Sequence alignment for CL0158

PF10096

Q8XK74_CLOPE/180-429---------------------------------------------------------------------------KGIIR
U5MQH8_CLOSA/192-443---------------------------------------------------------------------------IGLIR
G7MC91_9CLOT/194-445---------------------------------------------------------------------------IGLIR
M1MSD1_9CLOT/193-445---------------------------------------------------------------------------IGLIR
B2TQG3_CLOBB/185-436---------------------------------------------------------------------------IGLIR
R6P5J4_9FIRM/162-419---------------------------------------------------------------------------SAYIR
A6LS62_CLOB8/199-444---------------------------------------------------------------------------IGLIR
M1MAA0_9CLOT/199-444---------------------------------------------------------------------------IALIR
U5MNT4_CLOSA/199-442---------------------------------------------------------------------------IAMIR
M1MG87_9CLOT/199-442---------------------------------------------------------------------------VALIR
G7M6B9_9CLOT/199-442---------------------------------------------------------------------------VALIR
G7LYM9_9CLOT/199-443---------------------------------------------------------------------------VALIR
D9SNK6_CLOC7/207-454---------------------------------------------------------------------------AALIR
Q8XMN0_CLOPE/198-445---------------------------------------------------------------------------AALIR
U5RNL9_9CLOT/160-417---------------------------------------------------------------------------AALLR
A6LXX4_CLOB8/129-377---------------------------------------------------------------------------VSLIR
A5I018_CLOBH/188-437---------------------------------------------------------------------------PAFVR
W0EHC6_9FIRM/3-275---------------------------------------------------------------------------RAILR
A5D0J0_PELTS/44-299---------------------------------------------------------------------------AALVR
K4L6F7_9FIRM/42-301---------------------------------------------------------------------------PALVR
I0GIR5_CALEA/37-285---------------------------------------------------------------------------IALIR
R4SQ82_AMYOR/281-555---------------------------------------------------------------------------RALIR
G8SCF8_ACTS5/260-527---------------------------------------------------------------------------RALIR
U5WBT8_9ACTN/261-529---------------------------------------------------------------------------RALVR
A8LFA1_FRASN/262-530---------------------------------------------------------------------------RGLVR
W5WDT8_9PSEU/293-566---------------------------------------------------------------------------RALVR
E2Q861_STRC2/342-611---------------------------------------------------------------------------RALIR
K4RBX1_9ACTN/345-613---------------------------------------------------------------------------RAVVR
A1WAM2_ACISJ/315-589---------------------------------------------------------------------------QAMMR
D0J002_COMT2/256-530---------------------------------------------------------------------------KAMVR
B2UJM5_RALPJ/282-558---------------------------------------------------------------------------RAMVR
A0A068NT91_9BACT/235-497---------------------------------------------------------------------------QALLR
L0A522_DEIPD/259-504---------------------------------------------------------------------------RALVR
M9X7T8_MEIRD/244-506---------------------------------------------------------------------------RALAR
L0A502_DEIPD/323-574---------------------------------------------------------------------------RAILR
Q1IXI2_DEIGD/311-556---------------------------------------------------------------------------QAILR
Q1AST7_RUBXD/238-462---------------------------------------------------------------------------RAVIR
B0TC26_HELMI/295-528---------------------------------------------------------------------------.ATLR
R7P8S3_9BACT/4-202---------------------------------------------------------------------------KFLIR
E1RA10_SPISS/7-204---------------------------------------------------------------------------QYILR
Q7MSW5_WOLSU/4-200---------------------------------------------------------------------------RYIVR
E3GN09_EUBLK/1-199---------------------------------------------------------------------------MYLLR
R5ZC39_9FIRM/3-201---------------------------------------------------------------------------KYLLR
F4LX97_TEPAE/1-199---------------------------------------------------------------------------MYLIR
D4K2A5_9FIRM/3-201---------------------------------------------------------------------------QYIMR
R7LEI3_9BACT/4-204---------------------------------------------------------------------------KYLIR
A5V9P4_SPHWW/4-201---------------------------------------------------------------------------RYLFR
H6LBB2_ACEWD/5-204---------------------------------------------------------------------------RHIFR
E0RX58_BUTPB/2-201---------------------------------------------------------------------------HITIR
R5H8N9_9FIRM/2-200---------------------------------------------------------------------------KIAFR
R7R6S7_9FIRM/2-200---------------------------------------------------------------------------KITIR
R5CHW3_9FIRM/2-201---------------------------------------------------------------------------RIAIR
R6C994_9CLOT/6-204---------------------------------------------------------------------------KIAVR
R6ZDL3_9FIRM/2-202---------------------------------------------------------------------------KIAVR
R5BT68_9FIRM/9-207---------------------------------------------------------------------------KILIR
E4NN78_HALBP/100-323---------------------------------------------------------------------------.AVFR
H1XSW8_9BACT/27-257---------------------------------------------------------------------------LFVIR
B4U8C2_HYDS0/10-157---------------------------------------------------------------------------.LNIS
B2V9Y1_SULSY/4-150---------------------------------------------------------------------------KLNIS
D3SMT5_THEAH/3-151---------------------------------------------------------------------------SALVE
F8AAV2_THEID/3-151---------------------------------------------------------------------------KIIIE
K0CAU1_ALCDB/12-196---------------------------------------------------------------------------AFLLS
Q88N47_PSEPK/1-183---------------------------------------------------------------------------..MLV
Q9HW89_PSEAE/5-189---------------------------------------------------------------------------SLLLV
C1DDN4_AZOVD/5-189---------------------------------------------------------------------------HLLLV
K0ERT4_9NOCA/61-217---------------------------------------------------------------------------RLVVS
C7Q7J8_CATAD/6-161---------------------------------------------------------------------------.LLVS
D6Z9I9_SEGRD/14-177---------------------------------------------------------------------------VSLSG
C1A667_GEMAT/9-196---------------------------------------------------------------------------QLLVS
Q6LXR4_METMP/34-239---------------------------------------------------------------------------EPVIL
F6BD61_METIK/72-273---------------------------------------------------------------------------SPIIL
Y505_METJA/37-247---------------------------------------------------------------------------KPIIL
F6BE00_METIK/47-254---------------------------------------------------------------------------KPIIF
D7DSJ1_METV3/60-270---------------------------------------------------------------------------TPIVL
A6UV77_META3/44-251---------------------------------------------------------------------------KPIIL
Q5JH22_THEKO/56-259---------------------------------------------------------------------------RLVIL
Q897A5_CLOTE/246-480---------------------------------------------------------------------------KIFLR
A5I1D3_CLOBH/229-463---------------------------------------------------------------------------KVFIR
Q18AM8_PEPD6/233-467---------------------------------------------------------------------------RIFVR
F4LUH2_TEPAE/229-462---------------------------------------------------------------------------QIYVR
A8FA31_BACP2/214-479---------------------------------------------------------------------------TKYLM
Q65D17_BACLD/215-481---------------------------------------------------------------------------LLYLR
K0J5W3_AMPXN/221-485---------------------------------------------------------------------------TGYIR
Q81IW1_BACCR/212-474---------------------------------------------------------------------------EAYLR
C2WY28_BACCE/212-474---------------------------------------------------------------------------LAYLR
I4D437_DESAJ/233-460---------------------------------------------------------------------------QVLLR
M1E711_9FIRM/225-461---------------------------------------------------------------------------LGLIR

PF01522

NODB_AZOC5/9-134--------------------------------------------------------------------RITQNQSSIYIT
Q9A5L9_CAUCR/35-168--------------------------------------------------------------------KVALERPMVSFS
O69838_STRCO/70-214--------------------------------------------------------------------GGTKDGKPVALT
Q9XAP6_STRCO/96-224--------------------------------------------------------------------TVSVPDKTIVLT
CDA2_YEAST/112-232--------------------------------------------------------------------DDVYTCSKLSQT
Q98GK8_RHILO/808-946--------------------------------------------------------------------RQPFVGRPVLIT
ICAB_STAEQ/107-248--------------------------------------------------------------------KGKFPKRSVWIN
Q97ET9_CLOAB/86-214--------------------------------------------------------------------KRTDNKKVAYLT
YHEN_BACSU/79-203--------------------------------------------------------------------KQNMGDKTVYLT
Q9CHP6_LACLA/96-236--------------------------------------------------------------------KKEVIGKAVVIT
Q9RVF2_DEIRA/33-157--------------------------------------------------------------------EGRRARREVALT
Q982X7_RHILO/88-291--------------------------------------------------------------------AGGKGGRFATIT
Q97K82_CLOAB/62-192--------------------------------------------------------------------SNTKTEKTAYLT
O53444_MYCTU/41-164--------------------------------------------------------------------LSCSVIKCVALT
PDAA_BACSU/60-185--------------------------------------------------------------------LGNTKEKTIYLT
Q985U0_RHILO/77-213--------------------------------------------------------------------PAASGAGRVALT
Q9WXW8_THEMA/27-151--------------------------------------------------------------------GEENGVKLVALT
P73597_SYNY3/44-199--------------------------------------------------------------------DNIRLPISLSLM
Q9L1T3_STRCO/85-207--------------------------------------------------------------------SLSVPDHRLVLT
Q9A6E1_CAUCR/17-152--------------------------------------------------------------------AYAADKPVIAVT
Q97TP4_CLOAB/83-210--------------------------------------------------------------------KAPMPKKPVMLT
Q97JC7_CLOAB/83-211--------------------------------------------------------------------KREDGKKVAYLT
Q9X8Z4_STRCO/86-212--------------------------------------------------------------------ASDAGPNGVNIT
Q9KEF7_BACHD/63-188--------------------------------------------------------------------IGDTSRKELYLT
Q9PF00_XYLFA/74-213--------------------------------------------------------------------RGERSGKVMVVT
Q97LW8_CLOAB/106-234--------------------------------------------------------------------GKKVPKKSVLIT
Q9KEJ5_BACHD/75-214--------------------------------------------------------------------KLDTKEQVIALT
Q9CCZ2_MYCLE/73-201--------------------------------------------------------------------KIPGRGDLLALT
Q9KBK9_BACHD/74-199--------------------------------------------------------------------AGPTTANRIALT
Q9KSH6_VIBCH/26-172--------------------------------------------------------------------ANSTPKGTIYLT
Q9P9U2_XYLFA/249-384--------------------------------------------------------------------GNELPPKTLVLT
Q9FBM6_STRCO/131-288--------------------------------------------------------------------GRTPGPRTVHLT
Q9RV08_DEIRA/33-148--------------------------------------------------------------------GAGTAADRVALT
Y4760_STRCO/62-184--------------------------------------------------------------------HVRTDDPVVFLT
Q983K0_RHILO/61-197--------------------------------------------------------------------PAHGADRIIYLT
Q97MV1_CLOAB/82-216--------------------------------------------------------------------YKNDGKKIAYLT
Q9K630_BACHD/116-243--------------------------------------------------------------------DGTHDKKIVYLT
Q9R7V4_YERPE/101-271--------------------------------------------------------------------GPTLPDKAVLLT
Q9ZBN1_STRCO/59-183--------------------------------------------------------------------VDCAHTKCIALT
Q9PAV0_XYLFA/97-222--------------------------------------------------------------------QLDSTPPLVWLT
Q9KDB2_BACHD/39-162--------------------------------------------------------------------HVATNEPVIALT
Q9KA84_BACHD/124-248--------------------------------------------------------------------RGNPEKPMVTLL
Q9KVA7_VIBCH/402-543--------------------------------------------------------------------RLQPGKRFIIIT
PDAB_BACSU/51-176--------------------------------------------------------------------KGETDSKDISLT
NODB_RHILO/15-140--------------------------------------------------------------------ADGTGRRSVYLT
NODB_RHIME/15-140--------------------------------------------------------------------DYGTEDRSIYLT
Q9EWZ7_STRCO/52-176--------------------------------------------------------------------AGRGSPGHVALT
Q9PDB0_XYLFA/55-223--------------------------------------------------------------------GQPVPRKSIVIT
YXKH_BACSU/113-240--------------------------------------------------------------------DKKPSEKCVLIT
Q97DU4_CLOAB/83-214--------------------------------------------------------------------QKNNPKKTAYLT
Q9JWQ7_BACHD/50-175--------------------------------------------------------------------KAETDEKVAALT
Q9KYG2_STRCO/47-184--------------------------------------------------------------------ARGGGGDLVGLT
YADE_ECOLI/226-368--------------------------------------------------------------------KINLPARAVVIT
CDA1_YEAST/102-222--------------------------------------------------------------------DDVTSCFKLSQT
PDAC_BACSU/272-393--------------------------------------------------------------------TVDPNQKVIALT
Q97GQ0_CLOAB/126-253--------------------------------------------------------------------KKPFSIKPILIT
Q9CJ95_LACLA/136-266--------------------------------------------------------------------KEKPSDKMVWLT
Q97EU7_CLOAB/97-223--------------------------------------------------------------------IGDSSKKVIYLT
Q99Z68_STRP1/235-356--------------------------------------------------------------------KEQHPKKLVALT
NODB_RHISN/12-137--------------------------------------------------------------------RSGTGAPSVYLT
Q9RCX4_STRCO/8-132--------------------------------------------------------------------RMTGRGRTMLLT
PGAB_ECOLI/101-271--------------------------------------------------------------------GKPLPEKAVVLT
CDA1_SCHPO/63-190--------------------------------------------------------------------NRPVRERSIESC
Q99ZT1_STRP1/154-283--------------------------------------------------------------------NELPAKKVVWLT
O86800_STRCO/103-225--------------------------------------------------------------------TVPTKEKVVFLT
Q97GI4_CLOAB/50-174--------------------------------------------------------------------SVDTKDKKIAIT
Q97M42_CLOAB/8-133--------------------------------------------------------------------FPDGKFKVLTMS
Q9CIS3_LACLA/170-291--------------------------------------------------------------------NQYANKKLIALT
B3PIN1_CELJU/396-514--------------------------------------------------------------------....CSGYVGIT
D8Q165_SCHCM/200-314--------------------------------------------------------------------.......HWGVS
E6UBP6_RUMA7/470-592--------------------------------------------------------------------..DKDKPMVAIA
F4GY46_CELFA/213-331--------------------------------------------------------------------....TGDVSALT
F4H710_CELFA/356-474--------------------------------------------------------------------.....AGYVGLT
Q326Y8_SHIDS/46-204--------------------------------------------------------------------.GKLPRKSVMLT
Q7AQ13_MYCLE/46-161--------------------------------------------------------------------.....VKCIALT
Q81Z49_BACAN/63-186--------------------------------------------------------------------.GDTKKKDIYLT
PGDA_STRR6/264-377--------------------------------------------------------------------..KKHQKVVALT
Q9RKN7_STRCO/46-161--------------------------------------------------------------------......GYVGLT
ICAB_STAA8/109-248--------------------------------------------------------------------.GKFPKRSVWIN
S2JG56_MUCC1/153-273--------------------------------------------------------------------..CPEPETWGLT

PF03065

AMY1_DICT6/8-294--------------------------------------------------------------------SLGIHNHQP...
O66934_AQUAE/7-429--------------------------------------------------------------------VFWWHMHQPLYR
Q8TZQ1_PYRFU/35-537--------------------------------------------------------------------IIVWHQHQPYYY
MALQ_THEKO/7-291--------------------------------------------------------------------IFGIHNHQPL..
Q9HLU6_THEAC/262-747--------------------------------------------------------------------AIIYNDHQPLYK
Q8ZT36_PYRAE/22-486--------------------------------------------------------------------IFIFHNHQPWYL
Q8U136_PYRFU/6-395--------------------------------------------------------------------TFVLHSHIPYVR
Q8YXA5_NOSS1/8-473--------------------------------------------------------------------AFIWHQHQPLYK
Q55545_SYNY3/8-468--------------------------------------------------------------------AFVWHQHQPCYQ
Q97BM4_THEVO/7-311--------------------------------------------------------------------YFEIHQPFRLRP
AMYA_PYRHO/7-291--------------------------------------------------------------------IFGVHNHQPL..
O58106_PYRHO/3-316--------------------------------------------------------------------ALIFHGNLQYAE
AMYA_METJA/6-319--------------------------------------------------------------------NFEVHQPHRLNK
Q9KD04_BACHD/7-382--------------------------------------------------------------------SLVLHAHLPYVR
Q8TIT8_METAC/38-312--------------------------------------------------------------------NHIFSRLLK...
O83182_TREPA/12-351--------------------------------------------------------------------AFAAKLTEACVQ
Q9HL91_THEAC/8-289--------------------------------------------------------------------VF..........
Q8ZT57_PYRAE/6-321--------------------------------------------------------------------FFEVHQPRRLRP
Q8TIT9_METAC/7-321--------------------------------------------------------------------YFQVHQPFRLRR
O50094_PYRHO/6-394--------------------------------------------------------------------TFVLHTHIPYVR
Q973T0_SULTO/7-324--------------------------------------------------------------------GFEVHQPFRIRR
Q97ZD2_SULSO/7-324--------------------------------------------------------------------GFEVHQPFRIRR

PF09960

R7BLQ4_9FIRM/15-595ALFVLSILVFRERAGIGYEQTDAQ....AR....EWNLSYSDEV.......EQDIKCLILT.SDED..VSCEYGKMMEFV
R7D4R5_9FIRM/22-599CFILIAAALFAERSGVQYQEKKRQISYIDK....DKIITEKEAA......DSLKKTCLVLRDSSQK..ESEQAWIEFQRI
A1A0E3_BIFAA/3-581....IALVLLAQTLGIHYGATKFTLKYMAR....NEAIPAQNAI......MGQRATNLMLVDSSQD..GVDEAETMMKQV
A6LLQ2_THEM4/8-739LLLILSLFVFSQK..........................................KILLLYKKTEE.YGKYMLQNYVIPI
F7YUX2_9THEM/11-746LLLTLSCVAFGEK..........................................PFLLLYNPTEQ.YGEYMMKNHVVPV
Q9X1C9_THEMA/8-698ILVLLAFPFFS............................................KTLLLYKGSEGGYGYNIL.SWLAPE
Q97L33_CLOAB/20-587FFQIL.......RLNFVMNFFKNDKGITNKISYTSAKIPSNTE..........KEKFLILFDKNEQ..NSSEIKNNIEQM
H2J5Y8_MARPK/9-749ILIIIAVLSFSQK..........................................ELLLLYKQSEN.YGEMMFKYHIIPI
C0ZK84_BREBN/11-593FVAILGITIEATRSQFILQVSSNKSGGSGK....EADEPKQNAISQEEIAKLVRERFLILHDSKDE..SSMAIARNVEQV
A7HKR3_FERNB/18-733FVIFLDTLAYP............................................KALLLYKNSEQGYGYNILLKYVAPE
A8AV35_STRGC/20-596IFLLLSAVLWIQKSGEQYTVNP............EKNIYLKNAPSSNAVFDSLAQDNLVLYDENND..TSRRAKEQFTQI

PF01074

MA2A1_MOUSE/166-496---------------------------------------------------------------QVFVVPHSHNDPGWLKT
MA2A2_HUMAN/167-497---------------------------------------------------------------QVFVVPHSHNDPGWIKT
MANA_DICDI/43-353---------------------------------------------------------------NVHIVAHTHDDVGWLKT
MA2B1_HUMAN/64-381---------------------------------------------------------------NVHLLPHTHDDVGWLKT
O01574_CAEEL/138-459---------------------------------------------------------------KVYVLPFTHVDPGWLET
MA2B2_MOUSE/28-351---------------------------------------------------------------RAFVVPHSHMDVGWVFT
MA2C1_RAT/251-510---------------------------------------------------------------TIHATGHCHIDTAWLWP
MAN1_YEAST/290-559---------------------------------------------------------------NVYGIGNCHIDTAWLWP
P94078_ARATH/39-350---------------------------------------------------------------NVHLVPHSHDDVGWLKT
Q20829_CAEEL/37-351---------------------------------------------------------------TAHLIPHTHDDLGWIKT
MAN2_DROME/145-471---------------------------------------------------------------KVFVVPHSHNDPGWIQT
MA2B2_PIG/28-342---------------------------------------------------------------KVFVVPHSHMDVGWLHT
Q55528_SYNY3/232-495---------------------------------------------------------------QINLLGHAHLDMAWLWQ
Q7NPH5_GLOVI/217-477---------------------------------------------------------------TIALLGHSHIDMAWLWT
Q7PMM6_ANOGA/166-493---------------------------------------------------------------HVFVVPHSHNDPGWIQT
Q7S1L0_NEUCR/285-549---------------------------------------------------------------LVFGIGHCHIDSCWLWP
Q7U9I9_SYNPX/234-492---------------------------------------------------------------AVHWFGHAHLDLAWLWT
Q7V4V0_PROMM/221-479---------------------------------------------------------------LIHWIGHAHLDLAWLWS
Q826B6_STRAW/254-513---------------------------------------------------------------HISAVGHAHIDSAWLWP
Q82MA7_STRAW/254-513---------------------------------------------------------------TLSGVGHAHIDSAWLWP
Q8A5X3_BACTN/297-572---------------------------------------------------------------TVYLVQHTHTDIGYTKP
Q8DM33_THEEB/217-475---------------------------------------------------------------TIHLCGHAHLDLAWLWP
Q8G4P9_BIFLO/264-528---------------------------------------------------------------TLTAMGHSHIDSAWLWP
Q8G4Q0_BIFLO/268-532---------------------------------------------------------------NHIAIGHAHIDSAWLWP
Q8G4Q1_BIFLO/267-531---------------------------------------------------------------NVSAIGHAHIDSAWLWP
Q8IPB7_DROME/48-364---------------------------------------------------------------NVHLVAHTHDDVGWLKT
Q8LPJ3_ARATH/38-350---------------------------------------------------------------NVHVVPHSHDDVGWLKT
Q8XIN5_CLOPE/235-510---------------------------------------------------------------VATCVGHTHIDVAWLWT
Q8XM34_CLOPE/260-519---------------------------------------------------------------SVSAIGHAHIDLAWLWP
Q8Y5P1_LISMO/243-513---------------------------------------------------------------KVAAVGHTHIDVAWLWR
Q8Y9W8_LISMO/5-267---------------------------------------------------------------KVHVIPHSHWDREWYFT
Q8YYK0_NOSS1/230-491---------------------------------------------------------------KIYLLGHAHLDLAWLWP
Q97UK5_SULSO/220-473---------------------------------------------------------------VLVGTGHAHIDTAWLWP
Q9FKW9_ARATH/48-359---------------------------------------------------------------NVHLVPHSHDDVGWLKT
Q9KEQ8_BACHD/237-511---------------------------------------------------------------HIHAIGHSHIDLAWLWQ
GMAN2_ARATH/154-493---------------------------------------------------------------KIFVVPHSHNDPGWKLT
MAN1_SCHPO/282-549---------------------------------------------------------------NVFAIGHCHIDTAWLWP
Q9VLI0_DROME/38-352---------------------------------------------------------------NIHLVPHSHDDVGWLKT
Q9X2G6_THEMA/247-507---------------------------------------------------------------TIHLVGHAHIDYAWLWP
B2HSI3_MYCMM/98-400---------------------------------------------------------------TMFMVSHFHYDPVWWNT
C8VJ45_EMENI/284-549---------------------------------------------------------------.VYGIGHCHIDTCWLWP
H9JRV7_BOMMO/33-353---------------------------------------------------------------KVIVVPHSHNDPGWLKT
Q9VF33_DROME/169-499---------------------------------------------------------------KIIVVPHSHNDPGWLKT
Q9VLH9_DROME/39-352---------------------------------------------------------------NIHMVPHSHDDVGWLKT
Q9VLI2_DROME/38-351---------------------------------------------------------------NIHLVPHSHDDLGWLKT

PF15421

Q8A8I5_BACTN/62-500------------------------------------------------AEIIIHTKKEIQTKDINVEIPHLKYNKTWMLM
Q5LDR1_BACFN/50-470------------------------------------------------AEITIKTNSTINLELLDVYFAPLKYNKHLLIM
D4IMW2_9BACT/39-464------------------------------------------------AEIALSFGPGTDLSAAHIEIPPLKYNKSLLLL
R5UTM0_9PORP/51-471------------------------------------------------VEMVIQTKAGINMEQVKVEIPPLKYNKSWLFI
R6DLU9_9BACE/67-497------------------------------------------------.DITIHLKKDRQVSGLNAEIPPLKYNKEWLFM

PF03746

D7BG02_MEISD/3-241---------------------------------------------------------------MDLNADAGESFGSW..K
W5XZK8_9CORY/7-245---------------------------------------------------------------FDLNADLGESFGAY..S
D5QFG9_KOMHA/3-241---------------------------------------------------------------IDLNSDMGEGFGRW..R
Q6LSN4_PHOPR/2-250---------------------------------------------------------------.KLNCDMGESYGLW..Q
I0JJ59_HALH3/4-242---------------------------------------------------------------VDINCDMGESFGTY..T
F4C1I4_SPHS2/4-242---------------------------------------------------------------IDINCDVGESFGAY..T
Q2RU90_RHORT/5-243---------------------------------------------------------------VNVNADLGEGYGAY..R
D5MN08_9BACT/6-243---------------------------------------------------------------VDLNSDVGESFGVW..T
R5XP92_9FIRM/4-242---------------------------------------------------------------VDLNSDLGESFGNY..T
L7WC11_NONDD/4-237---------------------------------------------------------------IDLNCDLGE........
D6Y0B4_BACIE/3-241---------------------------------------------------------------VDINADLGERFGVY..D
D5BG15_ZUNPS/4-236---------------------------------------------------------------IDINCDLGEGGD.....
M3DE22_SPHMS/8-244---------------------------------------------------------------VHINVDLGEGYGNF..K
D5EDK5_AMICL/4-242---------------------------------------------------------------VDLNSDLGESFGVY..V
G8S4N9_ACTS5/10-248---------------------------------------------------------------VDLNADLGEGFGAW..R
F5XPT6_MICPN/6-244---------------------------------------------------------------IDLNSDLGEGFGTW..R
Y1143_NATTJ/4-242---------------------------------------------------------------IDLNCDMGESFGHY..K
F5XTC9_MICPN/4-241---------------------------------------------------------------IDLVADLGESFGAW..S
R5E047_9CLOT/3-241---------------------------------------------------------------IDLNCDLGESFGNY..V
E3H7Y1_ILYPC/4-242---------------------------------------------------------------VDLNSDLGESFGNY..K
D0IYS7_COMT2/4-242---------------------------------------------------------------MDLNSDLGESFGAW..R
Y1384_PEPD6/4-242---------------------------------------------------------------VDLNSDLGESFGTY..K
Q4FSQ9_PSYA2/3-236---------------------------------------------------------------IDLNADVAEG.......
L0DCE0_SINAD/9-227---------------------------------------------------------------IDLNADLGE........
E6SM88_THEM7/5-243---------------------------------------------------------------IDLNCDLGESFGAY..T
Y2112_KOCRD/4-242---------------------------------------------------------------MDLNSDVGEPFGAW..G
A5DMJ6_PICGU/30-269---------------------------------------------------------------.EINCDMGEGFGPW..K
A2U3P8_9FLAO/3-236---------------------------------------------------------------VDINCDVGEGVA.....
B1ZX56_OPITP/4-232---------------------------------------------------------------LDLNCDLGEG.......
Y2917_PSESM/3-241---------------------------------------------------------------IDLNADLGEGFGAW..T
U4KC78_9VIBR/2-236---------------------------------------------------------------ININSDMGEGFGIY..K
F5YAB0_TREAZ/4-242---------------------------------------------------------------VDLNCDLGESFGAW..K
G3B4G0_CANTC/32-271---------------------------------------------------------------.EINCDMGEGFGPW..K
S5XZQ9_PARAH/1-238---------------------------------------------------------------MDLNSDMGEAFGAW..Q
C5CZ15_VARPS/3-236---------------------------------------------------------------IDLNADLGEG.......
D1C8S7_SPHTD/5-240---------------------------------------------------------------MDINSDMGESFGRY..T
B4EWE9_PROMH/5-242---------------------------------------------------------------VDLNSDLGESFGQW..R
E8NF87_MICTS/3-240---------------------------------------------------------------VDLNADLGETVDGM..P
Q1IXD6_DEIGD/5-238---------------------------------------------------------------IDLNADLGE........
Y1821_BACHD/4-242---------------------------------------------------------------VDLNSDLGESFGAY..T
F6FQW1_ISOV2/4-241---------------------------------------------------------------VDLNSDLGEGFGRW..N
U5RSR8_9CLOT/3-239---------------------------------------------------------------IDINVDMGESFGRY..V
Y1029_CHRSD/6-245---------------------------------------------------------------..LNCDMGESFGNW..K
Y2522_SYMTH/11-249---------------------------------------------------------------IDLNCDMGESFGVY..R
G2PME2_MURRD/6-239---------------------------------------------------------------IDINCDVGEGVG.....
M1MIN5_9CLOT/4-242---------------------------------------------------------------VDLNCDLGESFGAY..K
Y2314_ERWT9/3-235---------------------------------------------------------------VDLNADLGEG.......
Q0S878_RHOJR/47-285---------------------------------------------------------------IDLNSDLGESYGAW..T
U3TWJ9_9ENTR/3-236---------------------------------------------------------------IDLNADLGEG.......
D3EM31_GEOS4/4-242---------------------------------------------------------------VDLNCDMGESYGAY..K
Y535_KINRD/4-242---------------------------------------------------------------IDLNSDLGENTPDR..P
A3UBZ2_CROAH/4-236---------------------------------------------------------------IDINCDLGE........
H2IWK8_RAHAC/3-236---------------------------------------------------------------VDLNADLGEG.......
C6XL46_HIRBI/7-240---------------------------------------------------------------IDLNADLGE........
G9MQN1_HYPVG/10-247---------------------------------------------------------------.EINADMGEGFGRW..K
Y2112_PSEAE/4-245---------------------------------------------------------------LLLNCDIGESFGAW..R
Y4436_RALSO/3-241---------------------------------------------------------------IDLNADLGEGYGPW..R
Y2790_CLOK5/4-243---------------------------------------------------------------IDLNCDLGEGFGVY..K
D7A9V4_STAND/3-236---------------------------------------------------------------VVINCDMGEGYGLY..S
M5A4V0_9ACTN/5-243---------------------------------------------------------------IDLNADLGEGTEAA..H
R5QKJ0_9FIRM/3-241---------------------------------------------------------------VDLNADLGESFGNY..K
W5TLR8_9NOCA/3-239---------------------------------------------------------------IDLNSDLGEGFGAW..S
Y2520_ACIAD/3-241---------------------------------------------------------------IDLNSDLGESYGSW..I
D7A110_STAND/4-243---------------------------------------------------------------IDLNCDMGEGFGVY..S
I0DPN0_PROSM/5-243---------------------------------------------------------------IDLNSDLGESFGQW..K
D2PYH8_KRIFD/4-242---------------------------------------------------------------VDLNADLGEGYGSW..A
B7VS04_VIBTL/1-234---------------------------------------------------------------......MGESFGNW..K
L0G1R1_ECHVK/3-236---------------------------------------------------------------IDINCDLGEGME.....
Y2655_BREBN/4-242---------------------------------------------------------------VDLNCDMGESFGAY..Q
Y1272_PYRFU/3-241---------------------------------------------------------------VDLNSDLGESFGRY..K
F4H0L0_CELFA/5-255---------------------------------------------------------------IDFNCDLGEGLDAWEPG
A9WUH9_RENSM/280-518---------------------------------------------------------------VDLNSDLGESFGSW..P
D6Y403_THEBD/3-248---------------------------------------------------------------IDLNADLGEGFGIW..R
F4GUU2_PUSST/5-243---------------------------------------------------------------IDLNCDMGESFGAW..K
A5WHM5_PSYWF/13-246---------------------------------------------------------------IDLNADVAEG.......
I3Z849_BELBD/30-262---------------------------------------------------------------LDINCDLGEGMP.....
M4RSN8_9BIFI/4-242---------------------------------------------------------------IDLNSDMGESFGRW..A
M9R857_9RHOB/6-244---------------------------------------------------------------VDLNCDMGEGFGQW..V
R7JBC4_9FUSO/13-246---------------------------------------------------------------IDFNIDLAQSFGIY...
C5D2N8_GEOSW/3-241---------------------------------------------------------------VDLNCDFGESFGIY..R
D5V4N2_ARCNC/3-244---------------------------------------------------------------IELNCDVGDSFGIW..K
R5B6J0_9CLOT/6-244---------------------------------------------------------------VDLNSDLGESFGAY..T
D8J6F9_HALJB/4-240---------------------------------------------------------------VDINCDMGESFGNW..E
Q2KTU9_BORA1/6-244---------------------------------------------------------------IDLNSDMGEGFGPW..K
C5D207_VARPS/3-241---------------------------------------------------------------IDLNADLGEGFGPW..R
F8Q293_SERL3/10-254---------------------------------------------------------------..VNCDMGESFSIY..S
E9T1F8_RHOHA/4-242---------------------------------------------------------------IDLNSDLGESFGAW..T
H8KYG9_FRAAD/4-242---------------------------------------------------------------IDLNADLGEGFGPW..R
Y1612_LACF3/4-240---------------------------------------------------------------IDLNSDLGESFGRY..T
R7AUI2_9FIRM/4-242---------------------------------------------------------------VDLNCDLGESFGAY..R
L0A698_DEIPD/4-241---------------------------------------------------------------LDLNCDMGESYGRF..T
F5Z8H6_ALTSS/2-241---------------------------------------------------------------.KLNCDLGESFGAW..Q
E0TF98_PARBH/9-240---------------------------------------------------------------IDLNADVGEGMG.....
Y1004_CORGL/4-242---------------------------------------------------------------IDLNSDLGESYGSW..V
U4KHV1_9VIBR/2-235---------------------------------------------------------------.KLNCDMGESFGCW..A
A4X134_SALTO/1-238---------------------------------------------------------------MDLNADLGEGLGVW..R
X5DN33_9CORY/5-237---------------------------------------------------------------.TINADLGEGLGLH..A
F0RQS5_DEIPM/3-243---------------------------------------------------------------TDLNADAGESFGNW..T
R5T180_9GAMM/13-246---------------------------------------------------------------IDFNCDLAQAYGVY...
A9I0Z0_BORPD/28-266---------------------------------------------------------------IDLNCDMGESYGAW..H
A3Q8T1_SHELP/8-241---------------------------------------------------------------IDLNADLGE........
R6NVF4_9CLOT/4-237---------------------------------------------------------------IDLNSDLGEG.......
A5D328_PELTS/1-237---------------------------------------------------------------MDLNVDMGESFGRY..K
F7QMW8_9BRAD/3-242---------------------------------------------------------------IDLNSDLGEGFGAW..E
I2BBK3_SHIBC/7-245---------------------------------------------------------------IDLNSDLGESYGQW..T
D5V4P7_ARCNC/3-243---------------------------------------------------------------IKLNCDMGESFGIW..K
B1HUZ0_LYSSC/2-236---------------------------------------------------------------.DINCDLGESYEAF..L
C5C6S0_MICLC/7-245---------------------------------------------------------------IDLNSDVGESFGSW..T
X2GVX0_9BACI/3-237---------------------------------------------------------------IDINCDMGEGMDVL..T
A0QXR8_MYCS2/4-236---------------------------------------------------------------IDLNADLGESFGVY..T
Y2372_RALPJ/4-237---------------------------------------------------------------IDLNADLGEG.......
E6TY73_BACCJ/5-243---------------------------------------------------------------VDLNSDIGESFGAY..K
H2G083_OCESG/4-245---------------------------------------------------------------LLLNADMGESFGPW..S
Q0RVU6_RHOJR/3-237---------------------------------------------------------------IDLNADAGESFGRW..V
F4KPP8_HALH1/2-235---------------------------------------------------------------IDLNCDLGEGFP.....
E2PUA2_STRC2/26-264---------------------------------------------------------------IDLNADLGEGFGRW..R
G0G150_AMYMS/1-239---------------------------------------------------------------MDLNSDLGEGFGAW..K
R4LWQ2_9ACTN/1-239---------------------------------------------------------------MDLNSDLGEGFGTW..R
D2B933_STRRD/3-241---------------------------------------------------------------IDLNADLGEGFGIW..R
Y3392_SYNFM/3-241---------------------------------------------------------------TDINCDMGESFGSY..R
B6JF92_OLICO/5-244---------------------------------------------------------------VDINSDIGEGFGAW..T
F8IB92_SULAT/6-243---------------------------------------------------------------IDLNSDMGESFGAW..T
W1QAN8_OGAPD/24-260---------------------------------------------------------------..IVCDMGEGFGKW..K
E3Q2S8_COLGM/10-249---------------------------------------------------------------.DINADMGEGFGPW..K
D3PTP5_MEIRD/3-241---------------------------------------------------------------IDLNADAGESFGNW..K
E4TP81_MARTH/4-239---------------------------------------------------------------IDINCDLGESFGQF..I
A9AYX3_HERA2/3-236---------------------------------------------------------------IDLNADLGE........
F4CNG9_PSEUX/4-242---------------------------------------------------------------IDLNSDVGESYGRW..T
Y1488_MACCJ/3-241---------------------------------------------------------------IDLNADLGESFGNY..K
J5JGM9_BEAB2/14-248---------------------------------------------------------------.EINADMGEGFGQW..K
D1BTW0_XYLCX/4-242---------------------------------------------------------------VDLNADLGEGFGQW..T
Y407_CORJK/10-248---------------------------------------------------------------IDLNADLGETTGGN..P
V5XGL8_MYCNE/4-242---------------------------------------------------------------VDLNADLGEGFGVW..R
D5WUZ1_KYRT2/4-242---------------------------------------------------------------IDLNSDMGESFGVY..T
C5AT01_METEA/6-244---------------------------------------------------------------IDLNADLGEGFGPW..R
B0RI75_CLAMS/3-241---------------------------------------------------------------IDLNSDLAESFGRW..T
K4IM75_PSYTT/4-236---------------------------------------------------------------INLNCDLGE........
Y3770_BACSK/4-242---------------------------------------------------------------IDLNSDVGESYGAY..T
G2NVC5_STRVO/7-244---------------------------------------------------------------.AVVADLGESFGNY..T
Q5NI64_FRATT/3-227---------------------------------------------------------------.LINCDLGER......G
C5BPU8_TERTT/2-239---------------------------------------------------------------VKLNCDLGEGLDAL...
Y2634_CROS8/4-237---------------------------------------------------------------IDLNADLGEG.......
G0IXS0_CYCMS/5-233---------------------------------------------------------------VDLNCDLGE........
N1PZT0_DOTSN/8-245---------------------------------------------------------------VHINVDLGEGYGNF..E
Q0SB09_RHOJR/3-241---------------------------------------------------------------VDLNCDLGEGFGQW..T
M1E8N0_9FIRM/3-239---------------------------------------------------------------VDLNSDVGESFGVY..K
C7NIG6_KYTSD/4-242---------------------------------------------------------------IDLNADLGEGLGMW..R
D9QUX4_ACEAZ/4-242---------------------------------------------------------------VDLNSDIGESFGNY..K
G8RT09_MYCRN/15-253---------------------------------------------------------------VDLNADLGESFGVW..K
R5C385_9FIRM/4-242---------------------------------------------------------------IDLNSDLGEGFGAY..K
E1VFF3_9GAMM/4-235---------------------------------------------------------------LELNADVGE........
E4RUB2_LEAB4/3-231---------------------------------------------------------------IEINCDMGERAETQ...
D5DCK3_BACMD/4-242---------------------------------------------------------------VDLNCDLGESFGNY..R
D9RZ18_THEOJ/5-243---------------------------------------------------------------VDLNSDIGESFGAY..K
E2SG17_9ACTN/9-231---------------------------------------------------------------VDLNADLGESVERW..E
Y1541_CAMJE/4-242---------------------------------------------------------------VDLNSDLGESFGAY..K
D3Q482_STANL/5-243---------------------------------------------------------------IDLNCDLGEGFGVW..T
D6ZAE9_SEGRD/6-231---------------------------------------------------------------VDLNADLGESLGVW..R
C0ZM31_RHOE4/5-242---------------------------------------------------------------IDLVADLGEGFGTW..T
M3B8E6_PSEFD/8-245---------------------------------------------------------------VHINVDLGEAYGNY..K
G4R9N3_PELHB/5-238---------------------------------------------------------------IDLNADLGEAIG.....
Q0C0C1_HYPNA/5-242---------------------------------------------------------------ICLNADIGELPGEA...
X5EC88_9CORY/4-241---------------------------------------------------------------IDLNADLGETTGGI..A
W0HWN7_9ENTR/4-243---------------------------------------------------------------VDINADLGEGLGRW..K
Y4486_PECAS/3-241---------------------------------------------------------------IDVNSDMGEGFGVW..R
D4MW94_9FIRM/4-242---------------------------------------------------------------IDLNSDLGESFGHY..T
F4HE29_GALAU/4-237---------------------------------------------------------------VDLNVDLAEG.......
K0B3I8_CLOA9/8-246---------------------------------------------------------------VDLNSDIGESFGIY..K
Y2450_CARHZ/4-240---------------------------------------------------------------IDLNADIGESYGNF..K
D7CXP4_TRURR/5-245---------------------------------------------------------------VDLNADLGEAFGVW..Q
Y1858_TOLAT/4-242---------------------------------------------------------------VDLNCDMGESFGIY..Q
F8KSZ7_HELBC/4-242---------------------------------------------------------------VDLNSDIGEGFGVY..K
A1RBG9_ARTAT/5-242---------------------------------------------------------------IDLVADLGEGFGAY..T
D8IRE9_HERSS/3-236---------------------------------------------------------------IDLNADLGEG.......
A4CKX7_ROBBH/8-240---------------------------------------------------------------IDLNCDVGEGVG.....
K0L0G1_WICCF/20-257---------------------------------------------------------------.EINCDMGEGFGRY..Q
H0Q289_9RHOO/5-243---------------------------------------------------------------INLNADLGESFGAW..R
V5UEX5_9BURK/3-235---------------------------------------------------------------IDLNVDLGEG.......
Q1GEX9_RUEST/5-243---------------------------------------------------------------VDLNADMGESFGPW..V
G3JBY9_CORMM/25-269---------------------------------------------------------------IRIHCDMGEAFGNW..T
C0ZPT0_RHOE4/5-243---------------------------------------------------------------VDLNSDLGEGFGAW..T
Y2677_OCEIH/5-243---------------------------------------------------------------VDLNSDIGESYGAY..T
B8ESL6_METSB/13-251---------------------------------------------------------------VDLNCDCGEGFGPY..A
A0M393_GRAFK/5-237---------------------------------------------------------------IHINCDLGEGRK.....
Y3659_RUEPO/4-242---------------------------------------------------------------VDLNADMGESFGPW..K
W0PB55_9BURK/4-242---------------------------------------------------------------IDLNCDMGESFGAW..T
Y228_NEIMB/4-237---------------------------------------------------------------VDLNADLAEG.......
M9LS18_PSEA3/10-256---------------------------------------------------------------IEINSDMGEAFGRW..Q
Y5076_MYCMM/4-242---------------------------------------------------------------IDLNADLGEGFGIW..Q
E4TEH0_CALNY/3-241---------------------------------------------------------------IDLNCDLGESFGAY..K
Q03XI2_LEUMM/7-243---------------------------------------------------------------VDFNSDLGESFGNY..K
C7MY76_SACVD/5-243---------------------------------------------------------------IDLNSDLGEGFGAW..P
Y870_RHOFT/3-241---------------------------------------------------------------MDLNSDLGESLGAW..R
D5WT32_KYRT2/3-240---------------------------------------------------------------VDLNCDMGESFGAW..T
G7V6Q9_THELD/4-242---------------------------------------------------------------IDLNSDLGESFGAY..K
W0K188_9EURY/4-239---------------------------------------------------------------IDINCDMGESFGNW..T
C8WJT5_EGGLE/4-242---------------------------------------------------------------IDLNSDLGESFGRY..T
F8A3C2_CELGA/1-238---------------------------------------------------------------MDLNCDLGEGLDPWQPG
D5USV9_TSUPD/5-243---------------------------------------------------------------IDLNADCGESYGAW..R
C7MA67_BRAFD/8-245---------------------------------------------------------------LDLNADLGEGVGAW..S
R6ZG54_9CLOT/4-242---------------------------------------------------------------VDLNSDLGESFGNY..T
E3I0X6_RHOVT/3-241---------------------------------------------------------------IDLNADMGEGFGVY..R
R6WIY8_9FIRM/4-242---------------------------------------------------------------VDLNCDLGESFGNY..K
Y3193_STRGG/2-240---------------------------------------------------------------MDLNADLGEGFGNW..T
J9Z0K8_9PROT/6-239---------------------------------------------------------------INFNSDLAERDLSF..Y
L0A0G9_DEIPD/6-244---------------------------------------------------------------VDINADAGESYGAW..P
D2SFX6_GEOOG/1-239---------------------------------------------------------------MDLNSDLGEGFGQW..R
F2IVP4_POLGS/3-236---------------------------------------------------------------VTINCDMGESFGLY..R
Y5378_PSESM/4-242---------------------------------------------------------------IDLNSDLGESFGAW..S
R5D7F4_9FIRM/4-242---------------------------------------------------------------VDLNCDLGESFGNY..K
A1WRL8_VEREI/23-261---------------------------------------------------------------IDLNSDMGEGFGPW..R
Y492_PSEAE/4-242---------------------------------------------------------------VDLNSDMGEGFGPW..T
G4KUC6_OSCVS/4-242---------------------------------------------------------------VDLNSDLGESFGAY..T
B9K5U5_AGRVS/3-241---------------------------------------------------------------IDLNSDMGEGFGPY..R
Y2936_PSESM/3-241---------------------------------------------------------------IDFNSDMGESFGAW..T
E0SL44_DICD3/5-243---------------------------------------------------------------IDLNSDMGENFGPW..K
C5C2F0_BEUC1/8-228---------------------------------------------------------------VDLNADLGEGVG.....
E6WID8_PANSA/3-241---------------------------------------------------------------IDVNSDMGEGFGVY..Q
C5AIE4_BURGB/6-244---------------------------------------------------------------VDLNSDLGEGFGLW..T
Y126_CUPNH/3-236---------------------------------------------------------------IDLNADLGEG.......
Y1315_CHLAA/4-242---------------------------------------------------------------IDINCDCGESYGAF..Q
B9L4Q4_THERP/5-240---------------------------------------------------------------IDINCDMGESFGRW..T
Y4277_AGRFC/3-241---------------------------------------------------------------IDLNSDMGEGFGPY..R
H6RAT6_NOCCG/3-241---------------------------------------------------------------LDLNSDLGEGFGPW..T
A4YUI8_BRASO/5-244---------------------------------------------------------------VDLNCDLGESFGPW..E
C6WEW0_ACTMD/3-240---------------------------------------------------------------LDLNSDLGEGFGIW..R
B8IQH8_METNO/3-241---------------------------------------------------------------ININADIGESFGRF..K
U3GU40_9CORY/2-237---------------------------------------------------------------VDLNADLGERFGLW..P
H6NIN3_9BACL/8-246---------------------------------------------------------------IDLNGDMGESFGVY..R
Q223B3_RHOFT/22-260---------------------------------------------------------------MDLNSDMGEGFGPW..S
Y4304_PHOLL/4-242---------------------------------------------------------------IDLNSDLGEGFGQW..K
M1FEE9_9ALTE/2-242---------------------------------------------------------------.LLNCDIGESYGAW..A
Y3634_BRADU/3-241---------------------------------------------------------------IGINSDMGEGFGNY..R
C6CWI5_PAESJ/6-244---------------------------------------------------------------VDLNCDFGEGYGSY..S
B9JN39_AGRRK/3-241---------------------------------------------------------------IDLNSDMGEGFGPY..R
Y1066_COREF/7-245---------------------------------------------------------------IDLNSDLGESYGSW..V
X4ZHZ1_9BACL/4-242---------------------------------------------------------------VDLNCDMGESFGAY..I
Y4198_BURPS/6-244---------------------------------------------------------------VDLNSDMGEGFGPW..K
Y3173_CHRVO/3-236---------------------------------------------------------------IDLNADLGEG.......
W0HX68_9ENTR/3-242---------------------------------------------------------------IDLNSDMGESFGPW..A
G7ZEN3_AZOL4/4-243---------------------------------------------------------------IDLNCDMGEGYGAW..A
Y439_FUSNN/5-242---------------------------------------------------------------VDLNSDIGEGYGAY..K
B1VIF3_CORU7/7-244---------------------------------------------------------------IDLNADLGESNAGN..P
I1XMA4_METNJ/11-252---------------------------------------------------------------LLLNCDMGESLGQW..S
C1DQ20_AZOVD/7-248---------------------------------------------------------------ILLNCDMGESFGVW..K
F4FA66_VERMA/1-238---------------------------------------------------------------MDLNADLGEGFGVW..Q
I4BYP2_ANAMD/4-242---------------------------------------------------------------IDLNSDLGESFGAW..K
E8QYT2_ISOPI/17-247---------------------------------------------------------------IDLNADLGE........
D7A1T1_STAND/3-241---------------------------------------------------------------ININADIGESYGKF..H
A6VS70_MARMS/2-241---------------------------------------------------------------MKLNCDMGEAFGAW..K
D1BL87_VEIPT/5-243---------------------------------------------------------------VDLNSDLGESFGNY..T
V9XKP0_9NOCA/4-242---------------------------------------------------------------IDLNSDLGESYGRW..R
E1VTB5_ARTAR/4-242---------------------------------------------------------------IDLNSDVGESFGNW..K
D1B9J1_THEAS/5-243---------------------------------------------------------------IDLNSDLGESFGAY..R
Y1708_STAA8/3-241---------------------------------------------------------------VDLNCDLGEAFGNY..S
R6QJ24_9FIRM/4-236---------------------------------------------------------------INLNCDLGEG.......
Q02CY7_SOLUE/3-225---------------------------------------------------------------IDLNCDMGELDDAA...
A1R1R8_ARTAT/1-239---------------------------------------------------------------MDLNADLGESFGSW..T
M4R6T5_BIBTR/4-237---------------------------------------------------------------IDLNVDLAEG.......
W0JZF2_9EURY/4-240---------------------------------------------------------------IDINCDMGESFGNW..R
Y2905_BURP8/3-236---------------------------------------------------------------IDLNADLGEG.......
D8PCF2_9BACT/7-245---------------------------------------------------------------IDLNCDLGEAATPE..Q
Y4778_VIBVY/6-245---------------------------------------------------------------VTLNCDMGESFGNW..K
R5BE93_9FIRM/4-242---------------------------------------------------------------VDMNSDLGESFGTY..T
A1T0G5_PSYIN/2-241---------------------------------------------------------------.KLNCDMGESFGIW..E
W0IZ00_9BACT/3-248---------------------------------------------------------------VDLNADLGE........
C3KLX3_RHISN/4-241---------------------------------------------------------------IDLNSDLGESFGPW..P
F2G9I8_ALTMD/2-244---------------------------------------------------------------.KLNCDLGESFGAW..S
J7KY74_NOCAA/3-241---------------------------------------------------------------IDLNSDLGESFGRW..E
F3ZDL6_9ACTN/6-244---------------------------------------------------------------IDLNADLAESFGHW..E
G0HCZ7_CORVD/4-242---------------------------------------------------------------IDLNSDLGETTNGV..A
D5DEN3_BACMD/4-242---------------------------------------------------------------VDLNCDLGESFGAY..R
B6QNE9_PENMQ/10-244---------------------------------------------------------------..INVDMGEAYGNY..V
W5XWZ0_9CORY/6-242---------------------------------------------------------------IDLNADLGETTAGN..P
G7ZD33_AZOL4/6-244---------------------------------------------------------------VDLNCDLGEGYGQW..T
F2JVE0_MARM1/2-240---------------------------------------------------------------.KLNCDMGEAFGAW..A
W5WPA4_9CORY/7-245---------------------------------------------------------------IDLNADLGETTGGN..P
X2H6N5_9GAMM/7-245---------------------------------------------------------------IDLNSDLGESFGQW..K
D7WE68_9CORY/5-242---------------------------------------------------------------IDLNADLGETTAGN..P
D8MPR3_ERWBE/3-236---------------------------------------------------------------VDLNADLGEG.......
E3EYK5_KETVY/5-244---------------------------------------------------------------VDLNADMGESFGAW..Q
A4F9Z7_SACEN/1-239---------------------------------------------------------------MDLNSDLAEGFGRW..E
G7XL47_ASPKW/8-245---------------------------------------------------------------VFINVDLGEGYGNF..K
A8LPR1_DINSH/5-243---------------------------------------------------------------VDLNADMGESFGPW..P
C7JDH8_ACEP3/3-240---------------------------------------------------------------IDLNADIGEGFGRW..T
N4VLC9_COLOR/6-246---------------------------------------------------------------VEVNCDMGEGFGKW..K
G0L477_ZOBGA/6-239---------------------------------------------------------------IDLNSDVGEGIG.....
B1MGY8_MYCA9/4-228---------------------------------------------------------------IDLNADLGEGFGAW..R
Q483Q3_COLP3/2-240---------------------------------------------------------------.KLNCDLGESFGAW..S
R5KN94_9CLOT/4-237---------------------------------------------------------------INLNCDLGEG.......
R0K0K3_SETT2/8-244---------------------------------------------------------------VKINVDLGEGYGNF..K
D0L462_GORB4/8-241---------------------------------------------------------------IDLNADLGEG.......
Y441_STRCO/2-240---------------------------------------------------------------IDLNADLGEGFGRW..T
H5X6J3_9PSEU/1-239---------------------------------------------------------------MDLNSDLAEGFGRW..T
Q2KUF2_BORA1/5-243---------------------------------------------------------------LDLNCDMGESYGAW..P
Y3066_BACCR/4-242---------------------------------------------------------------IDLNCDLGESFGAY..K
B9JHF9_AGRRK/4-243---------------------------------------------------------------IDLNCDMGEGFGAY..T
B0UCC0_METS4/4-242---------------------------------------------------------------IDLNSDLGEGFGDY..R
Q0SBI7_RHOJR/9-246---------------------------------------------------------------IDLVADLGESFGAW..T
A0JRP4_ARTS2/1-239---------------------------------------------------------------MDLNADLGESFGSW..T
F8KRQ1_HELBC/5-243---------------------------------------------------------------IDLNSDMGECFGPW..I
D5UJL7_CELFN/4-244---------------------------------------------------------------IDLNADLGEGDGPW..R
Y2700_YERPE/3-236---------------------------------------------------------------IDLNADLGEG.......
V4IFZ2_9ACTN/6-244---------------------------------------------------------------IDLNADLAEGFGRW..E
Y4074_AZOC5/4-242---------------------------------------------------------------VDLNSDLAEGFGIW..H
Y2695_THET8/3-241---------------------------------------------------------------VDLNADAGESYGAF..A
Q16DH1_ROSDO/4-242---------------------------------------------------------------VDLNADMGESFGPW..K
K7TCZ9_GLUOY/7-242---------------------------------------------------------------VDLNADLGESFGQF..K
D5EIJ1_CORAD/3-232---------------------------------------------------------------ILLNCDLGENEPTT...
K0FF24_9NOCA/3-241---------------------------------------------------------------LDLNSDLGEGFGPW..P
E8U5L2_DEIML/4-237---------------------------------------------------------------IDLNADLGE........
B4EQJ0_BURCJ/4-237---------------------------------------------------------------IDLNVNLGE........
Q2W2X4_MAGSA/5-238---------------------------------------------------------------VDLNSDLGEA.......
F8DZP5_CORRG/4-242---------------------------------------------------------------IDFNADLGETTAGN..P
J9S8D4_9ACTN/8-241---------------------------------------------------------------IDLNADLGEG.......
B1M8C8_METRJ/3-241---------------------------------------------------------------VDLNCDMGEGFGVY..R
E8MYL0_ANATU/1-235---------------------------------------------------------------MDLNCDLGESFGNY..R
R5C931_9FIRM/3-241---------------------------------------------------------------IDLNCDMGESFGNY..K
H6C6W1_EXODN/8-246---------------------------------------------------------------LEINCDMGEGFGRW..K
F0Y460_AURAN/32-276---------------------------------------------------------------INLNADLAEGYGPW..T
H0UJ33_9BACT/4-242---------------------------------------------------------------VDLNSDLGESFGPW..V
Y4511_PSEAE/8-249---------------------------------------------------------------ILLNCDMGESFGAW..R
E1VBZ3_HALED/5-245---------------------------------------------------------------.LLNADMGESFGAW..T
D4M7W6_9BACT/4-242---------------------------------------------------------------IDLNSDMGESFGAY..T
G2LEC2_CHLTF/4-242---------------------------------------------------------------IDLNADLGESFGAW..S
C7RQK9_ACCPU/6-244---------------------------------------------------------------INLNADLGEAFGVW..Q
Y4877_VIBPA/8-246---------------------------------------------------------------LTLNCDMGESFGSW..K
Y1531_COPPD/5-243---------------------------------------------------------------VDLNADMGESFGAY..K
V2WV16_MONRO/9-250---------------------------------------------------------------.TVNCDMGEGYSLY..T
M7WMG6_RHOT1/6-247---------------------------------------------------------------.TLNCDCGESYGQY..T
A3HS16_9BACT/7-235---------------------------------------------------------------..INCDLGE........
Y043_AZOSB/4-242---------------------------------------------------------------INLNADLGESFGAW..K
F0M0F6_VIBFN/6-245---------------------------------------------------------------IKLNCDMGESFGAW..T
Y2984_DEIRA/7-247---------------------------------------------------------------TDLNADAGESFGHW..P
C7R8W9_KANKD/7-245---------------------------------------------------------------IDINCDLGESINPQ...
Y1502_GEOKA/4-241---------------------------------------------------------------IDLNCDFGESFGVY..R
Y150_BORPE/5-243---------------------------------------------------------------IDLNCDMGESYGAW..R
Y2042_NITHX/3-242---------------------------------------------------------------IDLNCDLGESFGVW..S
A0R539_MYCS2/5-243---------------------------------------------------------------VDLNADLGESFGVW..Q
Y2038_STACT/3-241---------------------------------------------------------------VDLNCDLGEAFGNY..S
K1VQ76_TRIAC/63-302---------------------------------------------------------------..LISDMGEGYYRW..A
Y498_BACLD/4-242---------------------------------------------------------------VDLNCDLGESFGAY..K
G2J1V4_PSEUL/3-236---------------------------------------------------------------IDLNADLGEG.......
D8MWR7_ERWBE/4-242---------------------------------------------------------------LDLNADIGEGYGDY..Q
Q3ICU0_PSEHT/2-237---------------------------------------------------------------.LLNCDLGESFGAW..K
Y3910_AGRFC/4-242---------------------------------------------------------------IDLNSDLGESYGAW..R
S8E0A5_FOMPI/4-241---------------------------------------------------------------.SVNCDMGEGFALY..T
F6EKD4_AMYSD/4-242---------------------------------------------------------------IDLNCDLGESFGIW..A
Y3576_VIBCH/6-245---------------------------------------------------------------IQLNCDMGESFGVW..T
D3UZ92_XENBS/5-243---------------------------------------------------------------IDLNSDLGESFGQW..K
C1CZR4_DEIDV/6-239---------------------------------------------------------------IDLNADLGE........
K7TD01_GLUOY/6-244---------------------------------------------------------------IDLNADLGESFGAY..T
YBGL_SHIDS/3-236---------------------------------------------------------------IDLNADLGEG.......
H1YGF4_9SPHI/5-243---------------------------------------------------------------IDLNCDMGEAFGNY..P
Q5QXP9_IDILO/9-254---------------------------------------------------------------ITLNSDIGESFGAW..K
Q47NG6_THEFY/3-241---------------------------------------------------------------IDLNSDLGESFGRW..E
U5LAF3_9BACI/4-242---------------------------------------------------------------IDLNCDLGESFGSF..K
E1QDN4_DESB2/3-244---------------------------------------------------------------IDLNCDMGEGFGPY..R
X4ZYD6_9BACL/5-242---------------------------------------------------------------IDICSDLGEGYGNY..K
Y4577_PSEPK/13-254---------------------------------------------------------------LLLNCDMGESFGSW..R
B5ICJ8_ACIB4/3-241---------------------------------------------------------------VDLNADLGESFSIY..K
Q1DC03_MYXXD/8-229---------------------------------------------------------------.LLNVDLGELPG.....
C7MLY6_CRYCD/7-245---------------------------------------------------------------IDLNSDLGESFGRY..N
W8X9N3_CASDE/1-239---------------------------------------------------------------MDLNSDLGESYGAW..R
Q5E525_VIBF1/3-242---------------------------------------------------------------..INCDMGESFGLW..Q
A4ASE2_MARSH/6-239---------------------------------------------------------------VDINCDVGEGVG.....
W5W979_9PSEU/4-242---------------------------------------------------------------IDLNSDLGEGFGIW..Q
R5MQI6_9FIRM/5-243---------------------------------------------------------------VDLNCDMGESFGAY..K
R7XYL9_9ACTN/8-246---------------------------------------------------------------IDLNADLGEGFGQW..R
C0QGD0_DESAH/1-241---------------------------------------------------------------MDLNCDMGESFGTY..T
E5AMR8_BURRH/21-254---------------------------------------------------------------VDLNADLGEG.......
B8LZW7_TALSN/11-246---------------------------------------------------------------..INVDMGEGYGNW..A
G2TJB6_BACCO/4-242---------------------------------------------------------------IDLNCDMGESFGAY..T
R5H7E1_9SPIR/13-244---------------------------------------------------------------IDFNIDLAQSFGIY...
Q3SF52_THIDA/2-233---------------------------------------------------------------IELNADIGEGH......
Q4FMV7_PELUB/11-249---------------------------------------------------------------ININCDLGEKSKFH...
B9JN49_AGRRK/11-248---------------------------------------------------------------VDINCDMGEAFGRW..R
Y1729_HAEIN/4-237---------------------------------------------------------------IDLNADIAEG.......
I7F001_PHAIB/5-243---------------------------------------------------------------VDLNADMGESFGAW..T
K5WPA6_AGABU/8-248---------------------------------------------------------------.TVNCDLGEGYSLY..R
F2F1B3_SOLSS/4-242---------------------------------------------------------------VDLNCDLGESFGRY..Q
Y486_MYCPA/4-242---------------------------------------------------------------IDLNADLGEGFGVW..R
D5ATU4_RHOCB/3-236---------------------------------------------------------------LDLNSDMGEGAGA....
A4XXR4_PSEMY/4-245---------------------------------------------------------------LLLNCDIGESYGAW..T
B1LSM8_METRJ/4-242---------------------------------------------------------------VDLNSDLGEGYGAY..A
E6X9V0_CELAD/3-235---------------------------------------------------------------IDINSDVGEGVG.....
L0EBQ1_THECK/9-247---------------------------------------------------------------IDLNGDVGEGFGPY..A
Q28NJ3_JANSC/23-261---------------------------------------------------------------IDLNSDLGEGFGPW..S
Q21NC0_SACD2/2-238---------------------------------------------------------------.KLNCDLGEGLDHA...
G8AQ87_AZOBR/366-604---------------------------------------------------------------VNLNADLGEGFGAY..D
A1S1H7_SHEAM/4-236---------------------------------------------------------------LQLNADVGE........
R5XTA1_9FIRM/4-237---------------------------------------------------------------IDLNCDLGEG.......
F8I999_SULAT/1-233---------------------------------------------------------------......MGESFGVY..R
G0AE74_COLFT/9-243---------------------------------------------------------------VDLNADLGEQ.......
W0LH49_9ENTR/3-236---------------------------------------------------------------VDLNADLGEG.......
Q2J8R2_FRASC/53-290---------------------------------------------------------------LDLNADLGEGFGVW..R
R7JWG6_9CLOT/4-242---------------------------------------------------------------VDLNCDLGESFGNY..K
H6RUE6_BLASD/9-247---------------------------------------------------------------IDLNADLGEGFGVW..R
B8IGM4_METNO/4-242---------------------------------------------------------------IDVNSDLGEGFGPY..K
Y333_MYCLE/4-242---------------------------------------------------------------IDLNADLGEGFGVW..R
A9BP88_DELAS/14-252---------------------------------------------------------------IDLNSDMGESFGPW..A
E4U7W9_OCEP5/4-242---------------------------------------------------------------IDLNADAGESFGPW..K
Y093_ARTS2/4-242---------------------------------------------------------------MDLNSDVGESFGRW..T
J7QRE0_METSZ/8-246---------------------------------------------------------------IDLNADLGEGFGHW..R
C8WUH6_ALIAD/4-242---------------------------------------------------------------VDLNADLGEDFGAY..R
Y1168_STAEQ/5-243---------------------------------------------------------------IDLNCDLGEAFGNY..T
A1WEV7_VEREI/4-242---------------------------------------------------------------IDLNSDVGESYGRY..Q
C4ZLA9_THASP/5-243---------------------------------------------------------------INLNADLGESFGPW..T
D7BRG6_STRBB/6-245---------------------------------------------------------------IDLNADLGEGFGRW..Q
F4AY60_DOKS4/4-236---------------------------------------------------------------IDLNSDVGEGVG.....
A9H2F5_GLUDA/7-245---------------------------------------------------------------IDLNADLGESFGHY..T
D3FTL6_BACPE/4-242---------------------------------------------------------------VDLNCDLGESFGAY..K
Y282_PROAC/4-246---------------------------------------------------------------VDLNADMGESFGSW..K
E0SEY7_DICD3/3-236---------------------------------------------------------------IDLNADLGEG.......
M1MW29_9CORY/4-241---------------------------------------------------------------IDLNADVGETTAGD..P
D5BMH2_PUNMI/3-237---------------------------------------------------------------IDINCDMGESFGIY..K
R7MJT0_9CLOT/13-245---------------------------------------------------------------IDFNCDLAQSFGIY...
A0LSF5_ACIC1/16-254---------------------------------------------------------------VDLNADVGESFGAY..R
Y379_BACP2/4-242---------------------------------------------------------------VDINCDLGESFGQY..T
B6HFB9_PENCW/10-245---------------------------------------------------------------..INVDLGEGFGNW..T
H5WZE4_9PSEU/3-241---------------------------------------------------------------IDLNSDLGEGFGAW..F
I0GX05_ACTM4/4-242---------------------------------------------------------------IDLNADLGEGFGAW..T
E1SWB7_FERBD/3-239---------------------------------------------------------------IDLNCDVGELEGSA...
C0ZBV3_BREBN/4-239---------------------------------------------------------------LDINCDMAEGFSRG..R
E6SBM1_INTC7/6-244---------------------------------------------------------------IDLNSDLGESLGTW..R
A7IFF2_XANP2/3-241---------------------------------------------------------------VDLNSDLGEGFGAY..A
F8K454_STREN/34-272---------------------------------------------------------------VDLNADLGEGFGRW..R
H6N0G5_GORPV/18-251---------------------------------------------------------------VDLNADLGEG.......
S3BUE6_OPHP1/51-290---------------------------------------------------------------.EINADMGEGFGRW..K
D4M7F2_9BACT/5-243---------------------------------------------------------------VDLNSDLGESFGAW..K
G8T834_NIAKG/4-244---------------------------------------------------------------IDINCDMGESTHLWPYD
B5HGL3_STRPR/6-244---------------------------------------------------------------IDLNADLGEGFGRW..T
E4N888_KITSK/2-244---------------------------------------------------------------IDLNADLGEGFGRW..S
E8SIF4_STAPH/3-241---------------------------------------------------------------VDLNCDLGESFGNY..Q
B9K212_AGRVS/6-244---------------------------------------------------------------VDINCDLGEAFGRW..R
K4RDP3_9ACTN/4-242---------------------------------------------------------------IDLNADLGEGFGRW..R
D4ZD86_SHEVD/10-243---------------------------------------------------------------IDLNADLGE........
Y3513_ACIAC/3-241---------------------------------------------------------------IDLNSDLGESLGAW..R
Y2681_RHOPA/3-242---------------------------------------------------------------IDLNCDLGEGFGVW..Q
I2EPH3_EMTOG/6-243---------------------------------------------------------------IDLNCDMGEAFGSW..P
K0KCJ9_SACES/2-239---------------------------------------------------------------IDLNSDLGEGFGIW..R
F2NR58_MARHT/3-241---------------------------------------------------------------VDLNADAGESFGAW..R
Y2977_ALKMQ/4-242---------------------------------------------------------------VDLNSDIGESFGAY..E
Y5654_NOCFA/3-240---------------------------------------------------------------LDLNSDLGEGFGSW..T
D3F024_CONWI/21-259---------------------------------------------------------------LDVNVDMGESFGRW..R
K7RR83_PROA4/1-239---------------------------------------------------------------MDLNSDSGESFSSW..R
G9WFM7_9LACT/4-240---------------------------------------------------------------IDLNSDLGESFGRY..S
B9L7F1_NAUPA/2-239---------------------------------------------------------------IKLNADLGESFGHY..R
I4C5I2_DESTA/3-239---------------------------------------------------------------IDLNADMGESFGMY..K
E3CXI0_9BACT/4-242---------------------------------------------------------------MDMNSDLGESFGTY..V
Y1066_HELMI/3-241---------------------------------------------------------------IDLNCDIGESFGAY..R
D2RMC2_ACIFV/3-241---------------------------------------------------------------IDLNSDLGESFGAY..K
Q1GM83_RUEST/5-243---------------------------------------------------------------VDLNCDMGEGFGHW..V
E0SJD9_DICD3/3-241---------------------------------------------------------------IDVNADMGEGFGVY..Q
F7YS87_VIBA7/10-249---------------------------------------------------------------ITLNCDMGESFGAW..Q
Q6ANH3_DESPS/2-232---------------------------------------------------------------.LLNCDMGESFGNY..S
E3F040_KETVY/2-233---------------------------------------------------------------IDINADMGEGFGAY..Q
B2ICA4_BEII9/9-247---------------------------------------------------------------VDLNCDCGEGFGPY..Q
A1AYU0_PARDP/5-242---------------------------------------------------------------IDLNSDLGEGYGAW..K
F0RCU6_CELLC/6-239---------------------------------------------------------------IDINVDVGEGVG.....
K4L056_SIMAS/4-242---------------------------------------------------------------.LLNCDLGESFGSW..T
C7QHB5_CATAD/2-244---------------------------------------------------------------IDLNADLGEGFGRW..R
Y476_METCA/5-243---------------------------------------------------------------IDLNADLGESFGPW..R
G4QKJ0_GLANF/2-240---------------------------------------------------------------.KLNADLGESYGHW..Q
A1U0R3_MARHV/2-242---------------------------------------------------------------.KLNCDLGESYGAW..Q
Q3IWM6_RHOS4/5-244---------------------------------------------------------------IDLNCDMGESFGAY..V
U4KH28_9VIBR/6-245---------------------------------------------------------------LKLNCDMGESFGSW..K
Q6D7H2_PECAS/3-236---------------------------------------------------------------IDLNADLGEG.......

PF10096

Q8XK74_CLOPE/180-429FEDVA----------------STGA----------------GTEYDS....QYLET--IR--------------------
U5MQH8_CLOSA/192-443FEDVG----------------LSSQ----------------DYSK......DYFEK--LR--------------------
G7MC91_9CLOT/194-445FEDIG----------------VNSQ----------------PYSK......EYFEK--LR--------------------
M1MSD1_9CLOT/193-445FEDVG----------------LSSQ----------------SYSK......DYFEK--LR--------------------
B2TQG3_CLOBB/185-436FEDVC----------------VTSQ----------------GYDK......NYFEN--LR--------------------
R6P5J4_9FIRM/162-419LEDIV----------------ADGM----------------DTTAEPNYTIENLEK--LR--------------------
A6LS62_CLOB8/199-444FEDFG----------------CGYT----------------NVVD......KNQTK--IK--------------------
M1MAA0_9CLOT/199-444FEDFG----------------CGYS----------------NLED......KNQVK--VK--------------------
U5MNT4_CLOSA/199-442FEDFT----------------CGDS----------------NFVD......KNQTR--VK--------------------
M1MG87_9CLOT/199-442LEDFG----------------CGGN----------------YSVD......QNQTK--IK--------------------
G7M6B9_9CLOT/199-442LEDFG----------------CGGN----------------YAID......QNQTK--VK--------------------
G7LYM9_9CLOT/199-443LEDFG----------------CGGN----------------YAID......KNQAK--IK--------------------
D9SNK6_CLOC7/207-454LEDVS----------------AGSV----------------MLCN......DSLKK--MK--------------------
Q8XMN0_CLOPE/198-445IEDVS----------------AGGV----------------FSED......NNMEK--MK--------------------
U5RNL9_9CLOT/160-417LEDIS----------------AGGL----------------YNSH......ETLEK--LR--------------------
A6LXX4_CLOB8/129-377FEDIT----------------AGGK----------------YLDS......DNLEK--LR--------------------
A5I018_CLOBH/188-437LEDIT----------------SNQR----------------YKTP......EELEK--LR--------------------
W0EHC6_9FIRM/3-275LEDVG----------------PGGP----------------FGTA......ESLLK--LQ--------------------
A5D0J0_PELTS/44-299LEDVS----------------PGV.----------------YDSA......DKLEK--LK--------------------
K4L6F7_9FIRM/42-301LEDVG----------------PGQE----------------YTSQ......ENLDK--LI--------------------
I0GIR5_CALEA/37-285LEDVS----------------PWY.----------------AIQV......NGLEV--LR--------------------
R4SQ82_AMYOR/281-555LEDVG----------------PR..----------------..........TKPEE--LR--------------------
G8SCF8_ACTS5/260-527IEDVG----------------PD..----------------..........ADPEQ--LT--------------------
U5WBT8_9ACTN/261-529LEDVG----------------PD..----------------..........SDPAD--LR--------------------
A8LFA1_FRASN/262-530IEDVG----------------PD..----------------..........ADPAE--LH--------------------
W5WDT8_9PSEU/293-566IEDVS----------------PG..----------------..........SDPTE--LR--------------------
E2Q861_STRC2/342-611IEDIN----------------PL..----------------..........SDTTR--LR--------------------
K4RBX1_9ACTN/345-613LEDIS----------------PN..----------------..........SEPSE--LR--------------------
A1WAM2_ACISJ/315-589FEDAD----------------AK..----------------..........VNPVA--FK--------------------
D0J002_COMT2/256-530LEDVS----------------AL..----------------..........VSVTA--MK--------------------
B2UJM5_RALPJ/282-558LEDVN----------------AT..----------------..........TTVSS--MK--------------------
A0A068NT91_9BACT/235-497IEDVH----------------PQ..----------------..........SDPKM--LR--------------------
L0A522_DEIPD/259-504MEDIQ----------------PN..----------------..........ESAAV--LR--------------------
M9X7T8_MEIRD/244-506MEDLS----------------PN..----------------..........DQGAD--LK--------------------
L0A502_DEIPD/323-574IEDLI----------------AE..----------------..........DDPSG--LR--------------------
Q1IXI2_DEIGD/311-556LEDIS----------------PT..----------------..........GNPEG--LR--------------------
Q1AST7_RUBXD/238-462LEDVS----------------VH..----------------..........VPPER--II--------------------
B0TC26_HELMI/295-528IEDVH----------------PL..----------------..........RSPEA--LR--------------------
R7P8S3_9BACT/4-202LDDAC----------------PT..----------------..........MHKEN--WN--------------------
E1RA10_SPISS/7-204LDDAN----------------PC..----------------..........MDRSK--WG--------------------
Q7MSW5_WOLSU/4-200LDDAC----------------AT..----------------..........MDRKK--WK--------------------
E3GN09_EUBLK/1-199LDDAS----------------EY..----------------..........MDTAK--WK--------------------
R5ZC39_9FIRM/3-201LDDAS----------------EY..----------------..........MDVEK--WQ--------------------
F4LX97_TEPAE/1-199LDDAS----------------EY..----------------..........MDITR--WD--------------------
D4K2A5_9FIRM/3-201LDDAS----------------EY..----------------..........MDVEK--WQ--------------------
R7LEI3_9BACT/4-204LDDAC----------------PT..----------------..........MDGAK--WQ--------------------
A5V9P4_SPHWW/4-201LDDIC----------------PT..----------------..........MDWAR--FN--------------------
H6LBB2_ACEWD/5-204LDDVC----------------ET..----------------..........MNWDR--FF--------------------
E0RX58_BUTPB/2-201IDDIT----------------PD..----------------..........MDFEK--FY--------------------
R5H8N9_9FIRM/2-200MDDIT----------------PD..----------------..........MDWKS--FE--------------------
R7R6S7_9FIRM/2-200MDDIT----------------PD..----------------..........MDWAK--FL--------------------
R5CHW3_9FIRM/2-201LDDIT----------------AD..----------------..........MNWEK--FL--------------------
R6C994_9CLOT/6-204MDDIT----------------PD..----------------..........MDWEK--FE--------------------
R6ZDL3_9FIRM/2-202LDDIT----------------PD..----------------..........MDWER--FL--------------------
R5BT68_9FIRM/9-207FDDIC----------------PT..----------------..........MDYKQ--WN--------------------
E4NN78_HALBP/100-323NDDIK----------------PN..----------------..........PDPTT--MQ--------------------
H1XSW8_9BACT/27-257VDDIL----------------SRNI----------------S.........LQPRS--IT--------------------
B4U8C2_HYDS0/10-157IHDVC----------------P...----------------..........SNLEN--IF--------------------
B2V9Y1_SULSY/4-150IHDVT----------------K...----------------..........SNLEK--VY--------------------
D3SMT5_THEAH/3-151LHDVT----------------P...----------------..........HYEEE--IY--------------------
F8AAV2_THEID/3-151LHDVS----------------P...----------------..........FYKNE--FF--------------------
K0CAU1_ALCDB/12-196LHDVC----------------P...----------------..........ATWAD--YQ--------------------
Q88N47_PSEPK/1-183LHDVA----------------P...----------------..........ETWPD--YE--------------------
Q9HW89_PSEAE/5-189LHDVA----------------P...----------------..........ETWPD--YR--------------------
C1DDN4_AZOVD/5-189LHDVA----------------P...----------------..........ETWAD--YR--------------------
K0ERT4_9NOCA/61-217VHDVA----------------P...----------------..........ASAAE--TA--------------------
C7Q7J8_CATAD/6-161IHDIA----------------S...----------------..........ASAAP--SE--------------------
D6Z9I9_SEGRD/14-177IRD..----------------....----------------..........TTLGQ--AR--------------------
C1A667_GEMAT/9-196IHDVT----------------P...----------------..........ALADG--VH--------------------
Q6LXR4_METMP/34-239IHDVS----------------P...----------------..........VYLED--LK--------------------
F6BD61_METIK/72-273VHDVS----------------P...----------------..........LYYNE--LK--------------------
Y505_METJA/37-247IHDVS----------------P...----------------..........VYFKE--LK--------------------
F6BE00_METIK/47-254IHDVS----------------P...----------------..........KYFNE--LK--------------------
D7DSJ1_METV3/60-270IHDVS----------------P...----------------..........KYIDE--MK--------------------
A6UV77_META3/44-251VHDVS----------------P...----------------..........AYFNK--LK--------------------
Q5JH22_THEKO/56-259VHDVS----------------P...----------------..........VYLKE--LK--------------------
Q897A5_CLOTE/246-480IEDLH----------------PL..----------------..........RDVKI--LR--------------------
A5I1D3_CLOBH/229-463IEDVH----------------PL..----------------..........IDINK--LK--------------------
Q18AM8_PEPD6/233-467IEDVH----------------AF..----------------..........REPKN--LV--------------------
F4LUH2_TEPAE/229-462IEDVH----------------AQ..----------------..........TSINN--LC--------------------
A8FA31_BACP2/214-479LGNIS----------------PA..----------------..........SDEKK--LL--------------------
Q65D17_BACLD/215-481LEDIS----------------PM..----------------..........SDEKL--LL--------------------
K0J5W3_AMPXN/221-485LEDVH----------------PL..----------------..........VDPEP--LK--------------------
Q81IW1_BACCR/212-474LEDVH----------------PA..----------------..........ADINQ--LK--------------------
C2WY28_BACCE/212-474LEDVH----------------PA..----------------..........ADINQ--LQ--------------------
I4D437_DESAJ/233-460IEDVQ----------------PL..----------------..........TPPDT--LV--------------------
M1E711_9FIRM/225-461LEDVH----------------PM..----------------..........YDIKK--LE--------------------

PF01522

NODB_AZOC5/9-134FDDGP....................----------------...........HPSV--TP--------------------
Q9A5L9_CAUCR/35-168FDDAP....................----------------............ATA--CE--------------------
O69838_STRCO/70-214FDADMTADQGP..............----------------......RAASGERFD--NP--------------------
Q9XAP6_STRCO/96-224FDDGP....................----------------...........DPTW--TP--------------------
CDA2_YEAST/112-232FDDGP....................----------------...............--SA--------------------
Q98GK8_RHILO/808-946FDDGF....................----------------............QNF--AD--------------------
ICAB_STAEQ/107-248FDDMD....................----------------............QTI--YD--------------------
Q97ET9_CLOAB/86-214FDDGP....................----------------............SNN--TK--------------------
YHEN_BACSU/79-203FDDGP....................----------------............SAV--TT--------------------
Q9CHP6_LACLA/96-236FDDID....................----------------............KSL--PE--------------------
Q9RVF2_DEIRA/33-157FDDGP....................----------------...........DPQT--TP--------------------
Q982X7_RHILO/88-291ADDAY....................----------------............RDN--MT--------------------
Q97K82_CLOAB/62-192FDDGP....................----------------...........SSNV--TP--------------------
O53444_MYCTU/41-164FDDGP....................----------------............GPY--TD--------------------
PDAA_BACSU/60-185FDNGY....................----------------...........ENGY--TP--------------------
Q985U0_RHILO/77-213LDACD....................----------------............GQT--DT--------------------
Q9WXW8_THEMA/27-151FDDGP....................----------------...........DVKL--TS--------------------
P73597_SYNY3/44-199FETGSQPAKGAPTPFGNFTPPPDYY----------------DMPTITWYRYGYTEG--VP--------------------
Q9L1T3_STRCO/85-207FDDGP....................----------------...........DPTW--TP--------------------
Q9A6E1_CAUCR/17-152WDDLPAHSAL...............----------------......PPGVTRVEV--AA--------------------
Q97TP4_CLOAB/83-210FDDCT....................----------------............EDF--YT--------------------
Q97JC7_CLOAB/83-211FDDGP....................----------------............SVN--TS--------------------
Q9X8Z4_STRCO/86-212IDDGP....................----------------...........DPAW--TP--------------------
Q9KEF7_BACHD/63-188FDNGY....................----------------...........ENGY--TA--------------------
Q9PF00_XYLFA/74-213LDDGY....................----------------............LDN--LQ--------------------
Q97LW8_CLOAB/106-234FDDGY....................----------------............EDH--YK--------------------
Q9KEJ5_BACHD/75-214LDACGGP..................----------------..........HGSQF--DE--------------------
Q9CCZ2_MYCLE/73-201VDDGV....................----------------...........NTEV--VR--------------------
Q9KBK9_BACHD/74-199FDDGP....................----------------...........DPRF--TP--------------------
Q9KSH6_VIBCH/26-172FDDGP....................----------------............VNA--SV--------------------
Q9P9U2_XYLFA/249-384FDDGP....................----------------...........HRVY--TN--------------------
Q9FBM6_STRCO/131-288FDDGT....................----------------............HGL--WT--------------------
Q9RV08_DEIRA/33-148FDDGP....................----------------............SER--TP--------------------
Y4760_STRCO/62-184YDDGA....................----------------.............ER--DP--------------------
Q983K0_RHILO/61-197FDDGP....................----------------............LNG--TS--------------------
Q97MV1_CLOAB/82-216FDDGP....................----------------...........STTV--TP--------------------
Q9K630_BACHD/116-243FDDGP....................----------------............TPA--TK--------------------
Q9R7V4_YERPE/101-271FDDGY....................----------------............SSF--YR--------------------
Q9ZBN1_STRCO/59-183FDAGP....................----------------............SEN--SA--------------------
Q9PAV0_XYLFA/97-222IDDGP....................----------------............SDD--TA--------------------
Q9KDB2_BACHD/39-162FDDGP....................----------------............TAL--TD--------------------
Q9KA84_BACHD/124-248VNVAW....................----------------...........GNEH--LP--------------------
Q9KVA7_VIBCH/402-543VDDGY....................----------------............RDN--YD--------------------
PDAB_BACSU/51-176FDISW....................----------------...........GDER--AE--------------------
NODB_RHILO/15-140FDDGP....................----------------...........NPCF--TP--------------------
NODB_RHIME/15-140FDDGP....................----------------...........NPHC--TP--------------------
Q9EWZ7_STRCO/52-176FDDGP....................----------------...........DPAS--TP--------------------
Q9PDB0_XYLFA/55-223FDDGY....................----------------............LDN--WV--------------------
YXKH_BACSU/113-240FDDGY....................----------------............TDN--YQ--------------------
Q97DU4_CLOAB/83-214FDDGP....................----------------............SPN--TT--------------------
Q9JWQ7_BACHD/50-175FNISW....................----------------...........GEQR--VK--------------------
Q9KYG2_STRCO/47-184FDDGY....................----------------............ADF--VE--------------------
YADE_ECOLI/226-368FDDGL....................----------------............KSV--SR--------------------
CDA1_YEAST/102-222FDDGP....................----------------...............--AP--------------------
PDAC_BACSU/272-393FDDGP....................----------------...........NPAT--TN--------------------
Q97GQ0_CLOAB/126-253FDDGY....................----------------............EDN--YV--------------------
Q9CJ95_LACLA/136-266FDDGS....................----------------............VTM--YT--------------------
Q97EU7_CLOAB/97-223FDEGY....................----------------...........ERGY--TP--------------------
Q99Z68_STRP1/235-356FDDGP....................----------------...........DPTT--TP--------------------
NODB_RHISN/12-137FDDGP....................----------------...........NPVF--TP--------------------
Q9RCX4_STRCO/8-132FDDGP....................----------------...........HPEY--TP--------------------
PGAB_ECOLI/101-271FDDGY....................----------------............QSF--YT--------------------
CDA1_SCHPO/63-190FEYGS....................----------------............RCG--FW--------------------
Q99ZT1_STRP1/154-283FDDSM....................----------------............IDF--YN--------------------
O86800_STRCO/103-225IDDGA....................----------------.............EK--DP--------------------
Q97GI4_CLOAB/50-174FDSNW....................----------------...........GNDN--TM--------------------
Q97M42_CLOAB/8-133YDDGK....................----------------.............LS--DK--------------------
Q9CIS3_LACLA/170-291FDDGP....................----------------...........NPNT--TP--------------------
B3PIN1_CELJU/396-514FDDGP....................----------------............NSN--TA--------------------
D8Q165_SCHCM/200-314FDDGP....................----------------............ARF--SA--------------------
E6UBP6_RUMA7/470-592FDDGASA..................----------------.........AKKGDP--AY--------------------
F4GY46_CELFA/213-331FDDGP....................----------------...........NGAT--TT--------------------
F4H710_CELFA/356-474FDDGP....................----------------...........NTGT--TN--------------------
Q326Y8_SHIDS/46-204FDDGY....................----------------............LDN--WF--------------------
Q7AQ13_MYCLE/46-161FDDGP....................----------------............GPY--TD--------------------
Q81Z49_BACAN/63-186FDNGY....................----------------...........ENGY--TG--------------------
PGDA_STRR6/264-377FDDGP....................----------------...........NPAT--TP--------------------
Q9RKN7_STRCO/46-161FDDGP....................----------------............SGS--TQ--------------------
ICAB_STAA8/109-248FDDMD....................----------------............ETI--YE--------------------
S2JG56_MUCC1/153-273YDDGP....................----------------............NCS--HN--------------------

PF03065

AMY1_DICT6/8-294.....---.................----------------..........VGNFD--FVIERAYEMSYK----------
O66934_AQUAE/7-429EPY..---.....TGEYLLPWTFFH----------------...........AVKD--YY..........----------
Q8TZQ1_PYRFU/35-537DPV..---.....QGIYTRPWVRLH----------------...........AANN--YW..........----------
MALQ_THEKO/7-291.....---.................----------------...........GNFG--WVMESAYERSYR----------
Q9HLU6_THEAC/262-747IVG..---.....SNNYVLPWTEVH----------------...........ATSE--YI..........----------
Q8ZT36_PYRAE/22-486DFS..---.....KNELALPWVRMH----------------...........AVGN--YL..........----------
Q8U136_PYRFU/6-395KHG.K---WPFGEEWVFEA......----------------...........IAET--YI..........----------
Q8YXA5_NOSS1/8-473SPGSS---LSTPSSQQYRLPWVRLH----------------...........GTKD--YL..........----------
Q55545_SYNY3/8-468SYG..---MVGNGHGYYQLPWVRLH----------------...........GTRD--YG..........----------
Q97BM4_THEVO/7-311TNL..---......YDVKSEQNVFW----------------DEKNEEIFRRVAERS--YI..........----------
AMYA_PYRHO/7-291.....---.................----------------...........GNFE--WIIKRAYEKAYR----------
O58106_PYRHO/3-316IPKHE---ISKV.............----------------...........IEKS--YF..........----------
AMYA_METJA/6-319EIN..---.....QNGNTLWEKYVD----------------TKLNKEVFNKVANKC--YI..........----------
Q9KD04_BACHD/7-382HQE.E---DRLEERWLFEA......----------------...........MSET--YI..........----------
Q8TIT8_METAC/38-312.....---.................----------------...........TGRE--LL..........----------
O83182_TREPA/12-351SLHAE---H................----------------...........DPSQ--YQ..........----------
Q9HL91_THEAC/8-289.....---................W----------------EEKNEEIFKRIAANN--YI..........----------
Q8ZT57_PYRAE/6-321DLY..---...RVFPRRPGDLDVFY----------------DELNEHIFRRVAERV--YR..........----------
Q8TIT9_METAC/7-321FWP..---......DDRSGFFRYFD----------------ERSNKEIFERVSRKC--YT..........----------
O50094_PYRHO/6-394KHG.K---WPFGEEWLFEA......----------------...........MAES--YI..........----------
Q973T0_SULTO/7-324NYF..---..WDPVIRGGPLTKYFD----------------DNLNREIFERVKNKC--YI..........----------
Q97ZD2_SULSO/7-324DFF..---..WNPRFRQKLEDRFFD----------------TERNKEIFERIKKNC--YI..........----------

PF09960

R7BLQ4_9FIRM/15-595CDSMKLGCKVQDAGEG..FDAEELE----------------RYDTVVVTF..QDWS--VLKEQLLDIYSWVKEGGRLLTA
R7D4R5_9FIRM/22-599FMDMRVGTDVIDIQK...DTIPDLD----------------AYETVVLLL..SDLD--PLKEKVLDICEWVEDGGSAMFA
A1A0E3_BIFAA/3-581LLDMKVPTATVDLAKTDPDDIPSLN----------------RYRTVLIVM..PELD--SLGDELVSIMRWVEGGGNMMLA
A6LLQ2_THEM4/8-739LEKNGISYDLKDIETFN.YYNISTK----------------EYLGVISWYYSTELK--YPNLYLRQLSNFVENNGIFFFF
F7YUX2_9THEM/11-746LEKLGIPYELRSIFGLN.YNEIDHQ----------------KYAFVISWYYSQNVP--YPESYLRQLSIFVKNGGKFFFL
Q9X1C9_THEMA/8-698PEVLGEDYEFVDVEK....SLPDFE----------------DYDFVITCYYSSSMP--GAKKYLKKLVDFLLNGGKLFII
Q97L33_CLOAB/20-587LKYMKKTAVVEEKNN...VQTVD.P----------------SYRAVILTF..EDID--DFKS.LSSVMNYAQNGGNVLFA
H2J5Y8_MARPK/9-749LEKNNIRYELKNVEEMN.YYKITNE----------------KYFGVITWYYSSEMA--KPELYLRQLATFVEDGGIYFFF
C0ZK84_BREBN/11-593LRYMKKEYELADVKQ...FSKPD.P----------------QYMTVIVTI..ENLD--MLAN.LDAMMQYAHNGGNVFFS
A7HKR3_FERNB/18-733LKTLSIAYDLMDVESEE.FGTLDLR----------------SYELIVTCYYSPTMP--NAKTYLKRLYDFLLNGGKIFII
A8AV35_STRGC/20-596LKDMRMGYRLVDISK...DTIPSFS----------------DYKKVVVLL..SDLE--GLGDKALEMVDWVEQGGNVLFA

PF01074

MA2A1_MOUSE/166-496FNDY.-------------------.----------------.......FRDKTQYI..FN--------------------
MA2A2_HUMAN/167-497FDKY.-------------------.----------------.......YTEQTQHI..LN--------------------
MANA_DICDI/43-353VDEYY-------------------Y----------------GS.NMSIAFAGVQYT..LD--------------------
MA2B1_HUMAN/64-381VDQYF-------------------Y----------------GI.KNDIQHAGVQYI..LD--------------------
O01574_CAEEL/138-459FERY.-------------------.----------------........TKSTNQI..LD--------------------
MA2B2_MOUSE/28-351VQES.-------------------.----------------.......MRAYAANV..YT--------------------
MA2C1_RAT/251-510FKET.-------------------.----------------........VRKCARS..WS--------------------
MAN1_YEAST/290-559FAET.-------------------.----------------........RRKIVRS..WS--------------------
P94078_ARATH/39-350VDQYY-------------------V----------------GS.NNSIRGACVQNV..LD--------------------
Q20829_CAEEL/37-351VDQYF-------------------W----------------GA.KPELVPVGVQYI..YN--------------------
MAN2_DROME/145-471FEEY.-------------------.----------------.......YQHDTKHI..LS--------------------
MA2B2_PIG/28-342VQES.-------------------.----------------.......MQVYVPDV..YN--------------------
Q55528_SYNY3/232-495LEET.-------------------.----------------........WEVGERT..FQ--------------------
Q7NPH5_GLOVI/217-477VPET.-------------------.----------------........KEVIERT..FR--------------------
Q7PMM6_ANOGA/166-493FDEY.-------------------.----------------.......YERSTKNI..FA--------------------
Q7S1L0_NEUCR/285-549WDET.-------------------.----------------........KRKVARS..WS--------------------
Q7U9I9_SYNPX/234-492VADT.-------------------.----------------........WQAAERT..FR--------------------
Q7V4V0_PROMM/221-479VADT.-------------------.----------------........WQAAERT..FR--------------------
Q826B6_STRAW/254-513LRET.-------------------.----------------........VRKVART..TS--------------------
Q82MA7_STRAW/254-513IRET.-------------------.----------------........KRKTSRT..FS--------------------
Q8A5X3_BACTN/297-572QTEIL-------------------S----------------......EHLRYIDYAIEYC--------------------
Q8DM33_THEEB/217-475IAET.-------------------.----------------........WQVAQST..FQ--------------------
Q8G4P9_BIFLO/264-528VRET.-------------------.----------------........ERKVGRT..VS--------------------
Q8G4Q0_BIFLO/268-532VRET.-------------------.----------------........RRKVART..VS--------------------
Q8G4Q1_BIFLO/267-531VRET.-------------------.----------------........RRKVART..VS--------------------
Q8IPB7_DROME/48-364VDQYY-------------------Y----------------GS.ETKIQKAGVQYI..ID--------------------
Q8LPJ3_ARATH/38-350VDQYY-------------------V----------------GS.NNSIQVACVQNV..LD--------------------
Q8XIN5_CLOPE/235-510VAQT.-------------------.----------------........REKVARS..FS--------------------
Q8XM34_CLOPE/260-519IRET.-------------------.----------------........IRKGART..YS--------------------
Q8Y5P1_LISMO/243-513LKHT.-------------------.----------------........REKAARS..FS--------------------
Q8Y9W8_LISMO/5-267SSRS.-------------------.----------------........TIYLVKH..LK--------------------
Q8YYK0_NOSS1/230-491VSET.-------------------.----------------........WNAAQNT..FA--------------------
Q97UK5_SULSO/220-473FDET.-------------------.----------------........RRKVLRT..FS--------------------
Q9FKW9_ARATH/48-359VDQYY-------------------V----------------GS.NNRIQNACVRNV..LD--------------------
Q9KEQ8_BACHD/237-511TKHT.-------------------.----------------........KEKAKRT..FS--------------------
GMAN2_ARATH/154-493VEEY.-------------------.----------------.......YQRQSRHI..LD--------------------
MAN1_SCHPO/282-549FAET.-------------------.----------------........RRKIVRS..WA--------------------
Q9VLI0_DROME/38-352VDQYY-------------------Y----------------GH.RNNIQHAGVQYI..ID--------------------
Q9X2G6_THEMA/247-507VEET.-------------------.----------------........KRKILRT..FA--------------------
B2HSI3_MYCMM/98-400QGAYT-------------------S----------------QWHEDPPGRARQTNG..FE--------------------
C8VJ45_EMENI/284-549WAET.-------------------.----------------........KRKVARS..WS--------------------
H9JRV7_BOMMO/33-353FEHY.-------------------.----------------.......FEWKTKNI..IN--------------------
Q9VF33_DROME/169-499FTNY.-------------------.----------------.......FQSDSRQI..LN--------------------
Q9VLH9_DROME/39-352VDQYF-------------------Y----------------GH.RSNIQHAGVQYI..ID--------------------
Q9VLI2_DROME/38-351VDQYY-------------------Y----------------GN.KHNIQHAGVQYI..FD--------------------

PF15421

Q8A8I5_BACTN/62-500LTQDDCMQAAFCRTWAAINGKPISSSIPYPTPTPTDQNMKHQLYFDIKHLQKGDLPPTII--------------------
Q5LDR1_BACFN/50-470LTQDDCKPSIYPRTWASINGKPLSG................QYYYHYEQLKQDDLPPDIY--------------------
D4IMW2_9BACT/39-464LTQDDCKQAAFSTTWAAINGRPLSD................TYFYNAPHLRGGDMPPDTY--------------------
R5UTM0_9PORP/51-471LSQDDCKQASYCCTWAALNGRPLSK................KYYYDVRQYLNDDLPPDVY--------------------
R6DLU9_9BACE/67-497LTQDDCVQSAFCNTWAAIHGRPLSD................NYFYDLVHLQEGDLPPDYY--------------------

PF03746

D7BG02_MEISD/3-241L.G..------------------------------------------------NDE------------------------
W5XZK8_9CORY/7-245V.G..------------------------------------------------NDE------------------------
D5QFG9_KOMHA/3-241I.A..------------------------------------------------DDD------------------------
Q6LSN4_PHOPR/2-250M.G..------------------------------------------------NDQ------------------------
I0JJ59_HALH3/4-242K.G..------------------------------------------------RDE------------------------
F4C1I4_SPHS2/4-242L.P..------------------------------------------------EQD------------------------
Q2RU90_RHORT/5-243I.G..------------------------------------------------DDA------------------------
D5MN08_9BACT/6-243R.G..------------------------------------------------NDE------------------------
R5XP92_9FIRM/4-242I.G..------------------------------------------------NDD------------------------
L7WC11_NONDD/4-237..GMK------------------------------------------------NDA------------------------
D6Y0B4_BACIE/3-241L.G..------------------------------------------------DDE------------------------
D5BG15_ZUNPS/4-236.....------------------------------------------------YDH------------------------
M3DE22_SPHMS/8-244A.GP.------------------------------------------------.DD------------------------
D5EDK5_AMICL/4-242L.G..------------------------------------------------HDE------------------------
G8S4N9_ACTS5/10-248L.G..------------------------------------------------DDE------------------------
F5XPT6_MICPN/6-244L.G..------------------------------------------------DDD------------------------
Y1143_NATTJ/4-242I.G..------------------------------------------------CDE------------------------
F5XTC9_MICPN/4-241M.G..------------------------------------------------EDE------------------------
R5E047_9CLOT/3-241I.G..------------------------------------------------MDQ------------------------
E3H7Y1_ILYPC/4-242I.G..------------------------------------------------MDK------------------------
D0IYS7_COMT2/4-242M.G..------------------------------------------------DDA------------------------
Y1384_PEPD6/4-242I.G..------------------------------------------------LDE------------------------
Q4FSQ9_PSYA2/3-236C.G..------------------------------------------------QDD------------------------
L0DCE0_SINAD/9-227..GFP------------------------------------------------NDR------------------------
E6SM88_THEM7/5-243I.G..------------------------------------------------MDE------------------------
Y2112_KOCRD/4-242M.G..------------------------------------------------DDA------------------------
A5DMJ6_PICGU/30-269M.GP.------------------------------------------------.DA------------------------
A2U3P8_9FLAO/3-236.....------------------------------------------------NEH------------------------
B1ZX56_OPITP/4-232G.A..------------------------------------------------HDA------------------------
Y2917_PSESM/3-241M.G..------------------------------------------------EDE------------------------
U4KC78_9VIBR/2-236L.GD.------------------------------------------------.DE------------------------
F5YAB0_TREAZ/4-242M.G..------------------------------------------------MDD------------------------
G3B4G0_CANTC/32-271M.GP.------------------------------------------------.DE------------------------
S5XZQ9_PARAH/1-238M.G..------------------------------------------------DDA------------------------
C5CZ15_VARPS/3-236A.G..------------------------------------------------SDE------------------------
D1C8S7_SPHTD/5-240I.GN.------------------------------------------------.DA------------------------
B4EWE9_PROMH/5-242M.G..------------------------------------------------NDA------------------------
E8NF87_MICTS/3-240T.A..------------------------------------------------DDE------------------------
Q1IXD6_DEIGD/5-238..GSP------------------------------------------------HEA------------------------
Y1821_BACHD/4-242I.G..------------------------------------------------QDD------------------------
F6FQW1_ISOV2/4-241L.G..------------------------------------------------DDA------------------------
U5RSR8_9CLOT/3-239L.GD.------------------------------------------------.DE------------------------
Y1029_CHRSD/6-245M.G..------------------------------------------------LDD------------------------
Y2522_SYMTH/11-249I.G..------------------------------------------------ADE------------------------
G2PME2_MURRD/6-239.....------------------------------------------------NEA------------------------
M1MIN5_9CLOT/4-242L.G..------------------------------------------------LDE------------------------
Y2314_ERWT9/3-235C.V..------------------------------------------------HDR------------------------
Q0S878_RHOJR/47-285L.G..------------------------------------------------DDL------------------------
U3TWJ9_9ENTR/3-236S.A..------------------------------------------------SDR------------------------
D3EM31_GEOS4/4-242L.G..------------------------------------------------NDK------------------------
Y535_KINRD/4-242V.S..------------------------------------------------DDA------------------------
A3UBZ2_CROAH/4-236..GGL------------------------------------------------YDH------------------------
H2IWK8_RAHAC/3-236C.G..------------------------------------------------NDE------------------------
C6XL46_HIRBI/7-240..GCA------------------------------------------------TDV------------------------
G9MQN1_HYPVG/10-247M.GP.------------------------------------------------.DE------------------------
Y2112_PSEAE/4-245M.G..------------------------------------------------LDA------------------------
Y4436_RALSO/3-241M.G..------------------------------------------------DDE------------------------
Y2790_CLOK5/4-243M.G..------------------------------------------------NDE------------------------
D7A9V4_STAND/3-236C.GD.------------------------------------------------.DA------------------------
M5A4V0_9ACTN/5-243H.A..------------------------------------------------SDD------------------------
R5QKJ0_9FIRM/3-241C.G..------------------------------------------------MDE------------------------
W5TLR8_9NOCA/3-239M.G..------------------------------------------------DDA------------------------
Y2520_ACIAD/3-241M.G..------------------------------------------------NDE------------------------
D7A110_STAND/4-243L.G..------------------------------------------------DDK------------------------
I0DPN0_PROSM/5-243M.G..------------------------------------------------NDT------------------------
D2PYH8_KRIFD/4-242M.G..------------------------------------------------DDN------------------------
B7VS04_VIBTL/1-234M.G..------------------------------------------------DDE------------------------
L0G1R1_ECHVK/3-236.....------------------------------------------------SDA------------------------
Y2655_BREBN/4-242L.G..------------------------------------------------NDQ------------------------
Y1272_PYRFU/3-241L.G..------------------------------------------------LDD------------------------
F4H0L0_CELFA/5-255VPG..------------------------------------------------PES------------------------
A9WUH9_RENSM/280-518M.G..------------------------------------------------DDD------------------------
D6Y403_THEBD/3-248I.G..------------------------------------------------DDE------------------------
F4GUU2_PUSST/5-243M.G..------------------------------------------------LDE------------------------
A5WHM5_PSYWF/13-246C.G..------------------------------------------------QDI------------------------
I3Z849_BELBD/30-262.....------------------------------------------------NDS------------------------
M4RSN8_9BIFI/4-242L.G..------------------------------------------------DDT------------------------
M9R857_9RHOB/6-244L.GEA------------------------------------------------PEQ------------------------
R7JBC4_9FUSO/13-246..KNN------------------------------------------------YEF------------------------
C5D2N8_GEOSW/3-241L.G..------------------------------------------------EEK------------------------
D5V4N2_ARCNC/3-244M.G..------------------------------------------------NDE------------------------
R5B6J0_9CLOT/6-244I.G..------------------------------------------------MDA------------------------
D8J6F9_HALJB/4-240M.GR.------------------------------------------------.DE------------------------
Q2KTU9_BORA1/6-244I.GDG------------------------------------------------VDE------------------------
C5D207_VARPS/3-241M.G..------------------------------------------------EDE------------------------
F8Q293_SERL3/10-254V.GD.------------------------------------------------.DE------------------------
E9T1F8_RHOHA/4-242L.G..------------------------------------------------DDA------------------------
H8KYG9_FRAAD/4-242M.G..------------------------------------------------ADE------------------------
Y1612_LACF3/4-240I.G..------------------------------------------------NDD------------------------
R7AUI2_9FIRM/4-242I.G..------------------------------------------------MDE------------------------
L0A698_DEIPD/4-241L.G..------------------------------------------------QDA------------------------
F5Z8H6_ALTSS/2-241M.P..------------------------------------------------VDA------------------------
E0TF98_PARBH/9-240.....------------------------------------------------DDR------------------------
Y1004_CORGL/4-242M.G..------------------------------------------------NDV------------------------
U4KHV1_9VIBR/2-235K.G..------------------------------------------------QDS------------------------
A4X134_SALTO/1-238L.G..------------------------------------------------DDA------------------------
X5DN33_9CORY/5-237F.GN.------------------------------------------------.DE------------------------
F0RQS5_DEIPM/3-243A.G..------------------------------------------------NDA------------------------
R5T180_9GAMM/13-246..KNI------------------------------------------------QEY------------------------
A9I0Z0_BORPD/28-266M.G..------------------------------------------------NDE------------------------
A3Q8T1_SHELP/8-241..GGP------------------------------------------------QDE------------------------
R6NVF4_9CLOT/4-237A.A..------------------------------------------------FDA------------------------
A5D328_PELTS/1-237L.GN.------------------------------------------------.DG------------------------
F7QMW8_9BRAD/3-242M.G..------------------------------------------------NDD------------------------
I2BBK3_SHIBC/7-245L.G..------------------------------------------------DDD------------------------
D5V4P7_ARCNC/3-243M.G..------------------------------------------------LDE------------------------
B1HUZ0_LYSSC/2-236T.G..------------------------------------------------RDE------------------------
C5C6S0_MICLC/7-245M.G..------------------------------------------------DDA------------------------
X2GVX0_9BACI/3-237L.D..------------------------------------------------KDD------------------------
A0QXR8_MYCS2/4-236Y.GA.------------------------------------------------.DA------------------------
Y2372_RALPJ/4-237C.D..------------------------------------------------TDE------------------------
E6TY73_BACCJ/5-243I.G..------------------------------------------------NDK------------------------
H2G083_OCESG/4-245M.G..------------------------------------------------QDE------------------------
Q0RVU6_RHOJR/3-237L.G..------------------------------------------------HDE------------------------
F4KPP8_HALH1/2-235.....------------------------------------------------ADA------------------------
E2PUA2_STRC2/26-264L.T..------------------------------------------------EDA------------------------
G0G150_AMYMS/1-239M.G..------------------------------------------------DDE------------------------
R4LWQ2_9ACTN/1-239L.G..------------------------------------------------DDA------------------------
D2B933_STRRD/3-241L.G..------------------------------------------------DDM------------------------
Y3392_SYNFM/3-241I.G..------------------------------------------------EDE------------------------
B6JF92_OLICO/5-244M.G..------------------------------------------------DDE------------------------
F8IB92_SULAT/6-243M.G..------------------------------------------------HDE------------------------
W1QAN8_OGAPD/24-260M.GP.------------------------------------------------.DE------------------------
E3Q2S8_COLGM/10-249M.GP.------------------------------------------------.DE------------------------
D3PTP5_MEIRD/3-241L.G..------------------------------------------------RDE------------------------
E4TP81_MARTH/4-239M.G..------------------------------------------------NDD------------------------
A9AYX3_HERA2/3-236..GSD------------------------------------------------FDA------------------------
F4CNG9_PSEUX/4-242L.G..------------------------------------------------DDD------------------------
Y1488_MACCJ/3-241I.G..------------------------------------------------NDE------------------------
J5JGM9_BEAB2/14-248M.GP.------------------------------------------------.DE------------------------
D1BTW0_XYLCX/4-242L.G..------------------------------------------------DDA------------------------
Y407_CORJK/10-248V.S..------------------------------------------------DDA------------------------
V5XGL8_MYCNE/4-242L.G..------------------------------------------------DDD------------------------
D5WUZ1_KYRT2/4-242L.G..------------------------------------------------QDG------------------------
C5AT01_METEA/6-244M.G..------------------------------------------------DDA------------------------
B0RI75_CLAMS/3-241L.G..------------------------------------------------DDD------------------------
K4IM75_PSYTT/4-236..GGK------------------------------------------------YDA------------------------
Y3770_BACSK/4-242I.G..------------------------------------------------NDE------------------------
G2NVC5_STRVO/7-244I.G..------------------------------------------------DDG------------------------
Q5NI64_FRATT/3-227V.AHP------------------------------------------------IDD------------------------
C5BPU8_TERTT/2-239.....------------------------------------------------.DA------------------------
Y2634_CROS8/4-237C.G..------------------------------------------------NDA------------------------
G0IXS0_CYCMS/5-233..GMA------------------------------------------------NDN------------------------
N1PZT0_DOTSN/8-245C.GP.------------------------------------------------.DE------------------------
Q0SB09_RHOJR/3-241L.A..------------------------------------------------DDE------------------------
M1E8N0_9FIRM/3-239Y.G..------------------------------------------------.ST------------------------
C7NIG6_KYTSD/4-242M.G..------------------------------------------------DDD------------------------
D9QUX4_ACEAZ/4-242L.G..------------------------------------------------FDE------------------------
G8RT09_MYCRN/15-253L.G..------------------------------------------------DDD------------------------
R5C385_9FIRM/4-242M.G..------------------------------------------------ADE------------------------
E1VFF3_9GAMM/4-235..GGR------------------------------------------------YDE------------------------
E4RUB2_LEAB4/3-231.....------------------------------------------------LDL------------------------
D5DCK3_BACMD/4-242L.G..------------------------------------------------NDK------------------------
D9RZ18_THEOJ/5-243L.G..------------------------------------------------MDE------------------------
E2SG17_9ACTN/9-231S.G..------------------------------------------------EDL------------------------
Y1541_CAMJE/4-242M.G..------------------------------------------------MDE------------------------
D3Q482_STANL/5-243L.G..------------------------------------------------DDE------------------------
D6ZAE9_SEGRD/6-231I.G..------------------------------------------------DDG------------------------
C0ZM31_RHOE4/5-242M.G..------------------------------------------------ADD------------------------
M3B8E6_PSEFD/8-245C.GP.------------------------------------------------.DD------------------------
G4R9N3_PELHB/5-238.....------------------------------------------------DDR------------------------
Q0C0C1_HYPNA/5-242..GRA------------------------------------------------LDH------------------------
X5EC88_9CORY/4-241V.A..------------------------------------------------DDP------------------------
W0HWN7_9ENTR/4-243M.G..------------------------------------------------DDE------------------------
Y4486_PECAS/3-241V.C..------------------------------------------------DDD------------------------
D4MW94_9FIRM/4-242I.G..------------------------------------------------NDD------------------------
F4HE29_GALAU/4-237C.S..------------------------------------------------NDQ------------------------
K0B3I8_CLOA9/8-246I.G..------------------------------------------------LDE------------------------
Y2450_CARHZ/4-240V.G..------------------------------------------------EDE------------------------
D7CXP4_TRURR/5-245L.G..------------------------------------------------QDE------------------------
Y1858_TOLAT/4-242M.G..------------------------------------------------TDT------------------------
F8KSZ7_HELBC/4-242M.G..------------------------------------------------DDE------------------------
A1RBG9_ARTAT/5-242I.G..------------------------------------------------DDS------------------------
D8IRE9_HERSS/3-236C.D..------------------------------------------------TDE------------------------
A4CKX7_ROBBH/8-240.....------------------------------------------------NEQ------------------------
K0L0G1_WICCF/20-257I.AD.------------------------------------------------.DD------------------------
H0Q289_9RHOO/5-243M.G..------------------------------------------------DDA------------------------
V5UEX5_9BURK/3-235C.D..------------------------------------------------NDE------------------------
Q1GEX9_RUEST/5-243M.G..------------------------------------------------RDA------------------------
G3JBY9_CORMM/25-269M.GD.------------------------------------------------.DE------------------------
C0ZPT0_RHOE4/5-243L.G..------------------------------------------------DDD------------------------
Y2677_OCEIH/5-243I.G..------------------------------------------------QDD------------------------
B8ESL6_METSB/13-251M.G..------------------------------------------------DDA------------------------
A0M393_GRAFK/5-237.....------------------------------------------------FDE------------------------
Y3659_RUEPO/4-242M.G..------------------------------------------------DDD------------------------
W0PB55_9BURK/4-242M.G..------------------------------------------------DDA------------------------
Y228_NEIMB/4-237C.G..------------------------------------------------SDE------------------------
M9LS18_PSEA3/10-256L.GP.------------------------------------------------.DE------------------------
Y5076_MYCMM/4-242L.G..------------------------------------------------DDD------------------------
E4TEH0_CALNY/3-241I.G..------------------------------------------------NDE------------------------
Q03XI2_LEUMM/7-243I.G..------------------------------------------------LDS------------------------
C7MY76_SACVD/5-243L.G..------------------------------------------------DDE------------------------
Y870_RHOFT/3-241M.G..------------------------------------------------DDA------------------------
D5WT32_KYRT2/3-240M.GR.------------------------------------------------.DE------------------------
G7V6Q9_THELD/4-242I.G..------------------------------------------------NDE------------------------
W0K188_9EURY/4-239M.GR.------------------------------------------------.DE------------------------
C8WJT5_EGGLE/4-242L.G..------------------------------------------------LDD------------------------
F8A3C2_CELGA/1-238VVG..------------------------------------------------TDE------------------------
D5USV9_TSUPD/5-243L.G..------------------------------------------------DDD------------------------
C7MA67_BRAFD/8-245M.G..------------------------------------------------DDA------------------------
R6ZG54_9CLOT/4-242I.G..------------------------------------------------MDE------------------------
E3I0X6_RHOVT/3-241I.G..------------------------------------------------HDE------------------------
R6WIY8_9FIRM/4-242C.G..------------------------------------------------MDE------------------------
Y3193_STRGG/2-240L.T..------------------------------------------------DDD------------------------
J9Z0K8_9PROT/6-239Q.SV.------------------------------------------------.DL------------------------
L0A0G9_DEIPD/6-244M.G..------------------------------------------------RDH------------------------
D2SFX6_GEOOG/1-239L.G..------------------------------------------------DDE------------------------
F2IVP4_POLGS/3-236I.GD.------------------------------------------------.DA------------------------
Y5378_PSESM/4-242M.G..------------------------------------------------DDA------------------------
R5D7F4_9FIRM/4-242C.G..------------------------------------------------LDE------------------------
A1WRL8_VEREI/23-261I.GDG------------------------------------------------IDE------------------------
Y492_PSEAE/4-242I.GDG------------------------------------------------VDA------------------------
G4KUC6_OSCVS/4-242I.G..------------------------------------------------LDS------------------------
B9K5U5_AGRVS/3-241L.C..------------------------------------------------DDE------------------------
Y2936_PSESM/3-241I.GDG------------------------------------------------VDT------------------------
E0SL44_DICD3/5-243I.GDD------------------------------------------------VDR------------------------
C5C2F0_BEUC1/8-228.....------------------------------------------------DDA------------------------
E6WID8_PANSA/3-241L.C..------------------------------------------------DDA------------------------
C5AIE4_BURGB/6-244I.GDG------------------------------------------------VDE------------------------
Y126_CUPNH/3-236C.A..------------------------------------------------NDE------------------------
Y1315_CHLAA/4-242V.G..------------------------------------------------DDD------------------------
B9L4Q4_THERP/5-240L.GN.------------------------------------------------.DA------------------------
Y4277_AGRFC/3-241L.C..------------------------------------------------DDE------------------------
H6RAT6_NOCCG/3-241M.G..------------------------------------------------DDA------------------------
A4YUI8_BRASO/5-244M.G..------------------------------------------------NDA------------------------
C6WEW0_ACTMD/3-240L.G..------------------------------------------------DDE------------------------
B8IQH8_METNO/3-241V.G..------------------------------------------------HDE------------------------
U3GU40_9CORY/2-237M.G..------------------------------------------------DDA------------------------
H6NIN3_9BACL/8-246L.G..------------------------------------------------ADE------------------------
Q223B3_RHOFT/22-260I.GEG------------------------------------------------ADE------------------------
Y4304_PHOLL/4-242M.G..------------------------------------------------DDN------------------------
M1FEE9_9ALTE/2-242M.G..------------------------------------------------LDD------------------------
Y3634_BRADU/3-241I.C..------------------------------------------------DDE------------------------
C6CWI5_PAESJ/6-244F.G..------------------------------------------------QDA------------------------
B9JN39_AGRRK/3-241L.C..------------------------------------------------DDE------------------------
Y1066_COREF/7-245M.G..------------------------------------------------NDE------------------------
X4ZHZ1_9BACL/4-242I.G..------------------------------------------------ADE------------------------
Y4198_BURPS/6-244I.GDG------------------------------------------------VDE------------------------
Y3173_CHRVO/3-236C.G..------------------------------------------------DDA------------------------
W0HX68_9ENTR/3-242M.G..------------------------------------------------DDG------------------------
G7ZEN3_AZOL4/4-243M.G..------------------------------------------------DDR------------------------
Y439_FUSNN/5-242L.G..------------------------------------------------MDE------------------------
B1VIF3_CORU7/7-244V.S..------------------------------------------------DDA------------------------
I1XMA4_METNJ/11-252M.G..------------------------------------------------MDE------------------------
C1DQ20_AZOVD/7-248M.G..------------------------------------------------NDA------------------------
F4FA66_VERMA/1-238L.G..------------------------------------------------DDE------------------------
I4BYP2_ANAMD/4-242M.G..------------------------------------------------NDE------------------------
E8QYT2_ISOPI/17-247..GLP------------------------------------------------WDA------------------------
D7A1T1_STAND/3-241V.G..------------------------------------------------NDA------------------------
A6VS70_MARMS/2-241M.G..------------------------------------------------LDD------------------------
D1BL87_VEIPT/5-243L.G..------------------------------------------------MDS------------------------
V9XKP0_9NOCA/4-242L.G..------------------------------------------------DDE------------------------
E1VTB5_ARTAR/4-242M.G..------------------------------------------------DDA------------------------
D1B9J1_THEAS/5-243I.G..------------------------------------------------DDE------------------------
Y1708_STAA8/3-241F.G..------------------------------------------------GDH------------------------
R6QJ24_9FIRM/4-236A.A..------------------------------------------------YDE------------------------
Q02CY7_SOLUE/3-225.....------------------------------------------------HEA------------------------
A1R1R8_ARTAT/1-239M.G..------------------------------------------------DDA------------------------
M4R6T5_BIBTR/4-237C.A..------------------------------------------------NDE------------------------
W0JZF2_9EURY/4-240M.GN.------------------------------------------------.DE------------------------
Y2905_BURP8/3-236C.G..------------------------------------------------SDE------------------------
D8PCF2_9BACT/7-245L.D..------------------------------------------------VEA------------------------
Y4778_VIBVY/6-245M.G..------------------------------------------------SDE------------------------
R5BE93_9FIRM/4-242L.G..------------------------------------------------MDE------------------------
A1T0G5_PSYIN/2-241M.G..------------------------------------------------LDE------------------------
W0IZ00_9BACT/3-248..GSP------------------------------------------------ADE------------------------
C3KLX3_RHISN/4-241M.G..------------------------------------------------DDV------------------------
F2G9I8_ALTMD/2-244M.P..------------------------------------------------VES------------------------
J7KY74_NOCAA/3-241L.G..------------------------------------------------DDR------------------------
F3ZDL6_9ACTN/6-244L.G..------------------------------------------------DDE------------------------
G0HCZ7_CORVD/4-242V.A..------------------------------------------------DDH------------------------
D5DEN3_BACMD/4-242I.G..------------------------------------------------NDE------------------------
B6QNE9_PENMQ/10-244C.GP.------------------------------------------------.DK------------------------
W5XWZ0_9CORY/6-242V.A..------------------------------------------------DDK------------------------
G7ZD33_AZOL4/6-244L.GEA------------------------------------------------SDD------------------------
F2JVE0_MARM1/2-240M.G..------------------------------------------------MDE------------------------
W5WPA4_9CORY/7-245V.S..------------------------------------------------DDA------------------------
X2H6N5_9GAMM/7-245M.G..------------------------------------------------NDQ------------------------
D7WE68_9CORY/5-242V.A..------------------------------------------------DDA------------------------
D8MPR3_ERWBE/3-236C.A..------------------------------------------------NDR------------------------
E3EYK5_KETVY/5-244M.G..------------------------------------------------DDA------------------------
A4F9Z7_SACEN/1-239L.G..------------------------------------------------DDA------------------------
G7XL47_ASPKW/8-245C.GP.------------------------------------------------.DE------------------------
A8LPR1_DINSH/5-243M.G..------------------------------------------------DDA------------------------
C7JDH8_ACEP3/3-240V.A..------------------------------------------------NDD------------------------
N4VLC9_COLOR/6-246M.GP.------------------------------------------------.DE------------------------
G0L477_ZOBGA/6-239.....------------------------------------------------LEK------------------------
B1MGY8_MYCA9/4-228L.G..------------------------------------------------DDD------------------------
Q483Q3_COLP3/2-240M.G..------------------------------------------------LDN------------------------
R5KN94_9CLOT/4-237A.G..------------------------------------------------ADE------------------------
R0K0K3_SETT2/8-244C.GP.------------------------------------------------.DD------------------------
D0L462_GORB4/8-241V.G..------------------------------------------------DDE------------------------
Y441_STRCO/2-240L.T..------------------------------------------------DDD------------------------
H5X6J3_9PSEU/1-239L.G..------------------------------------------------DDA------------------------
Q2KUF2_BORA1/5-243M.G..------------------------------------------------NDS------------------------
Y3066_BACCR/4-242M.G..------------------------------------------------NDD------------------------
B9JHF9_AGRRK/4-243I.G..------------------------------------------------DDK------------------------
B0UCC0_METS4/4-242C.G..------------------------------------------------DDA------------------------
Q0SBI7_RHOJR/9-246M.G..------------------------------------------------DDD------------------------
A0JRP4_ARTS2/1-239M.G..------------------------------------------------DDA------------------------
F8KRQ1_HELBC/5-243I.GDG------------------------------------------------VDD------------------------
D5UJL7_CELFN/4-244L.EPP------------------------------------------------ADD------------------------
Y2700_YERPE/3-236C.A..------------------------------------------------NDQ------------------------
V4IFZ2_9ACTN/6-244L.G..------------------------------------------------DDD------------------------
Y4074_AZOC5/4-242L.T..------------------------------------------------EDE------------------------
Y2695_THET8/3-241Y.G..------------------------------------------------HDR------------------------
Q16DH1_ROSDO/4-242M.G..------------------------------------------------DDA------------------------
K7TCZ9_GLUOY/7-242I.G..------------------------------------------------NDD------------------------
D5EIJ1_CORAD/3-232.....------------------------------------------------RTA------------------------
K0FF24_9NOCA/3-241M.G..------------------------------------------------DDA------------------------
E8U5L2_DEIML/4-237..GSP------------------------------------------------HEA------------------------
B4EQJ0_BURCJ/4-237..GRA------------------------------------------------HDD------------------------
Q2W2X4_MAGSA/5-238M.G..------------------------------------------------DDE------------------------
F8DZP5_CORRG/4-242V.A..------------------------------------------------DDA------------------------
J9S8D4_9ACTN/8-241I.G..------------------------------------------------DDE------------------------
B1M8C8_METRJ/3-241L.G..------------------------------------------------DDA------------------------
E8MYL0_ANATU/1-235L.G..------------------------------------------------NDE------------------------
R5C931_9FIRM/3-241I.G..------------------------------------------------MDA------------------------
H6C6W1_EXODN/8-246M.GP.------------------------------------------------.DE------------------------
F0Y460_AURAN/32-276M.T..------------------------------------------------ADA------------------------
H0UJ33_9BACT/4-242M.G..------------------------------------------------RDE------------------------
Y4511_PSEAE/8-249M.G..------------------------------------------------DDV------------------------
E1VBZ3_HALED/5-245M.G..------------------------------------------------MDA------------------------
D4M7W6_9BACT/4-242I.G..------------------------------------------------GDE------------------------
G2LEC2_CHLTF/4-242M.G..------------------------------------------------ADE------------------------
C7RQK9_ACCPU/6-244M.G..------------------------------------------------NDS------------------------
Y4877_VIBPA/8-246M.G..------------------------------------------------ADD------------------------
Y1531_COPPD/5-243L.G..------------------------------------------------LDR------------------------
V2WV16_MONRO/9-250I.GN.------------------------------------------------.DD------------------------
M7WMG6_RHOT1/6-247I.G..------------------------------------------------DDE------------------------
A3HS16_9BACT/7-235..GIS------------------------------------------------HEA------------------------
Y043_AZOSB/4-242M.G..------------------------------------------------EDD------------------------
F0M0F6_VIBFN/6-245M.G..------------------------------------------------ADH------------------------
Y2984_DEIRA/7-247L.G..------------------------------------------------DDA------------------------
C7R8W9_KANKD/7-245..QWE------------------------------------------------ADS------------------------
Y1502_GEOKA/4-241L.G..------------------------------------------------.QE------------------------
Y150_BORPE/5-243M.G..------------------------------------------------NDE------------------------
Y2042_NITHX/3-242M.G..------------------------------------------------NDA------------------------
A0R539_MYCS2/5-243L.G..------------------------------------------------DDE------------------------
Y2038_STACT/3-241F.G..------------------------------------------------GDH------------------------
K1VQ76_TRIAC/63-302L.G..------------------------------------------------PDE------------------------
Y498_BACLD/4-242I.G..------------------------------------------------LDE------------------------
G2J1V4_PSEUL/3-236C.G..------------------------------------------------DDA------------------------
D8MWR7_ERWBE/4-242I.A..------------------------------------------------DDA------------------------
Q3ICU0_PSEHT/2-237M.G..------------------------------------------------LDE------------------------
Y3910_AGRFC/4-242M.G..------------------------------------------------DDE------------------------
S8E0A5_FOMPI/4-241I.GD.------------------------------------------------.DE------------------------
F6EKD4_AMYSD/4-242L.G..------------------------------------------------DDA------------------------
Y3576_VIBCH/6-245M.G..------------------------------------------------ADE------------------------
D3UZ92_XENBS/5-243M.G..------------------------------------------------NDA------------------------
C1CZR4_DEIDV/6-239..GSE------------------------------------------------HEA------------------------
K7TD01_GLUOY/6-244I.G..------------------------------------------------NDA------------------------
YBGL_SHIDS/3-236C.A..------------------------------------------------SDA------------------------
H1YGF4_9SPHI/5-243M.P..------------------------------------------------NDD------------------------
Q5QXP9_IDILO/9-254M.G..------------------------------------------------ADD------------------------
Q47NG6_THEFY/3-241L.G..------------------------------------------------DDE------------------------
U5LAF3_9BACI/4-242I.G..------------------------------------------------SDE------------------------
E1QDN4_DESB2/3-244L.G..------------------------------------------------DDQ------------------------
X4ZYD6_9BACL/5-242V.A..------------------------------------------------DDQ------------------------
Y4577_PSEPK/13-254M.G..------------------------------------------------LDA------------------------
B5ICJ8_ACIB4/3-241I.G..------------------------------------------------NDT------------------------
Q1DC03_MYXXD/8-229.....------------------------------------------------EDE------------------------
C7MLY6_CRYCD/7-245L.G..------------------------------------------------MDS------------------------
W8X9N3_CASDE/1-239M.G..------------------------------------------------DDA------------------------
Q5E525_VIBF1/3-242L.G..------------------------------------------------NDS------------------------
A4ASE2_MARSH/6-239.....------------------------------------------------NEE------------------------
W5W979_9PSEU/4-242L.G..------------------------------------------------DDE------------------------
R5MQI6_9FIRM/5-243I.G..------------------------------------------------LDE------------------------
R7XYL9_9ACTN/8-246L.G..------------------------------------------------DDD------------------------
C0QGD0_DESAH/1-241I.G..------------------------------------------------MDE------------------------
E5AMR8_BURRH/21-254C.G..------------------------------------------------NDE------------------------
B8LZW7_TALSN/11-246I.GP.------------------------------------------------.DD------------------------
G2TJB6_BACCO/4-242I.G..------------------------------------------------RDE------------------------
R5H7E1_9SPIR/13-244..KNN------------------------------------------------SEF------------------------
Q3SF52_THIDA/2-233.....------------------------------------------------EDD------------------------
Q4FMV7_PELUB/11-249..SIK------------------------------------------------NDP------------------------
B9JN49_AGRRK/11-248I.GDT------------------------------------------------RDE------------------------
Y1729_HAEIN/4-237F.P..------------------------------------------------FDE------------------------
I7F001_PHAIB/5-243M.G..------------------------------------------------DDA------------------------
K5WPA6_AGABU/8-248M.GD.------------------------------------------------.DE------------------------
F2F1B3_SOLSS/4-242L.G..------------------------------------------------EQE------------------------
Y486_MYCPA/4-242L.G..------------------------------------------------DDD------------------------
D5ATU4_RHOCB/3-236.....------------------------------------------------.DA------------------------
A4XXR4_PSEMY/4-245M.G..------------------------------------------------LDA------------------------
B1LSM8_METRJ/4-242C.G..------------------------------------------------DDA------------------------
E6X9V0_CELAD/3-235.....------------------------------------------------NEK------------------------
L0EBQ1_THECK/9-247I.G..------------------------------------------------RDR------------------------
Q28NJ3_JANSC/23-261M.G..------------------------------------------------DDE------------------------
Q21NC0_SACD2/2-238.....------------------------------------------------.DA------------------------
G8AQ87_AZOBR/366-604I.G..------------------------------------------------DDD------------------------
A1S1H7_SHEAM/4-236..GYP------------------------------------------------FDA------------------------
R5XTA1_9FIRM/4-237A.K..------------------------------------------------HDA------------------------
F8I999_SULAT/1-233Y.GA.------------------------------------------------.DE------------------------
G0AE74_COLFT/9-243SNG..------------------------------------------------SDE------------------------
W0LH49_9ENTR/3-236C.A..------------------------------------------------NDE------------------------
Q2J8R2_FRASC/53-290L.T..------------------------------------------------EDE------------------------
R7JWG6_9CLOT/4-242I.G..------------------------------------------------MDE------------------------
H6RUE6_BLASD/9-247L.G..------------------------------------------------DDD------------------------
B8IGM4_METNO/4-242A.A..------------------------------------------------DDE------------------------
Y333_MYCLE/4-242L.G..------------------------------------------------DDE------------------------
A9BP88_DELAS/14-252I.GDG------------------------------------------------VDQ------------------------
E4U7W9_OCEP5/4-242M.G..------------------------------------------------SDE------------------------
Y093_ARTS2/4-242L.G..------------------------------------------------DDT------------------------
J7QRE0_METSZ/8-246M.G..------------------------------------------------DDD------------------------
C8WUH6_ALIAD/4-242L.A..------------------------------------------------NDG------------------------
Y1168_STAEQ/5-243F.G..------------------------------------------------GDQ------------------------
A1WEV7_VEREI/4-242L.G..------------------------------------------------DDA------------------------
C4ZLA9_THASP/5-243M.G..------------------------------------------------EDE------------------------
D7BRG6_STRBB/6-245L.T..------------------------------------------------DDD------------------------
F4AY60_DOKS4/4-236.....------------------------------------------------NEA------------------------
A9H2F5_GLUDA/7-245I.G..------------------------------------------------NDA------------------------
D3FTL6_BACPE/4-242I.G..------------------------------------------------QDE------------------------
Y282_PROAC/4-246A.G..------------------------------------------------DDE------------------------
E0SEY7_DICD3/3-236G.Q..------------------------------------------------HDE------------------------
M1MW29_9CORY/4-241V.A..------------------------------------------------DDA------------------------
D5BMH2_PUNMI/3-237M.GN.------------------------------------------------.DE------------------------
R7MJT0_9CLOT/13-245..KNS------------------------------------------------SET------------------------
A0LSF5_ACIC1/16-254I.G..------------------------------------------------SDD------------------------
Y379_BACP2/4-242I.G..------------------------------------------------SDE------------------------
B6HFB9_PENCW/10-245I.TS.------------------------------------------------.DE------------------------
H5WZE4_9PSEU/3-241S.G..------------------------------------------------DDE------------------------
I0GX05_ACTM4/4-242L.G..------------------------------------------------DDD------------------------
E1SWB7_FERBD/3-239..N..------------------------------------------------LDA------------------------
C0ZBV3_BREBN/4-239Q.S..------------------------------------------------EDL------------------------
E6SBM1_INTC7/6-244L.G..------------------------------------------------DDE------------------------
A7IFF2_XANP2/3-241I.T..------------------------------------------------DDA------------------------
F8K454_STREN/34-272L.T..------------------------------------------------DDE------------------------
H6N0G5_GORPV/18-251V.G..------------------------------------------------DDE------------------------
S3BUE6_OPHP1/51-290M.GP.------------------------------------------------.DE------------------------
D4M7F2_9BACT/5-243M.G..------------------------------------------------MDE------------------------
G8T834_NIAKG/4-244I.E..------------------------------------------------KDK------------------------
B5HGL3_STRPR/6-244L.T..------------------------------------------------DDE------------------------
E4N888_KITSK/2-244L.T..------------------------------------------------DDE------------------------
E8SIF4_STAPH/3-241I.G..------------------------------------------------NDR------------------------
B9K212_AGRVS/6-244V.GDT------------------------------------------------ADQ------------------------
K4RDP3_9ACTN/4-242L.T..------------------------------------------------DDE------------------------
D4ZD86_SHEVD/10-243..GGA------------------------------------------------NDA------------------------
Y3513_ACIAC/3-241M.G..------------------------------------------------DDA------------------------
Y2681_RHOPA/3-242M.G..------------------------------------------------DDA------------------------
I2EPH3_EMTOG/6-243M.G..------------------------------------------------NDQ------------------------
K0KCJ9_SACES/2-239L.G..------------------------------------------------DDD------------------------
F2NR58_MARHT/3-241M.G..------------------------------------------------QDE------------------------
Y2977_ALKMQ/4-242L.G..------------------------------------------------MDG------------------------
Y5654_NOCFA/3-240M.G..------------------------------------------------DDA------------------------
D3F024_CONWI/21-259L.GD.------------------------------------------------.DA------------------------
K7RR83_PROA4/1-239M.G..------------------------------------------------DDD------------------------
G9WFM7_9LACT/4-240L.G..------------------------------------------------NDD------------------------
B9L7F1_NAUPA/2-239L.G..------------------------------------------------MDE------------------------
I4C5I2_DESTA/3-239L.GN.------------------------------------------------.DE------------------------
E3CXI0_9BACT/4-242L.G..------------------------------------------------DDE------------------------
Y1066_HELMI/3-241I.G..------------------------------------------------CDA------------------------
D2RMC2_ACIFV/3-241I.G..------------------------------------------------MDD------------------------
Q1GM83_RUEST/5-243L.GEA------------------------------------------------PDD------------------------
E0SJD9_DICD3/3-241L.C..------------------------------------------------DDA------------------------
F7YS87_VIBA7/10-249M.G..------------------------------------------------ADE------------------------
Q6ANH3_DESPS/2-232I.S..------------------------------------------------QDD------------------------
E3F040_KETVY/2-233I.A..------------------------------------------------DDA------------------------
B2ICA4_BEII9/9-247M.G..------------------------------------------------DDA------------------------
A1AYU0_PARDP/5-242M.G..------------------------------------------------DDA------------------------
F0RCU6_CELLC/6-239.....------------------------------------------------NES------------------------
K4L056_SIMAS/4-242M.G..------------------------------------------------MDE------------------------
C7QHB5_CATAD/2-244L.G..------------------------------------------------DDD------------------------
Y476_METCA/5-243M.G..------------------------------------------------QDE------------------------
G4QKJ0_GLANF/2-240F.D..------------------------------------------------ADS------------------------
A1U0R3_MARHV/2-242M.G..------------------------------------------------QDD------------------------
Q3IWM6_RHOS4/5-244M.G..------------------------------------------------DDA------------------------
U4KH28_9VIBR/6-245M.G..------------------------------------------------LDE------------------------
Q6D7H2_PECAS/3-236G.E..------------------------------------------------HDE------------------------

PF10096

Q8XK74_CLOPE/180-429------------------VM---GRYLGKKN---------V..PYHI--AWIPR-Y---IDPE-----------------
U5MQH8_CLOSA/192-443------------------II---ANYMYQRE---------I..PYHI--AWIPR-Y---VIPN-----------------
G7MC91_9CLOT/194-445------------------II---ADYMNQKK---------I..PYHI--AWIPR-Y---VIPS-----------------
M1MSD1_9CLOT/193-445------------------IM---ANYMYQKN---------I..PYHI--AWIPR-Y---VIPN-----------------
B2TQG3_CLOBB/185-436------------------II---GQYMNKQN---------I..PYHI--AWIPR-Y---KNPN-----------------
R6P5J4_9FIRM/162-419------------------YT---AEYLYIKG---------E..QYYI--AWVPV-Y---SNPA-----------------
A6LS62_CLOB8/199-444------------------IM---ANLLFSQG---------L..KFHI--SWIPR-F---VVPS-----------------
M1MAA0_9CLOT/199-444------------------LM---SNLLYSNG---------I..KFHI--AWIPR-F---IVPD-----------------
U5MNT4_CLOSA/199-442------------------CM---VNLLYSQG---------I..KFHV--AWIPR-F---KAPT-----------------
M1MG87_9CLOT/199-442------------------CM---ANLLYSQG---------M..KFHV--SWIPR-F---KDPD-----------------
G7M6B9_9CLOT/199-442------------------SI---ANLFYSQR---------I..KFHI--SWIPR-Y---KSPA-----------------
G7LYM9_9CLOT/199-443------------------LM---ANLLYSQG---------M..KFHV--SWIPR-F---VSPA-----------------
D9SNK6_CLOC7/207-454------------------AL---ADYFYSEG---------T..KFHV--AWIPR-Y---REPS-----------------
Q8XMN0_CLOPE/198-445------------------YL---SDYFKANN---------I..VFHI--AWIPR-Y---INPE-----------------
U5RNL9_9CLOT/160-417------------------IV---TDYLYAKG---------T..IFYV--AWVPR-Y---VDPS-----------------
A6LXX4_CLOB8/129-377------------------VV---ADYMFSAG---------I..PFHI--AWIPR-F---VDHK-----------------
A5I018_CLOBH/188-437------------------VI---SDYLYSKN---------I..PFHV--AWVPR-Y---LDPK-----------------
W0EHC6_9FIRM/3-275------------------AI---ADYLHSEN---------V..PFHV--SVIPR-Y---INPS-----------------
A5D0J0_PELTS/44-299------------------AI---ADYLHSEG---------V..PFHV--SVIPV-Y---KDPR-----------------
K4L6F7_9FIRM/42-301------------------VI---ADYLQQEG---------I..PFEV--SLIPR-M---VEPG-----------------
I0GIR5_CALEA/37-285------------------KT---ADYLYDEH---------V..PFHV--SVVPI-Y---INPL-----------------
R4SQ82_AMYOR/281-555------------------RV---TDFLVQEK---------I..PFSL--AVYPY-Y---SDPQ-----------------
G8SCF8_ACTS5/260-527------------------AV---ADFLFAEK---------V..PFSV--AVYPR-F---RDPK-----------------
U5WBT8_9ACTN/261-529------------------AA---ADYLYAQK---------V..PFSV--AVYPR-Y---RDPK-----------------
A8LFA1_FRASN/262-530------------------AI---ADYLSSAQ---------V..PFSV--AVYPR-Y---VDAN-----------------
W5WDT8_9PSEU/293-566------------------QV---ADYLHSAG---------V..PFSV--AVIPQ-Y---KDPN-----------------
E2Q861_STRC2/342-611------------------AI---ADYLKSQN---------I..AYGI--NVIPV-Y---SDPK-----------------
K4RBX1_9ACTN/345-613------------------AI---ADYLYAQR---------I..PYGI--NVIPV-Y---TDPN-----------------
A1WAM2_ACISJ/315-589------------------RV---VDLAFERK---------V..PFSV--GVVPH-Y---KDPL-----------------
D0J002_COMT2/256-530------------------SL---TDYLYQQR---------I..PFSI--ATIPY-Y---KDPL-----------------
B2UJM5_RALPJ/282-558------------------TL---TDYLYSKK---------I..PFSI--ATIPL-Y---TDPN-----------------
A0A068NT91_9BACT/235-497------------------SI---ADLLYAEG---------V..PYVV--CVIPQ-F---EDPL-----------------
L0A522_DEIPD/259-504------------------RA---IGLLEREH---------I..PFSA--TVIPE-F---RAP.-----------------
M9X7T8_MEIRD/244-506------------------RM---LDIINRVG---------I..PFLA--TAIPL-Y---IDNN-----------------
L0A502_DEIPD/323-574------------------NI---LDVLVKEK---------VT.KFGM--TVIPQ-N---VVPQ-----------------
Q1IXI2_DEIGD/311-556------------------TM---LDVIQDLR---------I..PFAL--TVIPE-A---YYQG-----------------
Q1AST7_RUBXD/238-462------------------RI---AGYLHEHR---------V..PFAV--GVIPA-Q---RFED-----------------
B0TC26_HELMI/295-528------------------QF---ADVLKSRN---------I..PFMV--TVVPV-Y---VNP.-----------------
R7P8S3_9BACT/4-202------------------KI---EFILDKYG---------V..RPIV--AVIPN-N---LDR.-----------------
E1RA10_SPISS/7-204------------------KV---ETIVNACG---------I..KPLV--AVVPD-N---RDP.-----------------
Q7MSW5_WOLSU/4-200------------------RI---EEILDHYS---------I..SPIV--AVIPS-N---QDP.-----------------
E3GN09_EUBLK/1-199------------------KI---ERILDQYK---------I..KPMV--GVIPN-N---EDT.-----------------
R5ZC39_9FIRM/3-201------------------RM---ETLIDKYG---------I..KPLV--GIIPD-N---KDA.-----------------
F4LX97_TEPAE/1-199------------------KM---EQILDLHN---------I..KPIV--GVIPN-N---QDN.-----------------
D4K2A5_9FIRM/3-201------------------RM---EDLLDKYH---------I..KPIV--GVIPN-N---QDP.-----------------
R7LEI3_9BACT/4-204------------------RM---FEILDQYG---------V..RPMV--GIIPH-N---EDP.-----------------
A5V9P4_SPHWW/4-201------------------AV---ADIFMRFE---------V..QPLL--GVIPD-N---KDA.-----------------
H6LBB2_ACEWD/5-204------------------ML---KNVFIKYN---------I..KPII--GVIPN-N---EDE.-----------------
E0RX58_BUTPB/2-201------------------KF---KAILDKHG---------I..KPLI--GVVPD-N---KDK.-----------------
R5H8N9_9FIRM/2-200------------------AF---EQLFERYG---------C..YPLL--GIVPD-N---LDP.-----------------
R7R6S7_9FIRM/2-200------------------RF---KELCDLYQ---------V..KPLI--GVVPA-N---QDT.-----------------
R5CHW3_9FIRM/2-201------------------RF---KDLMDRYG---------V..KPLL--GIVPD-N---HDS.-----------------
R6C994_9CLOT/6-204------------------AF---KTILDKYN---------I..KPLL--GIVPD-C---RDA.-----------------
R6ZDL3_9FIRM/2-202------------------AV---KKLLDRYK---------I..KPLI--GVIPD-N---RDE.-----------------
R5BT68_9FIRM/9-207------------------KA---VEVLDKYH---------I..KPLI--GVIPD-C---KDP.-----------------
E4NN78_HALBP/100-323------------------AV---DRVFADEN---------V..PVTN--AVIPF-P---GGE.-----------------
H1XSW8_9BACT/27-257------------------PF---QQTVEAVG---------A..KVSW--SVIPH-R---LQE.-----------------
B4U8C2_HYDS0/10-157------------------KL---KELLAENG---------FD.NITF--LLIPF-Y---HEK.-----------------
B2V9Y1_SULSY/4-150------------------YL---KDILEDLG---------VS.KITY--LLIPY-Y---HEK.-----------------
D3SMT5_THEAH/3-151------------------TT---LHLLKTVG---------VR.KFSL--LVIPN-F---QGR.-----------------
F8AAV2_THEID/3-151------------------EA---LKLIFEEE---------IN.KYCI--LLIPN-Y---KNK.-----------------
K0CAU1_ALCDB/12-196------------------PL---LRALERHP---------RI.PLTL--LVVPD-F---HGG.-----------------
Q88N47_PSEPK/1-183------------------PF---VGAVDALG---------HV.PMTW--LVVPD-F---HRR.-----------------
Q9HW89_PSEAE/5-189------------------PF---VEAVDALG---------QV.PMTW--LVVPD-F---HHR.-----------------
C1DDN4_AZOVD/5-189------------------NF---VAVVDALG---------NV.PITW--LVVPD-F---HHR.-----------------
K0ERT4_9NOCA/61-217------------------RW---CADADGFG---------I..PVSL--LVIPG-P---WRG.-----------------
C7Q7J8_CATAD/6-161------------------RW---LADLDARG---------I..PGTL--LVIPG-P---WRG.-----------------
D6Z9I9_SEGRD/14-177------------------AF---AELLDARG---------V..PLSL--LVAPK-L---PGK.-----------------
C1A667_GEMAT/9-196------------------TL---WNWCRAHD---------I..TPAL--FVVPN-W---HGE.-----------------
Q6LXR4_METMP/34-239------------------EI---DQVISKYG---------YSKRTYL--FLIVN-H---ANE.-----------------
F6BD61_METIK/72-273------------------EI---VKIIDKHN---------YQNRTYL--FVIVN-H---DNR.-----------------
Y505_METJA/37-247------------------EI---VKIIDKYH---------YQNRSYL--FLIVN-H---ANK.-----------------
F6BE00_METIK/47-254------------------DI---EKIINKHN---------YQDRTYL--FIIVN-H---ANK.-----------------
D7DSJ1_METV3/60-270------------------EI---TEILDNNH---------YSTRTYL--FVIVN-H---ANE.-----------------
A6UV77_META3/44-251------------------KI---TSIIDKYN---------CSNNTIL--FVIPD-L---ENP.-----------------
Q5JH22_THEKO/56-259------------------EI---TEIIDEYG---------MANNTYF--FVIPN-H---AGK.-----------------
Q897A5_CLOTE/246-480------------------EM---AEYLYKEN---------I..PYMV--ALIPV-F---IDT.-----------------
A5I1D3_CLOBH/229-463------------------AI---ADYLYSED---------I..PFMI--ALIPT-F---VDT.-----------------
Q18AM8_PEPD6/233-467------------------EI---ADYLSSKN---------I..PFTI--ALIPA-Y---VNP.-----------------
F4LUH2_TEPAE/229-462------------------EI---ADYFNKEG---------I..PYMV--ALIPA-F---YDV.-----------------
A8FA31_BACP2/214-479------------------EL---GQYVSAQH---------I..PYQI--AVTPA-W---IDR.-----------------
Q65D17_BACLD/215-481------------------QA---GSYLHKRN---------I..PFIL--SVIPV-Y---VNP.-----------------
K0J5W3_AMPXN/221-485------------------EI---ASILKEKN---------I..PYMV--AVIPI-Y---TNP.-----------------
Q81IW1_BACCR/212-474------------------EI---AELLKEKK---------M..PYMI--TVIPV-Y---KDP.-----------------
C2WY28_BACCE/212-474------------------DI---ADLLKKKK---------I..PYMI--TVIPV-Y---TDP.-----------------
I4D437_DESAJ/233-460------------------KL---INTLAIAR---------I..PFAL--TVTPL-M---E...-----------------
M1E711_9FIRM/225-461------------------GV---IDLLEKRR---------I..HFSI--GVIPI-F---VNP.-----------------

PF01522

NODB_AZOC5/9-134------------------AV---CEILREHS---------A.-LATF--FQIGR.F...AKEY....-------------
Q9A5L9_CAUCR/35-168------------------AG---ARALEARG---------L.-RGTY--YFAAG.LTGRDG..PMG.-------------
O69838_STRCO/70-214------------------GL---ITALRELK---------V.-PATV--FMTGR.W...AEEY....-------------
Q9XAP6_STRCO/96-224------------------QV---LDILEKYD---------V.-PGTF--FLVGS.M...VSRH....-------------
CDA2_YEAST/112-232------------------ST---TKLLDRLK---------H.-NSTF--FNLGV.N...IVQH....-------------
Q98GK8_RHILO/808-946------------------HA---WPTLRAND---------L.-TAEV--FLVTD.L...VGKGAQWD-------------
ICAB_STAEQ/107-248------------------NA---FPVLKKYH---------I.-PATG--FLITN.H...IGSTNFHN-------------
Q97ET9_CLOAB/86-214------------------KI---LSILDANQ---------I.-KATF--FLIGQ.N...AERY....-------------
YHEN_BACSU/79-203------------------RL---LDVLKSAD---------V.-KATF--FMLSP.R...MNEF....-------------
Q9CHP6_LACLA/96-236------------------NA---YPIMKKLD---------L.-PFTQ--FIITG.K...VGQTIDGS-------------
Q9RVF2_DEIRA/33-157------------------AV---LAALREAD---------M.-HATF--FVIAG.K...AQAH....-------------
Q982X7_RHILO/88-291------------------EA---LPVLEKHG---------A.-PITI--YVAPG.LIDGTADLWWDV-------------
Q97K82_CLOAB/62-192------------------YI---LDTLKTYD---------V.-KATF--FVTGK.N...SIIN....-------------
O53444_MYCTU/41-164------------------RL---LHILTDND---------A.-KATF--FLIGN.K...VAAN....-------------
PDAA_BACSU/60-185------------------KV---LDVLKKHR---------V.-TGTF--FVTGH.F...VKDQ....-------------
Q985U0_RHILO/77-213------------------RI---LSALVENK---------I.-PATI--FVTGIWLKRNAAAV....-------------
Q9WXW8_THEMA/27-151------------------AV---LGTLEKHG---------V.-VATF--FVVGQRL...NEST....-------------
P73597_SYNY3/44-199------------------RI---LDLLDKYK---------I.-KITS--HMSGR.T...VEMY....-------------
Q9L1T3_STRCO/85-207------------------RV---LDVLKKHD---------A.-HAVF--FVTGT.M...ASRY....-------------
Q9A6E1_CAUCR/17-152------------------EL---LKASAEAG---------A.-PAFG--FINAVQNEREPDSA....-------------
Q97TP4_CLOAB/83-210------------------NV---YPILRKYH---------M.-KAAE--FAITN.L...IDTYGH..-------------
Q97JC7_CLOAB/83-211------------------KI---IEILNRNN---------I.-KATF--FLIGK.S...AEEF....-------------
Q9X8Z4_STRCO/86-212------------------QV---LDLLEEYG---------V.-KATF--CMTGL.Q...AEAH....-------------
Q9KEF7_BACHD/63-188------------------VI---LDVLKDKQ---------V.-PATF--FVTGH.Y...LETE....-------------
Q9PF00_XYLFA/74-213------------------AA---LPVLQAHG---------F.-SATC--YVVSG.SLARFNTWDAER-------------
Q97LW8_CLOAB/106-234------------------NA---YPVLKKYN---------L.-HATM--FIITD.Y...LDKGTL..-------------
Q9KEJ5_BACHD/75-214------------------EL---LAYLQEKE---------I.-PATL--FVNER.W...IDEN....-------------
Q9CCZ2_MYCLE/73-201------------------SY---VQFVKDTD---------I.-RLTF--FVNGV.YDSWTDNM....-------------
Q9KBK9_BACHD/74-199------------------QV---LDVLQEYN---------V.-PATF--FVMGR.R...AERF....-------------
Q9KSH6_VIBCH/26-172------------------EV---IKVLNQGG---------V.-KATF--YFNAW.HLDGIGDENE..-------------
Q9P9U2_XYLFA/249-384------------------EI---KEILQHYA---------V.-PAVF--FEVGR.N...IGRFDRAG-------------
Q9FBM6_STRCO/131-288------------------HA---DPVLARYG---------M.-KAAA--YLIT..........GQVG-------------
Q9RV08_DEIRA/33-148------------------EL---LAVLARHD---------A.-QATF--FVLES.H...ARAL....-------------
Y4760_STRCO/62-184------------------AF---VGLIRERR---------L.-PVTL--FLTDTVA...GPAY....-------------
Q983K0_RHILO/61-197------------------NI---LDVLEAEQ---------V.-PATL--FMVGMHAEAGASNK....-------------
Q97MV1_CLOAB/82-216------------------KI---LDTLEREN---------V.-NATF--FLIGS.NIQLSNES....-------------
Q9K630_BACHD/116-243------------------KL---LTLLNEYE---------M.-KATF--FTLSP.K...VKQY....-------------
Q9R7V4_YERPE/101-271------------------RV---YPLLKAYK---------W.-SAVL--APVGT.W...IDTATDKK-------------
Q9ZBN1_STRCO/59-183------------------RL---LDILKEKQ---------V.-PATF--FLLGKRH...IDTY....-------------
Q9PAV0_XYLFA/97-222------------------AM---LDLLDRHD---------A.-RATF--FLVGE.R...AARQ....-------------
Q9KDB2_BACHD/39-162------------------DI---LSILQEED---------I.-KATF--FLTGR.E...IEEH....-------------
Q9KA84_BACHD/124-248------------------TM---LKTMNKYD---------V.-KSTF--FLDGS.W...VKKH....-------------
Q9KVA7_VIBCH/402-543------------------LL---LPLLKKYQ---------F.-KAVV--YVVTGENFNRWDVEVSDN-------------
PDAB_BACSU/51-176------------------PI---LNTLKANG---------I.-KNAT--FFLSASW...AERH....-------------
NODB_RHILO/15-140------------------QI---LDVLAQNR---------V.-PATF--FVIGA.Y...AAEH....-------------
NODB_RHIME/15-140------------------EI---LDVLAEYG---------V.-PATF--FVIGT.Y...AKSQ....-------------
Q9EWZ7_STRCO/52-176------------------RF---LDTLDGLG---------V.-RATF--FVLGE.N...ALRH....-------------
Q9PDB0_XYLFA/55-223------------------YA---HPILQKYH---------M.-HAVV--FIVTS.W...IGDGPARP-------------
YXKH_BACSU/113-240------------------DA---YPVLKKYG---------M.-KATI--FMIGK.S...IGHKHH..-------------
Q97DU4_CLOAB/83-214------------------KI---LDILNANK---------I.-KATF--FILGK.N...AEMH....-------------
Q9JWQ7_BACHD/50-175------------------PI---IDVLQSKK---------V.-EEAT--FFISASW...AERH....-------------
Q9KYG2_STRCO/47-184------------------HA---LPCLRRHG---------C.-GATL--FVLPG.RLGGVNSWDPLG-------------
YADE_ECOLI/226-368------------------YA---YPVLKQYG---------M.-KATA--FIVTS.R...IKRHPQKW-------------
CDA1_YEAST/102-222------------------AT---EALLKKLR---------Q.-RTTF--FVLGI.N...TVNY....-------------
PDAC_BACSU/272-393------------------QI---LDSLKKYK---------G.-HATF--FVLGS.R...VQYY....-------------
Q97GQ0_CLOAB/126-253------------------NA---YPVLKEFG---------F.-KATV--FAITD.L...INTCPY..-------------
Q9CJ95_LACLA/136-266------------------EI---FPLLKKYN---------M.-HATN--FIITG.Y...VNKGQGG.-------------
Q97EU7_CLOAB/97-223------------------KI---LDVLKKHK---------A.-KAAF--FVVKP.Y...ITSS....-------------
Q99Z68_STRP1/235-356------------------QV---LDILAKYQ---------A.-KGTF--FMIGS.K...VVNN....-------------
NODB_RHISN/12-137------------------EV---LDVLAEHR---------V.-PATF--FVIGA.Y...AKDR....-------------
Q9RCX4_STRCO/8-132------------------KI---LDTLAKYE---------V.-RATF--FVCGE.M...ADYN....-------------
PGAB_ECOLI/101-271------------------RV---FPILQAFQ---------W.-PAVW--APVGS.W...VDTPADKQ-------------
CDA1_SCHPO/63-190------------------RI---LNLFKKHK---------V.-PFTC--WAIGQ.A...VEKN....-------------
Q99ZT1_STRP1/154-283------------------VA---YPILKKYD---------A.-KATN--NVITG.L...TEMGSAA.-------------
O86800_STRCO/103-225------------------AF---LRMMSELK---------I.-PYTV--FLTDEEI...KDDY....-------------
Q97GI4_CLOAB/50-174------------------KI---LDVLDKYN---------A.-KATF--FLIGR.W...VEDY....-------------
Q97M42_CLOAB/8-133------------------KL---VSIFNKYG---------I.-KGTF--HINSG.L...IGSYNR..-------------
Q9CIS3_LACLA/170-291------------------QL---LKIFSDAQ---------V.-PATF--FALGK.Q...AQAC....-------------
B3PIN1_CELJU/396-514------------------TL---VNLLRQNN---------LT-PVTW--FNQGN.N...VASN....-------------
D8Q165_SCHCM/200-314------------------KV---LKYLDENQ---------L.-HATF--FVVGS.R...VIER....-------------
E6UBP6_RUMA7/470-592------------------RI---IDTMADNG---------F.-HATF--FYIGS.Q...IKTE....-------------
F4GY46_CELFA/213-331------------------AL---LDFLAERD---------I.-RATF--CVIGQ.N...IQAPG...-------------
F4H710_CELFA/356-474------------------QI---LSTLTQYG---------A.-TATV--FPTGQ.N...AQGN....-------------
Q326Y8_SHIDS/46-204------------------QV---YPLLKEFN---------L.-KAHI--FLITG.F...IGNGPVRH-------------
Q7AQ13_MYCLE/46-161------------------RL---VQILKDND---------A.-KATF--FLIGN.K...VATN....-------------
Q81Z49_BACAN/63-186------------------KI---LDVLKEKK---------V.-PATF--FVTGH.Y...IKTQ....-------------
PGDA_STRR6/264-377------------------QV---LETLAKYD---------I.-KATF--FVLGK.N...VSGN....-------------
Q9RKN7_STRCO/46-161------------------SL---LNALRQNG---------L.-RATM--FNQGQ.N...AAQN....-------------
ICAB_STAA8/109-248------------------NA---YPILKKYK---------I.-PATG--FIITG.H...VGEENFHN-------------
S2JG56_MUCC1/153-273------------------AF---YDYLQEQK---------L.-KASM--FYIGS.N...VVDW....-------------

PF03065

AMY1_DICT6/8-294------------------PL---INFFFKHPD........F--PINV--HFSGF-LLLWLEKNHPEY.............
O66934_AQUAE/7-429------------------DM---PAYLKDF.E........I--KLNF--NLTPV-LIDQIQEYAQGKAKDVFLEAI..RK
Q8TZQ1_PYRFU/35-537------------------KM---AHYLTEFPD........I--HVTI--DLSGS-LIAQLADYMNGA.KDIYQIISEKIA
MALQ_THEKO/7-291------------------PF---METLEEYPN........M--KVAV--HYSGP-LLEWIRDNKPEH.............
Q9HLU6_THEAC/262-747------------------EQ---ALIAHMFPQ........I--NVTY--ELSGS-LLYQLVNISTDPYYNNTFIQYAFIP
Q8ZT36_PYRAE/22-486------------------KV---PLLINQSG.........V--SVAF--TLSGS-LIEQLNWYSNGTYTDARFRISEKIA
Q8U136_PYRFU/6-395------------------PL---LMEFEKLRNKGV....NF--KLVI--SFSPV-LLEQLNDEYMKKEFEKYITRKLELM
Q8YXA5_NOSS1/8-473------------------DL---ILILEKYPK........L--HQTV--NLVPS-LILQLEDYIAGTAFDPYLKAS..LT
Q55545_SYNY3/8-468------------------GL---IKLWARYPS........L--HQTV--SFTPC-LLAQLEDYAQGLAIDRHLALT..LS
Q97BM4_THEVO/7-311------------------PA---TRNLMEYG.........I--KSSF--SITGT-AVEQALMYNTKV.............
AMYA_PYRHO/7-291------------------PF---LETLEEYPN........M--KVAV--HISGV-LVEWLERNRPEY.............
O58106_PYRHO/3-316------------------PT---ISELIKRE.........I--PFGL--NITGY-SLQFLPQEL................
AMYA_METJA/6-319------------------PT---NELILELIDEYD.....F--KVNY--SITGV-FVEQALEFNDYV.............
Q9KD04_BACHD/7-382------------------PL---LWALEKLPVK.......H--AVTI--SFTPP-VMEMLSDPLVQTRYLNHLENTEQLL
Q8TIT8_METAC/38-312------------------RL---NDFFLESIEGG......G--SYAF--DLSGP-FLEQC.RWDPEL.............
O83182_TREPA/12-351------------------AF---FSGLCRHEQ........L--PLTV--HMTGS-FFQFIQKKNSPY.............
Q9HL91_THEAC/8-289------------------PA---TQSLMDYG.........I--RSSF--SLSGT-FMEQASKYCPKV.............
Q8ZT57_PYRAE/6-321------------------KA---TRIILDVAREVP....GL--RVTY--SVSGL-ALEQFRKWAPDV.............
Q8TIT9_METAC/7-321------------------PA---NRVLLDSIDEHKG...EF--RFSL--SITGT-LLEQCELWGEEV.............
O50094_PYRHO/6-394------------------PL---LMELEKLKERGV....RF--ELVI--SFTPV-LMEQLADEYIKREFEKYMERKLKSM
Q973T0_SULTO/7-324------------------PA---TRILLEEIENGESEGYDF--KFFF--SLSGT-FIEQAEKWGKDV.............
Q97ZD2_SULSO/7-324------------------PA---TNIILSSIERAEEEGNNV--KYFF--SISGT-FLEQAERWGREV.............

PF09960

R7BLQ4_9FIRM/15-595LTPIPNS...........YF---QAVSAKFG---------ID.VIED--YYPPV-YGVKFLKECVIGAE...........
R7D4R5_9FIRM/22-599LTLQKNT...........YV---SLIEQKLG---------II.SSGY--ENTEV-DSIYFDKEFLI..............
A1A0E3_BIFAA/3-581MTPEKTG...........YL---DAIGPQIG---------IE.SSAY--DYVMT-KGIKPARDFML..............
A6LLQ2_THEM4/8-739NNLGVSTNQR........EI---NNFLNKLG---------VHYMYGY--KVLKN-FEPLYEKEFFTATP...STLPQPVE
F7YUX2_9THEM/11-746NNLGVKTSFR........EV---NNLMNLLG---------VHYRGGF--KTLEN-STAQFEKEYFVRAP..YGTTSVPAE
Q9X1C9_THEMA/8-698NNLGAFEDSSGDN.PSLSDI---NTLLNLLG---------VSFRYGW--RQETV-FSYEIEDGYLIKLP..SFPVKKAFD
Q97L33_CLOAB/20-587ERPVMGD...........AL---SSISNEIG---------I..KTVS--DMGES-DGMTLLSNVLI..............
H2J5Y8_MARPK/9-749NNIGASADIS........EM---NNLLNKIG---------VQYKYGY--RELED-YTIECISDYFLKKP..DSEYKVPVE
C0ZK84_BREBN/11-593RTPEYND...........SL---YRIYRKLG---------I..NSIN--LPIVT-NGIQMTSNLLI..............
A7HKR3_FERNB/18-733NNIGATIDSSGSNHPGLAEI---NSIYNLIG---------ISYTFGW--KKTKP-SEISIDKYYLLNENPVYLTKDRDVE
A8AV35_STRGC/20-596VTLSKDS...........KL---TEIEQKLG---------VS.SSSF--ENAYV-KKIYIDKDFMI..............

PF01074

MA2A1_MOUSE/166-496------------------NM...VLKLKEDS------------SRKF..MWSEISYLAKWWDI-----------------
MA2A2_HUMAN/167-497------------------SM...VSKLQEDP------------RRRF..LWAEVSFFAKWWDN-----------------
MANA_DICDI/43-353------------------TA...ITCLLANP------------ERKF..IYVEIAFFQRWWDE-----------------
MA2B1_HUMAN/64-381------------------SV...ISALLADP------------TRRF..IYVEIAFFSRWWHQ-----------------
O01574_CAEEL/138-459------------------NM...HQFMMKNE------------KMRF..MWAEFVFFERWWSL-----------------
MA2B2_MOUSE/28-351------------------TV...VAELVRGG------------QRRF..IAVEQEFFRLWWDG-----------------
MA2C1_RAT/251-510------------------TA...VKLMERNT------------EFTF..ACSQAQQLEWVKNQ-----------------
MAN1_YEAST/290-559------------------SQ...CTLMDRFP------------EYKF..VASQAQQFKWLLED-----------------
P94078_ARATH/39-350------------------SV...IASLLDDE------------NRKF..IYVEMAFFQRWWRQ-----------------
Q20829_CAEEL/37-351------------------TV...IDELLKNP------------DRRF..SFAETGFLWRWYTS-----------------
MAN2_DROME/145-471------------------NA...LRHLHDNP------------EMKF..IWAEISYFARFYHD-----------------
MA2B2_PIG/28-342------------------SV...VEALTRGK------------RRRF..IAVEQEYFRLWWDG-----------------
Q55528_SYNY3/232-495------------------SV...INLQTEFA------------DLVF..GHTSPVLYQWIEEH-----------------
Q7NPH5_GLOVI/217-477------------------SA...LGLMEDHP------------RLDF..AQSTAQSYQWLERE-----------------
Q7PMM6_ANOGA/166-493------------------NM...LRHLDENA------------GMRF..IWAEISYFAQWYDK-----------------
Q7S1L0_NEUCR/285-549------------------NQ...CDLMDRYP------------ELNF..ACSQAQQYKWCKTL-----------------
Q7U9I9_SYNPX/234-492------------------SA...LALMKRWP------------DLRF..AHSTPALYAWMEHH-----------------
Q7V4V0_PROMM/221-479------------------SV...LHLMQRFP------------DFHF..SHSSPALYQWVEHH-----------------
Q826B6_STRAW/254-513------------------NM...TALIEDEP------------DFVF..AMSQAQQWAWVKEH-----------------
Q82MA7_STRAW/254-513------------------NV...TSLADEYD------------DFIF..ACSQAQQYEWVRDN-----------------
Q8A5X3_BACTN/297-572------------------EQ...TKDYTNDA------------KFRW..TCESAWAVDEYLKN-----------------
Q8DM33_THEEB/217-475------------------SV...LGLKKRYP------------ELTF..THSTPALYAHLQTH-----------------
Q8G4P9_BIFLO/264-528------------------NA...LALMDIDP------------DFTY..VMSAAQHFAWLEER-----------------
Q8G4Q0_BIFLO/268-532------------------NV...LALMDEDP------------DFTY..AMSSAQQYAWLEEE-----------------
Q8G4Q1_BIFLO/267-531------------------NA...LALMDADP------------DFKY..AMSSAQQYAWLEED-----------------
Q8IPB7_DROME/48-364------------------SV...VEALLRDP------------EKRF..IYVESAFFFKWWKE-----------------
Q8LPJ3_ARATH/38-350------------------SI...VPALLADK------------NRKF..IYVEQAFFQRWWNE-----------------
Q8XIN5_CLOPE/235-510------------------TV...LKLMEEYP------------EYIF..MSSQPQLYKFLKED-----------------
Q8XM34_CLOPE/260-519------------------TV...LANMEKYS------------EYVF..GASQPQLYQWMKEY-----------------
Q8Y5P1_LISMO/243-513------------------TV...LHLMEDYP------------EYLF..LQSQPQLYAYIKED-----------------
Q8Y9W8_LISMO/5-267------------------EV...IETLEAKE------------DYHFYLMDAQSSLIEDYLRY-----------------
Q8YYK0_NOSS1/230-491------------------SV...LKLQQDFP------------ELIF..CHSTPALYAWIEEH-----------------
Q97UK5_SULSO/220-473------------------TI...LTLLDKY.------------DFHF..IQSAAIYYEWVKAD-----------------
Q9FKW9_ARATH/48-359------------------SV...VDSLLRDP------------NRKF..VFAEMAFFTRWWEE-----------------
Q9KEQ8_BACHD/237-511------------------TV...LRLMDLYP------------DYVY..LQSQPQLYQWMKEE-----------------
GMAN2_ARATH/154-493------------------TI...VETLSKDS------------RRKF..IWEEMSYLERWWRD-----------------
MAN1_SCHPO/282-549------------------TQ...MNIMDRYP------------EYQF..VCSQALQYLWLKED-----------------
Q9VLI0_DROME/38-352------------------TV...ISELIKNP------------DRRF..IQVETSFFSKWWNE-----------------
Q9X2G6_THEMA/247-507------------------NS...VLLSKLYP------------EFVY..TQSSAQMYEDLKQN-----------------
B2HSI3_MYCMM/98-400------------------LVHAHLEMARRDP------------DYKF..VLAEVDYLKPYWDT-----------------
C8VJ45_EMENI/284-549------------------NQ...CDLMDRYP------------EHRF..TCSQAQQFKWLKQY-----------------
H9JRV7_BOMMO/33-353------------------NI...VQKLHQYP------------NMTF..IWTEISFLNSWWER-----------------
Q9VF33_DROME/169-499------------------LL...VTKMQEYT------------DMTF..IWSEISFLQLWWDQ-----------------
Q9VLH9_DROME/39-352------------------TV...IAELIKDP------------ARRF..IQVETSFFAKWWAE-----------------
Q9VLI2_DROME/38-351------------------TV...VAELSKDS------------RRRF..IQVETGFFAKWWED-----------------

PF15421

Q8A8I5_BACTN/62-500------------------SANQSLGCTDGAG---------NEVRFAITTTLAPEEKWMDAETN-----------------
Q5LDR1_BACFN/50-470------------------YLGKTLGCTDGTG---------KEVRFSFTATLAADDNYMAEESI-----------------
D4IMW2_9BACT/39-464------------------SFGKALGSTDGTG---------REVRFSFTTAISPEWGYMDDKAV-----------------
R5UTM0_9PORP/51-471------------------TLGKTLGSTDGAG---------NEVRFNFTTTLAPEWDFMNAKTV-----------------
R6DLU9_9BACE/67-497------------------YLGKTLGSTDGTG---------REVRFSFATTVAAEWEFMNAHSN-----------------

PF03746

D7BG02_MEISD/3-241------------------EL---FKYVTSAN------------LACG--FHAGD--------------------------
W5XZK8_9CORY/7-245------------------EV---LRLVSSAN------------VACG--FHAGD--------------------------
D5QFG9_KOMHA/3-241------------------GL---MDTVSSAN------------IACG--FHAGD--------------------------
Q6LSN4_PHOPR/2-250------------------RV---MPFIDMAN------------IACG--FHASD--------------------------
I0JJ59_HALH3/4-242------------------EI---LKYVTSAN------------IACG--FHAGD--------------------------
F4C1I4_SPHS2/4-242------------------ML---FDYISSAN------------IACG--FHAGD--------------------------
Q2RU90_RHORT/5-243------------------AM---LDIVRSAN------------IACG--FHAGD--------------------------
D5MN08_9BACT/6-243------------------AL---MPSLTSAS------------IACG--WHGGD--------------------------
R5XP92_9FIRM/4-242------------------KV---IPLITSAN------------VACG--YHASD--------------------------
L7WC11_NONDD/4-237------------------ML---MSHISSCN------------IACG--GHYGD--------------------------
D6Y0B4_BACIE/3-241------------------GL---MDVITSAN------------IACG--FHAGD--------------------------
D5BG15_ZUNPS/4-236------------------LL---MPLISSCN------------IACG--GHAGD--------------------------
M3DE22_SPHMS/8-244------------------EL---IPLIDHAN------------IACG--FHAGD--------------------------
D5EDK5_AMICL/4-242------------------DV---MKSITSAN------------IACG--FHAGD--------------------------
G8S4N9_ACTS5/10-248------------------AL---LDVVTSAN------------VACG--FHAGD--------------------------
F5XPT6_MICPN/6-244------------------AL---LELVTSAN------------VACG--FHAGD--------------------------
Y1143_NATTJ/4-242------------------EV---INYISSAN------------IACG--FHAGD--------------------------
F5XTC9_MICPN/4-241------------------AV---LELLTSAN------------VACG--FHAGD--------------------------
R5E047_9CLOT/3-241------------------EV---IPYVSSVN------------VACG--YHAGD--------------------------
E3H7Y1_ILYPC/4-242------------------EI---LKYVSSAN------------IACG--WHGGD--------------------------
D0IYS7_COMT2/4-242------------------AM---LDIVSSAN------------VACG--FHAGD--------------------------
Y1384_PEPD6/4-242------------------EV---LKYISSAN------------IACG--FHAGD--------------------------
Q4FSQ9_PSYA2/3-236------------------KL---LTIVSSAN------------VCCG--LHAGS--------------------------
L0DCE0_SINAD/9-227------------------VI---LDFVTSAS------------VCCG--AHAAD--------------------------
E6SM88_THEM7/5-243------------------ET---LPLVSSAN------------IACG--FHGGD--------------------------
Y2112_KOCRD/4-242------------------AV---FRSVSSAN------------VACG--FHAGD--------------------------
A5DMJ6_PICGU/30-269------------------EL---MPLIDTAN------------IACG--GHAGD--------------------------
A2U3P8_9FLAO/3-236------------------LI---MPYISSCN------------IACG--GHFGD--------------------------
B1ZX56_OPITP/4-232------------------EL---MPLISSAN------------IACG--AHAGD--------------------------
Y2917_PSESM/3-241------------------AL---MQLISSAN------------VACG--FHAGD--------------------------
U4KC78_9VIBR/2-236------------------AL---MPYITEAN------------VACG--FHASD--------------------------
F5YAB0_TREAZ/4-242------------------KI---IPLVSSAN------------IACG--FHAGD--------------------------
G3B4G0_CANTC/32-271------------------DI---MPLIDRAN------------IACG--GHASD--------------------------
S5XZQ9_PARAH/1-238------------------AM---LKIVTSAN------------IACG--FHAGD--------------------------
C5CZ15_VARPS/3-236------------------AL---LGLVSSAN------------IACG--WHAGD--------------------------
D1C8S7_SPHTD/5-240------------------EL---MTVITSAN------------IACG--WHAGD--------------------------
B4EWE9_PROMH/5-242------------------AV---LEIVSSAN------------IACG--FHAGS--------------------------
E8NF87_MICTS/3-240------------------AM---FAVISSAN------------VACG--GHAGD--------------------------
Q1IXD6_DEIGD/5-238------------------AI---MPHVTSAN------------IACG--GHAGD--------------------------
Y1821_BACHD/4-242------------------RV---LEHVTSAN------------IACG--YHAGD--------------------------
F6FQW1_ISOV2/4-241------------------AM---LALVSSAN------------VACG--FHAGD--------------------------
U5RSR8_9CLOT/3-239------------------AL---MPYVTSAN------------IATC--FHAGD--------------------------
Y1029_CHRSD/6-245------------------EV---MPYVDCAN------------IACG--FHASD--------------------------
Y2522_SYMTH/11-249------------------EI---MPLITSAN------------IACG--FHGGD--------------------------
G2PME2_MURRD/6-239------------------DI---FPYISSCN------------IACG--GHAGN--------------------------
M1MIN5_9CLOT/4-242------------------EI---ISYVSSAN------------IACG--FHAAD--------------------------
Y2314_ERWT9/3-235------------------AL---LRLVSSAN------------IACG--FHAGD--------------------------
Q0S878_RHOJR/47-285------------------AM---LKLVTSAN------------VACG--FHAGD--------------------------
U3TWJ9_9ENTR/3-236------------------AL---LELVSSAN------------IACG--FHVGD--------------------------
D3EM31_GEOS4/4-242------------------EL---LRSITSAN------------IACG--FHAGD--------------------------
Y535_KINRD/4-242------------------AM---LRIVTSAN------------VSCG--FHAGS--------------------------
A3UBZ2_CROAH/4-236------------------KL---MPLITSCS------------IACG--GHFGN--------------------------
H2IWK8_RAHAC/3-236------------------AL---LQLVSSAN------------IACG--FHAGD--------------------------
C6XL46_HIRBI/7-240------------------DI---MPYISSCN------------IACG--GHTGD--------------------------
G9MQN1_HYPVG/10-247------------------EL---MPFIDAAN------------IACG--FHAGD--------------------------
Y2112_PSEAE/4-245------------------EV---MPLIDCAN------------IACG--FHAGD--------------------------
Y4436_RALSO/3-241------------------AM---MSLISSAN------------IACG--FHAGD--------------------------
Y2790_CLOK5/4-243------------------EI---LKYITSAN------------IACG--FHAGD--------------------------
D7A9V4_STAND/3-236------------------GI---MPHIQIGN------------VACG--FHAAD--------------------------
M5A4V0_9ACTN/5-243------------------AM---LDLVSSAN------------VACG--GHAGD--------------------------
R5QKJ0_9FIRM/3-241------------------EV---IQYVSSVN------------VACG--FHASD--------------------------
W5TLR8_9NOCA/3-239------------------AL---LGIVTSAN------------IACG--FHAGD--------------------------
Y2520_ACIAD/3-241------------------QI---LPMVSSAN------------IACG--FHAGD--------------------------
D7A110_STAND/4-243------------------AM---LDIVTSAN------------IACG--FHAGD--------------------------
I0DPN0_PROSM/5-243------------------AM---LKIVSSAN------------IACG--FHAGS--------------------------
D2PYH8_KRIFD/4-242------------------AL---LDVVTSAN------------VACG--FHAGD--------------------------
B7VS04_VIBTL/1-234------------------SV---MEWVDMAN------------IACG--FHASD--------------------------
L0G1R1_ECHVK/3-236------------------DV---MAYITSCN------------IACG--GHAGD--------------------------
Y2655_BREBN/4-242------------------EI---LSYITSAN------------VACG--FHAGD--------------------------
Y1272_PYRFU/3-241------------------EV---MKYITSAN------------VACG--WHAGD--------------------------
F4H0L0_CELFA/5-255------------------AL---LDAVTSAN------------VACG--FHAGD--------------------------
A9WUH9_RENSM/280-518------------------AL---LAMVTSAN------------VACG--FHAGD--------------------------
D6Y403_THEBD/3-248------------------AL---LDVVSSAN------------VACG--FHAGD--------------------------
F4GUU2_PUSST/5-243------------------EI---LPYVTSAN------------IACG--YHAGD--------------------------
A5WHM5_PSYWF/13-246------------------AL---MNIISSAN------------VSCG--LHAGS--------------------------
I3Z849_BELBD/30-262------------------ML---MPYLGSCN------------IACG--GHFGD--------------------------
M4RSN8_9BIFI/4-242------------------AL---LGVVSSAN------------VACG--FHAGD--------------------------
M9R857_9RHOB/6-244------------------EI---MSLISSAN------------IAAG--FHAGD--------------------------
R7JBC4_9FUSO/13-246------------------EL---LDYASSVN------------ISCG--FHAGD--------------------------
C5D2N8_GEOSW/3-241------------------EI---LQYVTSVN------------VACG--FHAGD--------------------------
D5V4N2_ARCNC/3-244------------------EI---MPYINMAN------------LACG--FHAGD--------------------------
R5B6J0_9CLOT/6-244------------------DV---LSFVSSAN------------IACG--FHAGD--------------------------
D8J6F9_HALJB/4-240------------------AV---MPYITSAN------------VAGG--YHAGD--------------------------
Q2KTU9_BORA1/6-244------------------QI---MPLISSAN------------IATG--FHAGD--------------------------
C5D207_VARPS/3-241------------------AL---LDIVSSAN------------VACG--FHAGD--------------------------
F8Q293_SERL3/10-254------------------NL---MKTIHLAN------------IACG--FHAGD--------------------------
E9T1F8_RHOHA/4-242------------------AM---LDLVTSAN------------VAGG--FHAGD--------------------------
H8KYG9_FRAAD/4-242------------------SL---LPLLSSAN------------IACG--FHAGD--------------------------
Y1612_LACF3/4-240------------------QV---LDLITAAN------------VACG--FHAGD--------------------------
R7AUI2_9FIRM/4-242------------------QI---IPLISSAN------------IACG--FHASD--------------------------
L0A698_DEIPD/4-241------------------AV---MKFITSAN------------IACG--FHAGD--------------------------
F5Z8H6_ALTSS/2-241------------------DI---MKFIDQAN------------IACG--FHAGD--------------------------
E0TF98_PARBH/9-240------------------AL---IPLVSSVN------------IACG--GHAGT--------------------------
Y1004_CORGL/4-242------------------AV---LDLVSSAN------------IACG--FHAGD--------------------------
U4KHV1_9VIBR/2-235------------------DV---MPFIDMAN------------IACG--FHASD--------------------------
A4X134_SALTO/1-238------------------AL---LDLVTSAN------------VACG--FHAGD--------------------------
X5DN33_9CORY/5-237------------------HL---MEVIDLAN------------VACG--FHASD--------------------------
F0RQS5_DEIPM/3-243------------------AL---FPELTSVN------------LALG--FHAGD--------------------------
R5T180_9GAMM/13-246------------------EL---LDYVSSVN------------VSCG--FHAGD--------------------------
A9I0Z0_BORPD/28-266------------------AV---LEFVSSAN------------VACG--FHGGD--------------------------
A3Q8T1_SHELP/8-241------------------AL---LTLVTSAN------------IACG--GHAGD--------------------------
R6NVF4_9CLOT/4-237------------------QI---IPLITGAN------------IACG--FHAGG--------------------------
A5D328_PELTS/1-237------------------EV---MRYITSAN------------VACG--FHAGD--------------------------
F7QMW8_9BRAD/3-242------------------AM---LGLASSVN------------VACG--FHAGD--------------------------
I2BBK3_SHIBC/7-245------------------AI---LALVSSAN------------VACG--FHAGS--------------------------
D5V4P7_ARCNC/3-243------------------EI---MPYIDMAN------------LACG--FHASD--------------------------
B1HUZ0_LYSSC/2-236------------------EI---LDYVTSIN------------IACG--YHAGD--------------------------
C5C6S0_MICLC/7-245------------------AI---MPSVSSAN------------VACG--FHAGD--------------------------
X2GVX0_9BACI/3-237------------------EI---LDYVTSIN------------IACG--YHAGN--------------------------
A0QXR8_MYCS2/4-236------------------EM---MPLITSAN------------IACG--GHGGD--------------------------
Y2372_RALPJ/4-237------------------AL---LALVSSAN------------IACG--WHAGD--------------------------
E6TY73_BACCJ/5-243------------------EI---LQYITSAN------------IACG--YHAGD--------------------------
H2G083_OCESG/4-245------------------AV---MPYVDLAN------------VACG--FHAAD--------------------------
Q0RVU6_RHOJR/3-237------------------EL---LKHVTSVN------------TACG--FHGGD--------------------------
F4KPP8_HALH1/2-235------------------AL---MPLISSAN------------IACG--YHAGD--------------------------
E2PUA2_STRC2/26-264------------------EL---LSVVTSAN------------VACG--FHAGD--------------------------
G0G150_AMYMS/1-239------------------AM---LDIVTSAN------------VACG--FHAGD--------------------------
R4LWQ2_9ACTN/1-239------------------AM---LDIVSSAN------------IACG--FHAGD--------------------------
D2B933_STRRD/3-241------------------AL---LDIVTSAN------------IACG--FHAGD--------------------------
Y3392_SYNFM/3-241------------------KV---MPCITSAN------------VACG--WHAGD--------------------------
B6JF92_OLICO/5-244------------------AM---LDVATSVN------------VACG--FHAGD--------------------------
F8IB92_SULAT/6-243------------------SV---LPYITSAN------------VACG--FHAGD--------------------------
W1QAN8_OGAPD/24-260------------------EL---MPLIDVAN------------IACG--FHAGD--------------------------
E3Q2S8_COLGM/10-249------------------EL---MSYIDAAN------------IACG--FHAGD--------------------------
D3PTP5_MEIRD/3-241------------------EL---FPLLSSVN------------VACG--FHAGD--------------------------
E4TP81_MARTH/4-239------------------SV---FPYISSCN------------IACG--FHGGD--------------------------
A9AYX3_HERA2/3-236------------------EL---MSLLSSCN------------IACG--GHAGD--------------------------
F4CNG9_PSEUX/4-242------------------AM---LAIITSAN------------VACG--FHAGD--------------------------
Y1488_MACCJ/3-241------------------AI---IPLITSAN------------IACG--MHAGD--------------------------
J5JGM9_BEAB2/14-248------------------EL---MPLIDAAN------------IACG--FHAGD--------------------------
D1BTW0_XYLCX/4-242------------------AM---LDVVSSAN------------VAGG--FHAGD--------------------------
Y407_CORJK/10-248------------------AM---VAIVSSAN------------VACG--FHAGD--------------------------
V5XGL8_MYCNE/4-242------------------AM---LDIVTSAN------------VACG--FHAGD--------------------------
D5WUZ1_KYRT2/4-242------------------PL---LDVVSSAN------------IACG--FHAGD--------------------------
C5AT01_METEA/6-244------------------AL---LDIVTSAN------------VACG--FHAGD--------------------------
B0RI75_CLAMS/3-241------------------AM---LDVVSSAN------------VACG--FHAGD--------------------------
K4IM75_PSYTT/4-236------------------LL---MPFLSSCN------------IACG--GHYGT--------------------------
Y3770_BACSK/4-242------------------KI---MPYISSAN------------IACG--FHAGD--------------------------
G2NVC5_STRVO/7-244------------------AL---LTLVTSSN------------IACG--FHAGD--------------------------
Q5NI64_FRATT/3-227------------------RL---VDYIDIAN------------IACG--GHAGD--------------------------
C5BPU8_TERTT/2-239------------------QV---MPFLQMAN------------IACG--AHAGN--------------------------
Y2634_CROS8/4-237------------------LL---MPLISSAN------------IACG--FHAGD--------------------------
G0IXS0_CYCMS/5-233------------------AI---MPFLGSCN------------IAAG--GHAGN--------------------------
N1PZT0_DOTSN/8-245------------------DL---IPMIDHAN------------IACG--FHAGD--------------------------
Q0SB09_RHOJR/3-241------------------AL---LDIVTSAN------------IACG--FHAGD--------------------------
M1E8N0_9FIRM/3-239------------------EI---IGFVSSIN------------VACG--MHAGD--------------------------
C7NIG6_KYTSD/4-242------------------AL---LGVVTSAN------------VATG--FHAGD--------------------------
D9QUX4_ACEAZ/4-242------------------EI---VPHITSAN------------IACG--WHAGD--------------------------
G8RT09_MYCRN/15-253------------------AM---LDVVTSAN------------VACG--FHAGD--------------------------
R5C385_9FIRM/4-242------------------EI---IQYVTAAN------------VACG--WHAGD--------------------------
E1VFF3_9GAMM/4-235------------------RL---MPLIQRAN------------IACG--GHAGD--------------------------
E4RUB2_LEAB4/3-231------------------EL---MPYVDAVN------------ISCG--YHAGS--------------------------
D5DCK3_BACMD/4-242------------------EI---LRYVTSAN------------IACG--FHAGD--------------------------
D9RZ18_THEOJ/5-243------------------EI---VKYISSAN------------IACG--FHAGD--------------------------
E2SG17_9ACTN/9-231------------------AL---LDVVTSAN------------VCCG--AYAGD--------------------------
Y1541_CAMJE/4-242------------------EI---LKFVSSVN------------VACG--FHAGD--------------------------
D3Q482_STANL/5-243------------------AL---LDIVTSAN------------VACG--FHAGD--------------------------
D6ZAE9_SEGRD/6-231------------------AM---LEMVSSAN------------IACG--FHGGD--------------------------
C0ZM31_RHOE4/5-242------------------AL---LDTLTSAN------------IACG--FHAGD--------------------------
M3B8E6_PSEFD/8-245------------------EL---IPLIDHAN------------IACG--FHAGD--------------------------
G4R9N3_PELHB/5-238------------------AM---LEIVTSAS------------IACG--GHAGN--------------------------
Q0C0C1_HYPNA/5-242------------------AI---LDVVSRCS------------IACG--GHAGD--------------------------
X5EC88_9CORY/4-241------------------AM---IALVSSAN------------VATG--FHAGD--------------------------
W0HWN7_9ENTR/4-243------------------TL---MSLISSAN------------IACG--FHAGD--------------------------
Y4486_PECAS/3-241------------------AM---MRIVSSAN------------IACG--FHAGD--------------------------
D4MW94_9FIRM/4-242------------------KI---IPLITSAN------------VACG--YHASD--------------------------
F4HE29_GALAU/4-237------------------RL---LQLVTSAN------------VACG--LHAGD--------------------------
K0B3I8_CLOA9/8-246------------------EI---VKYITSAN------------IACG--WHAGD--------------------------
Y2450_CARHZ/4-240------------------AI---LPLVSSIN------------VACG--FHAGD--------------------------
D7CXP4_TRURR/5-245------------------AL---MPQLTSAN------------LACG--FHAGD--------------------------
Y1858_TOLAT/4-242------------------QI---MPLVSSAN------------IACG--FHAGD--------------------------
F8KSZ7_HELBC/4-242------------------AI---LECVSSAN------------VACG--WHAGD--------------------------
A1RBG9_ARTAT/5-242------------------EL---LEIVSSAN------------IACG--FHAGD--------------------------
D8IRE9_HERSS/3-236------------------QL---LTLVSSAN------------IACG--WHAGD--------------------------
A4CKX7_ROBBH/8-240------------------EL---FPHISSCN------------IACG--GHAGN--------------------------
K0L0G1_WICCF/20-257------------------EI---IKYIDRAN------------IACG--FHAGD--------------------------
H0Q289_9RHOO/5-243------------------AM---LEVVNSAN------------VACG--FHAGD--------------------------
V5UEX5_9BURK/3-235------------------AL---LALVSSAN------------VACG--WHAGD--------------------------
Q1GEX9_RUEST/5-243------------------EV---LDVVTSAN------------VACG--VHAGD--------------------------
G3JBY9_CORMM/25-269------------------AI---MPHINSCS------------IACG--FHAGD--------------------------
C0ZPT0_RHOE4/5-243------------------AM---LELVTSAN------------IACG--FHAGD--------------------------
Y2677_OCEIH/5-243------------------EV---MEFITSAN------------IACG--YHAGD--------------------------
B8ESL6_METSB/13-251------------------AM---LEIVSSAS------------VACG--FHAGD--------------------------
A0M393_GRAFK/5-237------------------QL---MPLISACN------------IACG--GHAGN--------------------------
Y3659_RUEPO/4-242------------------SL---LKIITSAN------------IACG--FHAGD--------------------------
W0PB55_9BURK/4-242------------------AI---MPYVTSAN------------IACG--FHAGD--------------------------
Y228_NEIMB/4-237------------------AL---LQLITSAN------------IACA--QHAGS--------------------------
M9LS18_PSEA3/10-256------------------EL---MKYIDVAN------------VACG--FHASD--------------------------
Y5076_MYCMM/4-242------------------AM---LGIVTSAN------------VACG--FHAGE--------------------------
E4TEH0_CALNY/3-241------------------EV---IKFVDRVN------------IACG--FHAGD--------------------------
Q03XI2_LEUMM/7-243------------------EI---LHQVTSAN------------VACG--FHAGD--------------------------
C7MY76_SACVD/5-243------------------AL---LDVVTSAN------------VACG--FHAGD--------------------------
Y870_RHOFT/3-241------------------AM---LGIVSSAN------------VACG--FHAGD--------------------------
D5WT32_KYRT2/3-240------------------EM---MKYISSAN------------VAGG--FHAGD--------------------------
G7V6Q9_THELD/4-242------------------AV---LESVSSAN------------VACG--FHAGD--------------------------
W0K188_9EURY/4-239------------------EV---MPYISSAN------------IAGG--YHGGD--------------------------
C8WJT5_EGGLE/4-242------------------QI---IPLVSSAN------------IACG--QHAGD--------------------------
F8A3C2_CELGA/1-238------------------AL---LHVVTSAN------------VACG--GHAGD--------------------------
D5USV9_TSUPD/5-243------------------AL---LGIVSSAN------------VACG--FHAGD--------------------------
C7MA67_BRAFD/8-245------------------AM---LEVVTTAN------------VACG--GHAGD--------------------------
R6ZG54_9CLOT/4-242------------------EI---LKYVSSAN------------VACG--WHAGD--------------------------
E3I0X6_RHOVT/3-241------------------EL---VGIITSAN------------VACG--FHGGD--------------------------
R6WIY8_9FIRM/4-242------------------EI---IPYISSAN------------TACG--FHASD--------------------------
Y3193_STRGG/2-240------------------AL---LACVTSAN------------VACG--FHAGD--------------------------
J9Z0K8_9PROT/6-239------------------PL---ITQINSAN------------IGCL--YHGGV--------------------------
L0A0G9_DEIPD/6-244------------------EL---FPFLSSVN------------LACG--FHAGD--------------------------
D2SFX6_GEOOG/1-239------------------AL---LDVVTSAN------------VACG--FHAGD--------------------------
F2IVP4_POLGS/3-236------------------GI---MPFIHIAN------------VACG--FHASD--------------------------
Y5378_PSESM/4-242------------------AM---LDIVTSAN------------VACG--FHAGD--------------------------
R5D7F4_9FIRM/4-242------------------EV---IPFISSAN------------VACG--FHASD--------------------------
A1WRL8_VEREI/23-261------------------QI---MPLISSAN------------IATG--FHAGD--------------------------
Y492_PSEAE/4-242------------------AI---MPLISSAN------------IATG--FHAGD--------------------------
G4KUC6_OSCVS/4-242------------------EV---IRHVSSVN------------VACG--YHAGD--------------------------
B9K5U5_AGRVS/3-241------------------AL---MDVVSSAN------------IACG--FHAGD--------------------------
Y2936_PSESM/3-241------------------EL---MAFISSAN------------IATG--FHAGD--------------------------
E0SL44_DICD3/5-243------------------EI---MSYISSAN------------IAAG--FHAGD--------------------------
C5C2F0_BEUC1/8-228------------------AM---LDVVTSAS------------IACG--GHAGD--------------------------
E6WID8_PANSA/3-241------------------AL---MQVVSSAN------------IACG--FHAGD--------------------------
C5AIE4_BURGB/6-244------------------QI---MPLISSAN------------IATG--FHAGD--------------------------
Y126_CUPNH/3-236------------------AL---LALISSAN------------IACG--WHAGD--------------------------
Y1315_CHLAA/4-242------------------GI---LPFVSSAN------------VACG--GHAGD--------------------------
B9L4Q4_THERP/5-240------------------AL---MPYITSAN------------IACG--WHAGD--------------------------
Y4277_AGRFC/3-241------------------AM---MKIVSSAN------------IACG--FHGGD--------------------------
H6RAT6_NOCCG/3-241------------------AM---LDIVTSAN------------IACG--GHAGD--------------------------
A4YUI8_BRASO/5-244------------------AM---IELATSVN------------VACG--FHAGD--------------------------
C6WEW0_ACTMD/3-240------------------AL---LDVVTSAN------------VACG--FHAGD--------------------------
B8IQH8_METNO/3-241------------------AL---MPMIGSAN------------VACG--MHAGD--------------------------
U3GU40_9CORY/2-237------------------AM---LAVVDRAN------------VACG--FHAGD--------------------------
H6NIN3_9BACL/8-246------------------QL---VRVVTSAN------------IACG--FHAGD--------------------------
Q223B3_RHOFT/22-260------------------AI---MSQISSAN------------IATG--FHAGD--------------------------
Y4304_PHOLL/4-242------------------TM---LSIVTSAN------------VACG--FHAGD--------------------------
M1FEE9_9ALTE/2-242------------------QV---MPFIDQAN------------IACG--FHAGD--------------------------
Y3634_BRADU/3-241------------------AL---MSIVSSAN------------VACG--FHAGD--------------------------
C6CWI5_PAESJ/6-244------------------EL---LPFITSVN------------IACG--FHAGD--------------------------
B9JN39_AGRRK/3-241------------------AL---MDVVSSAN------------IACG--FHAGD--------------------------
Y1066_COREF/7-245------------------AV---LDLVSSAN------------IACG--FHAGD--------------------------
X4ZHZ1_9BACL/4-242------------------AL---LAAVTSAN------------IACG--FHAGD--------------------------
Y4198_BURPS/6-244------------------EI---MPLISSAN------------IATG--FHAGD--------------------------
Y3173_CHRVO/3-236------------------AL---LGLVSSAN------------IACG--WHAGD--------------------------
W0HX68_9ENTR/3-242------------------RM---LEIVSSAN------------IACG--FHAGD--------------------------
G7ZEN3_AZOL4/4-243------------------AM---LDIVTSAN------------IACG--FHAGD--------------------------
Y439_FUSNN/5-242------------------EI---MKCVTSVN------------CACG--WHAGD--------------------------
B1VIF3_CORU7/7-244------------------AM---ICVVSSAN------------TACG--FHAGD--------------------------
I1XMA4_METNJ/11-252------------------QV---MPLVDMAN------------IACG--FHASD--------------------------
C1DQ20_AZOVD/7-248------------------LA---MPLIDQAN------------LACG--FHAAD--------------------------
F4FA66_VERMA/1-238------------------AL---LELVTSAN------------VACG--FHAGD--------------------------
I4BYP2_ANAMD/4-242------------------AV---LDFVSSAN------------VACG--FHAGD--------------------------
E8QYT2_ISOPI/17-247------------------AI---LPEITSAN------------LGCA--RHAGT--------------------------
D7A1T1_STAND/3-241------------------EL---MPLIGSAN------------IACG--MHAGD--------------------------
A6VS70_MARMS/2-241------------------QI---MPFVDQAN------------IACG--FHASD--------------------------
D1BL87_VEIPT/5-243------------------EV---LNHVTSAN------------IACG--WHAGD--------------------------
V9XKP0_9NOCA/4-242------------------TM---LDIVTSAN------------VACG--FHAGD--------------------------
E1VTB5_ARTAR/4-242------------------AI---FTSVSSAN------------VACG--FHAGD--------------------------
D1B9J1_THEAS/5-243------------------SL---LGVVSSAN------------VACG--FHAGD--------------------------
Y1708_STAA8/3-241------------------QI---IPLITSAN------------VACG--FHAGD--------------------------
R6QJ24_9FIRM/4-236------------------QI---IPLINSAN------------IACG--FHAGN--------------------------
Q02CY7_SOLUE/3-225------------------AL---MQYITSAN------------VACG--GHAGD--------------------------
A1R1R8_ARTAT/1-239------------------SM---FRIVSSAN------------VACG--FHAGD--------------------------
M4R6T5_BIBTR/4-237------------------QL---LQLVSSAN------------VSCG--LHAGD--------------------------
W0JZF2_9EURY/4-240------------------GV---MPYITSAN------------IAGG--YHAGD--------------------------
Y2905_BURP8/3-236------------------AL---LDLVSSAN------------IACG--WHAGG--------------------------
D8PCF2_9BACT/7-245------------------RI---MAYVTSVN------------IACG--VHAGD--------------------------
Y4778_VIBVY/6-245------------------LV---MPWVDMAN------------IACG--FHASD--------------------------
R5BE93_9FIRM/4-242------------------AV---LTHVTSAN------------VACG--WHAGD--------------------------
A1T0G5_PSYIN/2-241------------------AV---IPWIDMAN------------IACG--FHASD--------------------------
W0IZ00_9BACT/3-248------------------AL---LERVTSAS------------IACG--GHAGD--------------------------
C3KLX3_RHISN/4-241------------------SM---LGIVTSAN------------IACG--FHAGD--------------------------
F2G9I8_ALTMD/2-244------------------AI---MAEIDQAN------------IACG--FHAGD--------------------------
J7KY74_NOCAA/3-241------------------TL---LSIVTSAN------------VACG--FHAGD--------------------------
F3ZDL6_9ACTN/6-244------------------AL---LPLVTSAN------------VACG--FHAGD--------------------------
G0HCZ7_CORVD/4-242------------------AM---IQLVTSAN------------VATG--FHAGD--------------------------
D5DEN3_BACMD/4-242------------------AI---LEHVTSVN------------IACG--FHAGD--------------------------
B6QNE9_PENMQ/10-244------------------EL---LPMIDHAN------------VACG--FHAGD--------------------------
W5XWZ0_9CORY/6-242------------------AM---LEMVSSAN------------VATG--FHAGD--------------------------
G7ZD33_AZOL4/6-244------------------AL---MDLISSAN------------VATG--FHAGD--------------------------
F2JVE0_MARM1/2-240------------------QI---MPYVDQAN------------IACG--FHASD--------------------------
W5WPA4_9CORY/7-245------------------AM---LGIISSAN------------VACG--FHAGD--------------------------
X2H6N5_9GAMM/7-245------------------AM---LQVVSSAN------------IACG--FHAGS--------------------------
D7WE68_9CORY/5-242------------------AM---LEMVSSAN------------VATG--FHAGD--------------------------
D8MPR3_ERWBE/3-236------------------DL---LQLVSSAN------------IACG--FHAGD--------------------------
E3EYK5_KETVY/5-244------------------AM---LGIVTSAN------------VACG--FHAGD--------------------------
A4F9Z7_SACEN/1-239------------------AL---LGIVTSAN------------VACG--YHAGD--------------------------
G7XL47_ASPKW/8-245------------------EL---IPLIDQAN------------VACG--FHAGD--------------------------
A8LPR1_DINSH/5-243------------------AL---LRTITSAN------------IACG--AHAGD--------------------------
C7JDH8_ACEP3/3-240------------------AL---MKVISSAN------------IACG--FHAGD--------------------------
N4VLC9_COLOR/6-246------------------EL---MKFIDVAN------------VACG--FHAGD--------------------------
G0L477_ZOBGA/6-239------------------DL---LPLISSCN------------VACG--GHAGN--------------------------
B1MGY8_MYCA9/4-228------------------AM---LDVVTSAN------------LACG--FHAGD--------------------------
Q483Q3_COLP3/2-240------------------EV---MPHIDQAN------------IACG--FHAGD--------------------------
R5KN94_9CLOT/4-237------------------II---IPHINSAN------------IACG--FHAGS--------------------------
R0K0K3_SETT2/8-244------------------EL---IPLIDHAN------------VACG--FHAGD--------------------------
D0L462_GORB4/8-241------------------AM---LTVVTSAN------------VACG--FHAGT--------------------------
Y441_STRCO/2-240------------------AL---LSVVTSAN------------VACG--FHAGD--------------------------
H5X6J3_9PSEU/1-239------------------AL---LDIVTSAN------------VACG--FHAGD--------------------------
Q2KUF2_BORA1/5-243------------------AV---LPLVSSAN------------IACG--FHGGD--------------------------
Y3066_BACCR/4-242------------------EI---LPFVSSIN------------VACG--FHAGD--------------------------
B9JHF9_AGRRK/4-243------------------AM---LGLITTAN------------IACG--FHAGD--------------------------
B0UCC0_METS4/4-242------------------AM---LAIVTSAN------------VACG--MHAGD--------------------------
Q0SBI7_RHOJR/9-246------------------AL---LDVLTSAN------------VACG--FHAGD--------------------------
A0JRP4_ARTS2/1-239------------------AM---FPLITSAS------------VACG--LHAGD--------------------------
F8KRQ1_HELBC/5-243------------------EI---MKLISSCN------------IAAG--FHASD--------------------------
D5UJL7_CELFN/4-244------------------AL---LDLVSSAN------------VAAG--YHGGD--------------------------
Y2700_YERPE/3-236------------------AL---LQLVSSAN------------IACG--FHAGD--------------------------
V4IFZ2_9ACTN/6-244------------------AL---LTVVTSAN------------VACG--FHAGD--------------------------
Y4074_AZOC5/4-242------------------AL---MDIVSSAN------------IACG--LHAGD--------------------------
Y2695_THET8/3-241------------------EI---FPLVSSAN------------LACG--FHGGS--------------------------
Q16DH1_ROSDO/4-242------------------TL---LKTVTSAN------------IACG--AHAGD--------------------------
K7TCZ9_GLUOY/7-242------------------AL---LNIVTSAN------------VACG--FHGGD--------------------------
D5EIJ1_CORAD/3-232------------------EL---LALVDAAN------------ICCG--VHAGS--------------------------
K0FF24_9NOCA/3-241------------------AM---LDIVTSAN------------IACG--FHAGD--------------------------
E8U5L2_DEIML/4-237------------------GV---MPYVTSAN------------IACG--GHAGD--------------------------
B4EQJ0_BURCJ/4-237------------------AL---MTYATSIN------------IACG--WHAGD--------------------------
Q2W2X4_MAGSA/5-238------------------AM---LGVVSSAN------------IACG--FHAGD--------------------------
F8DZP5_CORRG/4-242------------------AM---IKLITSAN------------VACG--FHAGD--------------------------
J9S8D4_9ACTN/8-241------------------AM---LGVVTSAN------------VACG--FHAGT--------------------------
B1M8C8_METRJ/3-241------------------EM---LTVATSAN------------IACG--FHAGD--------------------------
E8MYL0_ANATU/1-235------------------AL---LSIVTSAN------------IACG--LHAGD--------------------------
R5C931_9FIRM/3-241------------------EV---VSHITSAN------------VACG--FHASD--------------------------
H6C6W1_EXODN/8-246------------------EL---MQYIDTAN------------IACG--FHAGD--------------------------
F0Y460_AURAN/32-276------------------EL---MDIVTSAN------------VACG--GHAGD--------------------------
H0UJ33_9BACT/4-242------------------DV---LTFVSSAN------------VACG--FHGGD--------------------------
Y4511_PSEAE/8-249------------------HS---MPLVDQAN------------LACG--FHAGD--------------------------
E1VBZ3_HALED/5-245------------------EV---MPHVDLAN------------VACG--FHASD--------------------------
D4M7W6_9BACT/4-242------------------EV---IKFVTSAN------------VACG--FHAGD--------------------------
G2LEC2_CHLTF/4-242------------------AI---LPYVSSVN------------LACG--FHAGD--------------------------
C7RQK9_ACCPU/6-244------------------EL---LRVVGAAN------------IACG--FHAGD--------------------------
Y4877_VIBPA/8-246------------------SV---MPHVDMAN------------IACG--FHASD--------------------------
Y1531_COPPD/5-243------------------EL---LNLVTSAN------------IACG--FHAGD--------------------------
V2WV16_MONRO/9-250------------------SL---MKTIHLAN------------IACG--FHASD--------------------------
M7WMG6_RHOT1/6-247------------------GL---FPIVDIAN------------CACG--FHASD--------------------------
A3HS16_9BACT/7-235------------------DI---FPWIDAAS------------IACG--GHFGD--------------------------
Y043_AZOSB/4-242------------------AL---LQVVRSAN------------IACG--FHAGD--------------------------
F0M0F6_VIBFN/6-245------------------LV---MPYVDMAN------------IACG--FHASD--------------------------
Y2984_DEIRA/7-247------------------RL---FPLLTSVN------------LALG--FHAGD--------------------------
C7R8W9_KANKD/7-245------------------HL---MPYISSCN------------IACG--GHAGN--------------------------
Y1502_GEOKA/4-241------------------EI---LSYVTSVN------------IACG--FHAGD--------------------------
Y150_BORPE/5-243------------------AV---LQFVTSAN------------IACG--FHGGD--------------------------
Y2042_NITHX/3-242------------------AM---IDLATSVN------------IACG--FHAGD--------------------------
A0R539_MYCS2/5-243------------------AM---LGLVTSAN------------VACG--FHAGD--------------------------
Y2038_STACT/3-241------------------QI---IPLITSAN------------IACG--FHAGD--------------------------
K1VQ76_TRIAC/63-302------------------AL---FPLIDYAN------------IACG--MHAGD--------------------------
Y498_BACLD/4-242------------------EI---LEFVTSAN------------IACG--FHAGD--------------------------
G2J1V4_PSEUL/3-236------------------AI---LDCVSSAN------------IACG--WHAGD--------------------------
D8MWR7_ERWBE/4-242------------------TL---MPLITSAN------------VACG--FHAGD--------------------------
Q3ICU0_PSEHT/2-237------------------EV---MPHINMAN------------IACG--FHAGD--------------------------
Y3910_AGRFC/4-242------------------AM---LAIVSSAN------------IACG--FHAGD--------------------------
S8E0A5_FOMPI/4-241------------------AL---MKTIHLAN------------IACG--FHASD--------------------------
F6EKD4_AMYSD/4-242------------------AM---LPLVTSAN------------IACG--FHAGD--------------------------
Y3576_VIBCH/6-245------------------EV---MPWIDMAN------------IACG--FHASD--------------------------
D3UZ92_XENBS/5-243------------------KM---LGIVSSAN------------VACG--FHAGD--------------------------
C1CZR4_DEIDV/6-239------------------AI---MPFVTSAN------------IACG--GHAGD--------------------------
K7TD01_GLUOY/6-244------------------AI---LDVVSSAN------------VACG--FHGGD--------------------------
YBGL_SHIDS/3-236------------------EL---LTLVSSAN------------IACG--FHAGD--------------------------
H1YGF4_9SPHI/5-243------------------TL---MDYITSAN------------IACG--FHAGD--------------------------
Q5QXP9_IDILO/9-254------------------LI---MPHIDCAN------------VACG--FHASD--------------------------
Q47NG6_THEFY/3-241------------------AL---LSVVTSAN------------VACG--FHAGD--------------------------
U5LAF3_9BACI/4-242------------------EI---MAYITSAN------------IACG--FHAGD--------------------------
E1QDN4_DESB2/3-244------------------AM---LASVTSAN------------LACG--FHAGD--------------------------
X4ZYD6_9BACL/5-242------------------AL---LEVVSSAN------------IACG--FHAGD--------------------------
Y4577_PSEPK/13-254------------------EV---MPYIDCAN------------IACG--YHAGD--------------------------
B5ICJ8_ACIB4/3-241------------------EI---MNYITSAN------------IACG--WHGGD--------------------------
Q1DC03_MYXXD/8-229------------------QL---YALAHVAN------------IACG--GHAGD--------------------------
C7MLY6_CRYCD/7-245------------------EI---IPLVSSVN------------IACG--SHAGD--------------------------
W8X9N3_CASDE/1-239------------------AM---LDLVTSAN------------VACG--FHAGD--------------------------
Q5E525_VIBF1/3-242------------------AV---MPALDMAN------------IACG--MHASD--------------------------
A4ASE2_MARSH/6-239------------------SL---LPLISSCN------------IACG--GHTGN--------------------------
W5W979_9PSEU/4-242------------------AL---LDLVSSAN------------VACG--FHAGD--------------------------
R5MQI6_9FIRM/5-243------------------EV---AKYISSAN------------VACG--FHASD--------------------------
R7XYL9_9ACTN/8-246------------------AL---LDVVTSAN------------IACG--FHAGD--------------------------
C0QGD0_DESAH/1-241------------------AV---MPLITSAN------------IACG--FHGGD--------------------------
E5AMR8_BURRH/21-254------------------AL---LELVSSAN------------IACG--WHAGG--------------------------
B8LZW7_TALSN/11-246------------------DL---LPFIDHAN------------IACG--FHASD--------------------------
G2TJB6_BACCO/4-242------------------EI---LDLITSAN------------IACG--FHAGD--------------------------
R5H7E1_9SPIR/13-244------------------AL---LDYASSVN------------ISCG--FHAGD--------------------------
Q3SF52_THIDA/2-233------------------AL---MPYIARAS------------IACG--GHFGD--------------------------
Q4FMV7_PELUB/11-249------------------EL---LNIVNSAN------------IACG--YHAGD--------------------------
B9JN49_AGRRK/11-248------------------HL---IPLISSAN------------IATG--FHAGD--------------------------
Y1729_HAEIN/4-237------------------SL---LQLLSSAN------------VACG--LHAGG--------------------------
I7F001_PHAIB/5-243------------------AL---LDVVSSAN------------IACG--FHAGD--------------------------
K5WPA6_AGABU/8-248------------------EL---MKTIHLAN------------VACG--FHASD--------------------------
F2F1B3_SOLSS/4-242------------------EI---LKYVTSAN------------IACG--FHGGD--------------------------
Y486_MYCPA/4-242------------------AM---LGIVSSAN------------VACG--FHAGD--------------------------
D5ATU4_RHOCB/3-236------------------AL---LDVVTSAN------------ICCG--LHAGG--------------------------
A4XXR4_PSEMY/4-245------------------EV---MPFIDCAN------------IACG--FHASE--------------------------
B1LSM8_METRJ/4-242------------------AI---LGIVTSAN------------VACG--LHAGD--------------------------
E6X9V0_CELAD/3-235------------------EL---LPLISSCN------------IACG--GHAGD--------------------------
L0EBQ1_THECK/9-247------------------EL---IPLLSSAN------------IACG--FHAGD--------------------------
Q28NJ3_JANSC/23-261------------------TM---LGIVTSAN------------IACG--GHASD--------------------------
Q21NC0_SACD2/2-238------------------AI---MPLIHQAN------------IACG--GHTGN--------------------------
G8AQ87_AZOBR/366-604------------------SM---LGIVASAN------------IACG--FHAGD--------------------------
A1S1H7_SHEAM/4-236------------------DI---IALVDAAN------------IACG--GHAGD--------------------------
R5XTA1_9FIRM/4-237------------------DI---IPLITSAN------------IACG--FHAGD--------------------------
F8I999_SULAT/1-233------------------QL---MPYISSAN------------VACG--FHGGD--------------------------
G0AE74_COLFT/9-243------------------AL---LALVSSAN------------IACG--WHAGS--------------------------
W0LH49_9ENTR/3-236------------------AL---LQLVSSAN------------IACG--FHAGD--------------------------
Q2J8R2_FRASC/53-290------------------AL---LDLVTSAN------------IACG--FHAGD--------------------------
R7JWG6_9CLOT/4-242------------------QV---LPWITSAN------------IACG--FHASD--------------------------
H6RUE6_BLASD/9-247------------------AL---LEVVTSAN------------VACG--FHAGD--------------------------
B8IGM4_METNO/4-242------------------AL---LDLVSSAN------------IACG--FHAGD--------------------------
Y333_MYCLE/4-242------------------AM---LRIVTSAN------------VACG--FHAGD--------------------------
A9BP88_DELAS/14-252------------------EL---MPLISSAN------------IATG--FHAGD--------------------------
E4U7W9_OCEP5/4-242------------------AL---FPLLSSVN------------LATG--FHAGD--------------------------
Y093_ARTS2/4-242------------------AM---FQSVSSAN------------VACG--FHAGD--------------------------
J7QRE0_METSZ/8-246------------------AM---LDIVTSAN------------VACG--FHAGD--------------------------
C8WUH6_ALIAD/4-242------------------EI---LAYVTSAN------------LACG--MHAGD--------------------------
Y1168_STAEQ/5-243------------------HI---LPLITSAN------------IACG--YHAGD--------------------------
A1WEV7_VEREI/4-242------------------AV---LDHVSSAN------------VACG--MHAGD--------------------------
C4ZLA9_THASP/5-243------------------AL---LQVVRSAN------------IACG--FHAGD--------------------------
D7BRG6_STRBB/6-245------------------AL---LSVVTSAN------------VACG--YHAGD--------------------------
F4AY60_DOKS4/4-236------------------QL---IPYLSSCN------------IACG--GHAGD--------------------------
A9H2F5_GLUDA/7-245------------------AM---LDVVTSAN------------VACG--FHGGD--------------------------
D3FTL6_BACPE/4-242------------------FI---LDHISSAN------------VACG--YHAGD--------------------------
Y282_PROAC/4-246------------------SL---LGIVTSAN------------VACG--FHAGD--------------------------
E0SEY7_DICD3/3-236------------------AL---LQLISSAN------------IACG--FHAGD--------------------------
M1MW29_9CORY/4-241------------------AM---VRLISSAN------------VACG--FHAGD--------------------------
D5BMH2_PUNMI/3-237------------------AL---MPFITEAN------------VACG--FHASD--------------------------
R7MJT0_9CLOT/13-245------------------RL---LDYVSSVN------------ISCG--FHAGD--------------------------
A0LSF5_ACIC1/16-254------------------EL---LALVTSAS------------VACG--FHGGD--------------------------
Y379_BACP2/4-242------------------QI---LEYVTSAN------------IACG--FHAGD--------------------------
B6HFB9_PENCW/10-245------------------DL---LPFIDHAN------------VACG--FHASD--------------------------
H5WZE4_9PSEU/3-241------------------AL---LNVVTSAN------------VACG--FHAGD--------------------------
I0GX05_ACTM4/4-242------------------AL---LSVVTSAN------------VACG--FHAGD--------------------------
E1SWB7_FERBD/3-239------------------EL---MRLISSAN------------IACG--AHAGN--------------------------
C0ZBV3_BREBN/4-239------------------GI---MKWITSVN------------IACG--LHAGD--------------------------
E6SBM1_INTC7/6-244------------------AM---LEIVTSAN------------VACG--FHAGD--------------------------
A7IFF2_XANP2/3-241------------------AL---LDIVSSAN------------LACG--LHAGD--------------------------
F8K454_STREN/34-272------------------AL---LSVVTSAN------------VACG--YHGGD--------------------------
H6N0G5_GORPV/18-251------------------AM---LAIVTSAN------------VACG--FHAGT--------------------------
S3BUE6_OPHP1/51-290------------------EL---MPLLDAAN------------IACG--FHAGD--------------------------
D4M7F2_9BACT/5-243------------------DV---LTFVSSAN------------VACG--FHAGD--------------------------
G8T834_NIAKG/4-244------------------LL---LSYVSSIN------------LACG--YHAGD--------------------------
B5HGL3_STRPR/6-244------------------AL---LSLVTSAN------------VACG--FHAGD--------------------------
E4N888_KITSK/2-244------------------AL---LSVVTSAN------------VACG--FHAGD--------------------------
E8SIF4_STAPH/3-241------------------EV---LPLITSAN------------VACG--FHAGD--------------------------
B9K212_AGRVS/6-244------------------AL---MGLISSAN------------IATG--FHAGD--------------------------
K4RDP3_9ACTN/4-242------------------RL---LSVVTSAN------------VACG--FHAGD--------------------------
D4ZD86_SHEVD/10-243------------------AL---LQLITSAN------------IACG--GHSGD--------------------------
Y3513_ACIAC/3-241------------------AM---LGIVTSAN------------VACG--FHAGD--------------------------
Y2681_RHOPA/3-242------------------AM---MQIATSVN------------IACG--FHAGD--------------------------
I2EPH3_EMTOG/6-243------------------KL---MEAISSAN------------IACG--FHAGD--------------------------
K0KCJ9_SACES/2-239------------------AL---LDVVTSAN------------VACG--FHAGD--------------------------
F2NR58_MARHT/3-241------------------AL---FPLLTSVN------------LACG--FHAGD--------------------------
Y2977_ALKMQ/4-242------------------EV---VKYITSAN------------IACG--WHAGD--------------------------
Y5654_NOCFA/3-240------------------AM---LDLVTSAN------------IACG--FHAGD--------------------------
D3F024_CONWI/21-259------------------AI---MPFVSSAS------------IACG--FHAGD--------------------------
K7RR83_PROA4/1-239------------------AM---MAIVTSAN------------VACG--FHAGD--------------------------
G9WFM7_9LACT/4-240------------------QI---IKLVSSVN------------VACG--FHAGD--------------------------
B9L7F1_NAUPA/2-239------------------EI---MPLIDMAN------------IACG--FHAGD--------------------------
I4C5I2_DESTA/3-239------------------EF---MQYISAAN------------VACG--FHAGD--------------------------
E3CXI0_9BACT/4-242------------------AV---LRAVSSAN------------VACG--FHAGD--------------------------
Y1066_HELMI/3-241------------------EM---IAIASSVN------------IACG--FHGGD--------------------------
D2RMC2_ACIFV/3-241------------------KV---LPLVTSAN------------IACG--FHAGD--------------------------
Q1GM83_RUEST/5-243------------------QL---MELISSAN------------IAAG--FHAGD--------------------------
E0SJD9_DICD3/3-241------------------AL---MQVVSSAN------------IACG--FHAGD--------------------------
F7YS87_VIBA7/10-249------------------LV---MPWIDMAN------------IACG--FHASD--------------------------
Q6ANH3_DESPS/2-232------------------KI---MPHVDMAN------------IACG--MHASD--------------------------
E3F040_KETVY/2-233------------------AL---MRYVTSAN------------VACG--YHAGD--------------------------
B2ICA4_BEII9/9-247------------------AM---LDIVTSAN------------VACG--FHAGD--------------------------
A1AYU0_PARDP/5-242------------------TM---LGIVSSAN------------VACG--FHAGD--------------------------
F0RCU6_CELLC/6-239------------------QL---MPYISSCN------------IACV--GHAGT--------------------------
K4L056_SIMAS/4-242------------------QV---MPHIDQAN------------IACG--FHAGD--------------------------
C7QHB5_CATAD/2-244------------------AL---LELVTSAN------------VACG--FHAGD--------------------------
Y476_METCA/5-243------------------TL---LELVTSAN------------IACG--FHAGD--------------------------
G4QKJ0_GLANF/2-240------------------DI---MPYIDMAN------------VACG--GHAGD--------------------------
A1U0R3_MARHV/2-242------------------LV---MPLIDMAN------------VACG--FHAAD--------------------------
Q3IWM6_RHOS4/5-244------------------GM---LELVTSAN------------IACG--FHAGD--------------------------
U4KH28_9VIBR/6-245------------------EV---MPWVDMAN------------IACG--FHASD--------------------------
Q6D7H2_PECAS/3-236------------------AL---LKLVTSVN------------IACG--FHAGD--------------------------

PF10096

Q8XK74_CLOPE/180-429--------------------------------------------------------------------------------
U5MQH8_CLOSA/192-443--------------------------------------------------------------------------------
G7MC91_9CLOT/194-445--------------------------------------------------------------------------------
M1MSD1_9CLOT/193-445--------------------------------------------------------------------------------
B2TQG3_CLOBB/185-436--------------------------------------------------------------------------------
R6P5J4_9FIRM/162-419--------------------------------------------------------------------------------
A6LS62_CLOB8/199-444--------------------------------------------------------------------------------
M1MAA0_9CLOT/199-444--------------------------------------------------------------------------------
U5MNT4_CLOSA/199-442--------------------------------------------------------------------------------
M1MG87_9CLOT/199-442--------------------------------------------------------------------------------
G7M6B9_9CLOT/199-442--------------------------------------------------------------------------------
G7LYM9_9CLOT/199-443--------------------------------------------------------------------------------
D9SNK6_CLOC7/207-454--------------------------------------------------------------------------------
Q8XMN0_CLOPE/198-445--------------------------------------------------------------------------------
U5RNL9_9CLOT/160-417--------------------------------------------------------------------------------
A6LXX4_CLOB8/129-377--------------------------------------------------------------------------------
A5I018_CLOBH/188-437--------------------------------------------------------------------------------
W0EHC6_9FIRM/3-275--------------------------------------------------------------------------------
A5D0J0_PELTS/44-299--------------------------------------------------------------------------------
K4L6F7_9FIRM/42-301--------------------------------------------------------------------------------
I0GIR5_CALEA/37-285--------------------------------------------------------------------------------
R4SQ82_AMYOR/281-555--------------------------------------------------------------------------------
G8SCF8_ACTS5/260-527--------------------------------------------------------------------------------
U5WBT8_9ACTN/261-529--------------------------------------------------------------------------------
A8LFA1_FRASN/262-530--------------------------------------------------------------------------------
W5WDT8_9PSEU/293-566--------------------------------------------------------------------------------
E2Q861_STRC2/342-611--------------------------------------------------------------------------------
K4RBX1_9ACTN/345-613--------------------------------------------------------------------------------
A1WAM2_ACISJ/315-589--------------------------------------------------------------------------------
D0J002_COMT2/256-530--------------------------------------------------------------------------------
B2UJM5_RALPJ/282-558--------------------------------------------------------------------------------
A0A068NT91_9BACT/235-497--------------------------------------------------------------------------------
L0A522_DEIPD/259-504--------------------------------------------------------------------------------
M9X7T8_MEIRD/244-506--------------------------------------------------------------------------------
L0A502_DEIPD/323-574--------------------------------------------------------------------------------
Q1IXI2_DEIGD/311-556--------------------------------------------------------------------------------
Q1AST7_RUBXD/238-462--------------------------------------------------------------------------------
B0TC26_HELMI/295-528--------------------------------------------------------------------------------
R7P8S3_9BACT/4-202--------------------------------------------------------------------------------
E1RA10_SPISS/7-204--------------------------------------------------------------------------------
Q7MSW5_WOLSU/4-200--------------------------------------------------------------------------------
E3GN09_EUBLK/1-199--------------------------------------------------------------------------------
R5ZC39_9FIRM/3-201--------------------------------------------------------------------------------
F4LX97_TEPAE/1-199--------------------------------------------------------------------------------
D4K2A5_9FIRM/3-201--------------------------------------------------------------------------------
R7LEI3_9BACT/4-204--------------------------------------------------------------------------------
A5V9P4_SPHWW/4-201--------------------------------------------------------------------------------
H6LBB2_ACEWD/5-204--------------------------------------------------------------------------------
E0RX58_BUTPB/2-201--------------------------------------------------------------------------------
R5H8N9_9FIRM/2-200--------------------------------------------------------------------------------
R7R6S7_9FIRM/2-200--------------------------------------------------------------------------------
R5CHW3_9FIRM/2-201--------------------------------------------------------------------------------
R6C994_9CLOT/6-204--------------------------------------------------------------------------------
R6ZDL3_9FIRM/2-202--------------------------------------------------------------------------------
R5BT68_9FIRM/9-207--------------------------------------------------------------------------------
E4NN78_HALBP/100-323--------------------------------------------------------------------------------
H1XSW8_9BACT/27-257--------------------------------------------------------------------------------
B4U8C2_HYDS0/10-157--------------------------------------------------------------------------------
B2V9Y1_SULSY/4-150--------------------------------------------------------------------------------
D3SMT5_THEAH/3-151--------------------------------------------------------------------------------
F8AAV2_THEID/3-151--------------------------------------------------------------------------------
K0CAU1_ALCDB/12-196--------------------------------------------------------------------------------
Q88N47_PSEPK/1-183--------------------------------------------------------------------------------
Q9HW89_PSEAE/5-189--------------------------------------------------------------------------------
C1DDN4_AZOVD/5-189--------------------------------------------------------------------------------
K0ERT4_9NOCA/61-217--------------------------------------------------------------------------------
C7Q7J8_CATAD/6-161--------------------------------------------------------------------------------
D6Z9I9_SEGRD/14-177--------------------------------------------------------------------------------
C1A667_GEMAT/9-196--------------------------------------------------------------------------------
Q6LXR4_METMP/34-239--------------------------------------------------------------------------------
F6BD61_METIK/72-273--------------------------------------------------------------------------------
Y505_METJA/37-247--------------------------------------------------------------------------------
F6BE00_METIK/47-254--------------------------------------------------------------------------------
D7DSJ1_METV3/60-270--------------------------------------------------------------------------------
A6UV77_META3/44-251--------------------------------------------------------------------------------
Q5JH22_THEKO/56-259--------------------------------------------------------------------------------
Q897A5_CLOTE/246-480--------------------------------------------------------------------------------
A5I1D3_CLOBH/229-463--------------------------------------------------------------------------------
Q18AM8_PEPD6/233-467--------------------------------------------------------------------------------
F4LUH2_TEPAE/229-462--------------------------------------------------------------------------------
A8FA31_BACP2/214-479--------------------------------------------------------------------------------
Q65D17_BACLD/215-481--------------------------------------------------------------------------------
K0J5W3_AMPXN/221-485--------------------------------------------------------------------------------
Q81IW1_BACCR/212-474--------------------------------------------------------------------------------
C2WY28_BACCE/212-474--------------------------------------------------------------------------------
I4D437_DESAJ/233-460--------------------------------------------------------------------------------
M1E711_9FIRM/225-461--------------------------------------------------------------------------------

PF01522

NODB_AZOC5/9-134--------------------------------------------------------------------------------
Q9A5L9_CAUCR/35-168--------------------------------------------------------------------------------
O69838_STRCO/70-214--------------------------------------------------------------------------------
Q9XAP6_STRCO/96-224--------------------------------------------------------------------------------
CDA2_YEAST/112-232--------------------------------------------------------------------------------
Q98GK8_RHILO/808-946--------------------------------------------------------------------------------
ICAB_STAEQ/107-248--------------------------------------------------------------------------------
Q97ET9_CLOAB/86-214--------------------------------------------------------------------------------
YHEN_BACSU/79-203--------------------------------------------------------------------------------
Q9CHP6_LACLA/96-236--------------------------------------------------------------------------------
Q9RVF2_DEIRA/33-157--------------------------------------------------------------------------------
Q982X7_RHILO/88-291--------------------------------------------------------------------------------
Q97K82_CLOAB/62-192--------------------------------------------------------------------------------
O53444_MYCTU/41-164--------------------------------------------------------------------------------
PDAA_BACSU/60-185--------------------------------------------------------------------------------
Q985U0_RHILO/77-213--------------------------------------------------------------------------------
Q9WXW8_THEMA/27-151--------------------------------------------------------------------------------
P73597_SYNY3/44-199--------------------------------------------------------------------------------
Q9L1T3_STRCO/85-207--------------------------------------------------------------------------------
Q9A6E1_CAUCR/17-152--------------------------------------------------------------------------------
Q97TP4_CLOAB/83-210--------------------------------------------------------------------------------
Q97JC7_CLOAB/83-211--------------------------------------------------------------------------------
Q9X8Z4_STRCO/86-212--------------------------------------------------------------------------------
Q9KEF7_BACHD/63-188--------------------------------------------------------------------------------
Q9PF00_XYLFA/74-213--------------------------------------------------------------------------------
Q97LW8_CLOAB/106-234--------------------------------------------------------------------------------
Q9KEJ5_BACHD/75-214--------------------------------------------------------------------------------
Q9CCZ2_MYCLE/73-201--------------------------------------------------------------------------------
Q9KBK9_BACHD/74-199--------------------------------------------------------------------------------
Q9KSH6_VIBCH/26-172--------------------------------------------------------------------------------
Q9P9U2_XYLFA/249-384--------------------------------------------------------------------------------
Q9FBM6_STRCO/131-288--------------------------------------------------------------------------------
Q9RV08_DEIRA/33-148--------------------------------------------------------------------------------
Y4760_STRCO/62-184--------------------------------------------------------------------------------
Q983K0_RHILO/61-197--------------------------------------------------------------------------------
Q97MV1_CLOAB/82-216--------------------------------------------------------------------------------
Q9K630_BACHD/116-243--------------------------------------------------------------------------------
Q9R7V4_YERPE/101-271--------------------------------------------------------------------------------
Q9ZBN1_STRCO/59-183--------------------------------------------------------------------------------
Q9PAV0_XYLFA/97-222--------------------------------------------------------------------------------
Q9KDB2_BACHD/39-162--------------------------------------------------------------------------------
Q9KA84_BACHD/124-248--------------------------------------------------------------------------------
Q9KVA7_VIBCH/402-543--------------------------------------------------------------------------------
PDAB_BACSU/51-176--------------------------------------------------------------------------------
NODB_RHILO/15-140--------------------------------------------------------------------------------
NODB_RHIME/15-140--------------------------------------------------------------------------------
Q9EWZ7_STRCO/52-176--------------------------------------------------------------------------------
Q9PDB0_XYLFA/55-223--------------------------------------------------------------------------------
YXKH_BACSU/113-240--------------------------------------------------------------------------------
Q97DU4_CLOAB/83-214--------------------------------------------------------------------------------
Q9JWQ7_BACHD/50-175--------------------------------------------------------------------------------
Q9KYG2_STRCO/47-184--------------------------------------------------------------------------------
YADE_ECOLI/226-368--------------------------------------------------------------------------------
CDA1_YEAST/102-222--------------------------------------------------------------------------------
PDAC_BACSU/272-393--------------------------------------------------------------------------------
Q97GQ0_CLOAB/126-253--------------------------------------------------------------------------------
Q9CJ95_LACLA/136-266--------------------------------------------------------------------------------
Q97EU7_CLOAB/97-223--------------------------------------------------------------------------------
Q99Z68_STRP1/235-356--------------------------------------------------------------------------------
NODB_RHISN/12-137--------------------------------------------------------------------------------
Q9RCX4_STRCO/8-132--------------------------------------------------------------------------------
PGAB_ECOLI/101-271--------------------------------------------------------------------------------
CDA1_SCHPO/63-190--------------------------------------------------------------------------------
Q99ZT1_STRP1/154-283--------------------------------------------------------------------------------
O86800_STRCO/103-225--------------------------------------------------------------------------------
Q97GI4_CLOAB/50-174--------------------------------------------------------------------------------
Q97M42_CLOAB/8-133--------------------------------------------------------------------------------
Q9CIS3_LACLA/170-291--------------------------------------------------------------------------------
B3PIN1_CELJU/396-514--------------------------------------------------------------------------------
D8Q165_SCHCM/200-314--------------------------------------------------------------------------------
E6UBP6_RUMA7/470-592--------------------------------------------------------------------------------
F4GY46_CELFA/213-331--------------------------------------------------------------------------------
F4H710_CELFA/356-474--------------------------------------------------------------------------------
Q326Y8_SHIDS/46-204--------------------------------------------------------------------------------
Q7AQ13_MYCLE/46-161--------------------------------------------------------------------------------
Q81Z49_BACAN/63-186--------------------------------------------------------------------------------
PGDA_STRR6/264-377--------------------------------------------------------------------------------
Q9RKN7_STRCO/46-161--------------------------------------------------------------------------------
ICAB_STAA8/109-248--------------------------------------------------------------------------------
S2JG56_MUCC1/153-273--------------------------------------------------------------------------------

PF03065

AMY1_DICT6/8-294.......................................................................---------
O66934_AQUAE/7-429DPDDLEKEEVEKLIEFTKLNYE..............................KPIYRFERIRELM......---------
Q8TZQ1_PYRFU/35-537NGEPLTYDEKWFMLQAPGGFFDHTIPWNGEPVTDENGNPIRDFWDRYTELKDKMLAAKQKYANLP......---------
MALQ_THEKO/7-291.......................................................................---------
Q9HLU6_THEAC/262-747YSELNTTQNQSLLANITADYFS...............................IPSYVYKLDEPASNEYLE---------
Q8ZT36_PYRAE/22-486RGEPLTIEEKYAMLAVPGGFFD..........................INWQNILNKHPRYAVLLGVRNDA---------
Q8U136_PYRFU/6-395KEDLTKY.TNDQLKKAI......................................................---------
Q8YXA5_NOSS1/8-473PTEQLTQQQREFIIQH...FFD..........................ANHHTLIDPHPRYAEL.......---------
Q55545_SYNY3/8-468PVEKLSLEQKVEILTT...FFE..........................ANPRTQIFPQHRYQQL.......---------
Q97BM4_THEVO/7-311.......................................................................---------
AMYA_PYRHO/7-291.......................................................................---------
O58106_PYRHO/3-316.......................................................................---------
AMYA_METJA/6-319.......................................................................---------
Q9KD04_BACHD/7-382KKEEKRT.NDQRTQNLV......................................................---------
Q8TIT8_METAC/38-312.......................................................................---------
O83182_TREPA/12-351.......................................................................---------
Q9HL91_THEAC/8-289.......................................................................---------
Q8ZT57_PYRAE/6-321.......................................................................---------
Q8TIT9_METAC/7-321.......................................................................---------
O50094_PYRHO/6-394EEDLERF.KDEKLREAI......................................................---------
Q973T0_SULTO/7-324.......................................................................---------
Q97ZD2_SULSO/7-324.......................................................................---------

PF09960

R7BLQ4_9FIRM/15-595......................EDDIFWYDAGKLEGIV......SSLAVELK............SECEVYM.........
R7D4R5_9FIRM/22-599...............................GGGQAYTIMDPYDSAWEVELA............ETARVYA.........
A1A0E3_BIFAA/3-581...............................GGGHTYMFSGPFKSSLSLNLN............EKAAVEA.........
A6LLQ2_THEM4/8-739KYKIFEKDVNILLELKSNN.ETYPLIFISPKGGGALFNSFFDNNKEFILNIEKIFNIFLKKTVGSKNKILLVKDKYDTNY
F7YUX2_9THEM/11-746KYDIFGSDVKKILSYLDETGSEYPMIFLSKTGGGAVFNSFIDKDGRVILNVQKIIESFFETAVGNENKVLVVKSVFDPDE
Q9X1C9_THEMA/8-698GFEVFSSNVK.IVSYAVTKKGKHPVIFYGPFGGMALFDHAFNENGEPVVDLRKIVMDIVGGY..RENKVLM.........
Q97L33_CLOAB/20-587..............................KGNGVNVSKDIVSDYSLKVTLN............NNSKLLG.........
H2J5Y8_MARPK/9-749KYITFDNHMENILTYKIDN.EEYPMIFLTDNGGAAIFNSFVDKNGNLIININKLIHRFINHEVGTLNKFLIVNTKYDNQK
C0ZK84_BREBN/11-593..............................KGEDAKIGADAIVNSSIPVELN............RQAKVHA.........
A7HKR3_FERNB/18-733PYYSISPYTKPIVTVKTSDGNSFDMGFVGSIGAIISYNYLFDDNGKVSLDIGKILISLLYGDS.KVFKVLV.........
A8AV35_STRGC/20-596...............................GGGKSYAIDGAFHSAWAVTLS............SDAKVHA.........

PF01074

MA2A1_MOUSE/166-496--------------------------------------------------------------------------------
MA2A2_HUMAN/167-497--------------------------------------------------------------------------------
MANA_DICDI/43-353--------------------------------------------------------------------------------
MA2B1_HUMAN/64-381--------------------------------------------------------------------------------
O01574_CAEEL/138-459--------------------------------------------------------------------------------
MA2B2_MOUSE/28-351--------------------------------------------------------------------------------
MA2C1_RAT/251-510--------------------------------------------------------------------------------
MAN1_YEAST/290-559--------------------------------------------------------------------------------
P94078_ARATH/39-350--------------------------------------------------------------------------------
Q20829_CAEEL/37-351--------------------------------------------------------------------------------
MAN2_DROME/145-471--------------------------------------------------------------------------------
MA2B2_PIG/28-342--------------------------------------------------------------------------------
Q55528_SYNY3/232-495--------------------------------------------------------------------------------
Q7NPH5_GLOVI/217-477--------------------------------------------------------------------------------
Q7PMM6_ANOGA/166-493--------------------------------------------------------------------------------
Q7S1L0_NEUCR/285-549--------------------------------------------------------------------------------
Q7U9I9_SYNPX/234-492--------------------------------------------------------------------------------
Q7V4V0_PROMM/221-479--------------------------------------------------------------------------------
Q826B6_STRAW/254-513--------------------------------------------------------------------------------
Q82MA7_STRAW/254-513--------------------------------------------------------------------------------
Q8A5X3_BACTN/297-572--------------------------------------------------------------------------------
Q8DM33_THEEB/217-475--------------------------------------------------------------------------------
Q8G4P9_BIFLO/264-528--------------------------------------------------------------------------------
Q8G4Q0_BIFLO/268-532--------------------------------------------------------------------------------
Q8G4Q1_BIFLO/267-531--------------------------------------------------------------------------------
Q8IPB7_DROME/48-364--------------------------------------------------------------------------------
Q8LPJ3_ARATH/38-350--------------------------------------------------------------------------------
Q8XIN5_CLOPE/235-510--------------------------------------------------------------------------------
Q8XM34_CLOPE/260-519--------------------------------------------------------------------------------
Q8Y5P1_LISMO/243-513--------------------------------------------------------------------------------
Q8Y9W8_LISMO/5-267--------------------------------------------------------------------------------
Q8YYK0_NOSS1/230-491--------------------------------------------------------------------------------
Q97UK5_SULSO/220-473--------------------------------------------------------------------------------
Q9FKW9_ARATH/48-359--------------------------------------------------------------------------------
Q9KEQ8_BACHD/237-511--------------------------------------------------------------------------------
GMAN2_ARATH/154-493--------------------------------------------------------------------------------
MAN1_SCHPO/282-549--------------------------------------------------------------------------------
Q9VLI0_DROME/38-352--------------------------------------------------------------------------------
Q9X2G6_THEMA/247-507--------------------------------------------------------------------------------
B2HSI3_MYCMM/98-400