---MPLISSAN--------I-A--TGF--HAGDPNIIARTVQL----------
Y3173_CHRVO/3-236------------------------AAL---LGLVSSAN--------I-A--CGW--HAGDADTMRRTVLL----------
W0HX68_9ENTR/3-242------------------------GRM---LEIVSSAN--------I-A--CGF--HAGDPEVMHSTLSL----------
G7ZEN3_AZOL4/4-243------------------------RAM---LDIVTSAN--------I-A--CGF--HAGDPTIMADTARL----------
Y439_FUSNN/5-242------------------------EEI---MKCVTSVN--------C-A--CGW--HAGDPLIMDKTIKI----------
B1VIF3_CORU7/7-244------------------------AAM---ICVVSSAN--------T-A--CGF--HAGDPHDIAKTLEA----------
I1XMA4_METNJ/11-252------------------------EQV---MPLVDMAN--------I-A--CGF--HASDPVTMTRTVLL----------
C1DQ20_AZOVD/7-248------------------------ALA---MPLIDQAN--------L-A--CGF--HAADPLTMQRSVAL----------
F4FA66_VERMA/1-238------------------------EAL---LELVTSAN--------V-A--CGF--HAGDPVTMRRVCAA----------
I4BYP2_ANAMD/4-242------------------------EAV---LDFVSSAN--------V-A--CGF--HAGDPMVMLATVRA----------
E8QYT2_ISOPI/17-247------------------------AAI---LPEITSAN--------L-G--CAR--HAGTPDDVRRTLEA----------
D7A1T1_STAND/3-241------------------------AEL---MPLIGSAN--------I-A--CGM--HAGDPTIMVATLKS----------
A6VS70_MARMS/2-241------------------------DQI---MPFVDQAN--------I-A--CGF--HASDPLTMAKTVAL----------
D1BL87_VEIPT/5-243------------------------SEV---LNHVTSAN--------I-A--CGW--HAGDPLIMDATVRI----------
V9XKP0_9NOCA/4-242------------------------ETM---LDIVTSAN--------V-A--CGF--HAGDPATLLHTCHG----------
E1VTB5_ARTAR/4-242------------------------AAI---FTSVSSAN--------V-A--CGF--HAGDPSTIAQTCRD----------
D1B9J1_THEAS/5-243------------------------ESL---LGVVSSAN--------V-A--CGF--HAGDPSVMGRTVRA----------
Y1708_STAA8/3-241------------------------HQI---IPLITSAN--------V-A--CGF--HAGDENVMNETVKL----------
R6QJ24_9FIRM/4-236------------------------EQI---IPLINSAN--------I-A--CGF--HAGNHDMMEATAKL----------
Q02CY7_SOLUE/3-225------------------------AAL---MQYITSAN--------V-A--CGG--HAGDEQTMERTVVL----------
A1R1R8_ARTAT/1-239------------------------ASM---FRIVSSAN--------V-A--CGF--HAGDPLTMLDSCRA----------
M4R6T5_BIBTR/4-237------------------------EQL---LQLVSSAN--------V-S--CGL--HAGDYNEMRKAILW----------
W0JZF2_9EURY/4-240------------------------EGV---MPYITSAN--------I-A--GGY--HAGDPHVMRETVEL----------
Y2905_BURP8/3-236------------------------EAL---LDLVSSAN--------I-A--CGW--HAGGPNAMRECVRW----------
D8PCF2_9BACT/7-245------------------------ARI---MAYVTSVN--------I-A--CGV--HAGDAAVMRSTVQL----------
Y4778_VIBVY/6-245------------------------ELV---MPWVDMAN--------I-A--CGF--HASDPSVMSKTVAL----------
R5BE93_9FIRM/4-242------------------------EAV---LTHVTSAN--------V-A--CGW--HAGDPLIMAKTVQL----------
A1T0G5_PSYIN/2-241------------------------EAV---IPWIDMAN--------I-A--CGF--HASDPDVMAKTVQS----------
W0IZ00_9BACT/3-248------------------------EAL---LERVTSAS--------I-A--CGG--HAGDAATMLRTVRA----------
C3KLX3_RHISN/4-241------------------------VSM---LGIVTSAN--------I-A--CGF--HAGDPAGILAVLRE----------
F2G9I8_ALTMD/2-244------------------------SAI---MAEIDQAN--------I-A--CGF--HAGDPLVMKQALFL----------
J7KY74_NOCAA/3-241------------------------RTL---LSIVTSAN--------V-A--CGF--HAGDPSTLRRTTAE----------
F3ZDL6_9ACTO/6-244------------------------EAL---LPLVTSAN--------V-A--CGF--HAGDPRVIRRACAG----------
G0HCZ7_CORVD/4-242------------------------HAM---IQLVTSAN--------V-A--TGF--HAGDPHSIADTVRA----------
D5DEN3_BACMD/4-242------------------------EAI---LEHVTSVN--------I-A--CGF--HAGDPSVMRKTVKL----------
B6QNE9_PENMQ/10-244------------------------KEL---LPMIDHAN--------V-A--CGF--HAGDPLIMDETVAL----------
W5XWZ0_9CORY/6-242------------------------KAM---LEMVSSAN--------V-A--TGF--HAGDPHSIAGTLKA----------
G7ZD33_AZOL4/6-244------------------------DAL---MDLISSAN--------V-A--TGF--HAGDPNLMDRVVRL----------
F2JVE0_MARM1/2-240------------------------EQI---MPYVDQAN--------I-A--CGF--HASDPLTMSKTVAL----------
W5WPA4_9CORY/7-245------------------------AAM---LGIISSAN--------V-A--CGF--HAGDPHAIATTVAE----------
X2H6N5_9GAMM/7-245------------------------QAM---LQVVSSAN--------I-A--CGF--HAGSPVTILDTLKA----------
D7WE68_9CORY/5-242------------------------AAM---LEMVSSAN--------V-A--TGF--HAGDPHSIKGTLVD----------
D8MPR3_ERWBE/3-236------------------------RDL---LQLVSSAN--------I-A--CGF--HAGDAQTMRQSVLW----------
E3EYK5_KETVY/5-244------------------------AAM---LGIVTSAN--------V-A--CGF--HAGDHEVMAKTLRL----------
A4F9Z7_SACEN/1-239------------------------AAL---LGIVTSAN--------V-A--CGY--HAGDATVIRDACEH----------
G7XL47_ASPKW/8-245------------------------EEL---IPLIDQAN--------V-A--CGF--HAGDPLIMQETVSL----------
A8LPR1_DINSH/5-243------------------------AAL---LRTITSAN--------I-A--CGA--HAGDWDVMARTMAL----------
C7JDH8_ACEP3/3-240------------------------DAL---MKVISSAN--------I-A--CGF--HAGDHLIMDRVVKA----------
N4VLC9_COLOR/6-246------------------------EEL---MKFIDVAN--------V-A--CGF--HAGDPSIMLRTLRL----------
G0L477_ZOBGA/6-239------------------------KDL---LPLISSCN--------V-A--CGG--HAGNAQSISDIVDL----------
B1MGY8_MYCA9/4-228------------------------DAM---LDVVTSAN--------L-A--CGF--HAGDPATLHRTCHA----------
Q483Q3_COLP3/2-240------------------------NEV---MPHIDQAN--------I-A--CGF--HAGDPLVMQNTLAL----------
R5KN94_9CLOT/4-237------------------------EII---IPHINSAN--------I-A--CGF--HAGSAQMMAETLEF----------
R0K0K3_SETT2/8-244------------------------DEL---IPLIDHAN--------V-A--CGF--HAGDPLIMQQTVQM----------
D0L462_GORB4/8-241------------------------EAM---LTVVTSAN--------V-A--CGF--HAGTPAELLATCSA----------
Y441_STRCO/2-240------------------------DAL---LSVVTSAN--------V-A--CGF--HAGDPSVMRRVCDL----------
H5X6J3_9PSEU/1-239------------------------AAL---LDIVTSAN--------V-A--CGF--HAGDPGAIRRTCEK----------
Q2KUF2_BORA1/5-243------------------------SAV---LPLVSSAN--------I-A--CGF--HGGDPGTMRKTVAL----------
Y3066_BACCR/4-242------------------------DEI---LPFVSSIN--------V-A--CGF--HAGDPSIMRQTVEK----------
B9JHF9_AGRRK/4-243------------------------KAM---LGLITTAN--------I-A--CGF--HAGDPVVMRDTILA----------
B0UCC0_METS4/4-242------------------------AAM---LAIVTSAN--------V-A--CGM--HAGDPQIMARTFAL----------
Q0SBI7_RHOSR/9-246------------------------DAL---LDVLTSAN--------V-A--CGF--HAGDPRTMDATVRG----------
A0JRP4_ARTS2/1-239------------------------AAM---FPLITSAS--------V-A--CGL--HAGDPVTMLDTCRA----------
F8KRQ1_HELBC/5-243------------------------DEI---MKLISSCN--------I-A--AGF--HASDPNIMRHSVQN----------
D5UJL7_CELFN/4-244------------------------DAL---LDLVSSAN--------V-A--AGY--HGGDAATMAVTCAG----------
Y2700_YERPE/3-236------------------------QAL---LQLVSSAN--------I-A--CGF--HAGDAQTMRQSVRW----------
V4IFZ2_9ACTO/6-244------------------------DAL---LTVVTSAN--------V-A--CGF--HAGDPTVIRGACRQ----------
Y4074_AZOC5/4-242------------------------EAL---MDIVSSAN--------I-A--CGL--HAGDPEIMAKAFAY----------
Y2695_THET8/3-241------------------------REI---FPLVSSAN--------L-A--CGF--HGGSPGRILEAVRL----------
Q16DH1_ROSDO/4-242------------------------ATL---LKTVTSAN--------I-A--CGA--HAGDPDVMVATMRT----------
K7TCZ9_GLUOY/7-242------------------------DAL---LNIVTSAN--------V-A--CGF--HGGDPEVMASTFAS----------
D5EIJ1_CORAD/3-232------------------------AEL---LALVDAAN--------I-C--CGV--HAGSAAKTRETIGL----------
K0FF24_9NOCA/3-241------------------------AAM---LDIVTSAN--------I-A--CGF--HAGDPSIMRRTCEL----------
E8U5L2_DEIML/4-237------------------------AGV---MPYVTSAN--------I-A--CGG--HAGDADTMRRSVRL----------
B4EQJ0_BURCJ/4-237------------------------DAL---MTYATSIN--------I-A--CGW--HAGDPTTMHRTASA----------
Q2W2X4_MAGSA/5-238------------------------EAM---LGVVSSAN--------I-A--CGF--HAGDAMVMSRTVQA----------
F8DZP5_CORRG/4-242------------------------AAM---IKLITSAN--------V-A--CGF--HAGDPHDIAKTLKA----------
J9S8D4_9ACTO/8-241------------------------EAM---LGVVTSAN--------V-A--CGF--HAGTPGDLLTTCRA----------
B1M8C8_METRJ/3-241------------------------AEM---LTVATSAN--------I-A--CGF--HAGDPLVMHETLSR----------
E8MYL0_ANATU/1-235------------------------EAL---LSIVTSAN--------I-A--CGL--HAGDPLVMGRTVRW----------
R5C931_9FIRM/3-241------------------------AEV---VSHITSAN--------V-A--CGF--HASDPVVMEKTVAA----------
H6C6W1_EXODN/8-246------------------------EEL---MQYIDTAN--------I-A--CGF--HAGDRSLMLKTVRL----------
F0Y460_AURAN/32-276------------------------AEL---MDIVTSAN--------V-A--CGG--HAGDENIMVAACAL----------
H0UJ33_9BACT/4-242------------------------EDV---LTFVSSAN--------V-A--CGF--HGGDPAVMRRTVRM----------
Y4511_PSEAE/8-249------------------------VHS---MPLVDQAN--------L-A--CGF--HAGDPLTMRRAVEL----------
E1VBZ3_HALED/5-245------------------------AEV---MPHVDLAN--------V-A--CGF--HASDPDVMRETVRL----------
D4M7W6_9BACT/4-242------------------------EEV---IKFVTSAN--------V-A--CGF--HAGDPMVMDRTVKM----------
G2LEC2_CHLTF/4-242------------------------EAI---LPYVSSVN--------L-A--CGF--HAGDPHTLRASIQR----------
C7RQK9_ACCPU/6-244------------------------SEL---LRVVGAAN--------I-A--CGF--HAGDPLVMRRTVRQ----------
Y4877_VIBPA/8-246------------------------DSV---MPHVDMAN--------I-A--CGF--HASDPNVMHDTITL----------
Y1531_COPPD/5-243------------------------REL---LNLVTSAN--------I-A--CGF--HAGDYMVMQKTVNM----------
V2WV16_MONRO/9-250------------------------DSL---MKTIHLAN--------I-A--CGF--HASDFSVMDKTVSL----------
M7WMG6_RHOT1/6-247------------------------EGL---FPIVDIAN--------C-A--CGF--HASDFDVMAKTVLL----------
A3HS16_9BACT/7-235------------------------ADI---FPWIDAAS--------I-A--CGG--HFGDKNTISKSLDL----------
Y043_AZOSB/4-242------------------------DAL---LQVVRSAN--------I-A--CGF--HAGDPLVMRNTVRM----------
F0M0F6_VIBFN/6-245------------------------HLV---MPYVDMAN--------I-A--CGF--HASDPHVMSKTIDM----------
Y2984_DEIRA/7-247------------------------ARL---FPLLTSVN--------L-A--LGF--HAGDPVTLHSAVRL----------
C7R8W9_KANKD/7-245------------------------SHL---MPYISSCN--------I-A--CGG--HAGNQESIKVTIAN----------
Y1502_GEOKA/4-241------------------------EEI---LSYVTSVN--------I-A--CGF--HAGDPLVMRRTVQL----------
Y150_BORPE/5-243------------------------EAV---LQFVTSAN--------I-A--CGF--HGGDPSTMRQTVAA----------
Y2042_NITHX/3-242------------------------AAM---IDLATSVN--------I-A--CGF--HAGDADTMKKTVDL----------
A0R539_MYCS2/5-243------------------------EAM---LGLVTSAN--------V-A--CGF--HAGDPALLLRTCRT----------
Y2038_STACT/3-241------------------------HQI---IPLITSAN--------I-A--CGF--HAGDENVMNETVKL----------
K1VQ76_TRIAC/63-302------------------------EAL---FPLIDYAN--------I-A--CGM--HAGDHNTMLRMVRL----------
Y498_BACLD/4-242------------------------EEI---LEFVTSAN--------I-A--CGF--HAGDPGVMRKTVKM----------
G2J1V4_PSEUL/3-236------------------------AAI---LDCVSSAN--------I-A--CGW--HAGDAAAMRAAVQA----------
D8MWR7_ERWBE/4-242------------------------ATL---MPLITSAN--------V-A--CGF--HAGDAAIMARTVAL----------
Q3ICU0_PSEHT/2-237------------------------EEV---MPHINMAN--------I-A--CGF--HAGDADVMANTLKL----------
Y3910_AGRT5/4-242------------------------EAM---LAIVSSAN--------I-A--CGF--HAGDPAGIYRTVKA----------
S8E0A5_FOMPI/4-241------------------------EAL---MKTIHLAN--------I-A--CGF--HASDFNIMNKTVLL----------
F6EKD4_AMYSD/4-242------------------------AAM---LPLVTSAN--------I-A--CGF--HAGDARTLLITCQR----------
Y3576_VIBCH/6-245------------------------EEV---MPWIDMAN--------I-A--CGF--HASDPHVMSRTIDL----------
D3UZ92_XENBS/5-243------------------------AKM---LGIVSSAN--------V-A--CGF--HAGDPVGILQTLKS----------
C1CZR4_DEIDV/6-239------------------------AAI---MPFVTSAN--------I-A--CGG--HAGDVESMRESLQL----------
K7TD01_GLUOY/6-244------------------------AAI---LDVVSSAN--------V-A--CGF--HGGDPEVMASTFAT----------
YBGL_SHIDS/3-236------------------------AEL---LTLVSSAN--------I-A--CGF--HAGDAQTMQACVRE----------
H1YGF4_9SPHI/5-243------------------------DTL---MDYITSAN--------I-A--CGF--HAGDPEVMQHTVNV----------
Q5QXP9_IDILO/9-254------------------------DLI---MPHIDCAN--------V-A--CGF--HASDPLTMLKTVKL----------
Q47NG6_THEFY/3-241------------------------EAL---LSVVTSAN--------V-A--CGF--HAGDPLVLRRVCEQ----------
U5LAF3_9BACI/4-242------------------------EEI---MAYITSAN--------I-A--CGF--HAGDPGTMRRTVKL----------
E1QDN4_DESB2/3-244------------------------QAM---LASVTSAN--------L-A--CGF--HAGDPLVMDQTIAL----------
X4ZYD6_9BACL/5-242------------------------QAL---LEVVSSAN--------I-A--CGF--HAGDPRTMNAAVAQ----------
Y4577_PSEPK/13-254------------------------AEV---MPYIDCAN--------I-A--CGY--HAGDPGIMRRTVTL----------
B5ICJ8_ACIB4/3-241------------------------TEI---MNYITSAN--------I-A--CGW--HGGDPIVMRETVKW----------
Q1DC03_MYXXD/8-229------------------------EQL---YALAHVAN--------I-A--CGG--HAGDDASMRRALER----------
C7MLY6_CRYCD/7-245------------------------SEI---IPLVSSVN--------I-A--CGS--HAGDPVVMRDTVQL----------
W8X9N3_CASDE/1-239------------------------AAM---LDLVTSAN--------V-A--CGF--HAGDPAGILDTLRA----------
Q5E525_VIBF1/3-242------------------------SAV---MPALDMAN--------I-A--CGM--HASDPSVMMKTVAL----------
A4ASE2_MARSH/6-239------------------------ESL---LPLISSCN--------I-A--CGG--HTGNYESMTHVVKL----------
W5W979_9PSEU/4-242------------------------EAL---LDLVSSAN--------V-A--CGF--HAGDPTVLRRITEQ----------
R5MQI6_9FIRM/5-243------------------------EEV---AKYISSAN--------V-A--CGF--HASDPVVMDKTVKI----------
R7XYL9_9ACTO/8-246------------------------DAL---LDVVTSAN--------I-A--CGF--HAGDPTVLRRTCER----------
F2K8V1_PSEBN/4-245------------------------AEV---MPFIDCAN--------I-A--CGF--HAGDPSIMRKTVSL----------
C0QGD0_DESAH/1-241------------------------EAV---MPLITSAN--------I-A--CGF--HGGDPWVMEKTVIL----------
E5AMR8_BURRH/21-254------------------------EAL---LELVSSAN--------I-A--CGW--HAGGPSIMRQSVRW----------
B8LZW7_TALSN/11-246------------------------DDL---LPFIDHAN--------I-A--CGF--HASDPLIMMETVRN----------
G2TJB6_BACCO/4-242------------------------EEI---LDLITSAN--------I-A--CGF--HAGDPTVMRKTVRM----------
R5H7E1_9SPIR/13-244------------------------FAL---LDYASSVN--------I-S--CGF--HAGDPMTIKNALLK----------
Q3SF52_THIDA/2-233------------------------DAL---MPYIARAS--------I-A--CGG--HFGDAGSMRTALLR----------
Q4FMV7_PELUB/11-249------------------------PEL---LNIVNSAN--------I-A--CGY--HAGDEKTMEMVIQI----------
B9JN49_AGRRK/11-248------------------------EHL---IPLISSAN--------I-A--TGF--HAGDPNLMDETVRL----------
Y1729_HAEIN/4-237------------------------ESL---LQLLSSAN--------V-A--CGL--HAGGAKEMQSAVKF----------
I7F001_PHAIB/5-243------------------------AAL---LDVVSSAN--------I-A--CGF--HAGDPDVMAATMAR----------
K5WPA6_AGABU/8-248------------------------EEL---MKTIHLAN--------V-A--CGF--HASDWDIMNQTVTY----------
F2F1B3_SOLSS/4-242------------------------EEI---LKYVTSAN--------I-A--CGF--HGGDPSVMRETVKM----------
Y486_MYCPA/4-242------------------------DAM---LGIVSSAN--------V-A--CGF--HAGDPAGLLRVCRS----------
D5ATU4_RHOCB/3-236------------------------AAL---LDVVTSAN--------I-C--CGL--HAGGPLEMARVMAL----------
A4XXR4_PSEMY/4-245------------------------AEV---MPFIDCAN--------I-A--CGF--HASEPLTMRRTVAL----------
B1LSM8_METRJ/4-242------------------------AAI---LGIVTSAN--------V-A--CGL--HAGDPEIMARTFAL----------
E6X9V0_CELAD/3-235------------------------KEL---LPLISSCN--------I-A--CGG--HAGDENSIREVIKI----------
L0EBQ1_THECK/9-247------------------------REL---IPLLSSAN--------I-A--CGF--HAGDPRTMRETVER----------
Q28NJ3_JANSC/23-261------------------------ETM---LGIVTSAN--------I-A--CGG--HASDPETMYQTLVS----------
Q21NC0_SACD2/2-238------------------------AAI---MPLIHQAN--------I-A--CGG--HTGNAASMAKAIQL----------
G8AQ87_AZOBR/366-604------------------------DSM---LGIVASAN--------I-A--CGF--HAGDPLVMTRTVRN----------
A1S1H7_SHEAM/4-236------------------------ADI---IALVDAAN--------I-A--CGG--HAGDSNSMRATVKL----------
R5XTA1_9FIRM/4-237------------------------ADI---IPLITSAN--------I-A--CGF--HAGDLHTMADSVLL----------
F8I999_SULAT/1-233------------------------EQL---MPYISSAN--------V-A--CGF--HGGDPSVMRRTVQL----------
G0AE74_COLFT/9-243------------------------EAL---LALVSSAN--------I-A--CGW--HAGSALMMQQCVAW----------
W0LH49_SERFO/3-236------------------------EAL---LQLVSSAN--------I-A--CGF--HAGDAQTMRQSVRW----------
Q2J8R2_FRASC/53-290------------------------EAL---LDLVTSAN--------I-A--CGF--HAGDPATMRRTCEQ----------
E4PKH3_MARAH/2-242------------------------AEV---MPYIDMAS--------I-A--CGF--HASDPLTMDHTVKL----------
R7JWG6_9CLOT/4-242------------------------EQV---LPWITSAN--------I-A--CGF--HASDPVIMDKTVRM----------
H6RUE6_BLASD/9-247------------------------DAL---LEVVTSAN--------V-A--CGF--HAGDPVTMRRVCGA----------
B8IGM4_METNO/4-242------------------------EAL---LDLVSSAN--------I-A--CGF--HAGDPVVMDRTVRL----------
Y333_MYCLE/4-242------------------------EAM---LRIVTSAN--------V-A--CGF--HAGDPAGLLRVCRL----------
A9BP88_DELAS/14-252------------------------QEL---MPLISSAN--------I-A--TGF--HAGDPNIMRKTVLL----------
E4U7W9_OCEP5/4-242------------------------EAL---FPLLSSVN--------L-A--TGF--HAGDPLTMQRSIAL----------
Y093_ARTS2/4-242------------------------TAM---FQSVSSAN--------V-A--CGF--HAGDPTVIRRTCRE----------
J7QRE0_METSZ/8-246------------------------DAM---LDIVTSAN--------V-A--CGF--HAGDPDIMATTFAR----------
C8WUH6_ALIAD/4-242------------------------GEI---LAYVTSAN--------L-A--CGM--HAGDPVVMARSVAL----------
Y1168_STAEQ/5-243------------------------QHI---LPLITSAN--------I-A--CGY--HAGDEDVMNETVQL----------
A1WEV7_VEREI/4-242------------------------AAV---LDHVSSAN--------V-A--CGM--HAGDPSTIATTVGL----------
C4ZLA9_THASP/5-243------------------------EAL---LQVVRSAN--------I-A--CGF--HAGDPVVMRHTVRT----------
D7BRG6_STRBB/6-245------------------------DAL---LSVVTSAN--------V-A--CGY--HAGDPSTMRRVCEL----------
F4AY60_KROS4/4-236------------------------AQL---IPYLSSCN--------I-A--CGG--HAGDTATMLEVLAF----------
A9H2F5_GLUDA/7-245------------------------AAM---LDVVTSAN--------V-A--CGF--HGGDPEVMAATFRV----------
D3FTL6_BACPE/4-242------------------------EFI---LDHISSAN--------V-A--CGY--HAGDHNVMAATVKM----------
Y282_PROAC/4-246------------------------ESL---LGIVTSAN--------V-A--CGF--HAGDAVVMGQTCKA----------
E0SEY7_DICD3/3-236------------------------EAL---LQLISSAN--------I-A--CGF--HAGDADLMRQSVRW----------
M1MW29_9CORY/4-241------------------------AAM---VRLISSAN--------V-A--CGF--HAGDPHDIARTVAA----------
D5BMH2_PUNMI/3-237------------------------EAL---MPFITEAN--------V-A--CGF--HASDPNHMRTTVTL----------
R7MJT0_9CLOT/13-245------------------------TRL---LDYVSSVN--------I-S--CGF--HAGDPLTIKEALLE----------
A0LSF5_ACIC1/16-254------------------------DEL---LALVTSAS--------V-A--CGF--HGGDPAVMRRTVAV----------
Y379_BACP2/4-242------------------------EQI---LEYVTSAN--------I-A--CGF--HAGDPTVMRKTVRM----------
B6HFB9_PENCW/10-245------------------------EDL---LPFIDHAN--------V-A--CGF--HASDPLIMMETVRS----------
H5WZE4_9PSEU/3-241------------------------EAL---LNVVTSAN--------V-A--CGF--HAGDPSVLRRVTEQ----------
I0GX05_ACTM4/4-242------------------------DAL---LSVVTSAN--------V-A--CGF--HAGDPSTMRRVCRT----------
E1SWB7_FERBD/3-239------------------------AEL---MRLISSAN--------I-A--CGA--HAGNPALMRRTIAL----------
C0ZBV3_BREBN/4-239------------------------LGI---MKWITSVN--------I-A--CGL--HAGDPHIICRTIEA----------
E6SBM1_INTC7/6-244------------------------EAM---LEIVTSAN--------V-A--CGF--HAGDSLTLRRTCAR----------
A7IFF2_XANP2/3-241------------------------AAL---LDIVSSAN--------L-A--CGL--HAGDPEIMARVFAL----------
F8K454_STREN/34-272------------------------EAL---LSVVTSAN--------V-A--CGY--HGGDPATMRRVCEG----------
H6N0G5_GORPV/18-251------------------------EAM---LAIVTSAN--------V-A--CGF--HAGTPAELRATCRG----------
S3BUE6_OPHP1/51-290------------------------EEL---MPLLDAAN--------I-A--CGF--HAGDPSIMLRTVRL----------
D4M7F2_9BACT/5-243------------------------EDV---LTFVSSAN--------V-A--CGF--HAGDPLVMKNTVAA----------
G8T834_NIAKG/4-244------------------------KLL---LSYVSSIN--------L-A--CGY--HAGDAHTMYALAEA----------
B5HGL3_STRPR/6-244------------------------EAL---LSLVTSAN--------V-A--CGF--HAGDPGTMRRVCET----------
E4N888_KITSK/2-244------------------------EAL---LSVVTSAN--------V-A--CGF--HAGDPSTMRRVCSL----------
E8SIF4_STAPH/3-241------------------------REV---LPLITSAN--------V-A--CGF--HAGDENVMAETVRR----------
B9K212_AGRVS/6-244------------------------QAL---MGLISSAN--------I-A--TGF--HAGDPNLMDETVRL----------
K4RDP3_9ACTO/4-242------------------------ERL---LSVVTSAN--------V-A--CGF--HAGDAATMRRVCEL----------
D4ZD86_SHEVD/10-243------------------------AAL---LQLITSAN--------I-A--CGG--HSGDQSSMHTAVRL----------
Y3513_ACIAC/3-241------------------------AAM---LGIVTSAN--------V-A--CGF--HAGDAAGILATLRG----------
Y2681_RHOPA/3-242------------------------AAM---MQIATSVN--------I-A--CGF--HAGDPDIMHATVKL----------
I2EPH3_EMTOG/6-243------------------------QKL---MEAISSAN--------I-A--CGF--HAGDASIMRKTAQL----------
K0KCJ9_SACES/2-239------------------------DAL---LDVVTSAN--------V-A--CGF--HAGDPSTMRRVCAR----------
F2NR58_MARHT/3-241------------------------EAL---FPLLTSVN--------L-A--CGF--HAGDPRTMLRAVRL----------
Y2977_ALKMQ/4-242------------------------GEV---VKYITSAN--------I-A--CGW--HAGDPMVMEKTVQA----------
Y5654_NOCFA/3-240------------------------AAM---LDLVTSAN--------I-A--CGF--HAGDPSIMRRTCAL----------
D3F024_CONWI/21-259------------------------AAI---MPFVSSAS--------I-A--CGF--HAGDPRNMRETAGH----------
K7RR83_PROA4/1-239------------------------DAM---MAIVTSAN--------V-A--CGF--HAGDPSVMRSTITA----------
G9WFM7_9LACT/4-240------------------------DQI---IKLVSSVN--------V-A--CGF--HAGDPDVMAQTVAK----------
B9L7F1_NAUPA/2-239------------------------EEI---MPLIDMAN--------I-A--CGF--HAGDPIIMDKTVLL----------
I4C5I2_DESTA/3-239------------------------EEF---MQYISAAN--------V-A--CGF--HAGDPSVMKKTVGF----------
E3CXI0_9BACT/4-242------------------------EAV---LRAVSSAN--------V-A--CGF--HAGDPQVMETTVKL----------
Y1066_HELMI/3-241------------------------AEM---IAIASSVN--------I-A--CGF--HGGDPDVMAVTVER----------
D2RMC2_ACIFV/3-241------------------------DKV---LPLVTSAN--------I-A--CGF--HAGDPSVMKKTVDL----------
Q1GM83_RUEST/5-243------------------------DQL---MELISSAN--------I-A--AGF--HAGDPNSMDRVIKL----------
E0SJD9_DICD3/3-241------------------------AAL---MQVVSSAN--------I-A--CGF--HAGDPSIMTKMVRL----------
F7YS87_VIBA7/10-249------------------------ELV---MPWIDMAN--------I-A--CGF--HASDPHVMSRTIEL----------
Q6ANH3_DESPS/2-232------------------------DKI---MPHVDMAN--------I-A--CGM--HASDPEVMNHTVTL----------
E3F040_KETVY/2-233------------------------AAL---MRYVTSAN--------V-A--CGY--HAGDPMIMDRTIRL----------
B2ICA4_BEII9/9-247------------------------AAM---LDIVTSAN--------V-A--CGF--HAGDPRIMAETFHL----------
A1AYU0_PARDP/5-242------------------------ATM---LGIVSSAN--------V-A--CGF--HAGDPLTILVTVRE----------
F0RCU6_CELLC/6-239------------------------SQL---MPYISSCN--------I-A--CVG--HAGTIDLMKHIVRL----------
K4L056_SIMAS/4-242------------------------EQV---MPHIDQAN--------I-A--CGF--HAGDPVTMLHTLNL----------
C7QHB5_CATAD/2-244------------------------DAL---LELVTSAN--------V-A--CGF--HAGDPSTMRRVCAA----------
Y476_METCA/5-243------------------------ETL---LELVTSAN--------I-A--CGF--HAGDPDVMAETVRL----------
G4QKJ0_GLANF/2-240------------------------SDI---MPYIDMAN--------V-A--CGG--HAGDPTVMHKTIEL----------
A1U0R3_MARAV/2-242------------------------DLV---MPLIDMAN--------V-A--CGF--HAADPMVIRKTLAL----------
Q3IWM6_RHOS4/5-244------------------------AGM---LELVTSAN--------I-A--CGF--HAGDPVVMRRTIRM----------
D5CHF5_ENTCC/4-237------------------------AEL---MTLVTSVN--------I-A--CGF--HAGDAQTMLASVRS----------
U4KH28_9VIBR/6-245------------------------EEV---MPWVDMAN--------I-A--CGF--HASDPNVMSTTLKL----------
Q6D7H2_PECAS/3-236------------------------EAL---LKLVTSVN--------I-A--CGF--HAGDAQTMRQSVRW----------

PF01522

NODB_AZOC5/9-134-------------------------------------------------------------------------------.
Q9A5L9_CAUCR/35-168-------------------------------------------------------------------------------.
O69838_STRCO/70-214-------------------------------------------------------------------------------.
Q9XAP6_STRCO/96-224-------------------------------------------------------------------------------.
CDA2_YEAST/112-232-------------------------------------------------------------------------------.
Q98GK8_RHILO/808-946-------------------------------------------------------------------------------A
ICAB_STAEQ/107-248-------------------------------------------------------------------------------.
Q97ET9_CLOAB/86-214-------------------------------------------------------------------------------.
YHEN_BACSU/79-203-------------------------------------------------------------------------------.
Q9CHP6_LACLA/96-236-------------------------------------------------------------------------------.
Q9RVF2_DEIRA/33-157-------------------------------------------------------------------------------.
Q982X7_RHILO/88-291-------------------------------------------------------------------------------A
Q97K82_CLOAB/62-192-------------------------------------------------------------------------------.
O53444_MYCTU/41-164-------------------------------------------------------------------------------.
PDAA_BACSU/60-185-------------------------------------------------------------------------------.
Q985U0_RHILO/77-213-------------------------------------------------------------------------------.
Q9WXW8_THEMA/27-151-------------------------------------------------------------------------------.
P73597_SYNY3/44-199-------------------------------------------------------------------------------.
Q9L1T3_STRCO/85-207-------------------------------------------------------------------------------.
Q9A6E1_CAUCR/17-152-------------------------------------------------------------------------------.
Q97TP4_CLOAB/83-210-------------------------------------------------------------------------------.
Q97JC7_CLOAB/83-211-------------------------------------------------------------------------------.
Q9X8Z4_STRCO/86-212-------------------------------------------------------------------------------.
Q9KEF7_BACHD/63-188-------------------------------------------------------------------------------.
Q9PF00_XYLFA/74-213-------------------------------------------------------------------------------L
Q97LW8_CLOAB/106-234-------------------------------------------------------------------------------.
Q9KEJ5_BACHD/75-214-------------------------------------------------------------------------------.
Q9CCZ2_MYCLE/73-201-------------------------------------------------------------------------------.
Q9KBK9_BACHD/74-199-------------------------------------------------------------------------------.
Q9KSH6_VIBCH/26-172-------------------------------------------------------------------------------.
Q9P9U2_XYLFA/249-384-------------------------------------------------------------------------------K
Q9FBM6_STRCO/131-288-------------------------------------------------------------------------------T
Q9RV08_DEIRA/33-148-------------------------------------------------------------------------------.
Y4760_STRCO/62-184-------------------------------------------------------------------------------.
Q983K0_RHILO/61-197-------------------------------------------------------------------------------.
Q97MV1_CLOAB/82-216-------------------------------------------------------------------------------.
Q9K630_BACHD/116-243-------------------------------------------------------------------------------.
Q9R7V4_YERPE/101-271-------------------------------------------------------------------------------V
Q9ZBN1_STRCO/59-183-------------------------------------------------------------------------------.
Q9PAV0_XYLFA/97-222-------------------------------------------------------------------------------.
Q9KDB2_BACHD/39-162-------------------------------------------------------------------------------.
Q9KA84_BACHD/124-248-------------------------------------------------------------------------------.
Q9KVA7_VIBCH/402-543-------------------------------------------------------------------------------P
PDAB_BACSU/51-176-------------------------------------------------------------------------------.
NODB_RHILO/15-140-------------------------------------------------------------------------------.
NODB_RHIME/15-140-------------------------------------------------------------------------------.
Q9EWZ7_STRCO/52-176-------------------------------------------------------------------------------.
Q9PDB0_XYLFA/55-223-------------------------------------------------------------------------------H
YXKH_BACSU/113-240-------------------------------------------------------------------------------.
Q97DU4_CLOAB/83-214-------------------------------------------------------------------------------.
Q9JWQ7_BACHD/50-175-------------------------------------------------------------------------------.
Q9KYG2_STRCO/47-184-------------------------------------------------------------------------------P
YADE_ECOLI/226-368-------------------------------------------------------------------------------N
CDA1_YEAST/102-222-------------------------------------------------------------------------------.
PDAC_BACSU/272-393-------------------------------------------------------------------------------.
Q97GQ0_CLOAB/126-253-------------------------------------------------------------------------------.
Q9CJ95_LACLA/136-266-------------------------------------------------------------------------------.
Q97EU7_CLOAB/97-223-------------------------------------------------------------------------------.
Q99Z68_STRP1/235-356-------------------------------------------------------------------------------.
NODB_RHISN/12-137-------------------------------------------------------------------------------.
Q9RCX4_STRCO/8-132-------------------------------------------------------------------------------.
PGAB_ECOLI/101-271-------------------------------------------------------------------------------V
CDA1_SCHPO/63-190-------------------------------------------------------------------------------.
Q99ZT1_STRP1/154-283-------------------------------------------------------------------------------.
O86800_STRCO/103-225-------------------------------------------------------------------------------.
Q97GI4_CLOAB/50-174-------------------------------------------------------------------------------.
Q97M42_CLOAB/8-133-------------------------------------------------------------------------------.
Q9CIS3_LACLA/170-291-------------------------------------------------------------------------------.
B3PIN1_CELJU/396-514-------------------------------------------------------------------------------.
D8Q165_SCHCM/200-314-------------------------------------------------------------------------------.
E6UBP6_RUMA7/470-592-------------------------------------------------------------------------------.
F4GY46_CELFA/213-331-------------------------------------------------------------------------------.
F4H710_CELFA/356-474-------------------------------------------------------------------------------.
Q326Y8_SHIDS/46-204-------------------------------------------------------------------------------S
Q7AQ13_MYCLE/46-161-------------------------------------------------------------------------------.
Q81Z49_BACAN/63-186-------------------------------------------------------------------------------.
PGDA_STRR6/264-377-------------------------------------------------------------------------------.
Q9RKN7_STRCO/46-161-------------------------------------------------------------------------------.
ICAB_STAA8/109-248-------------------------------------------------------------------------------.
S2JG56_MUCC1/153-273-------------------------------------------------------------------------------.

PF03065

AMY1_DICT6/8-294................................................................................
O66934_AQUAE/7-429LEAI..RKDPDDLEKEEVEKLIEFTKLNYE..............................KPIYRFERIRELM.......
Q8TZQ1_PYRFU/35-537QIISEKIANGEPLTYDEKWFMLQAPGGFFDHTIPWNGEPVTDENGNPIRDFWDRYTELKDKMLAAKQKYANLP.......
MALQ_THEKO/7-291................................................................................
Q9HLU6_THEAC/262-747FIQYAFIPYSELNTTQNQSLLANITADYFS...............................IPSYVYKLDEPASNEYLEL
Q8ZT36_PYRAE/22-486FRISEKIARGEPLTIEEKYAMLAVPGGFFD..........................INWQNILNKHPRYAVLLGVRNDAF
I6TXK5_9EURY/6-395ITRKLELMKEDLTKY.TNDQLKKAI.......................................................
Q8YXA5_NOSS1/8-473LKAS..LTPTEQLTQQQREFIIQH...FFD..........................ANHHTLIDPHPRYAEL.......Y
F7URR6_SYNYG/8-468LALT..LSPVEKLSLEQKVEILTT...FFE..........................ANPRTQIFPQHRYQQL.......Y
Q97BM4_THEVO/7-311................................................................................
AMYA_PYRHO/7-291................................................................................
O58106_PYRHO/3-316................................................................................
AMYA_METJA/6-319................................................................................
Q9KD04_BACHD/7-382LENTEQLLKKEEKRT.NDQRTQNLV.......................................................
Q8TIT8_METAC/38-312................................................................................
D4G9W5_TREPC/12-351................................................................................
Q9HL91_THEAC/8-289................................................................................
Q8ZT57_PYRAE/6-321................................................................................
Q8TIT9_METAC/7-321................................................................................
O50094_PYRHO/6-394MERKLKSMEEDLERF.KDEKLREAI.......................................................
Q973T0_SULTO/7-324................................................................................
D0KTV8_SULS9/7-324................................................................................

PF01074

MA2A1_MOUSE/166-496--------------------------------------------------------------------------------
MA2A2_HUMAN/167-497--------------------------------------------------------------------------------
MANA_DICDI/43-353--------------------------------------------------------------------------------
MA2B1_HUMAN/64-381--------------------------------------------------------------------------------
O01574_CAEEL/138-459--------------------------------------------------------------------------------
MA2B2_MOUSE/28-351--------------------------------------------------------------------------------
MA2C1_RAT/251-510--------------------------------------------------------------------------------
MAN1_YEAST/290-559--------------------------------------------------------------------------------
P94078_ARATH/39-350--------------------------------------------------------------------------------
Q20829_CAEEL/37-351--------------------------------------------------------------------------------
MAN2_DROME/145-471--------------------------------------------------------------------------------
MA2B2_PIG/28-342--------------------------------------------------------------------------------
Q55528_SYNY3/232-495--------------------------------------------------------------------------------
Q7NPH5_GLOVI/217-477--------------------------------------------------------------------------------
Q7PMM6_ANOGA/166-493--------------------------------------------------------------------------------
Q7S1L0_NEUCR/285-549--------------------------------------------------------------------------------
Q7U9I9_SYNPX/234-492--------------------------------------------------------------------------------
Q7V4V0_PROMM/221-479--------------------------------------------------------------------------------
Q826B6_STRAW/254-513--------------------------------------------------------------------------------
Q82MA7_STRAW/254-513--------------------------------------------------------------------------------
Q8A5X3_BACTN/297-572--------------------------------------------------------------------------------
Q8DM33_THEEB/217-475--------------------------------------------------------------------------------
Q8G4P9_BIFLO/264-528--------------------------------------------------------------------------------
Q8G4Q0_BIFLO/268-532--------------------------------------------------------------------------------
Q8G4Q1_BIFLO/267-531--------------------------------------------------------------------------------
Q8IPB7_DROME/48-364--------------------------------------------------------------------------------
Q8LPJ3_ARATH/38-350--------------------------------------------------------------------------------
Q8XIN5_CLOPE/235-510--------------------------------------------------------------------------------
Q8XM34_CLOPE/260-519--------------------------------------------------------------------------------
Q8Y5P1_LISMO/243-513--------------------------------------------------------------------------------
Q8Y9W8_LISMO/5-267--------------------------------------------------------------------------------
Q8YYK0_NOSS1/230-491--------------------------------------------------------------------------------
Q97UK5_SULSO/220-473--------------------------------------------------------------------------------
Q9FKW9_ARATH/48-359--------------------------------------------------------------------------------
Q9KEQ8_BACHD/237-511--------------------------------------------------------------------------------
Q9LFR0_ARATH/154-493--------------------------------------------------------------------------------
MAN1_SCHPO/282-549--------------------------------------------------------------------------------
Q9VLI0_DROME/38-352--------------------------------------------------------------------------------
Q9X2G6_THEMA/247-507--------------------------------------------------------------------------------
B2HSI3_MYCMM/98-400--------------------------------------------------------------------------------
C8VJ45_EMENI/284-549--------------------------------------------------------------------------------
H9JRV7_BOMMO/33-353--------------------------------------------------------------------------------
Q9VF33_DROME/169-499--------------------------------------------------------------------------------
Q9VLH9_DROME/39-352--------------------------------------------------------------------------------
Q9VLI2_DROME/38-351--------------------------------------------------------------------------------

PF10096

Q18AM8_PEPD6/233-467--------------------------------------------------------------------------------
M1UCJ4_BACIU/208-474--------------------------------------------------------------------------------
Q5JH22_THEKO/56-259--------------------------------------------------------------------------------
A9AA29_METM6/35-240--------------------------------------------------------------------------------
A6VGM2_METM7/35-240--------------------------------------------------------------------------------
Q6LXR4_METMP/34-239--------------------------------------------------------------------------------
A4FWP9_METM5/37-242--------------------------------------------------------------------------------
A6UV77_META3/44-251--------------------------------------------------------------------------------
Q7MSW5_WOLSU/4-254--------------------------------------------------------------------------------
B2TDN6_BURPP/5-202--------------------------------------------------------------------------------
Q391U9_BURS3/257-532--------------------------------------------------------------------------------
Q39N31_BURS3/258-533--------------------------------------------------------------------------------
A3S0S8_RALSL/270-567--------------------------------------------------------------------------------
A3RWP7_RALSL/288-565--------------------------------------------------------------------------------
B7WV25_COMTE/256-530--------------------------------------------------------------------------------
A1WAM2_ACISJ/315-589--------------------------------------------------------------------------------
Q1AST7_RUBXD/238-462--------------------------------------------------------------------------------
Q1IXI2_DEIGD/311-556--------------------------------------------------------------------------------
Q0SST1_CLOPS/180-429--------------------------------------------------------------------------------
Q8XK74_CLOPE/180-429--------------------------------------------------------------------------------
A5I018_CLOBH/188-437--------------------------------------------------------------------------------
A7GBL6_CLOBL/187-436--------------------------------------------------------------------------------
A6LXX4_CLOB8/129-377--------------------------------------------------------------------------------
A6LS62_CLOB8/199-444--------------------------------------------------------------------------------
A6LXK7_CLOB8/199-442--------------------------------------------------------------------------------
Q0SV96_CLOPS/198-445--------------------------------------------------------------------------------
A5D0J0_PELTS/44-299--------------------------------------------------------------------------------
Q897A5_CLOTE/246-480--------------------------------------------------------------------------------
A7GCY7_CLOBL/229-463--------------------------------------------------------------------------------
Q65D17_BACLD/215-481--------------------------------------------------------------------------------
A7Z1H4_BACA2/214-480--------------------------------------------------------------------------------
A8FA31_BACP2/214-479--------------------------------------------------------------------------------
A9VQC2_BACWK/212-474--------------------------------------------------------------------------------
Q3EJ39_BACTI/132-394--------------------------------------------------------------------------------
A3IBG5_9BACI/196-373--------------------------------------------------------------------------------
Q1WTJ8_LACS1/90-295--------------------------------------------------------------------------------
A0A037ZQ94_ENTFL/224-427--------------------------------------------------------------------------------
Q03HA5_PEDPA/224-420--------------------------------------------------------------------------------
A6M167_CLOB8/134-348--------------------------------------------------------------------------------
A0AFX4_LISW6/211-439--------------------------------------------------------------------------------

PF15421

Q8A8I5_BACTN/62-500--------------------------------------------------------------------------------
Q5LDR1_BACFN/50-470--------------------------------------------------------------------------------
D4IMW2_9BACT/39-464--------------------------------------------------------------------------------
R5UTM0_9PORP/51-471--------------------------------------------------------------------------------
R6DLU9_9BACE/67-497--------------------------------------------------------------------------------

PF03746

D7BG02_MEISD/3-241--------------------------------------------------------------------------------
W5XZK8_9CORY/7-245--------------------------------------------------------------------------------
D5QFG9_KOMHA/3-241--------------------------------------------------------------------------------
Q6LSN4_PHOPR/2-250--------------------------------------------------------------------------------
I0JJ59_HALH3/4-242--------------------------------------------------------------------------------
F4C1I4_SPHS2/4-242--------------------------------------------------------------------------------
Q2RU90_RHORT/5-243--------------------------------------------------------------------------------
D5MN08_9BACT/6-243--------------------------------------------------------------------------------
R5XP92_9FIRM/4-242--------------------------------------------------------------------------------
L7WC11_NONDD/4-237--------------------------------------------------------------------------------
D6Y0B4_BACIE/3-241--------------------------------------------------------------------------------
D5BG15_ZUNPS/4-236--------------------------------------------------------------------------------
M3DE22_SPHMS/8-244--------------------------------------------------------------------------------
D5EDK5_AMICL/4-242--------------------------------------------------------------------------------
G8S4N9_ACTS5/10-248--------------------------------------------------------------------------------
F5XPT6_MICPN/6-244--------------------------------------------------------------------------------
Y1143_NATTJ/4-242--------------------------------------------------------------------------------
F5XTC9_MICPN/4-241--------------------------------------------------------------------------------
R5E047_9CLOT/3-241--------------------------------------------------------------------------------
E3H7Y1_ILYPC/4-242--------------------------------------------------------------------------------
D0IYS7_COMT2/4-242--------------------------------------------------------------------------------
Y1384_PEPD6/4-242--------------------------------------------------------------------------------
Q4FSQ9_PSYA2/3-236--------------------------------------------------------------------------------
L0DCE0_SINAD/9-227--------------------------------------------------------------------------------
E6SM88_THEM7/5-243--------------------------------------------------------------------------------
Y2112_KOCRD/4-242--------------------------------------------------------------------------------
A5DMJ6_PICGU/30-269--------------------------------------------------------------------------------
A2U3P8_9FLAO/3-236--------------------------------------------------------------------------------
B1ZX56_OPITP/4-232--------------------------------------------------------------------------------
Y2917_PSESM/3-241--------------------------------------------------------------------------------
U4KC78_9VIBR/2-236--------------------------------------------------------------------------------
R9VRL9_9ENTR/3-236--------------------------------------------------------------------------------
F5YAB0_TREAZ/4-242--------------------------------------------------------------------------------
G3B4G0_CANTC/32-271--------------------------------------------------------------------------------
S5XZQ9_PARAH/1-238--------------------------------------------------------------------------------
C5CZ15_VARPS/3-236--------------------------------------------------------------------------------
D1C8S7_SPHTD/5-240--------------------------------------------------------------------------------
B4EWE9_PROMH/5-242--------------------------------------------------------------------------------
E8NF87_MICTS/3-240--------------------------------------------------------------------------------
Q1IXD6_DEIGD/5-238--------------------------------------------------------------------------------
Y1821_BACHD/4-242--------------------------------------------------------------------------------
F6FQW1_ISOV2/4-241--------------------------------------------------------------------------------
U5RSR8_9CLOT/3-239--------------------------------------------------------------------------------
Y1029_CHRSD/6-245--------------------------------------------------------------------------------
Y2522_SYMTH/11-249--------------------------------------------------------------------------------
G2PME2_MURRD/6-239--------------------------------------------------------------------------------
M1MIN5_9CLOT/4-242--------------------------------------------------------------------------------
Y2314_ERWT9/3-235--------------------------------------------------------------------------------
Q0S878_RHOSR/47-285--------------------------------------------------------------------------------
U3TWJ9_9ENTR/3-236--------------------------------------------------------------------------------
D3EM31_GEOS4/4-242--------------------------------------------------------------------------------
Y535_KINRD/4-242--------------------------------------------------------------------------------
A3UBZ2_CROAH/4-236--------------------------------------------------------------------------------
H2IWK8_RAHAC/3-236--------------------------------------------------------------------------------
C6XL46_HIRBI/7-240--------------------------------------------------------------------------------
G9MQN1_HYPVG/10-247--------------------------------------------------------------------------------
Y2112_PSEAE/4-245--------------------------------------------------------------------------------
Y4436_RALSO/3-241--------------------------------------------------------------------------------
Y2790_CLOK5/4-243--------------------------------------------------------------------------------
D7A9V4_STAND/3-236--------------------------------------------------------------------------------
M5A4V0_9ACTN/5-243--------------------------------------------------------------------------------
R5QKJ0_9FIRM/3-241--------------------------------------------------------------------------------
W5TLR8_9NOCA/3-239--------------------------------------------------------------------------------
Y2520_ACIAD/3-241--------------------------------------------------------------------------------
D7A110_STAND/4-243--------------------------------------------------------------------------------
I0DPN0_PROSM/5-243--------------------------------------------------------------------------------
D2PYH8_KRIFD/4-242--------------------------------------------------------------------------------
B7VS04_VIBSL/1-234--------------------------------------------------------------------------------
L0G1R1_ECHVK/3-236--------------------------------------------------------------------------------
Y2655_BREBN/4-242--------------------------------------------------------------------------------
Y1272_PYRFU/3-241--------------------------------------------------------------------------------
F4H0L0_CELFA/5-255--------------------------------------------------------------------------------
A9WUH9_RENSM/280-518--------------------------------------------------------------------------------
D6Y403_THEBD/3-248--------------------------------------------------------------------------------
F4GUU2_PUSST/5-243--------------------------------------------------------------------------------
A5WHM5_PSYWF/13-246--------------------------------------------------------------------------------
I3Z849_BELBD/30-262--------------------------------------------------------------------------------
M4RSN8_9BIFI/4-242--------------------------------------------------------------------------------
M9R857_9RHOB/6-244--------------------------------------------------------------------------------
R7JBC4_9FUSO/13-246--------------------------------------------------------------------------------
C5D2N8_GEOSW/3-241--------------------------------------------------------------------------------
D5V4N2_ARCNC/3-244--------------------------------------------------------------------------------
R5B6J0_9CLOT/6-244--------------------------------------------------------------------------------
D8J6F9_HALJB/4-240--------------------------------------------------------------------------------
Q2KTU9_BORA1/6-244--------------------------------------------------------------------------------
C5D207_VARPS/3-241--------------------------------------------------------------------------------
F8Q293_SERL3/10-254--------------------------------------------------------------------------------
E9T1F8_COREQ/4-242--------------------------------------------------------------------------------
H8KYG9_FRAAD/4-242--------------------------------------------------------------------------------
Y1612_LACF3/4-240--------------------------------------------------------------------------------
R7AUI2_9FIRM/4-242--------------------------------------------------------------------------------
L0A698_DEIPD/4-241--------------------------------------------------------------------------------
F5Z8H6_ALTSS/2-241--------------------------------------------------------------------------------
E0TF98_PARBH/9-240--------------------------------------------------------------------------------
C3AMS1_BACMY/4-240--------------------------------------------------------------------------------
Y1004_CORGL/4-242--------------------------------------------------------------------------------
U4KHV1_9VIBR/2-235--------------------------------------------------------------------------------
A4X134_SALTO/1-238--------------------------------------------------------------------------------
X5DN33_9CORY/5-237--------------------------------------------------------------------------------
F0RQS5_DEIPM/3-243--------------------------------------------------------------------------------
R5T180_9GAMM/13-246--------------------------------------------------------------------------------
A9I0Z0_BORPD/28-266--------------------------------------------------------------------------------
A3Q8T1_SHELP/8-241--------------------------------------------------------------------------------
R6NVF4_9CLOT/4-237--------------------------------------------------------------------------------
A5D328_PELTS/1-237--------------------------------------------------------------------------------
F7QMW8_9BRAD/3-242--------------------------------------------------------------------------------
I2BBK3_SHIBC/7-245--------------------------------------------------------------------------------
D5V4P7_ARCNC/3-243--------------------------------------------------------------------------------
B1HUZ0_LYSSC/2-236--------------------------------------------------------------------------------
C5C6S0_MICLC/7-245--------------------------------------------------------------------------------
X2GVX0_9BACI/3-237--------------------------------------------------------------------------------
A0QXR8_MYCS2/4-236--------------------------------------------------------------------------------
Y2372_RALPJ/4-237--------------------------------------------------------------------------------
E6TY73_BACCJ/5-243--------------------------------------------------------------------------------
H2G083_OCESG/4-245--------------------------------------------------------------------------------
Q0RVU6_RHOSR/3-237--------------------------------------------------------------------------------
F4KPP8_HALH1/2-235--------------------------------------------------------------------------------
E2PUA2_STRC2/26-264--------------------------------------------------------------------------------
G0G150_AMYMS/1-239--------------------------------------------------------------------------------
R4LWQ2_9ACTO/1-239--------------------------------------------------------------------------------
D2B933_STRRD/3-241--------------------------------------------------------------------------------
Y3392_SYNFM/3-241--------------------------------------------------------------------------------
B6JF92_OLICO/5-244--------------------------------------------------------------------------------
F8IB92_SULAT/6-243--------------------------------------------------------------------------------
W1QAN8_OGAPD/24-260--------------------------------------------------------------------------------
E3Q2S8_COLGM/10-249--------------------------------------------------------------------------------
D3PTP5_MEIRD/3-241--------------------------------------------------------------------------------
E4TP81_MARTH/4-239--------------------------------------------------------------------------------
A9AYX3_HERA2/3-236--------------------------------------------------------------------------------
F4CNG9_PSEUX/4-242--------------------------------------------------------------------------------
Y1488_MACCJ/3-241--------------------------------------------------------------------------------
J5JGM9_BEAB2/14-248--------------------------------------------------------------------------------
D1BTW0_XYLCX/4-242--------------------------------------------------------------------------------
Y407_CORJK/10-248--------------------------------------------------------------------------------
V5XGL8_MYCNE/4-242--------------------------------------------------------------------------------
D5WUZ1_KYRT2/4-242--------------------------------------------------------------------------------
C5AT01_METEA/6-244--------------------------------------------------------------------------------
B0RI75_CLAMS/3-241--------------------------------------------------------------------------------
K4IM75_PSYTT/4-236--------------------------------------------------------------------------------
Y3770_BACSK/4-242--------------------------------------------------------------------------------
G2NVC5_STRVO/7-244--------------------------------------------------------------------------------
Q5NI64_FRATT/3-227--------------------------------------------------------------------------------
C5BPU8_TERTT/2-239--------------------------------------------------------------------------------
Y2634_CROS8/4-237--------------------------------------------------------------------------------
G0IXS0_CYCMS/5-233--------------------------------------------------------------------------------
N1PZT0_MYCP1/8-245--------------------------------------------------------------------------------
Q0SB09_RHOSR/3-241--------------------------------------------------------------------------------
M1E8N0_9FIRM/3-239--------------------------------------------------------------------------------
C7NIG6_KYTSD/4-242--------------------------------------------------------------------------------
D9QUX4_ACEAZ/4-242--------------------------------------------------------------------------------
G8RT09_MYCRN/15-253--------------------------------------------------------------------------------
R5C385_9FIRM/4-242--------------------------------------------------------------------------------
E1VFF3_9GAMM/4-235--------------------------------------------------------------------------------
W6EGN0_SULMU/3-242--------------------------------------------------------------------------------
E4RUB2_LEAB4/3-231--------------------------------------------------------------------------------
D5DCK3_BACMD/4-242--------------------------------------------------------------------------------
D9RZ18_THEOJ/5-243--------------------------------------------------------------------------------
E2SG17_9ACTO/9-231--------------------------------------------------------------------------------
Y1541_CAMJE/4-242--------------------------------------------------------------------------------
D3Q482_STANL/5-243--------------------------------------------------------------------------------
D6ZAE9_SEGRD/6-231--------------------------------------------------------------------------------
C0ZM31_RHOE4/5-242--------------------------------------------------------------------------------
M3B8E6_MYCFI/8-245--------------------------------------------------------------------------------
G4R9N3_PELHB/5-238--------------------------------------------------------------------------------
Q0C0C1_HYPNA/5-242--------------------------------------------------------------------------------
X5EC88_9CORY/4-241--------------------------------------------------------------------------------
W0HWN7_9ENTR/4-243--------------------------------------------------------------------------------
Y4486_PECAS/3-241--------------------------------------------------------------------------------
D4MW94_9FIRM/4-242--------------------------------------------------------------------------------
F4HE29_GALAU/4-237--------------------------------------------------------------------------------
K0B3I8_CLOA9/8-246--------------------------------------------------------------------------------
Y2450_CARHZ/4-240--------------------------------------------------------------------------------
D7CXP4_TRURR/5-245--------------------------------------------------------------------------------
Y1858_TOLAT/4-242--------------------------------------------------------------------------------
F8KSZ7_HELBC/4-242--------------------------------------------------------------------------------
A1RBG9_ARTAT/5-242--------------------------------------------------------------------------------
D8IRE9_HERSS/3-236--------------------------------------------------------------------------------
A4CKX7_ROBBH/8-240--------------------------------------------------------------------------------
K0L0G1_WICCF/20-257--------------------------------------------------------------------------------
H0Q289_9RHOO/5-243--------------------------------------------------------------------------------
V5UEX5_9BURK/3-235--------------------------------------------------------------------------------
Q1GEX9_RUEST/5-243--------------------------------------------------------------------------------
G3JBY9_CORMM/25-269--------------------------------------------------------------------------------
C0ZPT0_RHOE4/5-243--------------------------------------------------------------------------------
Y2677_OCEIH/5-243--------------------------------------------------------------------------------
B8ESL6_METSB/13-251--------------------------------------------------------------------------------
A0M393_GRAFK/5-237--------------------------------------------------------------------------------
Y3659_RUEPO/4-242--------------------------------------------------------------------------------
W0PB55_9BURK/4-242--------------------------------------------------------------------------------
Y228_NEIMB/4-237--------------------------------------------------------------------------------
M9LS18_PSEA3/10-256--------------------------------------------------------------------------------
Y5076_MYCMM/4-242--------------------------------------------------------------------------------
E4TEH0_CALNY/3-241-----------------------------------------------------