Sequence alignment for CL0165

PF17202

R5PDZ8_9CLOT/73-178--------------------------------------------------------------------------------
D9SR59_CLOC7/75-181--------------------------------------------------------------------------------
R5LDM7_9FIRM/84-188--------------------------------------------------------------------------------
A0A077LEG7_9PSED/107-217--------------------------------------------------------------------------------
R7K182_9CLOT/75-183--------------------------------------------------------------------------------
R7C785_9CLOT/80-187--------------------------------------------------------------------------------
D4GNY8_PANAM/110-221--------------------------------------------------------------------------------
R6ESX9_9FIRM/33-139--------------------------------------------------------------------------------
D9SR58_CLOC7/75-181--------------------------------------------------------------------------------
A1TTT5_ACIAC/43-151--------------------------------------------------------------------------------
C6C0L3_DESAD/124-227--------------------------------------------------------------------------------
Q2SCQ8_HAHCH/105-216--------------------------------------------------------------------------------
U5LHG9_9BACI/81-186--------------------------------------------------------------------------------
I4MQL7_9BURK/106-217--------------------------------------------------------------------------------
A5GDW0_GEOUR/197-301--------------------------------------------------------------------------------
M1E435_9FIRM/183-288--------------------------------------------------------------------------------
C3K447_PSEFS/107-217--------------------------------------------------------------------------------
A5G6W5_GEOUR/211-327--------------------------------------------------------------------------------
I0H0J9_ACTM4/128-247--------------------------------------------------------------------------------
D4H841_DENA2/120-233--------------------------------------------------------------------------------
R5SF85_9CLOT/154-260--------------------------------------------------------------------------------
Q8XUQ0_RALSO/115-227--------------------------------------------------------------------------------
C7RJ95_ACCPU/102-216--------------------------------------------------------------------------------
G4RG36_PELHB/93-201--------------------------------------------------------------------------------
R7H980_9FIRM/84-190--------------------------------------------------------------------------------
B1KL49_SHEWM/217-338--------------------------------------------------------------------------------
C7LSE2_DESBD/126-226--------------------------------------------------------------------------------
Q0K178_CUPNH/214-328--------------------------------------------------------------------------------
R7BD52_9FIRM/83-182--------------------------------------------------------------------------------
R6KC51_9FIRM/187-293--------------------------------------------------------------------------------
A9DH49_9RHIZ/90-198--------------------------------------------------------------------------------
U5N9Z9_9BURK/111-222--------------------------------------------------------------------------------
G4KZG5_OSCVS/79-190--------------------------------------------------------------------------------
B2A0N4_NATTJ/81-187--------------------------------------------------------------------------------
D7DTL6_METV3/203-310--------------------------------------------------------------------------------
F3Z2D9_DESAF/126-237--------------------------------------------------------------------------------
W0IVA8_9BACT/105-215--------------------------------------------------------------------------------
B9JP39_AGRRK/218-334--------------------------------------------------------------------------------
D8J016_HERSS/116-227--------------------------------------------------------------------------------
C5AA15_BURGB/110-221--------------------------------------------------------------------------------
X2GSB3_9BACI/75-182--------------------------------------------------------------------------------
D7DT69_METV3/191-294--------------------------------------------------------------------------------
A4GAL6_HERAR/223-338--------------------------------------------------------------------------------
Q2FU40_METHJ/105-215--------------------------------------------------------------------------------
Q7M944_WOLSU/110-221--------------------------------------------------------------------------------
Q6D133_PECAS/110-221--------------------------------------------------------------------------------
Q0W406_METAR/195-302--------------------------------------------------------------------------------
M1N767_9CLOT/176-278--------------------------------------------------------------------------------
Q3A4X2_PELCD/126-243--------------------------------------------------------------------------------
C8X5F8_DESRD/131-248--------------------------------------------------------------------------------
D3RUE8_ALLVD/81-192--------------------------------------------------------------------------------
C6BZS5_DESAD/173-278--------------------------------------------------------------------------------
D5V2F9_ARCNC/106-215--------------------------------------------------------------------------------
B8FF41_DESAA/197-313--------------------------------------------------------------------------------
R7C7X6_9CLOT/79-185--------------------------------------------------------------------------------
A4W5S4_ENT38/109-220--------------------------------------------------------------------------------
F9TD33_9VIBR/108-219--------------------------------------------------------------------------------
A4VNM3_PSEU5/150-260--------------------------------------------------------------------------------
J7IZ74_DESMD/74-180--------------------------------------------------------------------------------
D5WTF7_KYRT2/150-257--------------------------------------------------------------------------------
R6CC53_9CLOT/83-190--------------------------------------------------------------------------------
I7EZR3_PHAIB/193-308--------------------------------------------------------------------------------
B5EED7_GEOBB/207-322--------------------------------------------------------------------------------
G8M385_CLOCD/77-182--------------------------------------------------------------------------------
R6LTR5_9CLOT/88-195--------------------------------------------------------------------------------
H1YZJ5_9EURY/105-216--------------------------------------------------------------------------------
B8FKI9_DESAA/130-248--------------------------------------------------------------------------------
B8I594_CLOCE/73-179--------------------------------------------------------------------------------
B3EAL1_GEOLS/77-181--------------------------------------------------------------------------------
M1WWC3_DESPC/126-238--------------------------------------------------------------------------------
Q8EC62_SHEON/106-217--------------------------------------------------------------------------------
I4D1S2_DESAJ/74-180--------------------------------------------------------------------------------
G1UPC0_9DELT/173-278--------------------------------------------------------------------------------
B9M7S8_GEODF/192-295--------------------------------------------------------------------------------
F2G5X9_ALTMD/102-211--------------------------------------------------------------------------------
B4EIX9_BURCJ/110-221--------------------------------------------------------------------------------
E1QD66_DESB2/210-326--------------------------------------------------------------------------------
A6TKU1_ALKMQ/78-189--------------------------------------------------------------------------------
A0A075WRZ3_9BACT/93-200--------------------------------------------------------------------------------
R5WDE4_9CLOT/85-192--------------------------------------------------------------------------------
K4LEA6_THEPS/75-179--------------------------------------------------------------------------------
R7IWW0_9FIRM/75-184--------------------------------------------------------------------------------
Q4K3U8_PSEF5/107-217--------------------------------------------------------------------------------
G8QPI6_AZOSU/105-210--------------------------------------------------------------------------------
G7Z711_AZOL4/82-189--------------------------------------------------------------------------------
R7N8R2_9FIRM/73-179--------------------------------------------------------------------------------
G8ASR9_AZOBR/219-334--------------------------------------------------------------------------------
R5EKY7_9CLOT/77-185--------------------------------------------------------------------------------
Q31M73_SYNE7/126-244--------------------------------------------------------------------------------
Q3A5N0_PELCD/126-244--------------------------------------------------------------------------------
A8EX26_ARCB4/102-212--------------------------------------------------------------------------------
R5JUW9_9CLOT/66-172--------------------------------------------------------------------------------
A0A068JJ25_9DELT/173-278--------------------------------------------------------------------------------
R6DFM0_9CLOT/76-184--------------------------------------------------------------------------------
C4Z687_EUBE2/126-233--------------------------------------------------------------------------------
R6EK08_9FIRM/92-198--------------------------------------------------------------------------------
Q8P8Q8_XANCP/84-195--------------------------------------------------------------------------------
E3DR17_HALPG/78-184--------------------------------------------------------------------------------
W0E6D6_MARPU/81-192--------------------------------------------------------------------------------
E1QEE0_DESB2/135-253--------------------------------------------------------------------------------
F6DQL7_DESRL/85-189--------------------------------------------------------------------------------
B5EET6_GEOBB/72-178--------------------------------------------------------------------------------
G8QHB1_AZOSU/108-213--------------------------------------------------------------------------------
C6WF37_ACTMD/137-256--------------------------------------------------------------------------------
C4XN19_DESMR/213-318--------------------------------------------------------------------------------
R5R3V5_9FIRM/219-325--------------------------------------------------------------------------------
J1ATF6_9EURY/105-215--------------------------------------------------------------------------------
B2VCW3_ERWT9/110-221--------------------------------------------------------------------------------
Q07W74_SHEFN/224-344--------------------------------------------------------------------------------
A9KHQ9_CLOPH/86-194--------------------------------------------------------------------------------
K4MGY8_9EURY/99-209--------------------------------------------------------------------------------
R6K7N5_9FIRM/73-182--------------------------------------------------------------------------------
Q8P9I9_XANCP/109-220--------------------------------------------------------------------------------
B6BNF9_SULGG/103-215--------------------------------------------------------------------------------
R5NMM9_9FIRM/113-219--------------------------------------------------------------------------------
I4EZV9_MODMB/131-249--------------------------------------------------------------------------------
A8H262_SHEPA/106-216--------------------------------------------------------------------------------
T2GE62_DESGI/173-279--------------------------------------------------------------------------------
Q6APL6_DESPS/127-230--------------------------------------------------------------------------------
I4DB95_DESAJ/75-180--------------------------------------------------------------------------------
G8AW72_AZOBR/78-185--------------------------------------------------------------------------------
R7A1X1_9FIRM/85-192--------------------------------------------------------------------------------
C6PVG9_9CLOT/79-184--------------------------------------------------------------------------------
A1B979_PARDP/201-316--------------------------------------------------------------------------------
J7J3G2_DESMD/75-179--------------------------------------------------------------------------------
C5CXU1_VARPS/109-222--------------------------------------------------------------------------------
Q6LZ41_METMP/177-282--------------------------------------------------------------------------------
R7BG86_9FIRM/73-182--------------------------------------------------------------------------------
G0AIH2_COLFT/110-220--------------------------------------------------------------------------------
E1QGT6_DESB2/126-231--------------------------------------------------------------------------------
E3PU45_CLOSD/79-190--------------------------------------------------------------------------------
I0GPD1_SELRL/73-177--------------------------------------------------------------------------------
D2SAB0_GEOOG/128-246--------------------------------------------------------------------------------
Q2LSJ8_SYNAS/74-180--------------------------------------------------------------------------------
Q6LZY6_METMP/187-291--------------------------------------------------------------------------------
R6EC74_9CLOT/228-334--------------------------------------------------------------------------------
D5X7V1_THEPJ/75-181--------------------------------------------------------------------------------
R5LBG0_9FIRM/215-322--------------------------------------------------------------------------------
D5VSC2_METIM/204-310--------------------------------------------------------------------------------
Q67R82_SYMTH/236-345--------------------------------------------------------------------------------
F5Z460_ALTSS/106-219--------------------------------------------------------------------------------
Q2KCB1_RHIEC/88-194--------------------------------------------------------------------------------
A6LV74_CLOB8/104-212--------------------------------------------------------------------------------
F7QPR2_9BRAD/96-204--------------------------------------------------------------------------------
R6C687_9CLOT/76-182--------------------------------------------------------------------------------
G8PV01_PSEUV/88-196--------------------------------------------------------------------------------
R4L9R8_9ACTN/129-248--------------------------------------------------------------------------------
A0A0A1AYZ4_9ENTR/110-221--------------------------------------------------------------------------------
G8AVA4_AZOBR/79-185--------------------------------------------------------------------------------
R4KEL1_9FIRM/74-179--------------------------------------------------------------------------------
B8IZC5_DESDA/173-278--------------------------------------------------------------------------------
V9VW82_9RHOB/200-316--------------------------------------------------------------------------------
Q74F34_GEOSL/212-328--------------------------------------------------------------------------------
R5SFX5_9CLOT/88-196--------------------------------------------------------------------------------
Q87PJ9_VIBPA/202-320--------------------------------------------------------------------------------
F4LKK3_TREBD/186-288--------------------------------------------------------------------------------
C6XN72_HIRBI/90-198--------------------------------------------------------------------------------
A0A0C7P014_9BACT/77-188--------------------------------------------------------------------------------
A0A085L981_9FIRM/78-183--------------------------------------------------------------------------------
E6VZ02_DESAO/125-228--------------------------------------------------------------------------------
R7JZV9_9CLOT/71-183--------------------------------------------------------------------------------
B8HSN5_CYAP4/156-274--------------------------------------------------------------------------------
Q0A7Z6_ALKEH/211-327--------------------------------------------------------------------------------
R5QN54_9FIRM/79-185--------------------------------------------------------------------------------
M4U2E5_9GAMM/102-215--------------------------------------------------------------------------------
A1AN42_PELPD/73-179--------------------------------------------------------------------------------
U5N966_9BURK/105-212--------------------------------------------------------------------------------
Q3A1Q1_PELCD/126-245--------------------------------------------------------------------------------
W6RU28_9CLOT/73-179--------------------------------------------------------------------------------
I0HW90_RUBGI/100-211--------------------------------------------------------------------------------
D1BHQ7_SANKS/162-281--------------------------------------------------------------------------------
B8IZC2_DESDA/174-279--------------------------------------------------------------------------------
Q74H85_GEOSL/198-301--------------------------------------------------------------------------------
B1LVR8_METRJ/92-200--------------------------------------------------------------------------------
A3DJX9_CLOTH/307-413--------------------------------------------------------------------------------
A0A075LSR8_9BACI/79-184--------------------------------------------------------------------------------
G7WD19_DESOD/74-176--------------------------------------------------------------------------------
U5RZZ9_9CLOT/76-181--------------------------------------------------------------------------------
J7IWN7_DESMD/74-180--------------------------------------------------------------------------------
D4H251_DENA2/115-228--------------------------------------------------------------------------------
R7I3Y6_9CLOT/77-184--------------------------------------------------------------------------------
G4R699_PELHB/74-189--------------------------------------------------------------------------------
A0A0B4XTY6_9PROT/85-193--------------------------------------------------------------------------------
B5E7Q4_GEOBB/195-298--------------------------------------------------------------------------------
Q72C84_DESVH/127-233--------------------------------------------------------------------------------
Q2W2R7_MAGSA/89-196--------------------------------------------------------------------------------
B1I534_DESAP/81-187--------------------------------------------------------------------------------
R5NZ64_9CLOT/79-186--------------------------------------------------------------------------------
D4JWV0_9FIRM/158-263--------------------------------------------------------------------------------
A5I5P1_CLOBH/73-179--------------------------------------------------------------------------------
F6DLJ5_DESRL/74-180--------------------------------------------------------------------------------
F5XWM0_RAMTT/199-311--------------------------------------------------------------------------------
B6IML4_RHOCS/90-197--------------------------------------------------------------------------------
A8ESX6_ARCB4/106-217--------------------------------------------------------------------------------
F2JN05_CELLD/79-180--------------------------------------------------------------------------------
Q74DL3_GEOSL/77-183--------------------------------------------------------------------------------
Q5E501_VIBF1/198-319--------------------------------------------------------------------------------
E1SPH8_FERBD/213-325--------------------------------------------------------------------------------
B5EGJ6_GEOBB/77-183--------------------------------------------------------------------------------
A5D439_PELTS/73-179--------------------------------------------------------------------------------
U5N930_9BURK/110-220--------------------------------------------------------------------------------
E1SQW9_FERBD/106-217--------------------------------------------------------------------------------
D7DQM1_METV3/185-290--------------------------------------------------------------------------------
E8RQ04_ASTEC/85-195--------------------------------------------------------------------------------
Q74EC9_GEOSL/72-178--------------------------------------------------------------------------------
Q7D199_AGRFC/88-194--------------------------------------------------------------------------------
B5YKT7_THEYD/87-199--------------------------------------------------------------------------------
A0L9K9_MAGMM/119-226--------------------------------------------------------------------------------
A1WD99_ACISJ/101-212--------------------------------------------------------------------------------
C6WYS6_METML/102-211--------------------------------------------------------------------------------
A5G6Y0_GEOUR/211-325--------------------------------------------------------------------------------
Q0W8Y7_METAR/199-302--------------------------------------------------------------------------------
TLPC_BACSU/80-184--------------------------------------------------------------------------------
K0NLS4_DESTT/130-248--------------------------------------------------------------------------------
G8M385_CLOCD/307-413--------------------------------------------------------------------------------
A5G616_GEOUR/72-178--------------------------------------------------------------------------------
A9KQX1_CLOPH/40-140--------------------------------------------------------------------------------
G8MN10_9BURK/110-221--------------------------------------------------------------------------------
Q6LY71_METMP/187-292--------------------------------------------------------------------------------
A7HEU7_ANADF/134-251--------------------------------------------------------------------------------
D5X0H1_THIK1/108-218--------------------------------------------------------------------------------
E3CZU3_9BACT/182-287--------------------------------------------------------------------------------
E0RXX8_BUTPB/79-188--------------------------------------------------------------------------------
F5YEI7_TREAZ/86-202--------------------------------------------------------------------------------
G7ZDN4_AZOL4/72-179--------------------------------------------------------------------------------
X2GV97_9BACI/76-181--------------------------------------------------------------------------------
D3RVX8_ALLVD/111-221--------------------------------------------------------------------------------
R6ZMQ4_9FIRM/73-179--------------------------------------------------------------------------------
A1S844_SHEAM/106-217--------------------------------------------------------------------------------
D7DHR4_METV0/102-212--------------------------------------------------------------------------------
Q2ILX4_ANADE/105-215--------------------------------------------------------------------------------
E0SEE2_DICD3/109-220--------------------------------------------------------------------------------
Q89JH4_BRADU/94-202--------------------------------------------------------------------------------
G8AT44_AZOBR/76-183--------------------------------------------------------------------------------
L0HFV3_METFS/105-216--------------------------------------------------------------------------------
A5G6X8_GEOUR/210-326--------------------------------------------------------------------------------
A6LZK9_CLOB8/177-278--------------------------------------------------------------------------------
D4KWN6_9FIRM/76-185--------------------------------------------------------------------------------
H2IST1_RAHAC/113-224--------------------------------------------------------------------------------
E6TRU7_BACCJ/80-181--------------------------------------------------------------------------------
B3EA57_GEOLS/72-178--------------------------------------------------------------------------------
E1SQW8_FERBD/106-217--------------------------------------------------------------------------------
C4IHE8_CLOBU/72-179--------------------------------------------------------------------------------
C8VYH0_DESAS/73-179--------------------------------------------------------------------------------
A0A023Y143_9GAMM/113-224--------------------------------------------------------------------------------
F3Z371_DESAF/124-224--------------------------------------------------------------------------------
Q67JS3_SYMTH/218-329--------------------------------------------------------------------------------
D5XD62_THEPJ/76-178--------------------------------------------------------------------------------
R5SDE9_9CLOT/75-183--------------------------------------------------------------------------------
F2JZN6_MARM1/107-218--------------------------------------------------------------------------------
F3YY29_DESAF/173-278--------------------------------------------------------------------------------
Q213Z4_RHOPB/90-197--------------------------------------------------------------------------------
D4J2L3_BUTFI/78-188--------------------------------------------------------------------------------
G8QJI8_AZOSU/217-331--------------------------------------------------------------------------------
E4RNC2_HALHG/80-185--------------------------------------------------------------------------------
R5R8S2_9FIRM/79-186--------------------------------------------------------------------------------
C4XTW5_DESMR/173-278--------------------------------------------------------------------------------
A8F9U1_BACP2/79-184--------------------------------------------------------------------------------
F6DKG1_DESRL/79-184--------------------------------------------------------------------------------
A6UWZ1_META3/212-318--------------------------------------------------------------------------------
R6FBW2_9FIRM/88-195--------------------------------------------------------------------------------
D5WGD4_BURSC/49-157--------------------------------------------------------------------------------
R7R090_9FIRM/112-220--------------------------------------------------------------------------------
F2JRS0_CELLD/85-196--------------------------------------------------------------------------------
E0S2B9_BUTPB/88-197--------------------------------------------------------------------------------
Q47F07_DECAR/214-329--------------------------------------------------------------------------------
A3DJX9_CLOTH/77-183--------------------------------------------------------------------------------
D2S3V8_GEOOG/300-412--------------------------------------------------------------------------------
A1K1I5_AZOSB/222-336--------------------------------------------------------------------------------
D7CN43_SYNLT/76-181--------------------------------------------------------------------------------
E6TZ81_BACCJ/78-183--------------------------------------------------------------------------------
R7N631_9FIRM/83-190--------------------------------------------------------------------------------
D7EA93_METEZ/98-210--------------------------------------------------------------------------------
W0S9Z6_9RHOO/225-339--------------------------------------------------------------------------------
Q1QVS1_CHRSD/204-320--------------------------------------------------------------------------------
W0EC93_9FIRM/75-181--------------------------------------------------------------------------------
F2JGZ2_CELLD/76-178--------------------------------------------------------------------------------
R7I9R7_9CLOT/89-196--------------------------------------------------------------------------------
R6DVG8_9CLOT/5-112--------------------------------------------------------------------------------
G4QFB3_GLANF/102-211--------------------------------------------------------------------------------
A6VV35_MARMS/109-220--------------------------------------------------------------------------------
C6XCT3_METGS/126-235--------------------------------------------------------------------------------
L0K912_HALHC/77-183--------------------------------------------------------------------------------
D3RQD1_ALLVD/81-192--------------------------------------------------------------------------------
C9LRM7_SELS3/91-197--------------------------------------------------------------------------------
R5EER7_9CLOT/71-178--------------------------------------------------------------------------------
Q28LY5_JANSC/69-195--------------------------------------------------------------------------------
E6U3D4_ETHHY/87-192--------------------------------------------------------------------------------
W0E9X6_9FIRM/74-180--------------------------------------------------------------------------------
A5G0G1_ACICJ/83-185--------------------------------------------------------------------------------
C7RV68_ACCPU/102-213--------------------------------------------------------------------------------
A0A0C5X0D3_9GAMM/198-314--------------------------------------------------------------------------------
R5DWU0_9FIRM/73-182--------------------------------------------------------------------------------
F7YX84_9THEM/79-190--------------------------------------------------------------------------------
I4BTU7_ANAMD/116-231--------------------------------------------------------------------------------
H6NGN8_9BACL/80-186--------------------------------------------------------------------------------
W8KJN2_HALHR/81-192--------------------------------------------------------------------------------
F2NY56_TRES6/174-270--------------------------------------------------------------------------------
Q6M058_METMP/187-292--------------------------------------------------------------------------------
B9TMP9_RICCO/78-188--------------------------------------------------------------------------------
G2T516_ROSHA/86-192--------------------------------------------------------------------------------
C4XJA0_DESMR/214-319--------------------------------------------------------------------------------
Q5H0R3_XANOR/351-467--------------------------------------------------------------------------------
B8DJD3_DESVM/173-278--------------------------------------------------------------------------------
A0A068SK02_RHIGA/87-193--------------------------------------------------------------------------------
M4RH32_9ALTE/43-149--------------------------------------------------------------------------------
B5EEA7_GEOBB/208-324--------------------------------------------------------------------------------
D1B050_SULD5/102-212--------------------------------------------------------------------------------
B7GJK4_ANOFW/75-180--------------------------------------------------------------------------------
W8R0S9_PSEST/102-213--------------------------------------------------------------------------------
D5WSX0_KYRT2/75-180--------------------------------------------------------------------------------
A0KMS3_AERHH/198-314--------------------------------------------------------------------------------
W0V5R1_9BURK/112-223--------------------------------------------------------------------------------
C8X019_DESRD/133-251--------------------------------------------------------------------------------
C4XT43_DESMR/172-278--------------------------------------------------------------------------------
Q6LXP6_METMP/208-314--------------------------------------------------------------------------------
C9R7R0_AMMDK/78-183--------------------------------------------------------------------------------
H6RKC7_BLASD/264-378--------------------------------------------------------------------------------
C5BRD9_TERTT/103-207--------------------------------------------------------------------------------
R6BYZ3_9CLOT/75-182--------------------------------------------------------------------------------
G8QJH7_AZOSU/104-213--------------------------------------------------------------------------------
A6W7B6_KINRD/134-252--------------------------------------------------------------------------------
M1E7Y2_9FIRM/183-301--------------------------------------------------------------------------------
Q39WQ1_GEOMG/73-179--------------------------------------------------------------------------------
H6RSU6_BLASD/118-234--------------------------------------------------------------------------------
D5XCJ0_THEPJ/210-316--------------------------------------------------------------------------------
A4J257_DESRM/66-172--------------------------------------------------------------------------------
Q0AYG1_SYNWW/86-190--------------------------------------------------------------------------------
I4D0P6_DESAJ/74-180--------------------------------------------------------------------------------
R7K0M4_9CLOT/67-193--------------------------------------------------------------------------------
B8IJS3_METNO/210-322--------------------------------------------------------------------------------
Q87MS2_VIBPA/108-219--------------------------------------------------------------------------------
F0LZR4_VIBFN/108-218--------------------------------------------------------------------------------
A0A075K6B4_9FIRM/186-290--------------------------------------------------------------------------------
Q085R6_SHEFN/106-217--------------------------------------------------------------------------------
A9BU07_DELAS/105-220--------------------------------------------------------------------------------
M1F6J6_9ALTE/102-212--------------------------------------------------------------------------------
C9R7Y4_AMMDK/77-182--------------------------------------------------------------------------------
C9LWK5_SELS3/73-177--------------------------------------------------------------------------------
W8UBX6_EUBAC/79-190--------------------------------------------------------------------------------
D9SUK2_CLOC7/72-177--------------------------------------------------------------------------------
B3EA50_GEOLS/210-324--------------------------------------------------------------------------------

PF17201

C6BU40_DESAD/36-358QDCMKDEVRSLIESHVSQMTADLYEECRTSDQLLTAETERAAMALESLMDD.....EGSIRVLKRVSDWPVNNYRNDSDE
A6LV74_CLOB8/28-303.NKSNKAVFKEVNEKSQRLTESIITTLSVRNDLLTEKSYGDLNFANNVLNN.............LADMRVDYNEIVKVGD
E1QGT6_DESB2/31-334.YLAASDIQKSAQQDLEHITTNLRAICQSQEELLQKKVDSDLKVAVNVLNQFSWEAPMAISPDQTTKWTVTNQDTKQSQE
A8EX26_ARCB4/30-313..IVKNSIISDVKLGFKERVIDIRATFEVLNDSIKESAKTVSNVFSAKLNN................IEIDYSEKIELNG
G8QHB1_AZOSU/34-324TSMASRSAVALAESDLKEQMSILQDTLDSVFDSVLARGERQMNFFRRQLPG................DFNLGSGMVRTGN
A6VTS3_MARMS/34-320DRLFSYQINDIVSSHQQKEAALVAEQLESKYQLLTENTNRFSDILANQIES................ITINNEQTTLINN
F2K3U4_MARM1/35-301.RLFDYEVRDIVTDHQVAEVNLLAQKLESDWNSISGAITRSTNTLANNLSN.............................
H2IST1_RAHAC/38-323THSAGKQVSELTVNAISEQVTGVVDMIEMYNASLNAEVDSYTRLFSHFLPS...............DFELDPASPVMVGD
A8ESX6_ARCB4/32-319SNNTFEAMKKNTESTVHKEISLLVENINTFNKVAKTGADTIGNIFLDMLQG................IKIDKSQNIKVGD
F0JCL3_DESDE/35-351.ETLTTHFDLQAQAEMTLAVDDARNLLDTQHATLTKQLENDMRVVLDLERR..GGGLRLLP..GTVEWRAVNQISKAASA
I0HW90_RUBGI/37-316.WVTVRNANEANAERYGERAQAVADMAEAFDGAARTMADKLYGAFAADLPG.............................
D5V2F9_ARCNC/31-312SNIIANKSTKGSENKFKGSAEHIAIAFNTLDNNLHEVMNGYLNVIKTYLPD...............SYSIDKEKIVKVGQ
A6VTS4_MARMS/34-318SELFNLKINDIITVHQQKETDIVTSQLVERYETLTKTLVRQSSVFDNQLQE................SIVDTSDTIDLNG
B8HSN5_CYAP4/64-390NEQAKQDLEALIRADRDSIAKGVLALINTQGEALQQKVNNELKLARYLINT....SGKISLSKETVSWQAKNQFSHQTQL
Q2SCQ8_HAHCH/31-321.HSVDKTVTQLTRSDLQHLVGAAHMAAKAYSEELDNEAVRLSEVFGLTFPG...............EFSISAGEKVDVAG
B8DKE8_DESVM/33-319.WRTQGTLNRMGRDNLAGFMDAMCDVAAMQDRIGGEALHNSLEALASGLLG...QGELNLSASGAATHQVADQTTGATSS
C3K447_PSEFS/33-307.RSLDTANLATREEHLASEARLLADQLNTFHSTLRESTQRLTGLFEKRFSA...............GLRVQADQPVAVAG
G8MN10_9BURK/35-328TQSAGEQVDAHALARVESENRSIATMIGLFDKAVSAEVTRFTTIFAHRLPS...............TFTLDETRTVDVGG
B8DR25_DESVM/32-335.VDARRGYLAQGRASLRNVSQILMESARFQDTLNRNKIGSDLKLMQLQFGL...AGFPIPEIFMEVEADLRDADTGQRVK
Q2FQ15_METHJ/34-307YSSSVNVINEQIETLLETQVQDMKGWTNDVYKLTRNKVNSDLNVLRQNFYA.............................
E1QEE0_DESB2/42-369QEQVAEETDKLVAEQVAKQVQSAYFVCQAQQASALREIKLGLRMASHVAAQ...HGQPNLLTDQPQPWRAVDQFSKHASD
F6AK53_PSEF1/33-309.RSLSSANLVTREEHLGSEARLLADQLSTFHESLRESTQRLAGLFERRFSG...............GLRVSPDERVTVGA
A6W7B6_KINRD/41-362SQDTSQDVRAMSERSLHDSGTQVQTTVATQASAVQAMLDSNLRVTTDRLAQ...YGGPALDPAETATWTATNQVTKDKTP
C8X019_DESRD/39-360EKDMAKEVDHMAERELGHIAEDIRHMVEAQNESVQQKVESDLRVASHLLEQ..QGGIYTATQTETVSWQAVNQYTGQSKT
B6BNF9_SULGG/29-306NDYLNSYINKETHLKLDSSVERMVQTMDTYNGALEESATKLYNVFKSNFSD................FSITPNERVDVYG
C6WF37_ACTMD/44-372STAAAGNVAELIQTDTDHVTSGVSTLTRTAGEAIQESVNSSMNVANAELAQ...RGGLRLDDSSTTSWKAVNQLTQEATD
B8FKI9_DESAA/38-364QAKMKGQMDGMARQQVANIVQGLYRMAINQDEAIRRSMESNLRIAQKMVQD..MGGINMGR..ATVDWEITNQFTKEKST
Q3A5N0_PELCD/34-368DTAIDEEMESFIHNETRKVAESVYLMCRSVQQLQDESLKRNLDVATKLLDK..QGGLSFSP..ERVRWSAENQFDKSVKA
A6VV35_MARMS/34-326TKKSSAGFMQSIEHELQTSASQGDMLLDFYYESLKSNTDRLADIFFTLFPN...............GIIVSDSETVKIGE
F3Z2D9_DESAF/34-350QIEMHETFEGQAQQQITLAGHDALGLVKSQHESLTKLLEGNMRVMRELTDF..SGGFSLAR..ETVEWRAVNQVSGNASL
C8X5F8_DESRD/39-363EKDLHSEVRRTAERELENVAEGLQAMVKSQDEAVRQKVQADLNVAQELLRR..EGGVALSE..TNVTWSAVNQYSGDSNQ
Q88BA0_PSESM/33-309.RSLDASNLVIREEHMSSEARLLADQLSTFHSTLRDSTQRLSGLFEKRFAG...............GLTLQTDKPVAVAG
Q2FU40_METHJ/38-306YSSAEVTIKNDIRMSLEMQTADITEETKTVYDLTQVKVNSDLNVLRQLFYE.............................
D5UZK4_ARCNC/30-314TNSIKTSIINDLEKNLQSQAGDYLQTTKIYNDTLEENALLLFQVFEKSFLN................LRKRGTNKIKING
C5CXU1_VARPS/45-330...GSAQQQRSAAQYANAKAEAIARSLDIFDRTMQLTAENAYGVFRRQFSA.......................TFAVED
F2JZN6_MARM1/34-317..QSVGVLTSLQNDEQERKVDMLSSQLATIYGSFIRSTDMLSSVFGSYYDQ...............GFQLDEQRSVTIAG

PF02743

E0RXM7_BUTPB/48-273--------------------------------------------------------------------------------
D4J1J7_BUTFI/47-288--------------------------------------------------------------------------------
E0RW20_BUTPB/49-275--------------------------------------------------------------------------------
C6PRU6_9CLOT/32-298--------------------------------------------------------------------------------
F4LMY3_TREBD/35-291--------------------------------------------------------------------------------
A9KI79_CLOPH/38-284--------------------------------------------------------------------------------
C6CY24_PAESJ/49-303--------------------------------------------------------------------------------
D9SN50_CLOC7/34-225--------------------------------------------------------------------------------
B3PLL6_CELJU/36-263--------------------------------------------------------------------------------
H6NPI3_9BACL/38-270--------------------------------------------------------------------------------
Q8XIM7_CLOPE/39-272--------------------------------------------------------------------------------
B8CZL7_HALOH/50-288--------------------------------------------------------------------------------
D3EGX8_GEOS4/41-276--------------------------------------------------------------------------------
B8FI76_DESAA/33-279--------------------------------------------------------------------------------
F4GHS7_SPHCD/50-280--------------------------------------------------------------------------------
G7M452_9CLOT/54-282--------------------------------------------------------------------------------
G7MBH7_9CLOT/84-313--------------------------------------------------------------------------------
E3GJM9_EUBLK/37-310--------------------------------------------------------------------------------
E3DMV9_HALPG/43-295--------------------------------------------------------------------------------
D3EI08_GEOS4/52-270--------------------------------------------------------------------------------
Q729P1_DESVH/35-283--------------------------------------------------------------------------------
C0QWV4_BRAHW/43-259--------------------------------------------------------------------------------
A3DEW9_CLOTH/98-428--------------------------------------------------------------------------------
C6CUM5_PAESJ/53-294--------------------------------------------------------------------------------
H9UIR1_SPIAZ/46-279--------------------------------------------------------------------------------
D4H636_DENA2/32-256--------------------------------------------------------------------------------
F5YEX0_TREAZ/51-285--------------------------------------------------------------------------------
A3DJL4_CLOTH/54-311--------------------------------------------------------------------------------
F8F259_TRECH/36-277--------------------------------------------------------------------------------
G7LYC8_9CLOT/33-306--------------------------------------------------------------------------------
D4GMT0_PANAM/45-292--------------------------------------------------------------------------------
C6CV60_PAESJ/38-288--------------------------------------------------------------------------------
F8F0Y4_TRECH/37-279--------------------------------------------------------------------------------
C6CTL5_PAESJ/41-280--------------------------------------------------------------------------------
F2JPG3_CELLD/74-312--------------------------------------------------------------------------------
C6CUI3_PAESJ/43-274--------------------------------------------------------------------------------
H6NBH0_9BACL/31-281--------------------------------------------------------------------------------
F3ZVL8_MAHA5/40-277--------------------------------------------------------------------------------
C6D144_PAESJ/61-288--------------------------------------------------------------------------------
D3EMN3_GEOS4/45-297--------------------------------------------------------------------------------
C6D7B0_PAESJ/40-294--------------------------------------------------------------------------------
C6D7J9_PAESJ/38-288--------------------------------------------------------------------------------
E3PXB9_CLOSD/46-280--------------------------------------------------------------------------------
Q7VHJ6_HELHP/43-277--------------------------------------------------------------------------------
E6W5T9_DESIS/35-272--------------------------------------------------------------------------------
C6BZH4_DESAD/37-310--------------------------------------------------------------------------------
Q5JHH6_THEKO/57-298--------------------------------------------------------------------------------
B9M8I3_GEODF/40-299--------------------------------------------------------------------------------
Q47XG9_COLP3/35-267--------------------------------------------------------------------------------
E7A996_HELFC/33-261--------------------------------------------------------------------------------
F2JMM1_CELLD/60-290--------------------------------------------------------------------------------
B6BIE4_SULGG/44-312--------------------------------------------------------------------------------
A9A2K6_NITMS/39-281--------------------------------------------------------------------------------
E1X671_HALMS/37-327--------------------------------------------------------------------------------
E1WYC4_HALMS/48-313--------------------------------------------------------------------------------
B6BK47_SULGG/36-308--------------------------------------------------------------------------------
A4XMI4_CALS8/55-277--------------------------------------------------------------------------------
D4KX95_9FIRM/51-303--------------------------------------------------------------------------------
D4LPL0_9FIRM/48-267--------------------------------------------------------------------------------
C6D3Q0_PAESJ/27-245--------------------------------------------------------------------------------
A4XMH3_CALS8/43-295--------------------------------------------------------------------------------
Q6AR33_DESPS/36-271--------------------------------------------------------------------------------
B5YK24_THEYD/36-274--------------------------------------------------------------------------------
G7W723_DESOD/39-297--------------------------------------------------------------------------------
F2NHZ1_DESAR/35-311--------------------------------------------------------------------------------
C6C1E7_DESAD/46-293--------------------------------------------------------------------------------
C6CXB7_PAESJ/52-257--------------------------------------------------------------------------------
Q9KDT9_BACHD/37-275--------------------------------------------------------------------------------
D4H3E5_DENA2/28-291--------------------------------------------------------------------------------
F7YVT2_9THEM/41-272--------------------------------------------------------------------------------
E1QDC1_DESB2/44-271--------------------------------------------------------------------------------
E7ABZ2_HELFC/42-298--------------------------------------------------------------------------------
Q73RB3_TREDE/35-272--------------------------------------------------------------------------------
Q9KFJ6_BACHD/36-286--------------------------------------------------------------------------------
Q6MQG9_BDEBA/53-313--------------------------------------------------------------------------------
A4XGK2_CALS8/62-333--------------------------------------------------------------------------------
Q1IM50_KORVE/59-347--------------------------------------------------------------------------------
Q2SGW4_HAHCH/32-267--------------------------------------------------------------------------------
F8F462_TRECH/35-317--------------------------------------------------------------------------------
C7RT51_ACCPU/45-266--------------------------------------------------------------------------------
B7K4S0_CYAP8/44-338--------------------------------------------------------------------------------
G7W9K4_DESOD/50-262--------------------------------------------------------------------------------
C6CSH7_PAESJ/23-253--------------------------------------------------------------------------------
D4ZTE8_ARTPN/36-315--------------------------------------------------------------------------------
E8MZP1_ANATU/52-264--------------------------------------------------------------------------------
E1R2C1_SPISS/36-293--------------------------------------------------------------------------------
C6C0E4_DESAD/40-301--------------------------------------------------------------------------------
B5YHW7_THEYD/47-271--------------------------------------------------------------------------------
D3E5V1_GEOS4/40-274--------------------------------------------------------------------------------
E6VUE9_DESAO/63-288--------------------------------------------------------------------------------
A1WSF6_VEREI/52-286--------------------------------------------------------------------------------
A5D5V0_PELTS/36-281--------------------------------------------------------------------------------
Q2FLJ4_METHJ/50-283--------------------------------------------------------------------------------
A6TX67_ALKMQ/30-271--------------------------------------------------------------------------------
C0QIP9_DESAH/38-261--------------------------------------------------------------------------------
E8RGV5_DESPD/33-283--------------------------------------------------------------------------------
C0Q9P9_DESAH/46-273--------------------------------------------------------------------------------
B8DJ49_DESVM/62-282--------------------------------------------------------------------------------
H6NI13_9BACL/41-267--------------------------------------------------------------------------------
E0S203_BUTPB/55-291--------------------------------------------------------------------------------
B2TQC3_CLOBB/33-283--------------------------------------------------------------------------------
A6LM24_THEM4/37-269--------------------------------------------------------------------------------
H1XW39_9BACT/40-285--------------------------------------------------------------------------------
D8PCB9_9BACT/43-311--------------------------------------------------------------------------------
C3K184_PSEFS/56-337--------------------------------------------------------------------------------
Q1LHF7_RALME/81-344--------------------------------------------------------------------------------
F0RV54_SPHGB/66-306--------------------------------------------------------------------------------
D5MG95_9BACT/36-306--------------------------------------------------------------------------------
C3K2B9_PSEFS/49-329--------------------------------------------------------------------------------
Q1ILB4_KORVE/57-289--------------------------------------------------------------------------------
Q602G4_METCA/30-274--------------------------------------------------------------------------------
C6PUI2_9CLOT/40-278--------------------------------------------------------------------------------
F5Z6T8_ALTSS/35-267--------------------------------------------------------------------------------
H6NA60_9BACL/52-287--------------------------------------------------------------------------------
G8ANA3_AZOBR/64-289--------------------------------------------------------------------------------
H8MHX3_CORCM/30-270--------------------------------------------------------------------------------
C9RM68_FIBSS/40-270--------------------------------------------------------------------------------
A7IGX4_XANP2/66-286--------------------------------------------------------------------------------
B9M6B7_GEODF/52-287--------------------------------------------------------------------------------
C9Z824_STRSW/26-262--------------------------------------------------------------------------------
Q3SIW6_THIDA/34-299--------------------------------------------------------------------------------
E3FLW5_STIAD/37-269--------------------------------------------------------------------------------
I0HU31_RUBGI/29-253--------------------------------------------------------------------------------
E3GHH9_EUBLK/36-277--------------------------------------------------------------------------------
E3FG36_STIAD/32-267--------------------------------------------------------------------------------
G7Z6B1_AZOL4/54-254--------------------------------------------------------------------------------
D5CLV3_SIDLE/36-276--------------------------------------------------------------------------------
G8AMV0_AZOBR/40-289--------------------------------------------------------------------------------
D0LM69_HALO1/34-257--------------------------------------------------------------------------------
C7NWH4_HALMD/48-253--------------------------------------------------------------------------------
B8D1L9_HALOH/40-260--------------------------------------------------------------------------------
B2UE10_RALPJ/76-334--------------------------------------------------------------------------------
A8IDY9_AZOC5/74-323--------------------------------------------------------------------------------
G1UVU9_9DELT/33-268--------------------------------------------------------------------------------

PF17203

A8IJW0_AZOC5/37-200--------------------------------------------------------------------------------
E1VUF8_ARTAR/45-184--------------------------------------------------------------------------------
E8U7M9_DEIML/49-188--------------------------------------------------------------------------------
C7LRL2_DESBD/42-181--------------------------------------------------------------------------------
Q1QZP7_CHRSD/37-181--------------------------------------------------------------------------------
E8NFB8_MICTS/40-178--------------------------------------------------------------------------------
C8WZC3_DESRD/40-169--------------------------------------------------------------------------------
A5G384_GEOUR/38-175--------------------------------------------------------------------------------
C8X081_DESRD/32-168--------------------------------------------------------------------------------
B3E2P6_GEOLS/40-167--------------------------------------------------------------------------------
A6W5B6_KINRD/52-190--------------------------------------------------------------------------------
D2AVS4_STRRD/35-173--------------------------------------------------------------------------------
A0LAG0_MAGMM/37-175--------------------------------------------------------------------------------
E6VQM2_DESAO/32-165--------------------------------------------------------------------------------
B3EA57_GEOLS/33-179--------------------------------------------------------------------------------
A4FKM4_SACEN/27-164--------------------------------------------------------------------------------
F2R3Z9_STRVP/37-173--------------------------------------------------------------------------------
A5G7L0_GEOUR/36-180--------------------------------------------------------------------------------

PF14827

D7DT63_METV3/43-290--------------------------------------------------------------------------------
F4LKK3_TREBD/50-285--------------------------------------------------------------------------------
H1XWA2_9BACT/46-289--------------------------------------------------------------------------------
E8N3E1_ANATU/173-421--------------------------------------------------------------------------------
A9B1A1_HERA2/45-312--------------------------------------------------------------------------------
B8GT29_THISH/39-275--------------------------------------------------------------------------------
F6CHJ7_DESK7/41-278--------------------------------------------------------------------------------
A6LZK9_CLOB8/38-271--------------------------------------------------------------------------------
E1QXZ6_OLSUV/38-302--------------------------------------------------------------------------------
B6BK25_SULGG/41-273--------------------------------------------------------------------------------
A1TIP1_ACIAC/42-281--------------------------------------------------------------------------------
D8IXU4_HERSS/39-271--------------------------------------------------------------------------------
E1QFV1_DESB2/44-282--------------------------------------------------------------------------------
C4XT43_DESMR/37-275--------------------------------------------------------------------------------
C0QD16_DESAH/44-277--------------------------------------------------------------------------------
C7RNJ0_ACCPU/54-301--------------------------------------------------------------------------------
H8GHU3_METAL/46-282--------------------------------------------------------------------------------
E1SQJ5_FERBD/47-274--------------------------------------------------------------------------------
F5Z5Z5_ALTSS/36-270--------------------------------------------------------------------------------
D1B421_SULD5/41-285--------------------------------------------------------------------------------
Q7M9G7_WOLSU/43-278--------------------------------------------------------------------------------
Q7M861_WOLSU/41-289--------------------------------------------------------------------------------
H8GKJ7_METAL/52-296--------------------------------------------------------------------------------

PF05228

K9T5N2_9CYAN/61-217--------------------------------------------------------------------------------
Q8THY1_METAC/52-208--------------------------------------------------------------------------------
A1ATC4_PELPD/52-207--------------------------------------------------------------------------------
I0H3Y6_ACTM4/69-223--------------------------------------------------------------------------------
V5SI81_9RHIZ/41-227--------------------------------------------------------------------------------
Q2SK89_HAHCH/33-193--------------------------------------------------------------------------------
Q7MJU6_VIBVY/60-219--------------------------------------------------------------------------------
A4XQX9_PSEMY/55-221--------------------------------------------------------------------------------
Q87H61_VIBPA/60-219--------------------------------------------------------------------------------
Q2FTW2_METHJ/54-207--------------------------------------------------------------------------------
C4XMF3_DESMR/52-207--------------------------------------------------------------------------------
Q8TQ13_METAC/66-219--------------------------------------------------------------------------------
A5FVT2_ACICJ/60-228--------------------------------------------------------------------------------
F3YXA6_DESAF/52-207--------------------------------------------------------------------------------
D3RPD2_ALLVD/52-208--------------------------------------------------------------------------------
D9QF18_BRESC/52-225--------------------------------------------------------------------------------
E8N3Z5_ANATU/58-207--------------------------------------------------------------------------------
J1APM7_9EURY/52-203--------------------------------------------------------------------------------
K9V905_9CYAN/52-208--------------------------------------------------------------------------------
A1S8V4_SHEAM/53-207--------------------------------------------------------------------------------
K9VQQ8_9CYAN/81-235--------------------------------------------------------------------------------
F6CMI2_DESK7/52-198--------------------------------------------------------------------------------
B8FAJ2_DESAA/52-212--------------------------------------------------------------------------------
F7YQF2_VIBA7/72-226--------------------------------------------------------------------------------
K9WDX4_9CYAN/52-207--------------------------------------------------------------------------------
K9XAQ8_9CHRO/52-206--------------------------------------------------------------------------------
Q2K9V0_RHIEC/61-216--------------------------------------------------------------------------------
A5V6E3_SPHWW/65-238--------------------------------------------------------------------------------
E8RJK5_DESPD/57-210--------------------------------------------------------------------------------
E3CZ19_9BACT/52-205--------------------------------------------------------------------------------
K9TJL0_9CYAN/52-205--------------------------------------------------------------------------------
Q11B73_CHESB/53-222--------------------------------------------------------------------------------
Q7CV32_AGRFC/64-225--------------------------------------------------------------------------------
I0HBV1_ACTM4/59-206--------------------------------------------------------------------------------
Q07W08_SHEFN/52-212--------------------------------------------------------------------------------
D4H4D3_DENA2/52-205--------------------------------------------------------------------------------
Q117I8_TRIEI/66-213--------------------------------------------------------------------------------
C6BS22_DESAD/54-201--------------------------------------------------------------------------------
W0HUA8_9ENTR/58-232--------------------------------------------------------------------------------
Q9I243_PSEAE/59-220--------------------------------------------------------------------------------
Q3A254_PELCD/52-206--------------------------------------------------------------------------------
Q9I594_PSEAE/136-300--------------------------------------------------------------------------------
Q8TNE0_METAC/52-206--------------------------------------------------------------------------------
M1NBF3_DESSD/57-211--------------------------------------------------------------------------------
C4XQU7_DESMR/78-233--------------------------------------------------------------------------------
Q30Y92_DESAG/57-216--------------------------------------------------------------------------------
C7LSV6_DESBD/62-217--------------------------------------------------------------------------------
Q2K442_RHIEC/64-225--------------------------------------------------------------------------------
Q4KBE8_PSEF5/64-225--------------------------------------------------------------------------------
B8HRL0_CYAP4/58-211--------------------------------------------------------------------------------
A1TSZ0_ACIAC/62-225--------------------------------------------------------------------------------
E6TUY9_BACCJ/52-200--------------------------------------------------------------------------------
M1M0P0_9CLOT/53-200--------------------------------------------------------------------------------
Q2FNF0_METHJ/52-201--------------------------------------------------------------------------------
B9JAE4_AGRRK/65-226--------------------------------------------------------------------------------
Q72E59_DESVH/54-206--------------------------------------------------------------------------------
B8GE07_METPE/53-209--------------------------------------------------------------------------------
B8DPY6_DESVM/76-231--------------------------------------------------------------------------------
I4D6E9_DESAJ/52-207--------------------------------------------------------------------------------
E6W5W0_DESIS/57-218--------------------------------------------------------------------------------
W6RK75_9RHIZ/64-225--------------------------------------------------------------------------------
K9TZZ8_9CYAN/51-206--------------------------------------------------------------------------------
B8HP72_CYAP4/52-201--------------------------------------------------------------------------------
Q6ALC0_DESPS/53-212--------------------------------------------------------------------------------
J1L4S7_9EURY/84-233--------------------------------------------------------------------------------
K9U7Y2_9CYAN/52-203--------------------------------------------------------------------------------
Q12IQ4_SHEDO/66-220--------------------------------------------------------------------------------
U3U4B6_9ENTR/60-210--------------------------------------------------------------------------------
A9B039_HERA2/62-217--------------------------------------------------------------------------------
L0HGK7_METFS/52-200--------------------------------------------------------------------------------
D7DPR5_METV0/59-211--------------------------------------------------------------------------------
A0KLS5_AERHH/52-202--------------------------------------------------------------------------------
Q2FPW8_METHJ/52-207--------------------------------------------------------------------------------
Q8TMU6_METAC/57-210--------------------------------------------------------------------------------
M4S697_9SPHN/54-228--------------------------------------------------------------------------------
A5GD60_GEOUR/52-207--------------------------------------------------------------------------------
Q2K6U7_RHIEC/66-236--------------------------------------------------------------------------------
Q930X2_RHIME/53-224--------------------------------------------------------------------------------
K4MLE8_9EURY/44-198--------------------------------------------------------------------------------
D8MTI5_ERWBE/57-214--------------------------------------------------------------------------------
G2IUP0_PSEUL/57-230--------------------------------------------------------------------------------
A3QH71_SHELP/52-208--------------------------------------------------------------------------------
Q8TMU8_METAC/67-220--------------------------------------------------------------------------------
Q3IXL8_RHOS4/94-263--------------------------------------------------------------------------------
K9WKM5_9CYAN/55-201--------------------------------------------------------------------------------
E3CZH3_9BACT/52-207--------------------------------------------------------------------------------
D5EIB9_CORAD/51-205--------------------------------------------------------------------------------
A5VGJ2_SPHWW/58-218--------------------------------------------------------------------------------
W6RPB6_9RHIZ/61-221--------------------------------------------------------------------------------
K9Q1V5_9CYAN/52-207--------------------------------------------------------------------------------
A9B4T1_HERA2/61-214--------------------------------------------------------------------------------
Q2G9C2_NOVAD/70-248--------------------------------------------------------------------------------
F2J5B8_POLGS/64-244--------------------------------------------------------------------------------
F2J501_POLGS/58-239--------------------------------------------------------------------------------
A4J4S7_DESRM/52-207--------------------------------------------------------------------------------
W0A9B0_9SPHN/37-196--------------------------------------------------------------------------------
A0KQ37_AERHH/11-168--------------------------------------------------------------------------------
A5V026_ROSS1/71-227--------------------------------------------------------------------------------
H1YYG2_9EURY/37-190--------------------------------------------------------------------------------
K4MBS5_9EURY/32-186--------------------------------------------------------------------------------
Q6ARA2_DESPS/65-217--------------------------------------------------------------------------------
F3YZV6_DESAF/52-204--------------------------------------------------------------------------------
A7IB12_METB6/52-209--------------------------------------------------------------------------------
C4LCC8_TOLAT/58-220--------------------------------------------------------------------------------
Q12NN0_SHEDO/52-206--------------------------------------------------------------------------------
E8MZ62_ANATU/57-213--------------------------------------------------------------------------------
V5SHM0_9RHIZ/61-232--------------------------------------------------------------------------------
E8RHV7_DESPD/53-210--------------------------------------------------------------------------------
A9GVA6_SORC5/116-266--------------------------------------------------------------------------------
E6WE20_PANSA/70-227--------------------------------------------------------------------------------
Q9A9V4_CAUCR/49-225--------------------------------------------------------------------------------
A5HYQ1_CLOBH/55-201--------------------------------------------------------------------------------
F0LU73_VIBFN/57-210--------------------------------------------------------------------------------
K4KR53_SIMAS/61-223--------------------------------------------------------------------------------
Q74A79_GEOSL/59-214--------------------------------------------------------------------------------
B0SWN8_CAUSK/60-231--------------------------------------------------------------------------------
B9JNG4_AGRRK/66-215--------------------------------------------------------------------------------
E1STV9_FERBD/53-200--------------------------------------------------------------------------------
E1QL96_DESB2/52-207--------------------------------------------------------------------------------
W6RBR6_9RHIZ/54-223--------------------------------------------------------------------------------
C7LX06_DESBD/52-206--------------------------------------------------------------------------------
F2J0J8_POLGS/72-252--------------------------------------------------------------------------------
T2GDF2_DESGI/52-209--------------------------------------------------------------------------------
D5A0D5_ARTPN/52-216--------------------------------------------------------------------------------
M1NDH6_DESSD/74-254--------------------------------------------------------------------------------
A4VMP6_PSEU5/64-225--------------------------------------------------------------------------------
C3MB50_RHISN/61-215--------------------------------------------------------------------------------
K9TJP6_9CYAN/52-212--------------------------------------------------------------------------------
D1B471_SULD5/51-199--------------------------------------------------------------------------------
G8PR77_PSEUV/79-251--------------------------------------------------------------------------------
O28553_ARCFU/51-202--------------------------------------------------------------------------------
A1SRH3_PSYIN/64-218--------------------------------------------------------------------------------
K9TNS7_9CYAN/66-227--------------------------------------------------------------------------------
K9XD78_9CHRO/102-255--------------------------------------------------------------------------------
G8S572_ACTS5/52-200--------------------------------------------------------------------------------
Q88NQ1_PSEPK/62-223--------------------------------------------------------------------------------
F8F3N9_TRECH/52-197--------------------------------------------------------------------------------
D2W0H3_NAEGR/56-217--------------------------------------------------------------------------------
H1YWZ2_9EURY/52-203--------------------------------------------------------------------------------
E1RDF8_METP4/83-232--------------------------------------------------------------------------------
C6BRI7_DESAD/52-209--------------------------------------------------------------------------------
B8HR06_CYAP4/52-206--------------------------------------------------------------------------------
C4L2A5_EXISA/55-205--------------------------------------------------------------------------------
A7MJ29_CROS8/38-200--------------------------------------------------------------------------------
Q11KT0_CHESB/53-224--------------------------------------------------------------------------------
E8N650_ANATU/52-200--------------------------------------------------------------------------------
C8X0A9_DESRD/52-201--------------------------------------------------------------------------------
L0H9W3_METFS/52-207--------------------------------------------------------------------------------
K9VB90_9CYAN/52-208--------------------------------------------------------------------------------
Q12RR4_SHEDO/66-220--------------------------------------------------------------------------------
FILI_METH6/53-206--------------------------------------------------------------------------------
Q9KPS7_VIBCH/57-213--------------------------------------------------------------------------------
B8GK53_METPE/52-208--------------------------------------------------------------------------------
Q7CGN3_YERPE/1-161--------------------------------------------------------------------------------
K9RR01_SYNP3/56-207--------------------------------------------------------------------------------
C4L8H6_TOLAT/55-214--------------------------------------------------------------------------------
D1B728_THEAS/52-208--------------------------------------------------------------------------------
B1I214_DESAP/55-207--------------------------------------------------------------------------------
E6VXD3_DESAO/55-202--------------------------------------------------------------------------------
E3HD97_ILYPC/54-207--------------------------------------------------------------------------------

PF17155

I2B6K2_SHIBC/32-312--------------------------------------------------------------------------------
A8AHH5_CITK8/31-304--------------------------------------------------------------------------------
Q8ZPW4_SALTY/31-304--------------------------------------------------------------------------------
YEAJ_ECOLI/31-304--------------------------------------------------------------------------------

PF09308

LUXQ_VIBPA/40-277--------------------------------------------------------------------------------
Q5E6Z3_VIBF1/35-273--------------------------------------------------------------------------------
LUXQ_VIBCH/41-277--------------------------------------------------------------------------------
F0LXF0_VIBFN/41-278--------------------------------------------------------------------------------
B7VQX2_VIBTL/40-280--------------------------------------------------------------------------------
H2G0X9_OCESG/42-274--------------------------------------------------------------------------------
U4KH84_9VIBR/39-278--------------------------------------------------------------------------------
LUXQ_VIBVY/40-277--------------------------------------------------------------------------------
F7YS51_VIBA7/41-278--------------------------------------------------------------------------------

PF17152

E0SCU5_DICD3/45-146--------------------------------------------------------------------------------
Q88DZ8_PSEPK/44-145--------------------------------------------------------------------------------
Q0K8R5_CUPNH/47-148--------------------------------------------------------------------------------
B4EGX2_BURCJ/49-150--------------------------------------------------------------------------------
D8MLZ9_ERWBE/46-147--------------------------------------------------------------------------------
YFIN_ECOLI/45-146--------------------------------------------------------------------------------
E6WA91_PANSA/44-144--------------------------------------------------------------------------------
Q9I4L5_PSEAE/45-146--------------------------------------------------------------------------------
V4ISZ9_9GAMM/44-149--------------------------------------------------------------------------------
A8AND4_CITK8/44-145--------------------------------------------------------------------------------
H0PUF8_9RHOO/40-151--------------------------------------------------------------------------------
I3Y8L1_THIV6/40-146--------------------------------------------------------------------------------
Q3SJE3_THIDA/41-145--------------------------------------------------------------------------------
A5GE93_GEOUR/38-119--------------------------------------------------------------------------------
I2B6C2_SHIBC/16-117--------------------------------------------------------------------------------
A8G9I9_SERP5/47-148--------------------------------------------------------------------------------
S6AG39_9PROT/44-151--------------------------------------------------------------------------------
V5UC56_9BURK/41-142--------------------------------------------------------------------------------
E0TGV1_PARBH/47-148--------------------------------------------------------------------------------
G8QFT7_AZOSU/42-142--------------------------------------------------------------------------------
H0PZW7_9RHOO/40-129--------------------------------------------------------------------------------
A6TCL0_KLEP7/44-145--------------------------------------------------------------------------------
Q6FED5_ACIAD/42-142--------------------------------------------------------------------------------
U3TTF2_9ENTR/44-144--------------------------------------------------------------------------------
Q1GWL0_SPHAL/50-147--------------------------------------------------------------------------------
E1VJA3_9GAMM/38-160--------------------------------------------------------------------------------
I0HMR8_RUBGI/42-138--------------------------------------------------------------------------------
W8U9Z1_YEREN/55-156--------------------------------------------------------------------------------
H5WJN2_9BURK/46-165--------------------------------------------------------------------------------
H8GN69_METAL/40-142--------------------------------------------------------------------------------
A0KJG8_AERHH/45-146--------------------------------------------------------------------------------
D3VJ33_XENNA/45-146--------------------------------------------------------------------------------
Q028L5_SOLUE/41-145--------------------------------------------------------------------------------
H2ISM7_RAHAC/50-151--------------------------------------------------------------------------------
D5CQ10_SIDLE/43-151--------------------------------------------------------------------------------
Q4KIQ2_PSEF5/43-144--------------------------------------------------------------------------------
B1Y5B2_LEPCP/71-178--------------------------------------------------------------------------------
A9BW99_DELAS/42-143--------------------------------------------------------------------------------
Q7CG65_YERPE/47-148--------------------------------------------------------------------------------
Q1LL52_RALME/51-152--------------------------------------------------------------------------------
C6X923_METGS/42-143--------------------------------------------------------------------------------
F9ZZB9_METMM/41-143--------------------------------------------------------------------------------
F9ZZV9_METMM/42-151--------------------------------------------------------------------------------
B2JLF0_BURP8/42-150--------------------------------------------------------------------------------
G8TDJ1_NIAKG/40-139--------------------------------------------------------------------------------

PF10144

Q65RP6_MANSM/3-163--------------------------------------------------------------------------------
E0SJ77_DICD3/1-160--------------------------------------------------------------------------------
I0DSM4_PROSM/8-168--------------------------------------------------------------------------------
B2VH26_ERWT9/1-160--------------------------------------------------------------------------------
W0I1R9_9ENTR/1-160--------------------------------------------------------------------------------
Q9KPM1_VIBCH/29-174--------------------------------------------------------------------------------
J7TNM2_MORMO/1-162--------------------------------------------------------------------------------
B8F5V9_HAEPS/5-159--------------------------------------------------------------------------------
M4RAC0_BIBTR/9-155--------------------------------------------------------------------------------
A6VR58_ACTSZ/3-159--------------------------------------------------------------------------------
Q327K8_SHIDS/1-160--------------------------------------------------------------------------------
C9R638_AGGAD/5-160--------------------------------------------------------------------------------
Q6LUH0_PHOPR/10-161--------------------------------------------------------------------------------
SMP_YERPE/1-162--------------------------------------------------------------------------------
I2BD21_SHIBC/1-160--------------------------------------------------------------------------------
Q7N909_PHOLL/1-162--------------------------------------------------------------------------------
E6W7K9_PANSA/7-166--------------------------------------------------------------------------------
A3N1M9_ACTP2/4-157--------------------------------------------------------------------------------
AHPA_PASMU/4-161--------------------------------------------------------------------------------
W0LFC6_9ENTR/1-161--------------------------------------------------------------------------------
Q6D9Z7_PECAS/1-160--------------------------------------------------------------------------------
H2IRY9_RAHAC/1-162--------------------------------------------------------------------------------
B4EWX6_PROMH/1-162--------------------------------------------------------------------------------
A7MIG5_CROS8/1-160--------------------------------------------------------------------------------
Q7VNW6_HAEDU/3-158--------------------------------------------------------------------------------
M9X9K5_MANHA/4-157--------------------------------------------------------------------------------
C5B770_EDWI9/1-160--------------------------------------------------------------------------------

PF16736

A8FG45_BACP2/33-146--------------------------------------------------------------------------------
B7GGU1_ANOFW/33-148--------------------------------------------------------------------------------
C3ARI8_BACMY/7-124--------------------------------------------------------------------------------
C5D651_GEOSW/33-148--------------------------------------------------------------------------------
D5DMV7_BACMD/33-152--------------------------------------------------------------------------------
Q9K851_BACHD/33-149--------------------------------------------------------------------------------
PHOR_BACSU/35-140--------------------------------------------------------------------------------
Q3XXG8_ENTFC/34-152--------------------------------------------------------------------------------
Q65G91_BACLD/33-148--------------------------------------------------------------------------------
Q817G3_BACCR/33-149--------------------------------------------------------------------------------
U5LGS8_9BACI/33-151--------------------------------------------------------------------------------

PF09984

A1SSB7_PSYIN/31-175--------------------------------------------------------------------------------
A3QC72_SHELP/37-187--------------------------------------------------------------------------------
Q7N840_PHOLL/33-176--------------------------------------------------------------------------------
F7YLM8_VIBA7/31-174--------------------------------------------------------------------------------
C4K6P8_HAMD5/31-177--------------------------------------------------------------------------------
Q086B5_SHEFN/37-205--------------------------------------------------------------------------------
B7VK74_VIBTL/31-175--------------------------------------------------------------------------------
A1S4D2_SHEAM/37-196--------------------------------------------------------------------------------
D8MW73_ERWBE/31-177--------------------------------------------------------------------------------
H2G0B4_OCESG/31-174--------------------------------------------------------------------------------
W0I1D2_9ENTR/31-178--------------------------------------------------------------------------------
Q2SL29_HAHCH/32-177--------------------------------------------------------------------------------
Q5E319_VIBF1/31-174--------------------------------------------------------------------------------
D4ZAV7_SHEVD/31-180--------------------------------------------------------------------------------
Q47WQ0_COLP3/32-186--------------------------------------------------------------------------------
C7RAG7_KANKD/36-185--------------------------------------------------------------------------------
C4LBR6_TOLAT/31-175--------------------------------------------------------------------------------
A7MQZ7_CROS8/31-177--------------------------------------------------------------------------------
C5B8X7_EDWI9/31-172--------------------------------------------------------------------------------
Q6LMS6_PHOPR/7-150--------------------------------------------------------------------------------
M4UJ25_9GAMM/32-175--------------------------------------------------------------------------------
Q8EBQ2_SHEON/37-185--------------------------------------------------------------------------------
Q6D177_PECAS/31-177--------------------------------------------------------------------------------
D3V545_XENBS/41-184--------------------------------------------------------------------------------
M1FKU9_9ALTE/46-183--------------------------------------------------------------------------------
Q87LP4_VIBPA/31-175--------------------------------------------------------------------------------
A8G9V6_SERP5/31-176--------------------------------------------------------------------------------
A6VUQ0_MARMS/40-181--------------------------------------------------------------------------------
E1SSZ3_FERBD/35-175--------------------------------------------------------------------------------
A7T3Z6_NEMVE/26-157--------------------------------------------------------------------------------
I2B607_SHIBC/31-177--------------------------------------------------------------------------------
Q3IDM7_PSEHT/31-174--------------------------------------------------------------------------------
B2VFZ3_ERWT9/31-177--------------------------------------------------------------------------------
Q12PZ9_SHEDO/59-227--------------------------------------------------------------------------------
E6WGB6_PANSA/31-177--------------------------------------------------------------------------------
H2IUL0_RAHAC/31-176--------------------------------------------------------------------------------
W8UJA6_YEREN/31-176--------------------------------------------------------------------------------
E0SDL9_DICD3/31-174--------------------------------------------------------------------------------
D3VKK3_XENNA/24-166--------------------------------------------------------------------------------
A0KGG8_AERHH/31-175--------------------------------------------------------------------------------
Q4K894_PSEF5/36-169--------------------------------------------------------------------------------

PF13756

G2KMU6_MICAA/84-195--------------------------------------------------------------------------------
J7QN52_METSZ/158-272--------------------------------------------------------------------------------
F7QGB1_9BRAD/146-255--------------------------------------------------------------------------------
N0B6E4_9RHIZ/148-255--------------------------------------------------------------------------------
F2IVA4_POLGS/144-252--------------------------------------------------------------------------------
B8ENZ6_METSB/136-246--------------------------------------------------------------------------------
B1M5P0_METRJ/130-242--------------------------------------------------------------------------------
D5AP59_RHOCB/102-207--------------------------------------------------------------------------------
Q2RNS8_RHORT/101-211--------------------------------------------------------------------------------
Q5FSQ4_GLUOX/140-255--------------------------------------------------------------------------------
Q2WAP8_MAGSA/85-197--------------------------------------------------------------------------------
Q0C2C2_HYPNA/93-201--------------------------------------------------------------------------------
A6WX45_OCHA4/138-252--------------------------------------------------------------------------------
L0EUX7_LIBCB/132-243--------------------------------------------------------------------------------
G8PMZ9_PSEUV/146-255--------------------------------------------------------------------------------
A7HPA2_PARL1/159-269--------------------------------------------------------------------------------
V6F0S4_9PROT/96-208--------------------------------------------------------------------------------
Q0BQN2_GRABC/87-215--------------------------------------------------------------------------------
G4RA13_PELHB/145-254--------------------------------------------------------------------------------
Q0ATL6_MARMM/84-193--------------------------------------------------------------------------------
B8IMT5_METNO/142-250--------------------------------------------------------------------------------
D7A2W2_STAND/143-252--------------------------------------------------------------------------------
B2IJT7_BEII9/132-242--------------------------------------------------------------------------------
B6IV74_RHOCS/141-251--------------------------------------------------------------------------------
G7Z411_AZOL4/86-197--------------------------------------------------------------------------------
Q98CL9_RHILO/133-242--------------------------------------------------------------------------------
Q11CD4_CHESB/133-237--------------------------------------------------------------------------------
E3HZY3_RHOVT/124-231--------------------------------------------------------------------------------
A8ILQ6_AZOC5/131-240--------------------------------------------------------------------------------
G8AZB9_AZOBR/112-225--------------------------------------------------------------------------------
A4YL87_BRASO/141-247--------------------------------------------------------------------------------
C5AX77_METEA/139-250--------------------------------------------------------------------------------
C6XL61_HIRBI/92-192--------------------------------------------------------------------------------
K7SVF5_GLUOY/130-247--------------------------------------------------------------------------------
Q2KE68_RHIEC/148-257--------------------------------------------------------------------------------
V5SAA6_9RHIZ/148-256--------------------------------------------------------------------------------
CHVG_RHIME/115-223--------------------------------------------------------------------------------

PF08473

F6QWC7_HORSE/478-905--------------------------------------------------------------------------------
F7C1C8_XENTR/518-937--------------------------------------------------------------------------------
I3K056_ORENI/608-1035--------------------------------------------------------------------------------
G1KG65_ANOCA/230-674--------------------------------------------------------------------------------
M4AAE3_XIPMA/628-1054--------------------------------------------------------------------------------
I3KAL8_ORENI/601-1029--------------------------------------------------------------------------------
H2UJR2_TAKRU/616-1044--------------------------------------------------------------------------------
Q5TZ68_DANRE/625-1037--------------------------------------------------------------------------------
M4AR04_XIPMA/479-911--------------------------------------------------------------------------------
E7FFD3_DANRE/165-608--------------------------------------------------------------------------------
G3Q8D6_GASAC/592-1007--------------------------------------------------------------------------------
W5NEQ1_LEPOC/557-988--------------------------------------------------------------------------------
F7AR78_XENTR/479-871--------------------------------------------------------------------------------
G3TZG2_LOXAF/466-895--------------------------------------------------------------------------------
H2MK02_ORYLA/591-1020--------------------------------------------------------------------------------
H3B566_LATCH/337-780--------------------------------------------------------------------------------
H3DPE5_TETNG/458-884--------------------------------------------------------------------------------

PF03924

Q07ZB2_SHEFN/82-268--------------------------------------------------------------------------------
D3S982_THISK/96-250--------------------------------------------------------------------------------
S6AG73_9PROT/109-255--------------------------------------------------------------------------------
W0E565_MARPU/91-279--------------------------------------------------------------------------------
G8AIX9_AZOBR/63-252--------------------------------------------------------------------------------
B3E2W3_GEOLS/105-293--------------------------------------------------------------------------------
A7ICB7_XANP2/80-288--------------------------------------------------------------------------------
D5CRF7_SIDLE/79-272--------------------------------------------------------------------------------
K9VNM4_9CYAN/75-223--------------------------------------------------------------------------------
G0A1Y9_METMM/81-266--------------------------------------------------------------------------------
Q478M9_DECAR/83-269--------------------------------------------------------------------------------
G2J2T4_PSEUL/69-261--------------------------------------------------------------------------------
U5NB72_9BURK/101-288--------------------------------------------------------------------------------
M4S773_9ALTE/82-276--------------------------------------------------------------------------------
B7JZX3_CYAP8/87-271--------------------------------------------------------------------------------
E8RE96_DESPD/87-276--------------------------------------------------------------------------------
B2JN77_BURP8/73-261--------------------------------------------------------------------------------
Q87PR0_VIBPA/81-272--------------------------------------------------------------------------------
K9TEX2_9CYAN/81-270--------------------------------------------------------------------------------
K4KIR6_SIMAS/260-441--------------------------------------------------------------------------------
F2J6V0_POLGS/70-258--------------------------------------------------------------------------------
C5BRA4_TERTT/81-226--------------------------------------------------------------------------------
K9VEZ9_9CYAN/87-273--------------------------------------------------------------------------------
C6XQ69_HIRBI/48-235--------------------------------------------------------------------------------
Q12NK9_SHEDO/79-265--------------------------------------------------------------------------------
C7RN12_ACCPU/74-265--------------------------------------------------------------------------------
A1SVU7_PSYIN/82-271--------------------------------------------------------------------------------
A4VRL0_PSEU5/32-220--------------------------------------------------------------------------------
Q4KFI5_PSEF5/87-274--------------------------------------------------------------------------------
D7TAZ7_VITVI/158-355--------------------------------------------------------------------------------
M5DMG3_9GAMM/256-442--------------------------------------------------------------------------------
A7HB30_ANADF/89-270--------------------------------------------------------------------------------
Q6AK77_DESPS/78-262--------------------------------------------------------------------------------
S6AHN4_PSERE/88-272--------------------------------------------------------------------------------
E1SU35_FERBD/70-255--------------------------------------------------------------------------------
Q21TE4_RHOFT/73-261--------------------------------------------------------------------------------
Q3A8D4_PELCD/72-262--------------------------------------------------------------------------------
A1SS75_PSYIN/79-266--------------------------------------------------------------------------------
Q47X60_COLP3/99-279--------------------------------------------------------------------------------
I1XM00_METNJ/105-293--------------------------------------------------------------------------------
Q1CX17_MYXXD/61-251--------------------------------------------------------------------------------
Q3SJ06_THIDA/83-267--------------------------------------------------------------------------------
H5WI28_9BURK/103-291--------------------------------------------------------------------------------
W8LA34_HALHR/60-208--------------------------------------------------------------------------------
F5Y3E0_RAMTT/90-274--------------------------------------------------------------------------------
C4XRZ9_DESMR/92-280--------------------------------------------------------------------------------
Q98FM2_RHILO/70-258--------------------------------------------------------------------------------
Q39ST9_GEOMG/89-277--------------------------------------------------------------------------------
I3Y6Y1_THIV6/74-266--------------------------------------------------------------------------------
Q8P883_XANCP/85-269--------------------------------------------------------------------------------
C1IHU2_POPTR/158-355--------------------------------------------------------------------------------
G8QQ18_AZOSU/87-275--------------------------------------------------------------------------------
Q5NZD4_AROAE/303-495--------------------------------------------------------------------------------
K3XE50_SETIT/143-333--------------------------------------------------------------------------------
A1TR26_ACIAC/80-257--------------------------------------------------------------------------------
K9W8D9_9CYAN/75-222--------------------------------------------------------------------------------
F5Y0M8_RAMTT/91-269--------------------------------------------------------------------------------
A0A068NN91_9BACT/82-269--------------------------------------------------------------------------------
I1YH37_METFJ/59-246--------------------------------------------------------------------------------
Q2N855_ERYLH/71-253--------------------------------------------------------------------------------
D7DIJ0_METV0/86-274--------------------------------------------------------------------------------
Q7MJY8_VIBVY/85-274--------------------------------------------------------------------------------
A1K2L2_AZOSB/65-212--------------------------------------------------------------------------------
I2F3X4_9BACT/312-497--------------------------------------------------------------------------------
Q9KS83_VIBCH/83-275--------------------------------------------------------------------------------
K9VHA2_9CYAN/80-227--------------------------------------------------------------------------------
A4XYI0_PSEMY/82-267--------------------------------------------------------------------------------
F9ZXY2_METMM/258-446--------------------------------------------------------------------------------
Q2SNS1_HAHCH/99-244--------------------------------------------------------------------------------
G8QNF4_AZOSU/93-271--------------------------------------------------------------------------------
H8GLC0_METAL/65-257--------------------------------------------------------------------------------
U4KHJ2_9VIBR/76-268--------------------------------------------------------------------------------
Q2W4V8_MAGSA/89-234--------------------------------------------------------------------------------
U5NAN7_9BURK/101-289--------------------------------------------------------------------------------
U5NEM6_9BURK/87-275--------------------------------------------------------------------------------
Q21F90_SACD2/256-436--------------------------------------------------------------------------------
A1W7N9_ACISJ/80-274--------------------------------------------------------------------------------
K9S6Y7_9CYAN/52-240--------------------------------------------------------------------------------
Q2SEH6_HAHCH/90-278--------------------------------------------------------------------------------
G2IP39_9SPHN/89-271--------------------------------------------------------------------------------
C5CTK8_VARPS/75-260--------------------------------------------------------------------------------
Q47IM3_DECAR/90-277--------------------------------------------------------------------------------
D8IZ22_HERSS/78-273--------------------------------------------------------------------------------
G2KSE9_MICAA/244-435--------------------------------------------------------------------------------
Q5NZA1_AROAE/88-275--------------------------------------------------------------------------------
Q0K510_CUPNH/75-263--------------------------------------------------------------------------------
A1K2I8_AZOSB/87-268--------------------------------------------------------------------------------
A1SAF9_SHEAM/60-243--------------------------------------------------------------------------------
F6HFB2_VITVI/154-335--------------------------------------------------------------------------------
B8GSM8_THISH/76-268--------------------------------------------------------------------------------
I0IHL4_PHYMF/72-260--------------------------------------------------------------------------------
K7U4B4_MAIZE/89-270--------------------------------------------------------------------------------
K0HT62_9BURK/102-281--------------------------------------------------------------------------------
A9WDP6_CHLAA/252-439--------------------------------------------------------------------------------
Q2W8H8_MAGSA/104-299--------------------------------------------------------------------------------
G0AJ72_COLFT/77-272--------------------------------------------------------------------------------
I3YFT5_THIV6/76-268--------------------------------------------------------------------------------
B1M9G3_METRJ/90-278--------------------------------------------------------------------------------
A4G2U1_HERAR/63-263--------------------------------------------------------------------------------
Q7ULL8_RHOBA/92-280--------------------------------------------------------------------------------
Q88L38_PSEPK/87-274--------------------------------------------------------------------------------
G4T144_META2/60-248--------------------------------------------------------------------------------
Q2YCL1_NITMU/85-273--------------------------------------------------------------------------------
K0C646_CYCSP/90-268--------------------------------------------------------------------------------
I3TS71_TISMK/83-268--------------------------------------------------------------------------------
Q1GRC4_SPHAL/74-279--------------------------------------------------------------------------------
C6XE67_METGS/91-266--------------------------------------------------------------------------------
D3RSZ8_ALLVD/110-302--------------------------------------------------------------------------------
I3YBB8_THIV6/60-206--------------------------------------------------------------------------------
B0BZA1_ACAM1/72-256--------------------------------------------------------------------------------
C1DGR9_AZOVD/64-248--------------------------------------------------------------------------------
D8S3K5_SELML/54-234--------------------------------------------------------------------------------
K9XGZ6_9CHRO/81-269--------------------------------------------------------------------------------
B9IAR0_POPTR/350-544--------------------------------------------------------------------------------
C4L7R2_TOLAT/82-274--------------------------------------------------------------------------------
Q114Y4_TRIEI/78-266--------------------------------------------------------------------------------
U5N6G5_9BURK/155-337--------------------------------------------------------------------------------
Q5E4N6_VIBF1/51-241--------------------------------------------------------------------------------
F0ZPG2_DICPU/603-800--------------------------------------------------------------------------------
K9TIK7_9CYAN/87-278--------------------------------------------------------------------------------
A2SKN1_METPP/272-452--------------------------------------------------------------------------------
S6B0V0_9PROT/77-266--------------------------------------------------------------------------------
V6F941_9PROT/76-261--------------------------------------------------------------------------------
B5EJ10_GEOBB/88-276--------------------------------------------------------------------------------
H2FTU6_OCESG/76-255--------------------------------------------------------------------------------
K4A504_SETIT/311-506--------------------------------------------------------------------------------
F0LUC7_VIBFN/75-264--------------------------------------------------------------------------------
Q12H73_POLSJ/65-250--------------------------------------------------------------------------------
B0UGP9_METS4/40-230--------------------------------------------------------------------------------
Q141P4_BURXL/70-258--------------------------------------------------------------------------------
K9TE45_9CYAN/97-244--------------------------------------------------------------------------------
A6VZR0_MARMS/79-265--------------------------------------------------------------------------------
C5BTW1_TERTT/257-438--------------------------------------------------------------------------------
Q2RRT4_RHORT/82-267--------------------------------------------------------------------------------
M4UNQ9_9GAMM/73-254--------------------------------------------------------------------------------
Q0INH2_ORYSJ/83-263--------------------------------------------------------------------------------
Q21FR1_SACD2/95-283--------------------------------------------------------------------------------
V6F4D7_9PROT/86-266--------------------------------------------------------------------------------
B7VPL9_VIBTL/82-271--------------------------------------------------------------------------------
U5W1D5_9ACTN/61-242--------------------------------------------------------------------------------
D2UED2_XANAP/85-269--------------------------------------------------------------------------------
Q47XD7_COLP3/252-452--------------------------------------------------------------------------------
B4RFD4_PHEZH/83-270--------------------------------------------------------------------------------
Q219B0_RHOPB/108-292--------------------------------------------------------------------------------
Q08QK2_STIAD/62-252--------------------------------------------------------------------------------
C4KA21_THASP/254-442--------------------------------------------------------------------------------
A4Y0E4_PSEMY/86-274--------------------------------------------------------------------------------
F6IK42_9SPHN/137-319--------------------------------------------------------------------------------
Q2IJN1_ANADE/84-269--------------------------------------------------------------------------------
D8IR87_HERSS/94-279--------------------------------------------------------------------------------
C1DAE3_LARHH/90-274--------------------------------------------------------------------------------
C6WVK9_METML/84-271--------------------------------------------------------------------------------
A1S3J9_SHEAM/87-273--------------------------------------------------------------------------------
A6WGQ7_KINRD/89-271--------------------------------------------------------------------------------
Q3IF69_PSEHT/252-436--------------------------------------------------------------------------------
Q883N8_PSESM/123-304--------------------------------------------------------------------------------
G4SVS5_META2/83-276--------------------------------------------------------------------------------
I3TTP9_TISMK/93-271--------------------------------------------------------------------------------
L0DVR6_THIND/324-514--------------------------------------------------------------------------------
W1PQ59_AMBTC/159-356--------------------------------------------------------------------------------
W0RB56_9BACT/134-324--------------------------------------------------------------------------------
A9S5U9_PHYPA/114-296--------------------------------------------------------------------------------
C4ZNX8_THASP/71-258--------------------------------------------------------------------------------
H0PUF6_9RHOO/94-283--------------------------------------------------------------------------------
D0J4K2_COMT2/81-267--------------------------------------------------------------------------------
Q6AKV4_DESPS/76-260--------------------------------------------------------------------------------
W5DMW9_WHEAT/37-217--------------------------------------------------------------------------------
Q2W343_MAGSA/76-261--------------------------------------------------------------------------------
DHKA_DICDI/838-1037--------------------------------------------------------------------------------
Q0KC83_CUPNH/84-282--------------------------------------------------------------------------------
G7ZIA9_AZOL4/105-291--------------------------------------------------------------------------------
A1K5S9_AZOSB/253-435--------------------------------------------------------------------------------
G2KLH3_MICAA/276-461--------------------------------------------------------------------------------
F0LYC4_VIBFN/85-270--------------------------------------------------------------------------------
E4U250_SULKY/105-291--------------------------------------------------------------------------------
K9ZW21_DEIPD/84-269--------------------------------------------------------------------------------
D2U8Z5_XANAP/80-263--------------------------------------------------------------------------------
Q2SDA7_HAHCH/285-471--------------------------------------------------------------------------------
K4KJ54_SIMAS/76-256--------------------------------------------------------------------------------
Q9HWR8_PSEAE/80-264--------------------------------------------------------------------------------
G4QFV2_GLANF/57-243--------------------------------------------------------------------------------
Q1GF37_RUEST/79-254--------------------------------------------------------------------------------
G4SUW0_META2/86-274--------------------------------------------------------------------------------
F9ZZJ6_METMM/258-439--------------------------------------------------------------------------------
D9SIV1_GALCS/261-453--------------------------------------------------------------------------------
W1PSE7_AMBTC/96-292--------------------------------------------------------------------------------
W5GD18_WHEAT/393-584--------------------------------------------------------------------------------
M0TSU6_MUSAM/30-211--------------------------------------------------------------------------------
D8IWN5_HERSS/73-261--------------------------------------------------------------------------------
D0KWD4_HALNC/274-462--------------------------------------------------------------------------------
AHK2_ARATH/304-499--------------------------------------------------------------------------------
CYAG_DICDI/88-275--------------------------------------------------------------------------------
K9SC53_9CYAN/81-277--------------------------------------------------------------------------------
D3RTB4_ALLVD/74-266--------------------------------------------------------------------------------
G8AFS0_AZOBR/65-258--------------------------------------------------------------------------------
C7RCU7_KANKD/81-264--------------------------------------------------------------------------------
Q8EJC3_SHEON/87-273--------------------------------------------------------------------------------
M0U7W3_MUSAM/128-319--------------------------------------------------------------------------------
A4VIL7_PSEU5/82-268--------------------------------------------------------------------------------
Q7NXK5_CHRVO/87-272--------------------------------------------------------------------------------
D7KBN9_ARALL/166-363--------------------------------------------------------------------------------
D9SIS9_GALCS/75-263--------------------------------------------------------------------------------
A9TVM0_PHYPA/180-361--------------------------------------------------------------------------------
W0E361_MARPU/83-262--------------------------------------------------------------------------------
K9U3Z3_9CYAN/81-269--------------------------------------------------------------------------------
D4ZFW6_SHEVD/75-265--------------------------------------------------------------------------------
K0I1R5_9BURK/84-233--------------------------------------------------------------------------------
G2J059_PSEUL/87-274--------------------------------------------------------------------------------

PF17151

A8AF72_CITK8/8-194--------------------------------------------------------------------------------
I2B7Y2_SHIBC/35-221--------------------------------------------------------------------------------
A6TB76_KLEP7/37-223--------------------------------------------------------------------------------
YEDQ_ECOLI/41-227--------------------------------------------------------------------------------
YEDQ_SALTY/41-227--------------------------------------------------------------------------------
Q1LHF7_RALME/40-225--------------------------------------------------------------------------------
A7MJL3_CROS8/34-221--------------------------------------------------------------------------------
Q1LM75_RALME/47-231--------------------------------------------------------------------------------
E6WDV9_PANSA/32-218--------------------------------------------------------------------------------

PF10388

Q5WG23_BACSK/282-448--------------------------------------------------------------------------------
Q9KAL0_BACHD/239-405--------------------------------------------------------------------------------
Q8EP65_OCEIH/239-405--------------------------------------------------------------------------------
A8FCM0_BACP2/240-406--------------------------------------------------------------------------------
Q65K95_BACLD/240-406--------------------------------------------------------------------------------
Q5L150_GEOKA/240-405--------------------------------------------------------------------------------
B1HPH4_LYSSC/241-404--------------------------------------------------------------------------------
Q81MP3_BACAN/233-398--------------------------------------------------------------------------------
U5LAK7_9BACI/240-403--------------------------------------------------------------------------------

PF08918

A7MFU1_CROS8/11-189--------------------------------------------------------------------------------
D3VIC4_XENNA/9-185--------------------------------------------------------------------------------
Q2NU19_SODGM/11-189--------------------------------------------------------------------------------
E0SDF9_DICD3/5-184--------------------------------------------------------------------------------
H2IU53_RAHAC/9-187--------------------------------------------------------------------------------
Q7CJ04_YERPE/8-186--------------------------------------------------------------------------------
I2BAB0_SHIBC/10-189--------------------------------------------------------------------------------
B2VDQ4_ERWT9/11-189--------------------------------------------------------------------------------
D3V7Z8_XENBS/1-171--------------------------------------------------------------------------------
J7TLZ1_MORMO/8-188--------------------------------------------------------------------------------
D8MQW1_ERWBE/9-187--------------------------------------------------------------------------------
I0DPC3_PROSM/13-190--------------------------------------------------------------------------------
Q7N3B1_PHOLL/8-189--------------------------------------------------------------------------------
U3U2N0_9ENTR/9-187--------------------------------------------------------------------------------
B4EVF8_PROMH/8-186--------------------------------------------------------------------------------
C5B8C6_EDWI9/13-191--------------------------------------------------------------------------------
A6T7J7_KLEP7/10-189--------------------------------------------------------------------------------
A8GDC5_SERP5/8-186--------------------------------------------------------------------------------
Q6D4E5_PECAS/7-185--------------------------------------------------------------------------------
A8AHT7_CITK8/10-189--------------------------------------------------------------------------------

PF08521

Q21ZH0_RHOFT/35-180--------------------------------------------------------------------------------
A7MHT7_CROS8/21-169--------------------------------------------------------------------------------
D7DMC5_METV0/17-156--------------------------------------------------------------------------------
G4SVN9_META2/19-161--------------------------------------------------------------------------------
D0IYD3_COMT2/45-190--------------------------------------------------------------------------------
K0HXP6_9BURK/21-166--------------------------------------------------------------------------------
Q1LHC0_RALME/34-180--------------------------------------------------------------------------------
V5UEH0_9BURK/16-158--------------------------------------------------------------------------------
W6REE1_9RHIZ/20-162--------------------------------------------------------------------------------
E3HE65_ACHXA/21-162--------------------------------------------------------------------------------
Q7N2B0_PHOLL/22-170--------------------------------------------------------------------------------
D0J851_COMT2/17-157--------------------------------------------------------------------------------
B2FTQ3_STRMK/20-163--------------------------------------------------------------------------------
G4RD40_PELHB/25-169--------------------------------------------------------------------------------
B1XY05_LEPCP/28-171--------------------------------------------------------------------------------
A1W6F7_ACISJ/19-171--------------------------------------------------------------------------------
A7IFI7_XANP2/18-161--------------------------------------------------------------------------------
B1XY62_LEPCP/33-182--------------------------------------------------------------------------------
K0IC76_9BURK/24-165--------------------------------------------------------------------------------
W0PHH3_9BURK/20-166--------------------------------------------------------------------------------
Q47FQ2_DECAR/28-166--------------------------------------------------------------------------------
D5CMP6_SIDLE/20-160--------------------------------------------------------------------------------
A8GH47_SERP5/22-170--------------------------------------------------------------------------------
Q20WQ9_RHOPB/19-153--------------------------------------------------------------------------------
Q607J4_METCA/19-161--------------------------------------------------------------------------------
A2SKN2_METPP/18-155--------------------------------------------------------------------------------
Q47IZ4_DECAR/32-179--------------------------------------------------------------------------------
B4E6M7_BURCJ/17-158--------------------------------------------------------------------------------
C6XAG9_METGS/19-164--------------------------------------------------------------------------------
Q2KVA5_BORA1/16-172--------------------------------------------------------------------------------
E1V7G1_HALED/22-165--------------------------------------------------------------------------------
F4GUR2_PUSST/48-190--------------------------------------------------------------------------------
D8IWK7_HERSS/26-167--------------------------------------------------------------------------------
A9BTX8_DELAS/27-175--------------------------------------------------------------------------------
D9SGQ5_GALCS/25-160--------------------------------------------------------------------------------
G8AZZ8_AZOBR/21-171--------------------------------------------------------------------------------
V9VQU0_9RHOB/24-165--------------------------------------------------------------------------------
M9R6B1_9RHOB/62-203--------------------------------------------------------------------------------
Q122H1_POLSJ/29-174--------------------------------------------------------------------------------
V5UCE1_9BURK/87-233--------------------------------------------------------------------------------
Q1H1R1_METFK/19-157--------------------------------------------------------------------------------
Q4KGR3_PSEF5/19-167--------------------------------------------------------------------------------
C7RKT3_ACCPU/5-153--------------------------------------------------------------------------------
G8QN90_AZOSU/33-180--------------------------------------------------------------------------------
G8PV87_PSEUV/23-165--------------------------------------------------------------------------------
A6W2X9_MARMS/20-171--------------------------------------------------------------------------------
E3HPN1_ACHXA/41-186--------------------------------------------------------------------------------
C1DL46_AZOVD/26-174--------------------------------------------------------------------------------
I3THH3_TISMK/17-162--------------------------------------------------------------------------------
Q47EV6_DECAR/21-164--------------------------------------------------------------------------------
A7IE83_XANP2/18-150--------------------------------------------------------------------------------
G0AJ95_COLFT/18-161--------------------------------------------------------------------------------
E3F5P7_KETVY/20-164--------------------------------------------------------------------------------
D0J2J1_COMT2/28-180--------------------------------------------------------------------------------
A1VLL9_POLNA/25-177--------------------------------------------------------------------------------
G2IUK1_PSEUL/21-170--------------------------------------------------------------------------------
S6AAH4_9PROT/20-166--------------------------------------------------------------------------------
Q8Y1Y8_RALSO/59-201--------------------------------------------------------------------------------
A9I4J5_BORPD/28-184--------------------------------------------------------------------------------
Q13LY1_BURXL/18-164--------------------------------------------------------------------------------
Q21TS3_RHOFT/17-160--------------------------------------------------------------------------------
C7RPR7_ACCPU/26-161--------------------------------------------------------------------------------
S6AAN6_9PROT/19-158--------------------------------------------------------------------------------
Q9I5H2_PSEAE/19-167--------------------------------------------------------------------------------
C5CRC4_VARPS/23-167--------------------------------------------------------------------------------
K0HX06_9BURK/17-156--------------------------------------------------------------------------------
C4ZLE6_THASP/17-178--------------------------------------------------------------------------------
B2JDB3_BURP8/56-201--------------------------------------------------------------------------------
A2SJH0_METPP/17-152--------------------------------------------------------------------------------
G0AFZ6_COLFT/38-197--------------------------------------------------------------------------------
A1TI71_ACIAC/33-170--------------------------------------------------------------------------------
H5WRT2_9BURK/26-164--------------------------------------------------------------------------------
B2U723_RALPJ/34-182--------------------------------------------------------------------------------
D8J290_HERSS/17-158--------------------------------------------------------------------------------
Q2JYY6_RHIEC/22-159--------------------------------------------------------------------------------
A4G8B6_HERAR/45-197--------------------------------------------------------------------------------
A1TW34_ACIAC/23-169--------------------------------------------------------------------------------
A9BY32_DELAS/17-157--------------------------------------------------------------------------------
Q0K946_CUPNH/22-168--------------------------------------------------------------------------------
A1K438_AZOSB/36-181--------------------------------------------------------------------------------
D5UZP4_ARCNC/21-163--------------------------------------------------------------------------------
E1VB88_HALED/19-164--------------------------------------------------------------------------------
D5BND2_PUNMI/39-180--------------------------------------------------------------------------------
B9JD92_AGRRK/17-156--------------------------------------------------------------------------------
G0AH57_COLFT/17-159--------------------------------------------------------------------------------
B0UD46_METS4/18-149--------------------------------------------------------------------------------
Q63Z01_BURPS/17-161--------------------------------------------------------------------------------
A7IHL3_XANP2/20-161--------------------------------------------------------------------------------
H8GIB2_METAL/20-162--------------------------------------------------------------------------------
M4NKF0_9GAMM/25-166--------------------------------------------------------------------------------
I0DPY9_PROSM/22-170--------------------------------------------------------------------------------
H5WKZ5_9BURK/29-178--------------------------------------------------------------------------------
C5CW02_VARPS/30-171--------------------------------------------------------------------------------
Q1LMW7_RALME/18-164--------------------------------------------------------------------------------
A6X4R7_OCHA4/24-167--------------------------------------------------------------------------------
A8I2Y3_AZOC5/2-143--------------------------------------------------------------------------------
D3VKW5_XENNA/22-170--------------------------------------------------------------------------------
C5ACW0_BURGB/16-156--------------------------------------------------------------------------------
F2J3Y9_POLGS/18-160--------------------------------------------------------------------------------
E3HFF1_ACHXA/25-181--------------------------------------------------------------------------------
G8MCL6_9BURK/13-157--------------------------------------------------------------------------------
H2FVD7_OCESG/24-172--------------------------------------------------------------------------------
U3TX11_9ENTR/19-167--------------------------------------------------------------------------------
W8X979_CASDE/29-172--------------------------------------------------------------------------------
A2SBV0_METPP/22-171--------------------------------------------------------------------------------
W0A7F6_9SPHN/28-165--------------------------------------------------------------------------------
D7DK71_METV0/18-149--------------------------------------------------------------------------------
H0PXM1_9RHOO/36-181--------------------------------------------------------------------------------
A8LLA9_DINSH/24-162--------------------------------------------------------------------------------
K0HVR7_9BURK/23-175--------------------------------------------------------------------------------
Q28LK3_JANSC/21-159--------------------------------------------------------------------------------
D7A885_STAND/19-154--------------------------------------------------------------------------------
A4YN24_BRASO/26-168--------------------------------------------------------------------------------
C4ZKZ6_THASP/47-192--------------------------------------------------------------------------------
D8J280_HERSS/20-159--------------------------------------------------------------------------------
B9JZT0_AGRVS/33-177--------------------------------------------------------------------------------
Q92TS1_RHIME/26-169--------------------------------------------------------------------------------
E5AKH4_BURRH/19-158--------------------------------------------------------------------------------
G8MB33_9BURK/27-165--------------------------------------------------------------------------------
B0UNA3_METS4/20-164--------------------------------------------------------------------------------
Q21SM6_RHOFT/22-157--------------------------------------------------------------------------------
G4R8W0_PELHB/23-164--------------------------------------------------------------------------------
Q21RF3_RHOFT/23-167--------------------------------------------------------------------------------
W6RK56_9RHIZ/35-174--------------------------------------------------------------------------------
D7DN59_METV0/25-165--------------------------------------------------------------------------------
Q47GU4_DECAR/25-163--------------------------------------------------------------------------------
Q21VT6_RHOFT/15-158--------------------------------------------------------------------------------
A4VRR5_PSEU5/22-170--------------------------------------------------------------------------------
B1Y781_LEPCP/20-172--------------------------------------------------------------------------------
W8WTJ5_CASDE/25-170--------------------------------------------------------------------------------
Q1LGC3_RALME/22-170--------------------------------------------------------------------------------
Q8P5J0_XANCP/24-166--------------------------------------------------------------------------------
Q2KYE6_BORA1/5-149--------------------------------------------------------------------------------
B2UDU4_RALPJ/26-175--------------------------------------------------------------------------------
G8QM05_AZOSU/19-158--------------------------------------------------------------------------------
A9CHT1_AGRFC/21-163--------------------------------------------------------------------------------
Q12DJ3_POLSJ/2-146--------------------------------------------------------------------------------
D5BMD5_PUNMI/20-162--------------------------------------------------------------------------------
A9BLF0_DELAS/26-166--------------------------------------------------------------------------------
C4ZNL8_THASP/41-186--------------------------------------------------------------------------------
F4GTA9_PUSST/2-157--------------------------------------------------------------------------------
Q63WW7_BURPS/62-207--------------------------------------------------------------------------------
I0HYA8_RUBGI/22-170--------------------------------------------------------------------------------
E0SL95_DICD3/29-176--------------------------------------------------------------------------------
A4G8H3_HERAR/5-148--------------------------------------------------------------------------------
A6W3P7_MARMS/22-165--------------------------------------------------------------------------------
G8MK80_9BURK/17-159--------------------------------------------------------------------------------
C5A845_BURGB/22-162--------------------------------------------------------------------------------
Q0K5I3_CUPNH/61-216--------------------------------------------------------------------------------
Q9PGH7_XYLFA/26-166--------------------------------------------------------------------------------
Q8XYM3_RALSO/18-164--------------------------------------------------------------------------------
Q5P7G5_AROAE/70-215--------------------------------------------------------------------------------
Q0KE80_CUPNH/28-173--------------------------------------------------------------------------------
Q2L1Q3_BORA1/9-150--------------------------------------------------------------------------------
A8I2V4_AZOC5/2-140--------------------------------------------------------------------------------
Q82XD6_NITEU/23-161--------------------------------------------------------------------------------
G0ACP3_COLFT/31-164--------------------------------------------------------------------------------
B2FTU1_STRMK/26-168--------------------------------------------------------------------------------
K0I0K5_9BURK/32-175--------------------------------------------------------------------------------
A1TRJ2_ACIAC/23-175--------------------------------------------------------------------------------
A4XSA9_PSEMY/19-167--------------------------------------------------------------------------------
I7EXC3_PHAIB/24-165--------------------------------------------------------------------------------
A1AYT1_PARDP/20-163--------------------------------------------------------------------------------
A1TUP0_ACIAC/17-156--------------------------------------------------------------------------------
Q13KD9_BURXL/17-159--------------------------------------------------------------------------------
Q1QZL9_CHRSD/20-165--------------------------------------------------------------------------------
C5D1T2_VARPS/20-162--------------------------------------------------------------------------------
Q7VSR2_BORPE/26-171--------------------------------------------------------------------------------
Q5LWY2_RUEPO/23-164--------------------------------------------------------------------------------
C1DBC6_LARHH/23-162--------------------------------------------------------------------------------
Q7VVT9_BORPE/5-149--------------------------------------------------------------------------------
A1WEU1_VEREI/23-167--------------------------------------------------------------------------------
B2FUF4_STRMK/20-162--------------------------------------------------------------------------------
Q984L4_RHILO/18-155--------------------------------------------------------------------------------
M4S398_9SPHN/10-147--------------------------------------------------------------------------------
Q2SLI2_HAHCH/66-216--------------------------------------------------------------------------------
Q1GD00_RUEST/23-161--------------------------------------------------------------------------------
C5A8I2_BURGB/27-165--------------------------------------------------------------------------------
F6AA71_PSEF1/20-167--------------------------------------------------------------------------------
F5Y2Y3_RAMTT/23-167--------------------------------------------------------------------------------
B8IFI3_METNO/20-162--------------------------------------------------------------------------------
B9JLB1_AGRRK/22-164--------------------------------------------------------------------------------
A6VW98_MARMS/41-182--------------------------------------------------------------------------------
Q1QXK5_CHRSD/22-163--------------------------------------------------------------------------------
I0HPY4_RUBGI/21-160--------------------------------------------------------------------------------
F5XYY8_RAMTT/17-156--------------------------------------------------------------------------------
S6AMF6_PSERE/19-167--------------------------------------------------------------------------------
G0AFU1_COLFT/36-184--------------------------------------------------------------------------------
C5CP05_VARPS/19-171--------------------------------------------------------------------------------
H5WRA6_9BURK/20-174--------------------------------------------------------------------------------
Q63MF1_BURPS/18-161--------------------------------------------------------------------------------
D5X6A3_THIK1/38-189--------------------------------------------------------------------------------
F5Y4Y9_RAMTT/21-173--------------------------------------------------------------------------------
B4EL38_BURCJ/24-165--------------------------------------------------------------------------------
G7ZCI7_AZOL4/27-176--------------------------------------------------------------------------------
Q164X8_ROSDO/23-163--------------------------------------------------------------------------------
H8L6H6_FRAAD/33-174--------------------------------------------------------------------------------
A1VTK5_POLNA/19-162--------------------------------------------------------------------------------
D2UE67_XANAP/29-171--------------------------------------------------------------------------------
V5UAY1_9BURK/20-161--------------------------------------------------------------------------------
B4EIF9_BURCJ/19-168--------------------------------------------------------------------------------
D8IY76_HERSS/23-171--------------------------------------------------------------------------------

PF17200

A0L3P0_MAGMM/40-183--------------------------------------------------------------------------------
A1S653_SHEAM/40-186--------------------------------------------------------------------------------
A3QE36_SHELP/40-191--------------------------------------------------------------------------------
A4JSR8_BURVG/33-185--------------------------------------------------------------------------------
A4YR51_BRASO/71-224--------------------------------------------------------------------------------
A5G9N9_GEOUR/56-221--------------------------------------------------------------------------------
A5MZ77_CLOK5/52-216--------------------------------------------------------------------------------
A6LNC2_THEM4/37-187--------------------------------------------------------------------------------
A6W0M2_MARMS/47-194--------------------------------------------------------------------------------
A7GXL0_CAMC5/45-199--------------------------------------------------------------------------------
A8FA00_BACP2/42-204--------------------------------------------------------------------------------
A8H430_SHEPA/40-193--------------------------------------------------------------------------------
B1KDS9_SHEWM/40-192--------------------------------------------------------------------------------
B3PF36_CELJU/33-187--------------------------------------------------------------------------------
B8DJX7_DESVM/47-201--------------------------------------------------------------------------------
B8FHC1_DESAA/48-205--------------------------------------------------------------------------------
C0ZKG6_BREBN/43-206--------------------------------------------------------------------------------
C4IB20_CLOBU/48-199--------------------------------------------------------------------------------
C5AI41_BURGB/33-185--------------------------------------------------------------------------------
D3G0H7_BACPE/41-204--------------------------------------------------------------------------------
D4H8R2_DENA2/45-194--------------------------------------------------------------------------------
D6XXT0_BACIE/37-200--------------------------------------------------------------------------------
F2G8C7_ALTMD/38-188--------------------------------------------------------------------------------
F2JZQ2_MARM1/41-189--------------------------------------------------------------------------------
F6DRU7_DESRL/49-202--------------------------------------------------------------------------------
G2THG8_BACCO/43-205--------------------------------------------------------------------------------
G8MDC4_9BURK/45-197--------------------------------------------------------------------------------
I0GNI0_SELRL/45-198--------------------------------------------------------------------------------
Q896P7_CLOTE/42-204--------------------------------------------------------------------------------

PF08269

A8EUE0_ARCB4/33-326--------------------------------------------------------------------------------
B3E6F6_GEOLS/35-327--------------------------------------------------------------------------------
B6BID4_SULGG/36-307--------------------------------------------------------------------------------
B6BJK6_SULGG/33-333--------------------------------------------------------------------------------
B7VLV5_VIBTL/35-322--------------------------------------------------------------------------------
B8FJE3_DESAA/34-358--------------------------------------------------------------------------------
B8FNF8_DESAA/36-333--------------------------------------------------------------------------------
B9LZD3_GEODF/40-338--------------------------------------------------------------------------------
C4XHF5_DESMR/36-364--------------------------------------------------------------------------------
C6BU22_DESAD/28-341--------------------------------------------------------------------------------
C6BVV5_DESAD/30-331--------------------------------------------------------------------------------
C6BYJ2_DESAD/31-323--------------------------------------------------------------------------------
C6BYQ1_DESAD/28-326--------------------------------------------------------------------------------
C7LTF2_DESBD/37-333--------------------------------------------------------------------------------
D1B4Y3_SULD5/33-335--------------------------------------------------------------------------------
D1B584_SULD5/36-331--------------------------------------------------------------------------------
D4H1L4_DENA2/32-324--------------------------------------------------------------------------------
D4H3I8_DENA2/38-333--------------------------------------------------------------------------------
D4H596_DENA2/35-327--------------------------------------------------------------------------------
D4H6Q5_DENA2/30-348--------------------------------------------------------------------------------
D5V1U1_ARCNC/34-335--------------------------------------------------------------------------------
D5V2A1_ARCNC/30-322--------------------------------------------------------------------------------
D5V3A4_ARCNC/37-339--------------------------------------------------------------------------------
D5V3C7_ARCNC/36-334--------------------------------------------------------------------------------
D5V4P6_ARCNC/34-297--------------------------------------------------------------------------------
D5V4Y2_ARCNC/40-319--------------------------------------------------------------------------------
E1R464_SPISS/40-311--------------------------------------------------------------------------------
E6VS07_DESAO/37-301--------------------------------------------------------------------------------
E6W5X0_DESIS/41-338--------------------------------------------------------------------------------
E8RBS9_DESPD/29-287--------------------------------------------------------------------------------
E8RC22_DESPD/44-317--------------------------------------------------------------------------------
F0JKB1_DESDE/34-312--------------------------------------------------------------------------------
F2K254_MARM1/36-332--------------------------------------------------------------------------------
F2LTM5_HIPMA/26-310--------------------------------------------------------------------------------
F2LUQ6_HIPMA/35-337--------------------------------------------------------------------------------
H2J6M5_MARPK/30-340--------------------------------------------------------------------------------
Q2SG38_HAHCH/40-346--------------------------------------------------------------------------------
Q30Q08_SULDN/33-332--------------------------------------------------------------------------------
Q30XR6_DESAG/39-337--------------------------------------------------------------------------------
Q47JH8_DECAR/47-342--------------------------------------------------------------------------------
Q6AMC2_DESPS/35-333--------------------------------------------------------------------------------
Q7M809_WOLSU/66-363--------------------------------------------------------------------------------
Q7MJL5_VIBVY/36-329--------------------------------------------------------------------------------

PF13777

C3KQ81_RHISN/249-440--------------------------------------------------------------------------------
G7MAX1_9CLOT/244-433--------------------------------------------------------------------------------
R6C9R7_9CLOT/244-433--------------------------------------------------------------------------------
R7XSF7_9ACTN/603-792--------------------------------------------------------------------------------
E9T3K9_RHOHA/262-453--------------------------------------------------------------------------------
Q98E42_RHILO/209-400--------------------------------------------------------------------------------
W0RDV6_9BACT/257-448--------------------------------------------------------------------------------
C0ZMG5_RHOE4/260-451--------------------------------------------------------------------------------
Q0S6K1_RHOJR/253-444--------------------------------------------------------------------------------
A0Q168_CLONN/254-440--------------------------------------------------------------------------------
C6Y2K4_PEDHD/270-457--------------------------------------------------------------------------------
F0T1D6_SYNGF/255-442--------------------------------------------------------------------------------
H6NQQ1_9BACL/283-470--------------------------------------------------------------------------------
R5XNB3_9CLOT/251-445--------------------------------------------------------------------------------
R5B5Y8_9CLOT/255-441--------------------------------------------------------------------------------
D9TC52_MICAI/510-701--------------------------------------------------------------------------------
E6XBP3_CELAD/234-418--------------------------------------------------------------------------------
A5N2Q6_CLOK5/255-444--------------------------------------------------------------------------------
B8I1S1_CLOCE/282-473--------------------------------------------------------------------------------
D7AWB3_NOCDD/181-372--------------------------------------------------------------------------------
R5KUL7_9FIRM/249-445--------------------------------------------------------------------------------
E6UHQ5_RUMA7/288-478--------------------------------------------------------------------------------
D3PW34_STANL/613-804--------------------------------------------------------------------------------
A4FEG4_SACEN/91-282--------------------------------------------------------------------------------
G8SFI8_ACTS5/276-465--------------------------------------------------------------------------------
C7N5K6_SLAHD/273-462--------------------------------------------------------------------------------
B1MNA6_MYCA9/278-469--------------------------------------------------------------------------------
A0A068NWS3_9BACT/247-436--------------------------------------------------------------------------------
R5F1N2_9CLOT/272-455--------------------------------------------------------------------------------
B2IDT0_BEII9/251-442--------------------------------------------------------------------------------
G2NPR4_STREK/332-522--------------------------------------------------------------------------------
R5QH46_9FIRM/290-468--------------------------------------------------------------------------------
M1MGT2_9CLOT/247-436--------------------------------------------------------------------------------
I0H5I7_ACTM4/429-619--------------------------------------------------------------------------------
W6RZ80_9CLOT/366-546--------------------------------------------------------------------------------
R5H180_9FIRM/290-487--------------------------------------------------------------------------------
G8PM39_PSEUV/250-436--------------------------------------------------------------------------------
R5K472_9CLOT/342-524--------------------------------------------------------------------------------
R6BZX2_9CLOT/239-418--------------------------------------------------------------------------------
D4JS87_9FIRM/295-487--------------------------------------------------------------------------------
D5UCX5_CELFN/360-549--------------------------------------------------------------------------------
R4SPS0_AMYOR/287-478--------------------------------------------------------------------------------
B1VXS3_STRGG/257-449--------------------------------------------------------------------------------
R6GYN0_9FIRM/86-276--------------------------------------------------------------------------------
A9B338_HERA2/243-432--------------------------------------------------------------------------------
W5W7G3_9PSEU/246-437--------------------------------------------------------------------------------
D4IVT0_BUTFI/290-484--------------------------------------------------------------------------------
D3PWK7_STANL/231-422--------------------------------------------------------------------------------
K0B5G9_CLOA9/354-542--------------------------------------------------------------------------------
E3E7I0_PAEPS/267-456--------------------------------------------------------------------------------
Q82KE7_STRAW/354-544--------------------------------------------------------------------------------
F4H262_CELFA/231-421--------------------------------------------------------------------------------
E8N655_ANATU/246-436--------------------------------------------------------------------------------
V6KEH8_STRNV/234-424--------------------------------------------------------------------------------
R6TE55_9FIRM/266-457--------------------------------------------------------------------------------
W0AIE6_9SPHN/232-423--------------------------------------------------------------------------------
R6W355_9FIRM/265-455--------------------------------------------------------------------------------
D4Z7L7_SPHJU/247-438--------------------------------------------------------------------------------
I2EQT1_EMTOG/254-441--------------------------------------------------------------------------------
W8F0C6_9BACT/283-468--------------------------------------------------------------------------------
A4YUY5_BRASO/248-439--------------------------------------------------------------------------------
E8UC72_DEIML/268-459--------------------------------------------------------------------------------
R7IRN0_9CLOT/239-416--------------------------------------------------------------------------------
E1QWA8_OLSUV/251-439--------------------------------------------------------------------------------
X4ZBM1_9BACL/265-454--------------------------------------------------------------------------------
F4B1V9_DOKS4/233-412--------------------------------------------------------------------------------
B4RCQ4_PHEZH/234-425--------------------------------------------------------------------------------
R5EMU4_9FIRM/249-439--------------------------------------------------------------------------------
R7R1A9_9FIRM/272-456--------------------------------------------------------------------------------
U5WC64_9ACTN/287-478--------------------------------------------------------------------------------
Q67L49_SYMTH/271-462--------------------------------------------------------------------------------
R5D507_9FIRM/251-441--------------------------------------------------------------------------------
R6RSY2_9FIRM/254-446--------------------------------------------------------------------------------
H8MFN4_CORCM/293-481--------------------------------------------------------------------------------
R5SVS6_9CLOT/268-452--------------------------------------------------------------------------------
J9QZX6_RIEAN/237-416--------------------------------------------------------------------------------
D4LA20_RUMC1/300-490--------------------------------------------------------------------------------
G8TL52_NIAKG/267-454--------------------------------------------------------------------------------
G2SX70_ROSHA/263-449--------------------------------------------------------------------------------
R6TUD3_9FIRM/272-462--------------------------------------------------------------------------------
K0F269_9NOCA/594-785--------------------------------------------------------------------------------
F6ERY8_AMYSD/613-803--------------------------------------------------------------------------------
L7W1T5_NONDD/237-418--------------------------------------------------------------------------------
C6WHR6_ACTMD/262-453--------------------------------------------------------------------------------
R7MZW7_9FIRM/280-462--------------------------------------------------------------------------------
N0B1B5_9BACI/281-461--------------------------------------------------------------------------------
R6PDC4_9CLOT/247-432--------------------------------------------------------------------------------
D2AQJ9_STRRD/903-1097--------------------------------------------------------------------------------
R5YBQ5_9FIRM/178-364--------------------------------------------------------------------------------
H6QYH8_NOCCG/169-360--------------------------------------------------------------------------------
E6TQQ3_BACCJ/245-429--------------------------------------------------------------------------------
F2JL51_CELLD/281-469--------------------------------------------------------------------------------
E6SEY9_INTC7/638-828--------------------------------------------------------------------------------
R7F7D0_9CLOT/250-431--------------------------------------------------------------------------------
R6EB38_9FIRM/274-453--------------------------------------------------------------------------------
V4KM56_9ACTN/360-550--------------------------------------------------------------------------------
D4KWN4_9FIRM/288-472--------------------------------------------------------------------------------
E3GN91_EUBLK/263-454--------------------------------------------------------------------------------
W0ECJ4_9FIRM/268-456--------------------------------------------------------------------------------
R7MJC2_9FIRM/282-470--------------------------------------------------------------------------------
K0K8I5_SACES/209-399--------------------------------------------------------------------------------
Q89D27_BRADU/262-453--------------------------------------------------------------------------------
R6UCJ7_9CLOT/455-646--------------------------------------------------------------------------------
Q1GM10_RUEST/279-463--------------------------------------------------------------------------------
R7AK92_9BACE/280-471--------------------------------------------------------------------------------
F4L546_HALH1/255-442--------------------------------------------------------------------------------
C4ZHR4_EUBR3/312-491--------------------------------------------------------------------------------
G0FWF9_AMYMS/284-475--------------------------------------------------------------------------------

PF13687

A5FJU0_FLAJ1/158-383--------------------------------------------------------------------------------
A6TSA5_ALKMQ/158-379--------------------------------------------------------------------------------
A7MGD0_CROS8/150-384--------------------------------------------------------------------------------
A8ERI3_ARCB4/155-375--------------------------------------------------------------------------------
A8MH61_ALKOO/160-381--------------------------------------------------------------------------------
B0S2T1_FINM2/160-383--------------------------------------------------------------------------------
B8D209_HALOH/160-380--------------------------------------------------------------------------------
C6VYZ6_DYAFD/159-380--------------------------------------------------------------------------------
C6X615_FLAB3/156-381--------------------------------------------------------------------------------
C6XYG5_PEDHD/160-384--------------------------------------------------------------------------------
C7NDW6_LEPBD/156-378--------------------------------------------------------------------------------
C8VXT5_DESAS/157-383--------------------------------------------------------------------------------
C9LW42_SELS3/156-375--------------------------------------------------------------------------------
D2RK10_ACIFV/155-369--------------------------------------------------------------------------------
Q0AX67_SYNWW/157-383--------------------------------------------------------------------------------
Q11HD8_CHESB/167-394--------------------------------------------------------------------------------
Q21MZ4_SACD2/153-391--------------------------------------------------------------------------------
Q24YZ8_DESHY/157-383--------------------------------------------------------------------------------
Y1469_PASMU/133-357--------------------------------------------------------------------------------
M9WU31_MANHA/141-357--------------------------------------------------------------------------------
YHGE_ECOLI/150-389--------------------------------------------------------------------------------
R5MAA3_9BACE/165-386--------------------------------------------------------------------------------
R5TAF8_9FIRM/157-369--------------------------------------------------------------------------------

PF17202

R5PDZ8_9CLOT/73-178----------LCR----------DDVSYEF..........I.........DS----L...K----K--------D.....
D9SR59_CLOC7/75-181----------DNL----------INEDNEF..........V.........DF----V...K----E--------Q.....
R5LDM7_9FIRM/84-188----------HYL----------TN.DF............I.........DN----I...K----E--------D.....
A0A077LEG7_9PSED/107-217----------QPL----------NN.EFSE..........V.........DD----F...R----R--------L.....
R7K182_9CLOT/75-183----------YNI----------SQSETL...........V.........DT----I...K----E--------E.....
R7C785_9CLOT/80-187----------TML----------SG.NYKL..........V.........DQ----L...K----D--------E.....
D4GNY8_PANAM/110-221----------KTL----------NL.DQIA..........V.........DD----F...T----D--------R.....
R6ESX9_9FIRM/33-139----------LEK----------DDISYQF..........I.........DS----L...Q----D--------E.....
D9SR58_CLOC7/75-181----------KNP----------LHDIVGI..........I.........DK----V...K----E--------Q.....
A1TTT5_ACIAC/43-151----------RVL----------NG.DFAA..........I.........DR----F...T----A--------Q.....
C6C0L3_DESAD/124-227----------FD.----------......I..........V.........DD----L...K----K--------E.....
Q2SCQ8_HAHCH/105-216----------TPL----------AGNYTAV....................DN----F...A----S--------A.....
U5LHG9_9BACI/81-186----------ALL----------ND.NYEI..........V.........DE----I...A----E--------D.....
I4MQL7_9BURK/106-217----------MLL----------NG.DNSE..........A.........DS----F....----H--------L.....
A5GDW0_GEOUR/197-301----------DKI----------NN.DPNL..........S.........FQ----I...Q----E--------I.....
M1E435_9FIRM/183-288----------MMI----------SG.STSI..........V.........DQ----I...K----E--------K.....
C3K447_PSEFS/107-217----------DLL----------NN.NFDK..........V.........DE----F...K----Q--------M.....
A5G6W5_GEOUR/211-327----------TLL----------NG.NNVL..........V.........DK----I...K----R--------I.....
I0H0J9_ACTM4/128-247----------TDP----------GR.TTPF..........V.........DD----V...E----E--------L.....
D4H841_DENA2/120-233----------KPV----------MD.NSAL..........M.........DH----FVKST----N--------T.....
R5SF85_9CLOT/154-260----------VSI----------SGNTDL...........I.........DA----L...K----K--------R.....
Q8XUQ0_RALSO/115-227----------TAM----------NL.DFAI..........P.........DK----F...F----A--------R.....
C7RJ95_ACCPU/102-216----------KLL----------NG.RTTE..........V.........DA----I...V----A--------A.....
G4RG36_PELHB/93-201----------...----------...DNAL..........I.........DK----I...T----Q--------V.....
R7H980_9FIRM/84-190----------YNL----------NSNNQT...........I.........DD----F...K----K--------K.....
B1KL49_SHEWM/217-338----------ILF----------NR.DIRI..........V.........DH----I...R----D--------L.....
C7LSE2_DESBD/126-226----------TG.----------......I..........V.........DK----V...Q----Y--------M.....
Q0K178_CUPNH/214-328----------TLL----------NH.NLGF..........I.........DT----I...N----A--------L.....
R7BD52_9FIRM/83-182----------FNI----------SRNTQI...........F.........DE----L...T----R--------E.....
R6KC51_9FIRM/187-293----------TNL----------SQ.KQDG..........I.........DK----Y...I----.--------......
A9DH49_9RHIZ/90-198----------...----------...SHEM..........I.........DT----V...G----R--------M.....
U5N9Z9_9BURK/111-222----------QPL----------NA.EFAL..........V.........DQ----Y...T----S--------N.....
G4KZG5_OSCVS/79-190----------RSI----------DG.EYDY..........I.........DR----L...S----Q--------S.....
B2A0N4_NATTJ/81-187----------TPV----------HTLDDV...........L.........DE----F...H----E--------K.....
D7DTL6_METV3/203-310----------VDI----------LNKDNNL..........V.........DK----A...K----E--------V.....
F3Z2D9_DESAF/126-237----------VDP----------AR.PTPL..........V.........DK----L...R----T--------L.....
W0IVA8_9BACT/105-215----------TPV----------AL.DFEI..........V.........DQ----L...V----R--------L.....
B9JP39_AGRRK/218-334----------ILL----------NQ.NLAF..........V.........DT----I...N----D--------L.....
D8J016_HERSS/116-227----------HEL----------NL.DFSI..........P.........DR----F...T----A--------K.....
C5AA15_BURGB/110-221----------RVL----------DM.DFSI..........P.........DE----F...L----A--------R.....
X2GSB3_9BACI/75-182----------VKI----------VG.NFDI..........V.........DK----L...S----K--------L.....
D7DT69_METV3/191-294----------DFL----------NKDAYVL....................DK----I...Q----R--------N.....
A4GAL6_HERAR/223-338----------TLL----------NQ.NLGF..........V.........DT----I...N----S--------L.....
Q2FU40_METHJ/105-215----------YRV----------NN.NFEI..........V.........DE----V...Q----E--------L.....
Q7M944_WOLSU/110-221----------ESL----------VM.NFRS..........V.........DL----F...T----Q--------K.....
Q6D133_PECAS/110-221----------TVL----------NL.NTDV..........T.........DD----F...L----S--------R.....
Q0W406_METAR/195-302----------ADL----------QNNQNEL..........V.........DQ----V...G----E--------A.....
M1N767_9CLOT/176-278----------YRL----------DS.DNVV....................DY----I...K----E--------K.....
Q3A4X2_PELCD/126-243----------TQA----------EE.VTPL..........V.........DK----V...Y----E--------L.....
C8X5F8_DESRD/131-248----------QSF----------SR.NVPL..........V.........DQ----V...Q----N--------L.....
D3RUE8_ALLVD/81-192----------QPV----------AD.HFDL..........V.........DT----L...S----R--------E.....
C6BZS5_DESAD/173-278----------TSL----------S..DKDF..........V.........DD----V...K----Q--------F.....
D5V2F9_ARCNC/106-215----------TLL----------NN.NFEP..........L.........EK----Y...T----Q--------T.....
B8FF41_DESAA/197-313----------FLL----------NK.DTQI..........V.........DK----I...G----E--------T.....
R7C7X6_9CLOT/79-185----------TEI----------TS.DYRI..........L.........DD----I...K----N--------D.....
A4W5S4_ENT38/109-220----------TEL----------HE.NNTF..........S.........DD----F...L----N--------R.....
F9TD33_9VIBR/108-219----------ESL----------IG.DTKL..........V.........DS----F...T----R--------D.....
A4VNM3_PSEU5/150-260----------APL----------NN.DFSV..........V.........DD----F...R----E--------M.....
J7IZ74_DESMD/74-180----------TKI----------NL.NNEL..........V.........DH----L...S----R--------L.....
D5WTF7_KYRT2/150-257----------QKV----------SG.NEQF..........L.........AQ----L...T----Q--------F.....
R6CC53_9CLOT/83-190----------QDI----------TSDYSV...........I.........DK----F...H----E--------N.....
I7EZR3_PHAIB/193-308----------RLL----------NR.DLDF..........I.........DT----I...N----A--------L.....
B5EED7_GEOBB/207-322----------VLL----------NN.NQKL..........V.........DR----I...R----S--------V.....
G8M385_CLOCD/77-182----------NQV----------DN.SFNV..........L.........DE----I...K----E--------K.....
R6LTR5_9CLOT/88-195----------YNV----------SLSQKL...........V.........VE----M...S----E--------K.....
H1YZJ5_9EURY/105-216----------YIV----------ND.NFEV..........V.........DL----V...R----E--------L.....
B8FKI9_DESAA/130-248----------TKF----------TA.PSPL..........V.........DD----I...T----D--------L.....
B8I594_CLOCE/73-179----------HVV----------NE.DTQF..........V.........DN----I...K----K--------S.....
B3EAL1_GEOLS/77-181----------YQI----------NN.NFEI..........P.........DK----V...K----E--------L.....
M1WWC3_DESPC/126-238----------ADP----------NK.TTPM..........V.........DE----I...M----R--------M.....
Q8EC62_SHEON/106-217----------EQL----------NA.SKSK..........V.........DR----F...A----N--------L.....
I4D1S2_DESAJ/74-180----------EKI----------NL.NNNL..........V.........DH----L...S----S--------L.....
G1UPC0_9DELT/173-278----------TSL----------VT.PP.Y..........L.........DW----L...K----K--------L.....
B9M7S8_GEODF/192-295----------DKI----------NN.DPYL..........P.........FQ----I...Q----E--------I.....
F2G5X9_ALTMD/102-211----------APQ----------AN.SFDL..........V.........DS----L...T----E--------V.....
B4EIX9_BURCJ/110-221----------QPL----------DL.DYSI..........P.........DQ----F...L----K--------K.....
E1QD66_DESB2/210-326----------VLL----------SR.DKAI..........V.........DT----V...G----Q--------T.....
A6TKU1_ALKMQ/78-189----------NNI----------EG.NNEM..........V.........DA----I...L----K--------D.....
A0A075WRZ3_9BACT/93-200----------...----------...TNDV..........C.........DR----F...T----A--------I.....
R5WDE4_9CLOT/85-192----------YNI----------TKNEAM...........I.........DG----F...T----E--------G.....
K4LEA6_THEPS/75-179----------TLM----------NG.NNQA..........V.........DK----I...G----E--------L.....
R7IWW0_9FIRM/75-184----------YNI----------SKSENL...........V.........DN----I...K----S--------K.....
Q4K3U8_PSEF5/107-217----------VVL----------NN.NFAE..........V.........DQ----F...K----Q--------M.....
G8QPI6_AZOSU/105-210----------RPQ----------AL.ETAL..........V.........DS----V...S----G--------I.....
G7Z711_AZOL4/82-189----------VVM----------ND.NNVV..........V.........DK----I...K----R--------I.....
R7N8R2_9FIRM/73-179----------FDV----------TNATEI...........A.........DH----V...K----S--------A.....
G8ASR9_AZOBR/219-334----------VLL----------NG.NQGI..........V.........DR----L...N----T--------I.....
R5EKY7_9CLOT/77-185----------KDI----------TD.DYEL..........L.........DQ----I...K----E--------Q.....
Q31M73_SYNE7/126-244----------SRF----------DQ.AVPV..........I.........DT----V...S----R--------Q.....
Q3A5N0_PELCD/126-244----------ADI----------TR.ESPI..........V.........DQ----V...Q----K--------T.....
A8EX26_ARCB4/102-212----------IIL----------NK.NNEL..........I.........DE----F...T----K--------T.....
R5JUW9_9CLOT/66-172----------LAR----------DEVSYDF..........I.........DS----L...Q----D--------E.....
A0A068JJ25_9DELT/173-278----------FDL----------G..NFQF..........V.........DE----L...K----K--------R.....
R6DFM0_9CLOT/76-184----------YNV----------SKSEAL...........L.........DK----I...S----N--------N.....
C4Z687_EUBE2/126-233----------EEL----------TI.KPAA..........L.........DI----Y...V----K--------N.....
R6EK08_9FIRM/92-198----------VAI----------SGDTQL...........I.........DG----L...Q----E--------K.....
Q8P8Q8_XANCP/84-195----------KSQ----------AN.VFDM..........L.........DD----V...T----A--------I.....
E3DR17_HALPG/78-184----------TLM----------NE.NYQL..........V.........DK----I...G----R--------L.....
W0E6D6_MARPU/81-192----------KAI----------RE.RVGL..........V.........DR----L...S----N--------D.....
E1QEE0_DESB2/135-253----------RDP----------AR.PSAI..........V.........DG----V...S----Q--------V.....
F6DQL7_DESRL/85-189----------VCM----------NN.NNLI..........V.........DK----I...G----R--------M.....
B5EET6_GEOBB/72-178----------VTL----------DG.DNAL..........T.........DR----M...K----E--------I.....
G8QHB1_AZOSU/108-213----------EVL----------NA.NRKM..........L.........LA----F...Q----E--------L.....
C6WF37_ACTMD/137-256----------RDQ----------ST.PTPL..........V.........DD----I...R----S--------M.....
C4XN19_DESMR/213-318----------QDL----------SN.NSTL..........V.........DG----V...K----K--------D.....
R5R3V5_9FIRM/219-325----------VLI----------TGDNKL...........I.........DA----L...K----E--------R.....
J1ATF6_9EURY/105-215----------YVI----------ND.NFEI..........V.........DQ----V...Q----S--------L.....
B2VCW3_ERWT9/110-221----------RTL----------NL.DQVL..........V.........DD----F...Q----Q--------R.....
Q07W74_SHEFN/224-344----------MLF----------NH.NTDI..........V.........DN----I...R----D--------L.....
A9KHQ9_CLOPH/86-194----------QHI----------SGDHRL...........V.........DS----I...K----A--------S.....
K4MGY8_9EURY/99-209----------YVV----------NN.NFEI..........V.........DN----V...K----N--------M.....
R6K7N5_9FIRM/73-182----------YNV----------SKSESL...........V.........DG----I...K----Q--------N.....
Q8P9I9_XANCP/109-220----------QAQ----------NL.NFTA..........V.........DR----F...A----Q--------A.....
B6BNF9_SULGG/103-215----------AVI----------NN.NFAK..........I.........EE----F...T----K--------L.....
R5NMM9_9FIRM/113-219----------YRI----------TNNNTMI....................DA----I...K----K--------K.....
I4EZV9_MODMB/131-249----------ADV----------AT.PTPV..........V.........DQ----V...Q----S--------L.....
A8H262_SHEPA/106-216----------EQI----------NA.SKSK..........V.........DR----Y...S----N--------L.....
T2GE62_DESGI/173-279----------FEL----------SG.NEKL..........V.........DS----I...K----D--------L.....
Q6APL6_DESPS/127-230----------TG.----------......Y..........I.........DS----V...A----H--------L.....
I4DB95_DESAJ/75-180----------SIL----------NS.T.DI..........V.........DQ----I...G----K--------L.....
G8AW72_AZOBR/78-185----------VKL----------DG.ANDI..........V.........DT----V...R----S--------V.....
R7A1X1_9FIRM/85-192----------YQL----------NG.DFSI..........I.........DS----V...K----E--------K.....
C6PVG9_9CLOT/79-184----------KIL----------NE.DTEL..........V.........DN----I...K----T--------D.....
A1B979_PARDP/201-316----------ILL----------NR.NLSV..........V.........DS----I...N----A--------L.....
J7J3G2_DESMD/75-179----------RVI----------ND.S.TI..........V.........DQ----I...G----E--------L.....
C5CXU1_VARPS/109-222----------TQI----------NGASTSE..........V.........DA----F...A----R--------D.....
Q6LZ41_METMP/177-282----------DIL----------NN.NNEI..........V.........DQ----V...K----A--------D.....
R7BG86_9FIRM/73-182----------YNV----------SKSESL...........V.........DR----I...K----S--------N.....
G0AIH2_COLFT/110-220----------DAI----------NM.NFSV..........A.........DS----F...T----S--------A.....
E1QGT6_DESB2/126-231----------FE.----------......A..........V.........DR----I...K----S--------L.....
E3PU45_CLOSD/79-190----------IAI----------AG.QYDY..........I.........DK----L...S----D--------S.....
I0GPD1_SELRL/73-177----------YKI----------NG.DEDL..........V.........DD----L...G----K--------V.....
D2SAB0_GEOOG/128-246----------TDP----------AQ.PTPV..........V.........DQ----V...R----A--------L.....
Q2LSJ8_SYNAS/74-180----------QLI----------NG.DTRL..........V.........DM----I...K----E--------R.....
Q6LZY6_METMP/187-291----------DIV----------NN.DDYW..........V.........DS----L...K----E--------R.....
R6EC74_9CLOT/228-334----------VEI----------SGNYDL...........V.........DA----M...G----K--------K.....
D5X7V1_THEPJ/75-181----------TKI----------TN.NFAV..........V.........DR----I...A----E--------L.....
R5LBG0_9FIRM/215-322----------TRL----------TGNNSLL....................DT----L...K----K--------E.....
D5VSC2_METIM/204-310----------ADV----------LNKNLDL..........V.........EK----L...K----Q--------T.....
Q67R82_SYMTH/236-345----------DIL----------NN.DPTI..........V.........DE----V...Q----R--------R.....
F5Z460_ALTSS/106-219----------TLI----------ND.SNAL..........V.........DE----V...T----R--------Q.....
Q2KCB1_RHIEC/88-194----------...----------...DHSL..........V.........DR----T...A----Q--------S.....
A6LV74_CLOB8/104-212----------QRI----------SL.DNTI..........V.........DK----L...K----Q--------S.....
F7QPR2_9BRAD/96-204----------...----------...DHKT..........V.........DR----A...V----S--------Y.....
R6C687_9CLOT/76-182----------IAI----------SSDTSLL....................DT----L...K----E--------N.....
G8PV01_PSEUV/88-196----------...----------...NNDL..........V.........DH----I...G----H--------L.....
R4L9R8_9ACTN/129-248----------TDL----------DV.TTPF..........V.........DS----T...A----A--------L.....
A0A0A1AYZ4_9ENTR/110-221----------KTL----------NL.DEEV..........V.........DD----F...L----A--------R.....
G8AVA4_AZOBR/79-185----------RKL----------DG.QNAL..........L.........DR----F....----.--------......
R4KEL1_9FIRM/74-179----------TRI----------NE.NNEI..........V.........DY----I...N----R--------L.....
B8IZC5_DESDA/173-278----------TSL----------VT.PA.Y..........L.........DW----L...K----Q--------L.....
V9VW82_9RHOB/200-316----------RLL----------NR.NLDF..........I.........DT----I...N----A--------L.....
Q74F34_GEOSL/212-328----------VLL----------NG.NNEL..........V.........DR----I...K----K--------I.....
R5SFX5_9CLOT/88-196----------KDI----------TK.DTEF..........I.........DN----M...K----E--------I.....
Q87PJ9_VIBPA/202-320----------LLL----------NN.STVL..........V.........DQ----I...R----D--------L.....
F4LKK3_TREBD/186-288----------KSL----------SD..NDF..........L.........TK----Y...R----K--------L.....
C6XN72_HIRBI/90-198----------...----------...QHSL..........I.........DS----I...G----R--------M.....
A0A0C7P014_9BACT/77-188----------NPV----------KE.RYEV..........V.........DK----V...S----N--------H.....
A0A085L981_9FIRM/78-183----------TIM----------NN.NFTC..........V.........DK----I...G----S--------L.....
E6VZ02_DESAO/125-228----------FS.----------......V..........V.........DT----V...Q----K--------R.....
R7JZV9_9CLOT/71-183----------GRL----------LKGDLNI..........T.........DS----TMLYR----V--------R.....
B8HSN5_CYAP4/156-274----------YSF----------QE.PTLI..........V.........DE----T...Q----Q--------L.....
Q0A7Z6_ALKEH/211-327----------LLL----------NG.NFDF..........V.........DA----I...R----D--------V.....
R5QN54_9FIRM/79-185----------LEK----------DDVSYEF..........I.........DS----L...Q----K--------D.....
M4U2E5_9GAMM/102-215----------LQI----------NG...............ISLLHDFSVSDQ----F...Q----R--------D.....
A1AN42_PELPD/73-179----------YVV----------NN.NYEL..........P.........DK----M...N----Q--------I.....
U5N966_9BURK/105-212----------HAQ----------AF.HFGL..........V.........DG----V...T----A--------S.....
Q3A1Q1_PELCD/126-245----------RDA----------EY.PTPL..........V.........DE----V...E----R--------L.....
W6RU28_9CLOT/73-179----------TQI----------NE.NYEL..........I.........DD----F...T----K--------E.....
I0HW90_RUBGI/100-211----------QPL----------NG.QFAQ..........V.........DH----F...A----E--------L.....
D1BHQ7_SANKS/162-281----------TDL----------ST.ATPV..........V.........DD----I...A----E--------L.....
B8IZC2_DESDA/174-279----------VSL----------TA.PD.Y..........L.........DW----L...S----Q--------L.....
Q74H85_GEOSL/198-301----------GDI----------LETDTRL..........P.........SQ----V...Q----E--------V.....
B1LVR8_METRJ/92-200----------...----------...DAGV..........V.........DD----A...V----A--------Y.....
A3DJX9_CLOTH/307-413----------LLL----------ND.DTSI..........A.........EK----I...S----S--------D.....
A0A075LSR8_9BACI/79-184----------TKM----------ND.NFDL..........V.........DR----I...A----E--------L.....
G7WD19_DESOD/74-176----------VRI----------SL.NNEI..........T.........DY----L...S----R--------L.....
U5RZZ9_9CLOT/76-181----------KLI----------SG.DTKF..........V.........DS----I...K----A--------E.....
J7IWN7_DESMD/74-180----------TQI----------SH.QTEL..........V.........DY----L...A----E--------L.....
D4H251_DENA2/115-228----------KSV----------FA.NYPL..........V.........DE----IVDKS----K--------I.....
R7I3Y6_9CLOT/77-184----------YNI----------SE.DTEL..........I.........DT----I...K----K--------N.....
G4R699_PELHB/74-189----------VMP----------RFYNNDI..........A.........DS----I...A----R--------V.....
A0A0B4XTY6_9PROT/85-193----------...----------...SHSL..........I.........DR----I...G----T--------A.....
B5E7Q4_GEOBB/195-298----------DIL----------NH.HPNL..........P.........GK----L...Q----E--------V.....
Q72C84_DESVH/127-233----------RSM----------V..TEAF..........A.........DS----I...K----G--------Y.....
Q2W2R7_MAGSA/89-196----------HVL----------NG.NFDV..........V.........DK----I...K----A--------L.....
B1I534_DESAP/81-187----------VLM----------ND.NFHV..........V.........DF----I...G----K--------L.....
R5NZ64_9CLOT/79-186----------YNV----------SLSTPF...........I.........DD----I...A----A--------K.....
D4JWV0_9FIRM/158-263----------VCI----------DLNDSEY..........V.........DS----V...K----A--------K.....
A5I5P1_CLOBH/73-179----------ELI----------NN.NFYV..........V.........DN----I...K----E--------E.....
F6DLJ5_DESRL/74-180----------VRM----------NN.NNEI..........V.........DF----I...S----S--------L.....
F5XWM0_RAMTT/199-311----------VLL----------NQ.NLPF..........I.........DH----I...N----R--------I.....
B6IML4_RHOCS/90-197----------VRL----------NG.NHDV..........V.........DE----V...Q----S--------L.....
A8ESX6_ARCB4/106-217----------KAL----------NL.NFDI..........V.........DK----F...T----E--------M.....
F2JN05_CELLD/79-180----------ESL----------TG...............I.........EE----VHVLK----K--------Y.....
Q74DL3_GEOSL/77-183----------YVV----------ND.NFEI..........P.........DK----V...K----D--------L.....
Q5E501_VIBF1/198-319----------IIL----------NN.STLL..........V.........DR----I...R----D--------L.....
E1SPH8_FERBD/213-325----------ALM----------NH.NTEL..........V.........DN----I...K----A--------L.....
B5EGJ6_GEOBB/77-183----------YVL----------ND.NNEI..........P.........DR----I...F----A--------I.....
A5D439_PELTS/73-179----------IKV----------NE.NYEL..........V.........DL----I...G----N--------L.....
U5N930_9BURK/110-220----------APM----------NL.DFGI..........V.........DG----F...T----Q--------L.....
E1SQW9_FERBD/106-217----------EVM----------NG.RDQE..........V.........DR----F...A----S--------L.....
D7DQM1_METV3/185-290----------VRI----------LNNNVEL..........V.........DK----I...K----S--------I.....
E8RQ04_ASTEC/85-195----------...----------...DHTL..........V.........DE----T...G----K--------I.....
Q74EC9_GEOSL/72-178----------YVI----------ND.NYEL..........P.........DK----L...K----E--------L.....
Q7D199_AGRFC/88-194----------...----------...DNDL..........V.........DR----T...A----A--------G.....
B5YKT7_THEYD/87-199----------PGI----------KP.NNDV..........C.........DK----F...T----S--------L.....
A0L9K9_MAGMM/119-226----------FRL----------NG.HNEL..........V.........DT----I...S----T--------L.....
A1WD99_ACISJ/101-212----------ALV----------NE.DYSA..........V.........DK----F...A----N--------E.....
C6WYS6_METML/102-211----------TEI----------TG.YFEL..........V.........DG----V...S----D--------L.....
A5G6Y0_GEOUR/211-325----------VLL----------NN.NTTL..........V.........DK----I...K----N--------I.....
Q0W8Y7_METAR/199-302----------EVL----------NN.NNEI..........V.........DY----I...T----E--------E.....
TLPC_BACSU/80-184----------TQI----------NG.NEDI..........V.........DL----L...G----E--------K.....
K0NLS4_DESTT/130-248----------QDM----------NS.PSII..........V.........DK----T...R----D--------L.....
G8M385_CLOCD/307-413----------VCL----------ND.NDVV..........L.........NR----I...N----Y--------N.....
A5G616_GEOUR/72-178----------YTV----------NG.NFEL..........P.........DR----L...K----E--------L.....
A9KQX1_CLOPH/40-140----------VPV----------AK.LQNI..........V.........DN----Y...K----Q--------K.....
G8MN10_9BURK/110-221----------KPL----------NN.DFAI..........P.........DA----F...L----E--------E.....
Q6LY71_METMP/187-292----------VDI----------MNKDDYW..........V.........DR----V...K----E--------V.....
A7HEU7_ANADF/134-251----------ADP----------AR.PSLL..........V.........DR----V...R----E--------L.....
D5X0H1_THIK1/108-218----------TSE----------VN.QFGL..........V.........DG----V...T----K--------L.....
E3CZU3_9BACT/182-287----------FNL----------TE.KDTL..........V.........DR----V...K----D--------L.....
E0RXX8_BUTPB/79-188----------TAV----------HDIYQAQ..........L.........DA----L...N----Q--------K.....
F5YEI7_TREAZ/86-202----------KPL----------DG.RTEL..........I.........DD----I...S----K--------D.....
G7ZDN4_AZOL4/72-179----------RAL----------ND.FFEP..........V.........DR----V...K----R--------L.....
X2GV97_9BACI/76-181----------AKI----------AEETAL...........I.........DK----L...G----E--------L.....
D3RVX8_ALLVD/111-221----------RRL----------TL.DDSV..........L.........ER----F...T----K--------A.....
R6ZMQ4_9FIRM/73-179----------FNI----------SEAVDI...........A.........DH----V...K----S--------A.....
A1S844_SHEAM/106-217----------EQI----------NS.TKSK..........V.........DR----Y...A----N--------L.....
D7DHR4_METV0/102-212----------TPI----------TN.FFKL..........V.........DD----L...S----S--------L.....
Q2ILX4_ANADE/105-215----------RMV----------DL.DYPT..........V.........DR----F...T----A--------T.....
E0SEE2_DICD3/109-220----------TVL----------NM.NTAV..........T.........DD----F...L----S--------R.....
Q89JH4_BRADU/94-202----------...----------...DHAI..........V.........DR----A...V----S--------Y.....
G8AT44_AZOBR/76-183----------VRI----------DG.DIRM..........V.........DQ----I...R----E--------L.....
L0HFV3_METFS/105-216----------YVV----------ND.NFEI..........V.........DK----V...Q----S--------M.....
A5G6X8_GEOUR/210-326----------ILL----------NN.NNTL..........V.........DR----I...K----Q--------I.....
A6LZK9_CLOB8/177-278----------.RL----------DS.NNLV....................DY----V...K----S--------K.....
D4KWN6_9FIRM/76-185----------YNI----------SQSENL...........V.........DT----I...K----Q--------E.....
H2IST1_RAHAC/113-224----------TPL----------NL.DSKI..........P.........DD----F...L----A--------R.....
E6TRU7_BACCJ/80-181----------EVM----------NE.DFEI..........A.........DK----I...G----E--------T.....
B3EA57_GEOLS/72-178----------YAL----------NN.NEEL..........P.........DK----L...K----E--------L.....
E1SQW8_FERBD/106-217----------RLI----------NT.TLAQ..........V.........DR----Y...A----K--------I.....
C4IHE8_CLOBU/72-179----------DAL----------LNNNNDV..........P.........EF----I...K----I--------E.....
C8VYH0_DESAS/73-179----------VKI----------ND.NYEI..........V.........DK----I...G----S--------I.....
A0A023Y143_9GAMM/113-224----------QAI----------NL.QESA..........V.........DR----F...A----S--------A.....
F3Z371_DESAF/124-224----------.H.----------......L..........V.........DR----V...Q----Q--------M.....
Q67JS3_SYMTH/218-329----------DIL----------NN.DHAI..........V.........DE----V...L----Q--------R.....
D5XD62_THEPJ/76-178----------QLM----------ND.NFAI..........V.........DK----I...A----E--------L.....
R5SDE9_9CLOT/75-183----------YNI----------SQSDNL...........V.........DT----I...K----E--------E.....
F2JZN6_MARM1/107-218----------KSV----------AQ.DFSK..........V.........DQ----F...T----K--------V.....
F3YY29_DESAF/173-278----------IDL----------A..SLKF..........V.........DS----I...K----Q--------R.....
Q213Z4_RHOPB/90-197----------HVL----------ND.DVAA..........V.........DK----V...K----A--------L.....
D4J2L3_BUTFI/78-188----------YAL----------HDDFQNQ..........L.........DM----I...K----E--------E.....
G8QJI8_AZOSU/217-331----------ILL----------NN.NLAL..........I.........DN----I...R----E--------V.....
E4RNC2_HALHG/80-185----------LKI----------DG.NYEL..........V.........DY----I...E----R--------N.....
R5R8S2_9FIRM/79-186----------VVL----------TG.DYSI..........V.........DS----L...K----E--------S.....
C4XTW5_DESMR/173-278----------MNI----------SK.NDAF..........V.........DS----L...K----K--------L.....
A8F9U1_BACP2/79-184----------TQI----------ND.HDTL..........V.........DH----L...A----K--------Y.....
F6DKG1_DESRL/79-184----------TYI----------ND.N.SI..........V.........DK----V...A----E--------Y.....
A6UWZ1_META3/212-318----------SKV----------LNKDTYI..........V.........DK----I...K----A--------T.....
R6FBW2_9FIRM/88-195----------VDI----------TREYSLF....................DQ----F...K----E--------D.....
D5WGD4_BURSC/49-157----------TLL----------NL.NYGE..........V.........DR----F...T----D--------K.....
R7R090_9FIRM/112-220----------KNI----------SD.NVEF..........F.........DN----F...S----K--------K.....
F2JRS0_CELLD/85-196----------EPI----------TS.EDEM..........I.........ET----L...G----E--------D.....
E0S2B9_BUTPB/88-197----------VEV----------HDEYEEI..........I.........DE----L...K----D--------Y.....
Q47F07_DECAR/214-329----------VLL----------NK.NLDF..........I.........DQ----M...N----A--------I.....
A3DJX9_CLOTH/77-183----------NLI----------NN.DSLI..........L.........DA----I...K----E--------K.....
D2S3V8_GEOOG/300-412----------DDP----------RR.PAPL..........V.........DD----V...V----A--------L.....
A1K1I5_AZOSB/222-336----------VML----------NR.NLGI..........V.........DR----I...N----A--------A.....
D7CN43_SYNLT/76-181----------VLM----------DE.NFEI..........V.........DL----V...G----E--------K.....
E6TZ81_BACCJ/78-183----------TVI----------ND.NFEL..........M.........DT----I...G----E--------M.....
R7N631_9FIRM/83-190----------HVL----------NG.DYEL..........I.........DS----V...K----K--------V.....
D7EA93_METEZ/98-210----------YVV----------NN.NSDI..........V.........AD----I...T----N--------Q.....
W0S9Z6_9RHOO/225-339----------LLL----------NK.NLEF..........V.........DR----I...N----D--------I.....
Q1QVS1_CHRSD/204-320----------RLL----------NG.DAGP..........V.........DE----I...R----D--------L.....
W0EC93_9FIRM/75-181----------EKI----------NG.NFTV..........V.........DE----I...G----S--------L.....
F2JGZ2_CELLD/76-178----------...----------NLQETSL..........L.........NK----L...K----A--------S.....
R7I9R7_9CLOT/89-196----------YNI----------SQSSAL...........L.........DA----F...K----K--------D.....
R6DVG8_9CLOT/5-112----------YNI----------TKDEEL...........I.........DS----F...T----E--------G.....
G4QFB3_GLANF/102-211----------SGQ----------GN.NFTL..........V.........DG----L...T----E--------I.....
A6VV35_MARMS/109-220----------ETI----------NL.NFSK..........P.........DQ----F...T----S--------M.....
C6XCT3_METGS/126-235----------HPQ----------TG.NFSV..........V.........DE----V...T----R--------I.....
L0K912_HALHC/77-183----------RKI----------NG.NFKL..........V.........NY----I...S----Q--------L.....
D3RQD1_ALLVD/81-192----------RSV----------EG.NTAM..........P.........DA----I...S----R--------D.....
C9LRM7_SELS3/91-197----------GRL----------LNDNGSF..........V.........DH----L...K----E--------V.....
R5EER7_9CLOT/71-178----------YNI----------SKSEDL...........V.........DS----I...H----D--------E.....
Q28LY5_JANSC/69-195----------AGA----------DAGGFEITWPRMPNTLMF.........DD----VDAAS----A--------I.....
E6U3D4_ETHHY/87-192----------HRV----------TG.DTAI..........V.........DM----V...Q----R--------E.....
W0E9X6_9FIRM/74-180----------KEI----------AF.NNNL..........V.........DY----L...S----T--------L.....
A5G0G1_ACICJ/83-185----------YRI----------NG.DDRV..........V.........DE----I...K----T--------Q.....
C7RV68_ACCPU/102-213----------TPL----------ND.RFDV..........V.........EA----F...T----A--------K.....
A0A0C5X0D3_9GAMM/198-314----------ILL----------NN.STQL..........V.........DR----I...R----D--------L.....
R5DWU0_9FIRM/73-182----------YNV----------SKSENL...........V.........DR----I...K----E--------N.....
F7YX84_9THEM/79-190----------VPL----------DG.RFEL..........V.........DT----I...S----K--------N.....
I4BTU7_ANAMD/116-231----------KQI----------TGSNDIV....................DQ----L...A----E--------Q.....
H6NGN8_9BACL/80-186----------TLI----------DG.NYGL..........I.........DE----F...G----A--------D.....
W8KJN2_HALHR/81-192----------EPL----------EG.RHEM..........A.........DA----I...S----R--------D.....
F2NY56_TRES6/174-270----------...----------...NNSF..........V.........ER----I...S----K--------S.....
Q6M058_METMP/187-292----------DVL----------NN.DHTL..........V.........DS----I...K----A--------S.....
B9TMP9_RICCO/78-188----------HPQ----------TN.DFAL..........V.........DH----V...T----A--------I.....
G2T516_ROSHA/86-192----------YNI----------SEHQDV...........L.........DA----F...K----E--------N.....
C4XJA0_DESMR/214-319----------INL----------SS.SNAF..........V.........DD----I...K----K--------V.....
Q5H0R3_XANOR/351-467----------KSQ----------AN.TFSL..........V.........DS----A...A----S--------ILVDDG
B8DJD3_DESVM/173-278----------TSL----------V..REGF..........V.........DD----I...K----S--------F.....
A0A068SK02_RHIGA/87-193----------...----------...GYEL..........V.........DR----T...A----S--------A.....
M4RH32_9ALTE/43-149----------KAQ----------GN.NFEL..........V.........DG----L...T----N--------I.....
B5EEA7_GEOBB/208-324----------VLL----------NN.NNAL..........V.........DK----I...K----E--------I.....
D1B050_SULD5/102-212----------VAL----------NN.NFEA..........L.........DA----Y...T----K--------L.....
B7GJK4_ANOFW/75-180----------MKM----------NE.NGEV..........V.........DY----I...K----E--------V.....
W8R0S9_PSEST/102-213----------ERL----------NG.DFTL..........V.........DE----F...T----T--------L.....
D5WSX0_KYRT2/75-180----------RPV----------AG.ASAV..........V.........DQ----V...A----G--------A.....
A0KMS3_AERHH/198-314----------ELI----------NG.STRL..........V.........DE----L...K----G--------Q.....
W0V5R1_9BURK/112-223----------KLL----------NM.DFSV..........A.........DR----Y...T----A--------Q.....
C8X019_DESRD/133-251----------RAM----------DK.TAPL..........V.........DQ----V...Q----D--------L.....
C4XT43_DESMR/172-278----------ADL----------AA.KNAL..........V.........DS----L...K----T--------M.....
Q6LXP6_METMP/208-314----------ADI----------LNKDYSI..........V.........DT----V...K----D--------A.....
C9R7R0_AMMDK/78-183----------TVL----------NN.NFQL..........V.........DE----I...K----D--------L.....
H6RKC7_BLASD/264-378----------DDP----------RR.PSAL..........V.........DE----V...V----R--------Q.....
C5BRD9_TERTT/103-207----------QPQ----------AN.NFDL..........V.........DN----L...T----K--------K.....
R6BYZ3_9CLOT/75-182----------FYV----------SGGITI...........V.........DN----I...K----R--------A.....
G8QJH7_AZOSU/104-213----------TPI----------NG.NTPL..........L.........EA----Y...R----K--------A.....
A6W7B6_KINRD/134-252----------GDP----------AA.TVPG..........M.........DE----A...A----R--------L.....
M1E7Y2_9FIRM/183-301----------YRI----------AG.ANEI..........S.........NQ----I...K----N--------N.....
Q39WQ1_GEOMG/73-179----------YVL----------NG.NFEL..........P.........DM----I...Q----S--------I.....
H6RSU6_BLASD/118-234----------SDV----------AV.PTAV..........V.........DD----I...M----S--------M.....
D5XCJ0_THEPJ/210-316----------KIL----------NN.NNTI..........V.........DN----I...K----K--------N.....
A4J257_DESRM/66-172----------TLM----------NN.NSDI..........V.........DS----V...A----Q--------L.....
Q0AYG1_SYNWW/86-190----------VLM----------EE.NYEV..........V.........DR----I...G----K--------L.....
I4D0P6_DESAJ/74-180----------VKI----------SL.NSDM..........V.........DH----I...A----Q--------L.....
R7K0M4_9CLOT/67-193----------NAV----------NS.........................DT----Y...S----V--------SGDKLM
B8IJS3_METNO/210-322----------SLL----------NG.NLGF..........V.........DT----I...N----D--------L.....
Q87MS2_VIBPA/108-219----------ESL----------IN.DTKL..........V.........DS----F...T----R--------D.....
F0LZR4_VIBFN/108-218----------LPL----------VN.NTDI..........V.........DM----F...T----R--------D.....
A0A075K6B4_9FIRM/186-290----------YDL----------EN.NKAV....................DQ----V...K----K--------M.....
Q085R6_SHEFN/106-217----------EQI----------NN.SNNN..........V.........DH----F...S----E--------L.....
A9BU07_DELAS/105-220----------QPL----------NG.NDAH..........L.........QA----F...T----R--------S.....
M1F6J6_9ALTE/102-212----------SMM----------NN.EFEL..........V.........DG----L...T----K--------V.....
C9R7Y4_AMMDK/77-182----------VLM----------NN.N.PI..........V.........NR----I...T----A--------L.....
C9LWK5_SELS3/73-177----------HNM----------NE.DTEI..........V.........DR----F....----.--------......
W8UBX6_EUBAC/79-190----------TEV----------RD.NFAM..........V.........DA----A...G----E--------K.....
D9SUK2_CLOC7/72-177----------ILI----------ND.NFEL..........V.........DN----I...K----K--------S.....
B3EA50_GEOLS/210-324----------QLL----------NN.NEPL..........A.........DR----I...T----R--------L.....

PF17201

C6BU40_DESAD/36-358LTVPVMTLGGTEF....TYSKRKGK-PLSL----------L---------VE----A---T----R--------I-----
A6LV74_CLOB8/28-303FNLPVLYSGNQRI..........SL-DNTI----------V---------DK----L---K----Q--------S-----
E1QGT6_DESB2/31-334LELPLLQAGDHII..........SK-NFEA----------V---------DR----I---K----S--------L-----
A8EX26_ARCB4/30-313VQTATLKSNGIIL..........NK-NNEL----------I---------DE----F---T----K--------T-----
G8QHB1_AZOSU/34-324VDLPVIRAGGEVL..........NA-NRKM----------L---------LA----F---Q----E--------L-----
A6VTS3_MARMS/34-320QQLPTLTLNNQII..........DG-NAKF----------L---------TD----F---A----R--------S-----
F2K3U4_MARM1/35-301....ILNEGSQKI....GERNSQIA-ITNF----------L---------TS----H---I----K--------S-----
H2IST1_RAHAC/38-323QSAPVIKAGGTPL..........NL-DSKI----------P---------DD----F---L----A--------R-----
A8ESX6_ARCB4/32-319LQTPVLSINGKAL..........NL-NFDI----------V---------DK----F---T----E--------M-----
F0JCL3_DESDE/35-351VSLPRLALGADWL....GQNSDPGT-PTPL----------V---------DE----I---M----Q--------L-----
I0HW90_RUBGI/37-316...PYVLRGESLS....AQGQPLNG-QFAQ----------V---------DH----F---A----E--------L-----
D5V2F9_ARCNC/31-312IAAPAFYNGSTLL..........NN-NFEP----------L---------EK----Y---T----Q--------T-----
A6VTS4_MARMS/34-318VELPSVKLNYEAI..........NG-NSEY----------M---------IN----F---A----S--------V-----
B8HSN5_CYAP4/64-390IQLPKMFVGSKWL....GQNYSFQE-PTLI----------V---------DE----T---Q----Q--------L-----
Q2SCQ8_HAHCH/31-321QSVFQMYSGDTPL..........AG-NYTA----------V---------DN----F---A----S--------A-----
B8DKE8_DESVM/33-319VSVPDFELSNDGM.......PLPFS-PNSL----------V---------ER----H---K----R--------T-----
C3K447_PSEFS/33-307VQTPSLYLGSDLL..........NN-NFDK----------V---------DE----F---K----Q--------M-----
G8MN10_9BURK/35-328VAAPIFLAGDKPL..........NN-DFAI----------P---------DA----F---L----E--------E-----
B8DR25_DESVM/32-335ATLPGFKLGSAYL..........HQ-GTDL----------V---------DR----I---R----E--------L-----
Q2FQ15_METHJ/34-307KGTPEIINNNMTLIDKNGKEFVVND-NFEI----------V---------DG----V---R----D--------L-----
E1QEE0_DESB2/42-369ISLPTLALGQAAI....AVERDPAR-PSAI----------V---------DG----V---S----Q--------V-----
F6AK53_PSEF1/33-309LQAPALYLGNTQL..........NN-DFSE----------V---------DE----F---R----R--------L-----
A6W7B6_KINRD/41-362VTLPRLEFGGTWL....GQQGDPAA-TVPG----------M---------DE----A---A----R--------L-----
C8X019_DESRD/39-360MDLPKMLMGSNWL....GKVRAMDK-TAPL----------V---------DQ----V---Q----D--------L-----
B6BNF9_SULGG/29-306VSTPVLVSDGAVI..........NN-NFAK----------I---------EE----F---T----K--------L-----
C6WF37_ACTMD/44-372VTLPRAEVSGAWL....GQNRDQST-PTPL----------V---------DD----I---R----S--------M-----
B8FKI9_DESAA/38-364ISLPTMLAGDLWL....GKNTKFTA-PSPL----------V---------DD----I---T----D--------L-----
Q3A5N0_PELCD/34-368IELPKVLVGARWL....GQNADITR-ESPI----------V---------DQ----V---Q----K--------T-----
A6VV35_MARMS/34-326YDSPLATNSGETI..........NL-NFSK----------P---------DQ----F---T----S--------M-----
F3Z2D9_DESAF/34-350ARLPRMMLGGEWL....GQNVDPAR-PTPL----------V---------DK----L---R----T--------L-----
C8X5F8_DESRD/39-363VDLPQMELGGQWL....GQVQSFSR-NVPL----------V---------DQ----V---Q----N--------L-----
Q88BA0_PSESM/33-309TQTPGLYLRDTAL..........NN-DFTE----------V---------DE----F---R----S--------M-----
Q2FU40_METHJ/38-306KGKPSIVNGELIL....GSSYRVNN-NFEI----------V---------DE----V---Q----E--------L-----
D5UZK4_ARCNC/30-314VETLTLYDGFAML..........NK-SFGR----------V---------DR----F---K----E--------L-----
C5CXU1_VARPS/45-330AAQGIVSSYGTQI.........NGA-STSE----------V---------DA----F---A----R--------D-----
F2JZN6_MARM1/34-317NKAPSLTYEGKSV..........AQ-DFSK----------V---------DQ----F---T----K--------V-----

PF02743

E0RXM7_BUTPB/48-273-------......----------....RES----------E---------SV....L---K----T--------L-----
D4J1J7_BUTFI/47-288-------.YQSST----------SKAHADA----------L---------EL....L---S----A--------T-----
E0RW20_BUTPB/49-275-------..RKAQ----------TDAETAL----------A---------WQ....A---K----Y--------L-----
C6PRU6_9CLOT/32-298-------.SSSIS----------SNVIDNN----------K---------KL....S---S----T--------I-----
F4LMY3_TREBD/35-291-------..KNTG----------EQTAAVY----------Q---------QS....L---E----S--------I-----
A9KI79_CLOPH/38-284-------SKNLIV----------GQLSSET----------M---------SS....L---Q----M--------A-----
C6CY24_PAESJ/49-303-------.KSTIN----------EKVTEYS----------E---------QL....L---K----Q--------T-----
D9SN50_CLOC7/34-225-------....LK----------KQIMTSA----------Q---------SN....L---K----I--------A-----
B3PLL6_CELJU/36-263-------..TAME----------QSIRQQV----------G---------GI....S---A----T--------F-----
H6NPI3_9BACL/38-270-------.....V----------RTALEEM----------D---------KS....H---E----A--------K-----
Q8XIM7_CLOPE/39-272-------....IK----------RNNLYLN----------D---------KI....L---Q----D--------V-----
B8CZL7_HALOH/50-288-------.....L----------RQVNGQI----------E---------TV....K---T----S--------Q-----
D3EGX8_GEOS4/41-276-------.ESLLQ----------NQVIRDA----------E---------LL....V---S----R--------T-----
B8FI76_DESAA/33-279-------.KSVLK----------SQAKAQM----------L---------LQ....V---E----S--------S-----
F4GHS7_SPHCD/50-280-------......----------..ALDSD----------V---------LY....I---N----T--------I-----
G7M452_9CLOT/54-282-------......----------....RLV----------Q---------GQ....F---E----T--------V-----
G7MBH7_9CLOT/84-313-------.RNILT----------NKVGELS----------K---------GT....S---A----Q--------T-----
E3GJM9_EUBLK/37-310-------......----------..VNRRL----------T---------AH....A---E----E--------I-----
E3DMV9_HALPG/43-295-------..KIVR----------DQIDKNI----------N---------LV....A---N----S--------Y-----
D3EI08_GEOS4/52-270-------....IN----------SQFGKYG----------D---------NA....V---A----Q--------L-----
Q729P1_DESVH/35-283-------.....V----------AAFEESS----------L---------GQ....L---D----R--------T-----
C0QWV4_BRAHW/43-259-------......----------.......----------S---------LN....I---E----L--------A-----
A3DEW9_CLOTH/98-428-------.SNTMI----------QQAKEST----------L---------GL....M---E----Q--------T-----
C6CUM5_PAESJ/53-294-------....AV----------KRETENA----------L---------NL....N---N----T--------K-----
H9UIR1_SPIAZ/46-279-------..SALG----------RQAIAFS----------E---------NL....L---S----V--------T-----
D4H636_DENA2/32-256-------....IK----------NTEMNQL----------N---------II....H---T----Q--------M-----
F5YEX0_TREAZ/51-285-------......----------...LQML----------Q---------TL....A---R----T--------A-----
A3DJL4_CLOTH/54-311-------..DAMI----------RHAGADN----------L---------EL....V---K----Q--------I-----
F8F259_TRECH/36-277-------.SRSIE----------TQVIDHT----------L---------RM....I---A----Q--------V-----
G7LYC8_9CLOT/33-306-------.RHILE----------TELVSSM----------S---------ER....T---T----E--------S-----
D4GMT0_PANAM/45-292-------......----------..IRYQV----------D---------SL....A---T----G--------I-----
C6CV60_PAESJ/38-288-------.KTQIV----------NKVSSTN----------L---------GV....V---R----V--------V-----
F8F0Y4_TRECH/37-279-------..ETAR----------LSSQQYT----------K---------QL....I---R----Q--------I-----
C6CTL5_PAESJ/41-280-------...QLQ----------RHTENSF----------K---------QL....V---I----H--------L-----
F2JPG3_CELLD/74-312-------SKSTVK----------ETSSQLA----------L---------EM....V---K----Q--------T-----
C6CUI3_PAESJ/43-274-------..SILQ----------NNIEKGV----------Q---------SR....M---K----E--------I-----
H6NBH0_9BACL/31-281-------.QHIIE----------QNYAEQS----------E---------FT....L---K----A--------V-----
F3ZVL8_MAHA5/40-277-------..AVIK----------QQVQAST----------Q---------QT....V---I----Q--------A-----
C6D144_PAESJ/61-288-------......----------.......----------.---------......V---L----Q--------T-----
D3EMN3_GEOS4/45-297-------..ASMR----------KQTRLNI----------Q---------GT....L---L----Q--------I-----
C6D7B0_PAESJ/40-294-------SQKAII----------DKATNNS----------S---------RE....L---V----L--------I-----
C6D7J9_PAESJ/38-288-------..QTVK----------NEYQNSA----------N---------LI....L---N----N--------L-----
E3PXB9_CLOSD/46-280-------..KIIV----------GYANALV----------Q---------SA....T---A----S--------N-----
Q7VHJ6_HELHP/43-277-------......----------.......----------.---------.......---.----.--------L-----
E6W5T9_DESIS/35-272-------.QKDME----------RLLASQQ----------Y---------AT....V---S----L--------M-----
C6BZH4_DESAD/37-310-------.SAAIE----------AVAEREL----------Y---------GL....A---G----T--------Y-----
Q5JHH6_THEKO/57-298-------VQEPIT----------EEAGTIT----------V---------SA....A---E----L--------G-----
B9M8I3_GEODF/40-299-------.RARFI----------EQYNRQQ----------S---------LM....A---E----L--------A-----
Q47XG9_COLP3/35-267-------.RNNTV----------ENVNETS----------Q---------GM....I---R----Y--------E-----
E7A996_HELFC/33-261-------...NIA----------TRVQHSL----------N---------SA....V---T----L--------I-----
F2JMM1_CELLD/60-290-------.TRSTQ----------NVVGDYS----------Q---------KI....V---E----Q--------L-----
B6BIE4_SULGG/44-312-------.VKSFK----------EAAYEDL----------K---------HS....V---E----L--------E-----
A9A2K6_NITMS/39-281-------.KENFK----------ESLKDES----------E---------TR....G---N----T--------I-----
E1X671_HALMS/37-327-------SKNALQ----------AQSINQF----------S---------SM....G---E----M--------M-----
E1WYC4_HALMS/48-313-------SSEAIV----------SEVHEKI----------K---------AT....K---S----L--------K-----
B6BK47_SULGG/36-308-------..EGYI----------ESAYKLS----------E---------RD....T---N----N--------L-----
A4XMI4_CALS8/55-277-------...VLF----------ENAIVES----------E---------NT....L---R----E--------V-----
D4KX95_9FIRM/51-303-------....SE----------EDFWNQD----------Q---------ST....F---E----S--------A-----
D4LPL0_9FIRM/48-267-------......----------......M----------Q---------QT....I---K----.--------.-----
C6D3Q0_PAESJ/27-245-------.....Q----------QIIERKV----------T---------AS....V---N----T--------I-----
A4XMH3_CALS8/43-295-------....IR----------KYTNVYM----------Q---------NS....I---N----Q--------V-----
Q6AR33_DESPS/36-271-------......----------..SEQIA----------K---------TT....L---P----L--------T-----
B5YK24_THEYD/36-274-------.EQAIV----------KQAKE..----------.---------DN....L---Q----L--------L-----
G7W723_DESOD/39-297-------.TNTII----------AQQEQQM----------L---------TI....S---K----S--------A-----
F2NHZ1_DESAR/35-311-------.REVIS----------EQFNQQQ----------L---------VI....A---Q----G--------A-----
C6C1E7_DESAD/46-293-------.....E----------RIFNEQQ----------A---------LQ....A---K----L--------V-----
C6CXB7_PAESJ/52-257-------......----------....VNN----------Q---------.Q....L---L----Y--------A-----
Q9KDT9_BACHD/37-275-------.VNEMV----------QATTEYQ----------E---------QL....L---T----L--------L-----
D4H3E5_DENA2/28-291-------SKKLIQ----------DDVKSQA----------E---------LI....L---R----M--------K-----
F7YVT2_9THEM/41-272-------......----------..ARTAV----------I---------DV....A---I----G--------K-----
E1QDC1_DESB2/44-271-------.REAYR----------EKVIAHL----------H---------EL....I---L----K--------H-----
E7ABZ2_HELFC/42-298-------......----------...NISV----------A---------AQ....A---S----N--------K-----
Q73RB3_TREDE/35-272-------.RKAVT----------EKVEDHL----------I---------DK....A---T----D--------V-----
Q9KFJ6_BACHD/36-286-------.SDAIH----------EQVSEDK----------R---------SS....V---Y----Q--------T-----
Q6MQG9_BDEBA/53-313-------......----------.......----------.---------.......---.----.--------.-----
A4XGK2_CALS8/62-333-------.....L----------NESQKSY----------I---------TA....V---S----T--------A-----
Q1IM50_KORVE/59-347-------......----------....DNS----------L---------NI....A---P----R--------A-----
Q2SGW4_HAHCH/32-267-------..EQYR----------GKIDKRL----------S---------EM....S---L----S--------Y-----
F8F462_TRECH/35-317-------.....K----------KEIHEKM----------R---------LT....I---L----S--------Y-----
C7RT51_ACCPU/45-266-------......----------...RKLL----------Q---------TE....S---A----D--------L-----
B7K4S0_CYAP8/44-338-------......----------....KAV----------E---------DL....A---G----Q--------L-----
G7W9K4_DESOD/50-262-------......----------.......----------L---------QV....V---D----G--------E-----
C6CSH7_PAESJ/23-253-------VKQEMI----------NTASDRA----------A---------SQ....L---S----V--------S-----
D4ZTE8_ARTPN/36-315-------ARSALL----------ETARLNL----------T---------ES....A---V----K--------K-----
E8MZP1_ANATU/52-264-------......----------.....HL----------Q---------DI....N---R----Q--------A-----
E1R2C1_SPISS/36-293-------.RNEII----------RSKLTLG----------S---------TV....T---T----D--------I-----
C6C0E4_DESAD/40-301-------..QEEL----------ETDRAES----------T---------AT....L---N----T--------L-----
B5YHW7_THEYD/47-271-------......----------.....MA----------Q---------TI....G---K----L--------L-----
D3E5V1_GEOS4/40-274-------.KRSLY----------DTTMSLN----------L---------SS....A---Q----K--------M-----
E6VUE9_DESAO/63-288-------.RHSLE----------SENLLRT----------A---------RT....T---S----N--------T-----
A1WSF6_VEREI/52-286-------..RQLV----------GQQTDEV----------E---------VV....A---R----L--------L-----
A5D5V0_PELTS/36-281-------STAALE----------GEAKEAM----------L---------KV....A---R----Q--------A-----
Q2FLJ4_METHJ/50-283-------......----------.TIHLTQ----------K---------KT....A---E----E--------V-----
A6TX67_ALKMQ/30-271-------SKRSML----------ESNDDLL----------K---------SA....V---D----I--------R-----
C0QIP9_DESAH/38-261-------.....K----------EKSSVYL----------K---------GF....A---K----R--------N-----
E8RGV5_DESPD/33-283-------SSRALT----------DLAMKNA----------E---------AT....A---K----G--------I-----
C0Q9P9_DESAH/46-273-------......----------....KSQ----------D---------NF....A---K----Y--------L-----
B8DJ49_DESVM/62-282-------......----------..FERQS----------A---------LL....T---T----T--------L-----
H6NI13_9BACL/41-267-------......----------.EIEQGQ----------L---------IL....A---D----A--------T-----
E0S203_BUTPB/55-291-------...LIY----------SSLENHV----------S---------VD....A---G----S--------V-----
B2TQC3_CLOBB/33-283-------...RSI----------ELIKENV----------I---------IA....A---K----D--------Q-----
A6LM24_THEM4/37-269-------......----------.MASTIN----------E---------LV....L---T----S--------I-----
H1XW39_9BACT/40-285-------....HK----------NETQIEL----------K---------WL....S---D----T--------K-----
D8PCB9_9BACT/43-311-------..QAIG----------EGFQEIA----------R---------ST....S---I----R--------L-----
C3K184_PSEFS/56-337-------......----------.SVEQLL----------Q---------AR....A---A----E--------Q-----
Q1LHF7_RALME/81-344-------......----------RDYAQQL----------L---------EL....Q---Q----G--------T-----
F0RV54_SPHGB/66-306-------....QE----------RYLTEQT----------M---------NL....V---I----T--------D-----
D5MG95_9BACT/36-306-------.SDQLL----------QHELDES----------K---------QE....V---L----T--------N-----
C3K2B9_PSEFS/49-329-------.....E----------SATIREM----------Q---------NL....A---E----S--------R-----
Q1ILB4_KORVE/57-289-------....LQ----------NTVTRSL----------A---------DD....A---S----Q--------R-----
Q602G4_METCA/30-274-------SREALA----------EEIGRNL----------A---------KD....A---T----L--------L-----
C6PUI2_9CLOT/40-278-------VYSEMK----------SNQNSNV----------D---------NI....L---S----R--------Y-----
F5Z6T8_ALTSS/35-267-------.....A----------EQSRAQQ----------Q---------SL....S---P----A--------V-----
H6NA60_9BACL/52-287-------.TDRAI----------EQSYNTA----------S---------VL....L---N----S--------T-----
G8ANA3_AZOBR/64-289-------......----------..IERSG----------R---------DL....A---R----T--------L-----
H8MHX3_CORCM/30-270-------SEHALA----------QRIDEQQ----------R---------AL....A---T----A--------T-----
C9RM68_FIBSS/40-270-------.MKTTL----------KLSYDTN----------E---------TQ....L---Q----Q--------L-----
A7IGX4_XANP2/66-286-------......----------EAARQRL----------L---------QQ....A---V----A--------A-----
B9M6B7_GEODF/52-287-------..QTQR----------TQAMNTE----------L---------EV....A---Q----G--------V-----
C9Z824_STRSW/26-262-------..RAVR----------SEVRDRV----------E---------TT....A---A----V--------S-----
Q3SIW6_THIDA/34-299-------.EASLT----------QTVLANM----------A---------SV....A---D----K--------K-----
E3FLW5_STIAD/37-269-------.....Q----------QALLNAQ----------G---------LT....A---Q----A--------V-----
I0HU31_RUBGI/29-253-------.RRQTL----------DAEQRHL----------S---------SL....A---G----A--------M-----
E3GHH9_EUBLK/36-277-------.ERKVS----------EETGQYL----------E---------EVGIQSA---A----L--------I-----
E3FG36_STIAD/32-267-------..EQLA----------QALAEQH----------L---------RT....A---H----G--------E-----
G7Z6B1_AZOL4/54-254-------.....V----------QQATGVA----------G---------NI....G---L----L--------A-----
D5CLV3_SIDLE/36-276-------......----------ATAIFNG----------L---------EI....S---E----M--------H-----
G8AMV0_AZOBR/40-289-------....AL----------KKAAESI----------D---------NL....A---S----A--------L-----
D0LM69_HALO1/34-257-------....SA----------AQVIEGN----------R---------RA....A---H----A--------I-----
C7NWH4_HALMD/48-253-------.RDATI----------AQEEAAL----------E---------RV....S---E----T--------M-----
B8D1L9_HALOH/40-260-------.....K----------LAAHQDL----------I---------ET....I---D----V--------N-----
B2UE10_RALPJ/76-334-------.....L----------TQAQQAA----------G---------GR....V---D----R--------Y-----
A8IDY9_AZOC5/74-323-------.....L----------SEVRVAA----------E---------AA....V---G----L--------R-----
G1UVU9_9DELT/33-268-------.KQDIT----------TTLTQRL----------Q---------ES....T---H----Y--------A-----

PF17203

A8IJW0_AZOC5/37-200-----------------------MLDDDAA----------Q---------NA----I---N----RQNVAIRAAA-----
E1VUF8_ARTAR/45-184-----------------------QATNNFE----------K---------IE----G---R----R........S-----
E8U7M9_DEIML/49-188-----------------------TLQASIH----------R---------GY----A---E----R........A-----
C7LRL2_DESBD/42-181-----------------------LTEEMLH----------E---------QI----G---Q----T........A-----
Q1QZP7_CHRSD/37-181-----------------------TLRDTQA----------R---------AQ----A---D----R........V-----
E8NFB8_MICTS/40-178-----------------------VQERSIR----------A---------AT----E---E----R........V-----
C8WZC3_DESRD/40-169-----------------------YFKKRIS----------Q---------NQ----E---E----N........N-----
A5G384_GEOUR/38-175-----------------------.FRRDYV----------N---------AL----F---L----R........S-----
C8X081_DESRD/32-168-----------------------.LVSGLT----------S---------EL----K---M----R........G-----
B3E2P6_GEOLS/40-167-----------------------RQEAVAL----------Q---------QH----V---L----Q........A-----
A6W5B6_KINRD/52-190-----------------------QLRADTR----------R---------DA----S---V----E........V-----
D2AVS4_STRRD/35-173-----------------------HTRSQLD----------R---------QY----Q---Q----R........A-----
A0LAG0_MAGMM/37-175-----------------------YAFDAIM----------K---------DQ----E---A----R........L-----
E6VQM2_DESAO/32-165-----------------------RLKREMT----------R---------EH----E---S----K........A-----
B3EA57_GEOLS/33-179-----------------------EMYRQAQ----------V---------SQ----E---S----R.........-----
A4FKM4_SACEN/27-164-----------------------QSDAAFR----------A---------TE----G---R----R........M-----
F2R3Z9_STRVP/37-173-----------------------TDRAQAE----------E---------TA----R---R----Q........A-----
A5G7L0_GEOUR/36-180-----------------------.EKQHLI----------E---------KL----E---G----Q........G-----

PF14827

D7DT63_METV3/43-290--------SKSLD----------KSAELSL----------N---------SG----V---V----S--------L-----
F4LKK3_TREBD/50-285--------KRNYL----------EQLTEKS----------T---------FV----T---A----M--------L-----
H1XWA2_9BACT/46-289--------ENQSE----------ATLHSLI----------L---------AS----E---N----L--------I-----
E8N3E1_ANATU/173-421--------QSRFL----------NQLYATG----------K---------QA----Q---D----W--------F-----
A9B1A1_HERA2/45-312--------QNQLN----------QSLRTSA----------T---------NT----G---V----G--------L-----
B8GT29_THISH/39-275--------QRAEE----------RQLQDLF----------L---------SL----R---T----A--------I-----
F6CHJ7_DESK7/41-278--------.QQEK----------QHFQSIQ----------A---------FV----E---N----D--------L-----
A6LZK9_CLOB8/38-271--------DRNNK----------TEVMNAN----------E---------TI----S---E----K--------I-----
E1QXZ6_OLSUV/38-302--------ISSVV----------ARLDVCL----------Q---------TA----Y---D----R--------L-----
B6BK25_SULGG/41-273--------NNMIN----------GQFKQAL----------N---------MA----E---N----H--------I-----
A1TIP1_ACIAC/42-281--------MNSVD----------AALEAGA----------Q---------TF----E---Y----T--------A-----
D8IXU4_HERSS/39-271--------RASIS----------EELAVGE----------R---------VF----A---R----Q--------L-----
E1QFV1_DESB2/44-282--------.QAAM----------DGLAGRA----------V---------SV----S---E----A--------I-----
C4XT43_DESMR/37-275--------SKEYD----------DNIQAFQ----------R---------VG----A---D----R--------L-----
C0QD16_DESAH/44-277--------GEKAQ----------TRYFHIA----------K---------..----.---T----V--------I-----
C7RNJ0_ACCPU/54-301--------RTATR----------ERLIAEA----------F---------..----.---A----L--------R-----
H8GHU3_METAL/46-282--------RARLH----------HAYSQAF----------G---------AI----L---E----Q--------V-----
E1SQJ5_FERBD/47-274--------LVSQH----------HALWRDY----------S---------IR----L---K----A--------T-----
F5Z5Z5_ALTSS/36-270--------FQQQE----------EQLKNQ.----------.---------..----.---R----R--------L-----
D1B421_SULD5/41-285--------YENEK----------ESLSIYL----------D---------..----.---N----Q--------L-----
Q7M9G7_WOLSU/43-278--------QLNYS----------RQIDNIY----------Q---------..----.---A----S--------L-----
Q7M861_WOLSU/41-289--------SLEVK----------ERLEKTY----------P---------..----.---Q----F--------L-----
H8GKJ7_METAL/52-296--------YAQSQ----------ASWTAEL----------K---------..----.---G----L--------I-----

PF05228

K9T5N2_9CYAN/61-217----------VLS----------HEICQLD--------------------LM----A---G----D--------W-----
Q8THY1_METAC/52-208----------VID----------FQIIQLD--------------------ET----S---S----A--------L-----
A1ATC4_PELPD/52-207----------SIA----------DDIRQID--------------------TI----T---S----D--------Y-----
I0H3Y6_ACTM4/69-223----------ALN----------AQAQRLI--------------------DF----G---I----T--------N-----
V5SI81_9RHIZ/41-227----------AIN----------KSVGSVL--------------------DG----L---K----S--------V-----
Q2SK89_HAHCH/33-193----------ALF----------HELTNLH--------------------QY----T---L----D--------W-----
Q7MJU6_VIBVY/60-219----------VIE----------MMISLQE--------------------DR----S---Y----D--------W-----
A4XQX9_PSEMY/55-221----------...----------GHIERTT--------------------GL----L---H----S--------Y-----
Q87H61_VIBPA/60-219----------VID----------MMVTQQE--------------------GS----S---Y----D--------W-----
Q2FTW2_METHJ/54-207----------ILK----------MEEKSLS--------------------LF----T---H----D--------W-----
C4XMF3_DESMR/52-207----------ALN----------RDLKNLE--------------------GM----A---A----D--------W-----
Q8TQ13_METAC/66-219----------AVY----------TEQSYIN--------------------NM----A---Q----D--------W-----
A5FVT2_ACICJ/60-228----------..S----------QLRSQVA--------------------HD----Q---E----S--------S-----
F3YXA6_DESAF/52-207----------IIG----------AEAEYLD--------------------RL----V---K----D--------W-----
D3RPD2_ALLVD/52-208----------ALQ----------RELDFLI--------------------PS----I---N----D--------W-----
D9QF18_BRESC/52-225----------.LA----------SRVDEIG--------------------RS----V---V----P--------Q-----
E8N3Z5_ANATU/58-207----------...----------...GEMT--------------------TL----A---K----D--------W-----
J1APM7_9EURY/52-203----------TIQ----------REIDTLG--------------------VT----G---R----D--------W-----
K9V905_9CYAN/52-208----------LLL----------QSQESFS--------------------DR----Y---G----D--------W-----
A1S8V4_SHEAM/53-207----------.MN----------FFSQPLS--------------------TF----S---H----D--------Y-----
K9VQQ8_9CYAN/81-235----------.FG----------QTADDFN--------------------SR----F---A----D--------W-----
F6CMI2_DESK7/52-198----------ALE----------REMAELD--------------------KY----T---E----D--------W-----
B8FAJ2_DESAA/52-212----------TLE----------TETEHLK--------------------AL----T---H----D--------W-----
F7YQF2_VIBA7/72-226----------VIQ----------DLLVQQE--------------------KR----S---Y----D--------W-----
K9WDX4_9CYAN/52-207----------AFF----------DEVETLN--------------------TT----A---A----D--------Y-----
K9XAQ8_9CHRO/52-206----------ALS----------DEIAKLS--------------------LT----T---R----D--------W-----
Q2K9V0_RHIEC/61-216----------AIA----------AFMARLS--------------------AT----T---T----D--------N-----
A5V6E3_SPHWW/65-238----------VLE----------QNFRSIA--------------------HD----Q---E----V--------A-----
E8RJK5_DESPD/57-210----------ELE----------NKLYRVE--------------------SS----V---S----D--------W-----
E3CZ19_9BACT/52-205----------VLA----------LRLENLD--------------------TT----C---A----D--------W-----
K9TJL0_9CYAN/52-205----------AFS----------NSKQELQ--------------------AL----N---F----Q--------W-----
Q11B73_CHESB/53-222----------EIS----------SIMAAVP--------------------RE----Q---E----S--------F-----
Q7CV32_AGRFC/64-225----------ALV----------TFRDQLG--------------------AT----L---N----D--------Y-----
I0HBV1_ACTM4/59-206----------.IG----------AHAQRLR--------------------DF----G---V----T--------N-----
Q07W08_SHEFN/52-212----------ALS----------LSKNSLT--------------------TL----C---Y----D--------Y-----
D4H4D3_DENA2/52-205----------SID----------NRVNYYK--------------------AF----L---N----D--------W-----
Q117I8_TRIEI/66-213----------...----------..QDRVL--------------------LL----S---K----N--------F-----
C6BS22_DESAD/54-201----------AVN----------ENSQALK--------------------SL----C---R----D--------W-----
W0HUA8_9ENTR/58-232----------..A----------QRLHELA--------------------VQ----Q---Y----S--------I-----
Q9I243_PSEAE/59-220----------ALQ----------NRRENSE--------------------QF----S---T----T--------Y-----
Q3A254_PELCD/52-206----------VYQ----------ENLAFLE--------------------RM----T---K----D--------W-----
Q9I594_PSEAE/136-300----------RLD----------FELKRHL--------------------DI----V---R----T--------Y-----
Q8TNE0_METAC/52-206----------NFQ----------SEVSRIS--------------------SL----N---H----D--------W-----
M1NBF3_DESSD/57-211----------ALL----------REGEALG--------------------VL----A---H----D--------W-----
C4XQU7_DESMR/78-233----------FLD----------EEVQKLD--------------------DI----I---V----D--------W-----
Q30Y92_DESAG/57-216----------IME----------DSLRHLG--------------------EQ----A---Q----L--------L-----
C7LSV6_DESBD/62-217----------SLQ----------QDMQRVD--------------------NL----L---K----D--------W-----
Q2K442_RHIEC/64-225----------ALK----------TFEDQLG--------------------AT----L---D----D--------Y-----
Q4KBE8_PSEF5/64-225----------ALQ----------SFAGNAR--------------------TT----L---K----D--------Y-----
B8HRL0_CYAP4/58-211----------LIK----------LKGESLE--------------------NF----V---H----N--------Y-----
A1TSZ0_ACIAC/62-225----------SLE----------QQRNETG--------------------RN----I---I----N--------Y-----
E6TUY9_BACCJ/52-200----------ALN----------NELNRLK--------------------MI----V---R----D--------Y-----
M1M0P0_9CLOT/53-200----------.IN----------KEEDNMQ--------------------RL----I---T----D--------W-----
Q2FNF0_METHJ/52-201----------AID----------EEIKRLQ--------------------QI----A---T----D--------W-----
B9JAE4_AGRRK/65-226----------ALK----------TFEGQLD--------------------AT----L---H----D--------Y-----
Q72E59_DESVH/54-206----------.LL----------ASRDAMH--------------------RQ----C---A----D--------W-----
B8GE07_METPE/53-209----------.VN----------DEMTTLS--------------------SI----V---S----D--------W-----
B8DPY6_DESVM/76-231----------ALQ----------SDVRRLD--------------------AL----L---K----D--------W-----
I4D6E9_DESAJ/52-207----------MLN----------SRQNSLK--------------------ST----L---L----D--------W-----
E6W5W0_DESIS/57-218----------ALE----------ISLQRLR--------------------EI----A---L----D--------Y-----
W6RK75_9RHIZ/64-225----------ALK----------TFEMQLS--------------------AT----L---N----D--------Y-----
K9TZZ8_9CYAN/51-206----------AFT----------QSKKDLS--------------------IH----I---D----D--------W-----
B8HP72_CYAP4/52-201----------ALN----------ADLNHLD--------------------ST----A---A----D--------W-----
Q6ALC0_DESPS/53-212----------.LK----------DEIDHVD--------------------RY----C---H----D--------L-----
J1L4S7_9EURY/84-233----------AIT----------EDLSKLD--------------------TI----A---F----T--------W-----
K9U7Y2_9CYAN/52-203----------ALD----------EEIFRVN--------------------LI----A---T----D--------W-----
Q12IQ4_SHEDO/66-220----------VFK----------QSRQSFE--------------------LL----L---T----D--------Y-----
U3U4B6_9ENTR/60-210----------SFN----------QSLSEHL--------------------RQ----L---R----S--------L-----
A9B039_HERA2/62-217----------AIN----------SELAQID--------------------AL----V---L----S--------M-----
L0HGK7_METFS/52-200----------RLD----------AEYNALS--------------------TV----T---T----D--------W-----
D7DPR5_METV0/59-211----------.LN----------EQSQQLE--------------------GI----V---S----E--------Y-----
A0KLS5_AERHH/52-202----------VVQ----------AELGQLT--------------------ML----G---Q----D--------W-----
Q2FPW8_METHJ/52-207----------VLS----------YEKDQIY--------------------SL----T---G----D--------W-----
Q8TMU6_METAC/57-210----------SVA----------TEQGYLD--------------------YI----V---Q----D--------W-----
M4S697_9SPHN/54-228----------.LK----------DNATRVA--------------------HD----Q---E----A--------I-----
A5GD60_GEOUR/52-207----------VID----------NELDSMV--------------------SS----T---G----D--------Y-----
Q2K6U7_RHIEC/66-236----------GLD----------EQIKALP--------------------RE----Q---E----S--------V-----
Q930X2_RHIME/53-224----------VIS----------KMQGSIA--------------------HD----Q---E----S--------V-----
K4MLE8_9EURY/44-198----------.LY----------WDMKDLE--------------------KK----T---A----D--------W-----
D8MTI5_ERWBE/57-214----------.LS----------QSLDEMI--------------------KQ----H---R----S--------L-----
G2IUP0_PSEUL/57-230----------NLL----------KQRNTLG--------------------HN----L---T----E--------Y-----
A3QH71_SHELP/52-208----------GIA----------YAQKNLD--------------------TL----C---Y----D--------Y-----
Q8TMU8_METAC/67-220----------AIA----------WEALSLD--------------------RT----A---R----D--------W-----
Q3IXL8_RHOS4/94-263----------ALL----------RETRELL--------------------QQ----Q---Q----A--------S-----
K9WKM5_9CYAN/55-201----------...----------TTLDNIS--------------------RQ----T---R----D--------Y-----
E3CZH3_9BACT/52-207----------ALE----------EEARELN--------------------RT----A---A----D--------W-----
D5EIB9_CORAD/51-205----------ILE----------LERANLA--------------------TF----A---Y----D--------Y-----
A5VGJ2_SPHWW/58-218----------.FA----------TASAMVQ--------------------HD----L---Q----D--------Y-----
W6RPB6_9RHIZ/61-221----------ALQ----------VKAREVA--------------------RN----L---R----D--------Y-----
K9Q1V5_9CYAN/52-207----------ALY----------EEIEQLS--------------------VS----V---Y----D--------Y-----
A9B4T1_HERA2/61-214----------ALQ----------FEQNRLD--------------------TA----L---V----S--------W-----
Q2G9C2_NOVAD/70-248----------...----------..EKQIL--------------------EA----D---K----L--------Q-----
F2J5B8_POLGS/64-244----------ALR----------DRMLLLA--------------------RD----Q---L----T--------V-----
F2J501_POLGS/58-239----------AIH----------LKLDQIA--------------------KQ----Q---E----D--------A-----
A4J4S7_DESRM/52-207----------VLS----------EDISSLN--------------------KL----A---M----D--------W-----
W0A9B0_9SPHN/37-196----------ALQ----------TSLDLIG--------------------RD----L---R----D--------Y-----
A0KQ37_AERHH/11-168----------AVQ----------GDINAIN--------------------AF----T---R----D--------W-----
A5V026_ROSS1/71-227----------TLQ----------NEINVLY--------------------GN----A---K----D--------Y-----
H1YYG2_9EURY/37-190----------.IY----------YKISDVD--------------------RI----N---K----D--------W-----
K4MBS5_9EURY/32-186----------SID----------SKTNHLL--------------------AT----A---K----D--------W-----
Q6ARA2_DESPS/65-217----------TIK----------NEFPSLT--------------------LL----T---Q----D--------W-----
F3YZV6_DESAF/52-204----------ALE----------DELAHLA--------------------SA----A---A----D--------W-----
A7IB12_METB6/52-209----------NLN----------DQEKIVS--------------------AN----C---R----D--------W-----
C4LCC8_TOLAT/58-220----------TIQ----------IKLDDMA--------------------RR----S---G----D--------W-----
Q12NN0_SHEDO/52-206----------AFI----------SEFSQLK--------------------TI----N---Y----D--------Y-----
E8MZ62_ANATU/57-213----------LIQ----------KEQEKLE--------------------RF----V---Q----D--------W-----
V5SHM0_9RHIZ/61-232----------ALV----------NSVEKIP--------------------YD----Q---E----S--------V-----
E8RHV7_DESPD/53-210----------AID----------REIAHLN--------------------KL----C---G----D--------W-----
A9GVA6_SORC5/116-266----------...----------...SDFN--------------------AR----W---T----D--------W-----
E6WE20_PANSA/70-227----------SFE----------QSLTEHL--------------------RQ----L---R----S--------L-----
Q9A9V4_CAUCR/49-225----------GMD----------SKIADIQ--------------------RA----V---S----P--------Q-----
A5HYQ1_CLOBH/55-201----------LIN----------KDIQNIY--------------------NL----N---K----D--------Y-----
F0LU73_VIBFN/57-210----------IIA----------LEKQEMG--------------------AS----M---A----D--------Y-----
K4KR53_SIMAS/61-223----------FLS----------SHMASLI--------------------SR----A---S----D--------N-----
Q74A79_GEOSL/59-214----------IIA----------DELDKLS--------------------TI----C---T----D--------Y-----
B0SWN8_CAUSK/60-231----------TIQ----------RGLERMT--------------------HE----L---T----S--------A-----
B9JNG4_AGRRK/66-215----------...----------..ISRLS--------------------GT----T---T----D--------N-----
E1STV9_FERBD/53-200----------.IE----------ARQQALA--------------------LL----A---Q----D--------M-----
E1QL96_DESB2/52-207----------VLR----------REESQLA--------------------AF----C---M----D--------W-----
W6RBR6_9RHIZ/54-223----------.VS----------KMQAAVA--------------------HD----Q---E----S--------A-----
C7LX06_DESBD/52-206----------AID----------RENYHLE--------------------RI----C---R----D--------W-----
F2J0J8_POLGS/72-252----------ALK----------HELALLA--------------------RD----Q---T----F--------L-----
T2GDF2_DESGI/52-209----------TLA----------QSIQALH--------------------SL----N---N----D--------W-----
D5A0D5_ARTPN/52-216----------ALE----------DDLANLD--------------------TI----A---Q----D--------Q-----
M1NDH6_DESSD/74-254----------ALK----------GKFMLMA--------------------RD----Q---L----S--------L-----
A4VMP6_PSEU5/64-225----------ALQ----------AQHEWMN--------------------RS----I---V----D--------Y-----
C3MB50_RHISN/61-215----------AIA----------AFTDRLS--------------------TT----V---R----D--------N-----
K9TJP6_9CYAN/52-212----------SLQ----------QTLNELK--------------------SI----A---R----Y--------H-----
D1B471_SULD5/51-199----------ILA----------LKSEPMK--------------------KQ----S---L----D--------Y-----
G8PR77_PSEUV/79-251----------.LK----------VFRNGLA--------------------NE----A---E----R--------I-----
O28553_ARCFU/51-202----------ALF----------HEVDAID--------------------SF----C---A----D--------W-----
A1SRH3_PSYIN/64-218----------VLK----------QNQLSFE--------------------LQ----I---K----D--------Y-----
K9TNS7_9CYAN/66-227----------VLF----------DEIAKLS--------------------FT----A---N----D--------W-----
K9XD78_9CHRO/102-255----------..A----------QSQVDFS--------------------LR----V---T----D--------W-----
G8S572_ACTS5/52-200----------.LD----------NQAQLLT--------------------AF----G---V----T--------N-----
Q88NQ1_PSEPK/62-223----------ALE----------QRLLASR--------------------QF----L---S----S--------Y-----
F8F3N9_TRECH/52-197----------LIQ----------DDLVQFD--------------------RI----T---I----D--------W-----
D2W0H3_NAEGR/56-217----------AIM----------DDFKNQM--------------------DI----L---L----T--------Y-----
H1YWZ2_9EURY/52-203----------AFG----------DDINHLD--------------------SV----A---V----E--------W-----
E1RDF8_METP4/83-232----------AVN----------AEVDRLD--------------------SI----A---N----A--------W-----
C6BRI7_DESAD/52-209----------.LE----------VETSIQQ--------------------EI----L---E----E--------Y-----
B8HR06_CYAP4/52-206----------TIK----------LNSKSLT--------------------NF----T---Y----D--------Y-----
C4L2A5_EXISA/55-205----------VFA----------NHRLMLE--------------------RI----L---V----D--------W-----
A7MJ29_CROS8/38-200----------ALQ----------NRQDTIK--------------------TT----L---N----D--------Y-----
Q11KT0_CHESB/53-224----------ALE----------EQIEAVP--------------------RD----Q---R----S--------V-----
E8N650_ANATU/52-200----------AIE----------QEQQNLQ--------------------TL----V---L----D--------F-----
C8X0A9_DESRD/52-201----------AMD----------KSLQKID--------------------QT----A---Q----A--------W-----
L0H9W3_METFS/52-207----------AIE----------TDLKSGF--------------------ST----T---R----D--------Y-----
K9VB90_9CYAN/52-208----------ALD----------DDLSNLD--------------------TS----A---Q----D--------Y-----
Q12RR4_SHEDO/66-220----------IFE----------QNRLSFE--------------------LQ----V---N----D--------Y-----
FILI_METH6/53-206----------.LQ----------EDLSSLK--------------------RA----A---E----D--------W-----
Q9KPS7_VIBCH/57-213----------LLS----------LERKAMG--------------------AS----L---A----D--------Y-----
B8GK53_METPE/52-208----------AVD----------ADLSTIN--------------------SH----L---M----E--------R-----
Q7CGN3_YERPE/1-161----------...----------MQQDSLK--------------------TR----I---K----D--------N-----
K9RR01_SYNP3/56-207----------..E----------LKKEDFT--------------------RD----F---Q----S--------W-----
C4L8H6_TOLAT/55-214----------LLQ----------NERDGLS--------------------RA----V---N----D--------Y-----
D1B728_THEAS/52-208----------TLD----------QELRELV--------------------RL----A---R----D--------W-----
B1I214_DESAP/55-207----------...----------AQLDELS--------------------SG----V---G----D--------W-----
E6VXD3_DESAO/55-202----------...----------REIEALG--------------------TF----V---W----D--------W-----
E3HD97_ILYPC/54-207----------IFS----------KDLNTLK--------------------HN----L---S----T--------H-----

PF17155

I2B6K2_SHIBC/32-312-----------EL----------DNLNKYT--------------------RY----I---A----E--------N-----
A8AHH5_CITK8/31-304-----------SD----------RAMNAYM--------------------GY----I---I----E--------K-----
Q8ZPW4_SALTY/31-304-----------SD----------RAMNAYM--------------------RY----I---M----E--------R-----
YEAJ_ECOLI/31-304-----------SD----------RAMSAYL--------------------RY----I---V----Q--------K-----

PF09308

LUXQ_VIBPA/40-277-------SKQIIW----------QEVDRTK------------------------------Q----Q--------T-----
Q5E6Z3_VIBF1/35-273-------SVNTIN----------EEVKRNL------------------------------Q----Q--------T-----
LUXQ_VIBCH/41-277-------SSRLMA----------QEGQRTS------------------------------V----Q--------T-----
F0LXF0_VIBFN/41-278-------SSRLIS----------QEVARTS------------------------------T----Q--------T-----
B7VQX2_VIBTL/40-280-------SSRIVK----------QETNRTV------------------------------K----Q--------T-----
H2G0X9_OCESG/42-274-------SA.MID----------DSIHQQL------------------------------E----E--------A-----
U4KH84_9VIBR/39-278-------SSSIIK----------QEVARSS------------------------------T----Q--------T-----
LUXQ_VIBVY/40-277-------SNKIIK----------QEVMLTK------------------------------Q----Q--------T-----
F7YS51_VIBA7/41-278-------SSKIIA----------QEVQRTA------------------------------S----Q--------T-----

PF17152

E0SCU5_DICD3/45-146-----------------------FKQYADK--------------------NL..QLL---G----Y--------T-----
Q88DZ8_PSEPK/44-145-----------------------LRVYANH--------------------NL..QLI---A----R--------S-----
Q0K8R5_CUPNH/47-148-----------------------LRVYADH--------------------NV..RLV---A----R--------S-----
B4EGX2_BURCJ/49-150-----------------------LRAYAGN--------------------NL..NLL---A----R--------S-----
D8MLZ9_ERWBE/46-147-----------------------LRSYAEN--------------------NL..QLV---A----T--------T-----
YFIN_ECOLI/45-146-----------------------LKQYAQK--------------------NL..ALT---A----A--------T-----
E6WA91_PANSA/44-144-----------------------IKSYEKR--------------------NL..ELI---A----N--------T-----
Q9I4L5_PSEAE/45-146-----------------------LRAYADP--------------------NQ..QLI---A----R--------S-----
V4ISZ9_9GAMM/44-149-----------------------TKTRLTA--------------------EQ..QTL---A----R--------L-----
A8AND4_CITK8/44-145-----------------------LKQYAQK--------------------NL..DLT---A----A--------T-----
H0PUF8_9RHOO/40-151-----------------------EQENLTR--------------------HM..AIL---T----R--------M-----
I3Y8L1_THIV6/40-146-----------------------LQRTALG--------------------EL..HAL---A----E--------M-----
Q3SJE3_THIDA/41-145-----------------------GLISLAS--------------------TN..RVE---A----R--------V-----
A5GE93_GEOUR/38-119-----------------------LERRARQ--------------------IM..EPY---A----Q--------L-----
I2B6C2_SHIBC/16-117-----------------------LKQYAQS--------------------NL..RLS---G----A--------S-----
A8G9I9_SERP5/47-148-----------------------LRAYANH--------------------NL..HLI---A----R--------S-----
S6AG39_9PROT/44-151-----------------------FNRSLLE--------------------NT..HSQ---A----A--------M-----
V5UC56_9BURK/41-142-----------------------LRSYAEN--------------------NL..QLI---G----R--------S-----
E0TGV1_PARBH/47-148-----------------------YRDGFEQ--------------------EQ..HGL---A----E--------V-----
G8QFT7_AZOSU/42-142-----------------------VEQFNRE--------------------NL..QAL---L----D--------V-----
H0PZW7_9RHOO/40-129-----------------------FRQTLLD--------------------EL..NTQ---A----D--------I-----
A6TCL0_KLEP7/44-145-----------------------LKQYAQK--------------------NL..ELT---A----A--------T-----
Q6FED5_ACIAD/42-142-----------------------METYTKQ--------------------NL..NVL---S----L--------A-----
U3TTF2_9ENTR/44-144-----------------------IKRYEKR--------------------NL..ELI---A----A--------T-----
Q1GWL0_SPHAL/50-147-----------------------LRGYADR--------------------NM..ELA---A----Q--------L-----
E1VJA3_9GAMM/38-160-----------------------EKEATQQ--------------------EL..HQV---A----G--------I-----
I0HMR8_RUBGI/42-138-----------------------LKGEQRH--------------------SL..DLI---G----R--------S-----
W8U9Z1_YEREN/55-156-----------------------LRVYADH--------------------NL..HLI---A----R--------S-----
H5WJN2_9BURK/46-165-----------------------VTETQQE--------------------EAAAETL---E----R--------V-----
H8GN69_METAL/40-142-----------------------LRHAMFD--------------------RL..RTQ---A----D--------I-----
A0KJG8_AERHH/45-146-----------------------LRLYADH--------------------NL..ELV---A----R--------A-----
D3VJ33_XENNA/45-146-----------------------MQKYAEN--------------------NL..KLI---S----T--------T-----
Q028L5_SOLUE/41-145-----------------------FRASMQR--------------------DL..SAL---A----R--------I-----
H2ISM7_RAHAC/50-151-----------------------LRSHAEN--------------------NL..QLT---A----R--------A-----
D5CQ10_SIDLE/43-151-----------------------SYKETLQ--------------------QL..SSL---S----D--------I-----
Q4KIQ2_PSEF5/43-144-----------------------LRVYADH--------------------NL..HLI---A----R--------S-----
B1Y5B2_LEPCP/71-178-----------------------ARDTLVD--------------------DT..VAQ---A----R--------V-----
A9BW99_DELAS/42-143-----------------------LRLYLSN--------------------NL..HLV---A----R--------S-----
Q7CG65_YERPE/47-148-----------------------LRVYVDH--------------------NL..HLI---A----R--------A-----
Q1LL52_RALME/51-152-----------------------LRVYADH--------------------NL..RLV---A----R--------S-----
C6X923_METGS/42-143-----------------------LQAYATQ--------------------NM..QLV---A----R--------S-----
F9ZZB9_METMM/41-143-----------------------VKRKAME--------------------DF..SAT---A----N--------L-----
F9ZZV9_METMM/42-151-----------------------EHRALLV--------------------NA..KST---A----N--------M-----
B2JLF0_BURP8/42-150-----------------------LRASLTD--------------------IA..RLQ---A----A--------M-----
G8TDJ1_NIAKG/40-139-----------------------FKDEARR--------------------KM..YSL---A----R--------I-----

PF10144

Q65RP6_MANSM/3-163----------IIK----------EKLAKSL--------------------MFVVIIA---L----C--------I-----
E0SJ77_DICD3/1-160----------MVR----------ARIKFRL--------------------HRTAIVL---I----C--------L-----
I0DSM4_PROSM/8-168----------.IS----------MKLTFKL--------------------HKTVIII---I----C--------V-----
B2VH26_ERWT9/1-160----------MAK----------AKIKFRL--------------------HRTAIVL---I----C--------L-----
W0I1R9_9ENTR/1-160----------MAR----------ARFSFRL--------------------HRTVIVL---I----C--------V-----
Q9KPM1_VIBCH/29-174----------...----------....FRV--------------------VVRVATV---L----A--------V-----
J7TNM2_MORMO/1-162----------MAK----------TKLTFRL--------------------HKTAIIL---I----C--------L-----
B8F5V9_HAEPS/5-159----------..R----------EQLIKSS--------------------IIAVIMA---I----C--------L-----
M4RAC0_BIBTR/9-155----------...----------...IKFS--------------------IIGLVFV---F----C--------F-----
A6VR58_ACTSZ/3-159----------LVK----------EKILKSA--------------------LLTVIIA---L----C--------A-----
Q327K8_SHIDS/1-160----------MAR----------AKLKFRL--------------------HRAVIVL---F----C--------L-----
C9R638_AGGAD/5-160----------..K----------EKMMKFM--------------------MFFGIVL---L----C--------V-----
Q6LUH0_PHOPR/10-161----------RLQ----------QTWQL..--------------------...FVLV---F----S--------L-----
SMP_YERPE/1-162----------MAR----------AKLKFRL--------------------HRTAIVL---I----C--------L-----
I2BD21_SHIBC/1-160----------MVR----------AKLRFRL--------------------HRTVIVL---I----C--------L-----
Q7N909_PHOLL/1-162----------MIK----------AKLKFRL--------------------HKTAIIL---I----C--------I-----
E6W7K9_PANSA/7-166----------MVK----------TALKFRL--------------------HRTVIVL---I----S--------L-----
A3N1M9_ACTP2/4-157----------.TR----------EKLIKFG--------------------LLAGISV---L----C--------V-----
AHPA_PASMU/4-161----------.TK----------EKFIKLS--------------------MISSIII---L----C--------I-----
W0LFC6_9ENTR/1-161----------MAK----------AKLKFRL--------------------HRTAIIL---I----C--------L-----
Q6D9Z7_PECAS/1-160----------MVR----------ARVKFRL--------------------HRTAIAL---I----C--------L-----
H2IRY9_RAHAC/1-162----------MAR----------AKLKFRL--------------------HRAAIVL---I----S--------L-----
B4EWX6_PROMH/1-162----------MLK----------DKLKFKL--------------------QKTAIIL---I----C--------I-----
A7MIG5_CROS8/1-160----------MAR----------AKLKFRL--------------------HRAVIVL---I----C--------L-----
Q7VNW6_HAEDU/3-158----------LTR----------EKVIKTT--------------------LLAGIIV---V----C--------V-----
M9X9K5_MANHA/4-157----------.SR----------EKITKTL--------------------LLAGITL---L----C--------C-----
C5B770_EDWI9/1-160----------MVK----------ATLRFRL--------------------HRTAIVL---I----C--------L-----

PF16736

A8FG45_BACP2/33-146---------VFYE----------TKLTERM--------------------EKESSFL---L----S--------S-----
B7GGU1_ANOFW/33-148---------KFYA----------DTVHDRM--------------------AKEAKLL---A----L--------Y-----
C3ARI8_BACMY/7-124---------NYYI----------DHAKDRT--------------------VKEARYV---A----S--------L-----
C5D651_GEOSW/33-148---------DFYV----------ETMNIRM--------------------EKEAKAI---A----I--------L-----
D5DMV7_BACMD/33-152---------NFYF----------QTFQERM--------------------EKEAKLV---E----M--------Y-----
Q9K851_BACHD/33-149---------NVYL----------ENLTDRL--------------------KKETYLA---A----S--------M-----
PHOR_BACSU/35-140---------..DQ----------RKAEEHI--------------------EKEAKYL---A----S--------L-----
Q3XXG8_ENTFC/34-152---------.QIV----------EQQESYL--------------------TKKAQLL---I----R--------Q-----
Q65G91_BACLD/33-148---------SSYD----------AKLSSHI--------------------EKEAALV---A----S--------L-----
Q817G3_BACCR/33-149---------NYYI----------DHAKERM--------------------VKETEYV---A----T--------L-----
U5LGS8_9BACI/33-151---------SYYL----------KSFDERL--------------------IKESEML---S----T--------Y-----

PF09984

A1SSB7_PSYIN/31-175--------FHRYY----------QANDFLI--------------------DRAINIS---E----P--------L-----
A3QC72_SHELP/37-187--------INRFY----------ELEESLI--------------------ERGGNII---E----P--------L-----
Q7N840_PHOLL/33-176--------..HYR----------ELENQIV--------------------RSGISII---E----P--------L-----
F7YLM8_VIBA7/31-174--------FNRYH----------DLEKQVI--------------------NAGASII---E----P--------L-----
C4K6P8_HAMD5/31-177--------MHRYH----------ELEKQVI--------------------HAGTYII---Q----S--------L-----
Q086B5_SHEFN/37-205--------INRFY----------ELEQTLI--------------------EKGSNIV---E----P--------L-----
B7VK74_VIBTL/31-175--------FNRYQ----------DLEGQVV--------------------NTGTSII---E----P--------L-----
A1S4D2_SHEAM/37-196--------INRFY----------DLEDTLK--------------------DMGSNII---E----P--------L-----
D8MW73_ERWBE/31-177--------VHRYN----------ELQNQLV--------------------DAGANII---E----P--------L-----
H2G0B4_OCESG/31-174--------VNRYQ----------QLEEALI--------------------QEGVNVI---E----P--------L-----
W0I1D2_9ENTR/31-178--------VHRYN----------ELQHQLV--------------------DAGASII---E----P--------L-----
Q2SL29_HAHCH/32-177--------.TRLD----------DLSDVLL--------------------ERGSDSA---R----H--------L-----
Q5E319_VIBF1/31-174--------MNRYN----------DLENQLI--------------------SSGTSII---E----P--------L-----
D4ZAV7_SHEVD/31-180--------INRFY----------ELEQTLV--------------------EQGSNII---E----P--------L-----
Q47WQ0_COLP3/32-186--------.SRSV----------ELNDFLE--------------------QRAKSII---E----P--------I-----
C7RAG7_KANKD/36-185--------DSKYS----------.....LS--------------------ARGKTIA---T----H--------L-----
C4LBR6_TOLAT/31-175--------FHRHQ----------QIENFMI--------------------EQGTSVI---E----P--------L-----
A7MQZ7_CROS8/31-177--------VHRYH----------DLQRQLE--------------------DAGASII---E----P--------L-----
C5B8X7_EDWI9/31-172--------VHRYN----------ELQDQLV--------------------DAGASII---E----P--------L-----
Q6LMS6_PHOPR/7-150--------MSRYR----------DLEHQLI--------------------STGSSII---E----P--------L-----
M4UJ25_9GAMM/32-175--------.YRFQ----------QANDYLI--------------------NFAINIT---E----P--------L-----
Q8EBQ2_SHEON/37-185--------INRFY----------ELEDTLI--------------------EQGSNII---E----P--------L-----
Q6D177_PECAS/31-177--------IHRYN----------QLQAQLA--------------------DSGTSII---E----P--------L-----
D3V545_XENBS/41-184--------..RYY----------ELKNLIV--------------------RSGISII---E----P--------L-----
M1FKU9_9ALTE/46-183--------.....----------QIESLLR--------------------DRGEALS---R----Q--------L-----
Q87LP4_VIBPA/31-175--------FNRYQ----------DLEKQVI--------------------TTGNSII---E----P--------L-----
A8G9V6_SERP5/31-176--------VHRYN----------ELQEQLV--------------------DAGASII---E----P--------L-----
A6VUQ0_MARMS/40-181--------.TRFN----------DLNRNLY--------------------ERTSHIT---E----Q--------V-----
E1SSZ3_FERBD/35-175--------.SRFS----------ELEQTLL--------------------RQGTNII---E----P--------L-----
A7T3Z6_NEMVE/26-157--------.....----------.LQGQLL--------------------QRGQMII---E----Q--------L-----
I2B607_SHIBC/31-177--------IHRYN----------DLQRQLE--------------------DAGANII---E----P--------L-----
Q3IDM7_PSEHT/31-174--------INRYI----------ELDEILY--------------------QQGTTIS---E----P--------L-----
B2VFZ3_ERWT9/31-177--------VNRYN----------ELQSQLT--------------------DAGINII---E----P--------L-----
Q12PZ9_SHEDO/59-227--------INRFY----------ELEETLI--------------------AQGRSIV---E----P--------L-----
E6WGB6_PANSA/31-177--------VHRYN----------ELQHQVQ--------------------DAGANII---E----P--------L-----
H2IUL0_RAHAC/31-176--------VHRYN----------ELQNQLT--------------------EAGASII---E----P--------L-----
W8UJA6_YEREN/31-176--------VNRYN----------ELQKQLV--------------------SAGTNII---E----P--------L-----
E0SDL9_DICD3/31-174--------IHRYN----------QLQEQLA--------------------DAGASII---Q----P--------L-----
D3VKK3_XENNA/24-166--------..RYY----------ELKSLIV--------------------RSGISII---E----P--------L-----
A0KGG8_AERHH/31-175--------FHRYQ----------QLENNLI--------------------DQGINII---E----P--------L-----
Q4K894_PSEF5/36-169--------....S----------DLQTQLL--------------------QRGEMIA---E----Q--------L-----

PF13756

G2KMU6_MICAA/84-195-----------------------V.PELSR--------------------RM----V---R----R--------L-----
J7QN52_METSZ/158-272-----------------------LNPERVG--------------------PL----L---R----R--------L-----
F7QGB1_9BRAD/146-255-----------------------INPERVA--------------------PV----L---R----R--------L-----
N0B6E4_9RHIZ/148-255-----------------------IDPHQAA--------------------VV----L---R----K--------L-----
F2IVA4_POLGS/144-252-----------------------.NPERVG--------------------PV----L---R----R--------L-----
B8ENZ6_METSB/136-246-----------------------INPERVG--------------------PV----L---R----R--------L-----
B1M5P0_METRJ/130-242-----------------------LNPEKVA--------------------PL----L---S----R--------L-----
D5AP59_RHOCB/102-207-----------------------....DVA--------------------EV----M---R----G--------I-----
Q2RNS8_RHORT/101-211-----------------------INPEMSR--------------------QM----V---R----R--------L-----
Q5FSQ4_GLUOX/140-255-----------------------LDVAQAR--------------------PL----L---A----R--------L-----
Q2WAP8_MAGSA/85-197-----------------------INPAMAQ--------------------QM----V---R----R--------L-----
Q0C2C2_HYPNA/93-201-----------------------LNPEAAR--------------------LA----I---A----R--------L-----
A6WX45_OCHA4/138-252-----------------------INPEKVS--------------------PL----L---R----R--------L-----
L0EUX7_LIBCB/132-243-----------------------INPERVA--------------------PI----L---K----Q--------L-----
G8PMZ9_PSEUV/146-255-----------------------INPEIVG--------------------PI----L---R----R--------L-----
A7HPA2_PARL1/159-269-----------------------IIPDNAA--------------------PI----L---R----R--------L-----
V6F0S4_9PROT/96-208-----------------------INQDLAQ--------------------HM----V---R----R--------L-----
Q0BQN2_GRABC/87-215-----------------------LSAGIAR--------------------PL----L---R----R--------L-----
G4RA13_PELHB/145-254-----------------------ISPERVA--------------------PL----L---R----N--------L-----
Q0ATL6_MARMM/84-193-----------------------LRNEDAR--------------------AI----L---R----Q--------L-----
B8IMT5_METNO/142-250-----------------------LNPERVA--------------------PL----L---R----R--------L-----
D7A2W2_STAND/143-252-----------------------INPERVA--------------------PV----L---K----R--------L-----
B2IJT7_BEII9/132-242-----------------------INPERVG--------------------PV----L---R----R--------L-----
B6IV74_RHOCS/141-251-----------------------W..ELAR--------------------QM----V---R----R--------L-----
G7Z411_AZOL4/86-197-----------------------LAPELAR--------------------PM----V---R----R--------L-----
Q98CL9_RHILO/133-242-----------------------INPERVA--------------------PV----L---R----R--------L-----
Q11CD4_CHESB/133-237-----------------------INPEKVA--------------------LL----L---R----R--------L-----
E3HZY3_RHOVT/124-231-----------------------.DPEVVS--------------------PM----L---R----D--------L-----
A8ILQ6_AZOC5/131-240-----------------------INPERVA--------------------PV----L---R----R--------L-----
G8AZB9_AZOBR/112-225-----------------------LSPELGR--------------------QM----I---R----R--------L-----
A4YL87_BRASO/141-247-----------------------INPERVA--------------------PV----L---R----T--------L-----
C5AX77_METEA/139-250-----------------------LNPEKVA--------------------PL----L---R----R--------L-----
C6XL61_HIRBI/92-192-----------------------......R--------------------SS----L---K----R--------L-----
K7SVF5_GLUOY/130-247-----------------------LDPSQAR--------------------PL----L---A----R--------L-----
Q2KE68_RHIEC/148-257-----------------------IDPEKVA--------------------PV----L---R----R--------L-----
V5SAA6_9RHIZ/148-256-----------------------IRPERVA--------------------PI----L---R----R--------L-----
CHVG_RHIME/115-223-----------------------IQ.ERVA--------------------PV----L---R----R--------L-----

PF08473

F6QWC7_HORSE/478-905----------YFE----------FLLPSSF--------------------ESEGHVFIAPR----E--------YCKDLN
F7C1C8_XENTR/518-937----------DFE----------SLLPNNF--------------------ELEGRVFLAPR----Q--------YCKELE
I3K056_ORENI/608-1035----------ISE----------SLMADKF--------------------DEYGYTLIAPR----D--------YCKDLK
G1KG65_ANOCA/230-674----------DFE----------YLLPNSF--------------------ESEGHVFIAPR----E--------YCKDLN
M4AAE3_XIPMA/628-1054----------ISE----------SLLSDKF--------------------DEYGYTFIAPR----M--------YCKDLK
I3KAL8_ORENI/601-1029----------DMQ----------SLLPSSF--------------------ESSGHVFLAPR----E--------YCKRLQ
H2UJR2_TAKRU/616-1044----------ISE----------SLLADKF--------------------DEYGYTFIAPR----M--------YCKDLK
Q5TZ68_DANRE/625-1037----------FSE----------SLQVDKF--------------------EEYGYTLIAPR----D--------YCEDLK
M4AR04_XIPMA/479-911----------NFE----------SLLPNSF--------------------ESEGHVFIAPR----E--------YCNDLE
E7FFD3_DANRE/165-608----------DFE----------SLLPNTF--------------------ESEGHVFIAPR----E--------YCKDLE
G3Q8D6_GASAC/592-1007----------FSE----------SLMADKF--------------------DEYGYTFIAPR----M--------YCKDLK
W5NEQ1_LEPOC/557-988----------ISE----------SMQLENF--------------------NENGYTLIAPR----E--------YCKDLK
F7AR78_XENTR/479-871----------DSE----------TLKLEHF--------------------EETGYTFLAPR----E--------YCTDLK
G3TZG2_LOXAF/466-895----------DSE----------TLKPDNF--------------------EESGYTFIAPR----D--------YCSDLK
H2MK02_ORYLA/591-1020----------FSE----------TLLVDKF--------------------DEYGYTFIAPR----T--------YCKDME
H3B566_LATCH/337-780----------DFE----------SLLPNSF--------------------ESDGHVFIAPR----E--------YCKDLD
H3DPE5_TETNG/458-884----------AME----------TLQLERF--------------------DEYGYTFISPR----E--------YCKELK

PF03924

Q07ZB2_SHEFN/82-268-----------------------DNISRDF--------------------------F---K----K--------Y-----
D3S982_THISK/96-250-----------------------PDLESDE--------------------------F---E----R--------V-----
S6AG73_9PROT/109-255-----------------------PDIDQAG--------------------------F---S----A--------I-----
W0E565_MARPU/91-279-----------------------EAVSRQE--------------------------W---R----T--------Y-----
G8AIX9_AZOBR/63-252-----------------------GQVSRTE--------------------------W---R----A--------Y-----
B3E2W3_GEOLS/105-293-----------------------RSVSKHE--------------------------F---A----M--------Y-----
A7ICB7_XANP2/80-288-----------------------GRIDRAQ--------------------------F---Q----R--------Y-----
D5CRF7_SIDLE/79-272-----------------------GSVERKE--------------------------F---H----D--------Y-----
K9VNM4_9CYAN/75-223-----------------------PNISQAE--------------------------F---E----N--------L-----
G0A1Y9_METMM/81-266-----------------------..MTRER--------------------------F---Q----T--------Y-----
Q478M9_DECAR/83-269-----------------------..TNRRA--------------------------L---C----D--------Y-----
G2J2T4_PSEUL/69-261-----------------------AEVERDE--------------------------F---R----R--------Y-----
U5NB72_9BURK/101-288-----------------------GHVSRQD--------------------------F---Q----Q--------Y-----
M4S773_9ALTE/82-276-----------------------NEVSRKE--------------------------F---S----T--------F-----
B7JZX3_CYAP8/87-271-----------------------DNVTRED--------------------------F---H----T--------F-----
E8RE96_DESPD/87-276-----------------------EALTREQ--------------------------W---H----L--------Y-----
B2JN77_BURP8/73-261-----------------------GSLDLDA--------------------------F---H----G--------Y-----
Q87PR0_VIBPA/81-272-----------------------.SSYWSA--------------------------F---P----V--------Y-----
K9TEX2_9CYAN/81-270-----------------------QTVSREQ--------------------------F---H----Q--------F-----
K4KIR6_SIMAS/260-441-----------------------SEFDWAA--------------------------F---E----R--------F-----
F2J6V0_POLGS/70-258-----------------------GKVDHDH--------------------------F---R----T--------F-----
C5BRA4_TERTT/81-226-----------------------PEMSQAR--------------------------F---A----Q--------L-----
K9VEZ9_9CYAN/87-273-----------------------TEISRED--------------------------F---K----H--------F-----
C6XQ69_HIRBI/48-235-----------------------EQVDRTE--------------------------F---D----T--------F-----
Q12NK9_SHEDO/79-265-----------------------QGISREI--------------------------F---K----G--------Y-----
C7RN12_ACCPU/74-265-----------------------QGVDEKE--------------------------F---L----V--------F-----
A1SVU7_PSYIN/82-271-----------------------DHVNRLE--------------------------F---H----H--------Y-----
A4VRL0_PSEU5/32-220-----------------------EQVSREQ--------------------------W---R----L--------Y-----
Q4KFI5_PSEF5/87-274-----------------------DLVTRQD--------------------------F---D----G--------Y-----
D7TAZ7_VITVI/158-355-----------------------SAIDQGT--------------------------F---A----R--------Y-----
M5DMG3_9GAMM/256-442-----------------------NSVSRTE--------------------------F---D----Q--------F-----
A7HB30_ANADF/89-270-----------------------......A--------------------------F---R----D--------F-----
Q6AK77_DESPS/78-262-----------------------...SYDR--------------------------F---N----N--------E-----
S6AHN4_PSERE/88-272-----------------------YEVSPEE--------------------------F---Q----G--------F-----
E1SU35_FERBD/70-255-----------------------ENVSPEE--------------------------F---A----R--------V-----
Q21TE4_RHOFT/73-261-----------------------DAADRDK--------------------------F---R----D--------Y-----
Q3A8D4_PELCD/72-262-----------------------QRVEESE--------------------------F---A----A--------V-----
A1SS75_PSYIN/79-266-----------------------NNIEREE--------------------------F---K----K--------Y-----
Q47X60_COLP3/99-279-----------------------TDITHTK--------------------------W---L----A--------Y-----
I1XM00_METNJ/105-293-----------------------PDLSRED--------------------------F---A----N--------F-----
Q1CX17_MYXXD/61-251-----------------------RFVSQEE--------------------------F---D----A--------Y-----
Q3SJ06_THIDA/83-267-----------------------...SRSE--------------------------W---R----T--------Y-----
H5WI28_9BURK/103-291-----------------------GEVTRES--------------------------W---R----R--------Y-----
W8LA34_HALHR/60-208-----------------------PDISESE--------------------------F---R----R--------V-----
F5Y3E0_RAMTT/90-274-----------------------GSVDRAS--------------------------F---Q----A--------Y-----
C4XRZ9_DESMR/92-280-----------------------GDVSREQ--------------------------W---Q----A--------F-----
Q98FM2_RHILO/70-258-----------------------GDISQTE--------------------------F---K----A--------F-----
Q39ST9_GEOMG/89-277-----------------------ESVERHE--------------------------F---R----D--------Y-----
I3Y6Y1_THIV6/74-266-----------------------GMVDRQE--------------------------W---R----S--------Y-----
Q8P883_XANCP/85-269-----------------------DVISRDR--------------------------F---T----R--------Y-----
C1IHU2_POPTR/158-355-----------------------SAIDQRT--------------------------F---A----R--------Y-----
G8QQ18_AZOSU/87-275-----------------------DDVTRQE--------------------------W---R----D--------F-----
Q5NZD4_AROAE/303-495-----------------------SAVTRDE--------------------------F---E----T--------F-----
K3XE50_SETIT/143-333-----------------------SAIDQRT--------------------------F---A----R--------Y-----
A1TR26_ACIAC/80-257-----------------------PRLTRAE--------------------------F---D----N--------A-----
K9W8D9_9CYAN/75-222-----------------------PDIDREK--------------------------F---D----N--------L-----
F5Y0M8_RAMTT/91-269-----------------------....RAE--------------------------F---R----R--------Y-----
A0A068NN91_9BACT/82-269-----------------------GNIDRKR--------------------------F---H----D--------Y-----
I1YH37_METFJ/59-246-----------------------.YVSRNE--------------------------F---K----V--------F-----
Q2N855_ERYLH/71-253-----------------------DNVSYDL--------------------------F---R----R--------F-----
D7DIJ0_METV0/86-274-----------------------ESVTVSE--------------------------F---R----S--------Y-----
Q7MJY8_VIBVY/85-274-----------------------...DWDR--------------------------F---E----V--------F-----
A1K2L2_AZOSB/65-212-----------------------GGIGEEE--------------------------F---E----R--------L-----
I2F3X4_9BACT/312-497-----------------------SFVSRQE--------------------------F---R----N--------Y-----
Q9KS83_VIBCH/83-275-----------------------TSDDWVR--------------------------F---H----T--------F-----
K9VHA2_9CYAN/80-227-----------------------PNITEAE--------------------------F---A----A--------T-----
A4XYI0_PSEMY/82-267-----------------------DQVSPIE--------------------------W---E----R--------A-----
F9ZXY2_METMM/258-446-----------------------GTVNRQQ--------------------------F---A----R--------F-----
Q2SNS1_HAHCH/99-244-----------------------PDMNQER--------------------------F---T----E--------F-----
G8QNF4_AZOSU/93-271-----------------------..PSHQA--------------------------W---H----Q--------F-----
H8GLC0_METAL/65-257-----------------------VSVERDE--------------------------F---R----E--------Y-----
U4KHJ2_9VIBR/76-268-----------------------EQVSRKE--------------------------F---A----Q--------F-----
Q2W4V8_MAGSA/89-234-----------------------DGMSDAD--------------------------F---R----R--------A-----
U5NAN7_9BURK/101-289-----------------------DNIDRNK--------------------------W---R----K--------Y-----
U5NEM6_9BURK/87-275-----------------------EHVARQE--------------------------W---K----V--------F-----
Q21F90_SACD2/256-436-----------------------.AVEYTQ--------------------------F---N----H--------Y-----
A1W7N9_ACISJ/80-274-----------------------PQLRRAD--------------------------F---E----R--------V-----
K9S6Y7_9CYAN/52-240-----------------------RDLNKTQ--------------------------F---Q----K--------L-----
Q2SEH6_HAHCH/90-278-----------------------NEVRRDE--------------------------W---R----I--------Y-----
G2IP39_9SPHN/89-271-----------------------MDVSPAF--------------------------F---Q----E--------F-----
C5CTK8_VARPS/75-260-----------------------ETVTRSD--------------------------F---R----D--------Y-----
Q47IM3_DECAR/90-277-----------------------ETVDRRE--------------------------W---R----D--------Y-----
D8IZ22_HERSS/78-273-----------------------.DPTRDQ--------------------------F---E----N--------F-----
G2KSE9_MICAA/244-435-----------------------DSVDRRE--------------------------F---E----V--------F-----
Q5NZA1_AROAE/88-275-----------------------DRVDRRT--------------------------W---R----E--------Y-----
Q0K510_CUPNH/75-263-----------------------PDTSRTQ--------------------------W---R----D--------Y-----
A1K2I8_AZOSB/87-268-----------------------ERFDPDE--------------------------F---A----R--------Y-----
A1SAF9_SHEAM/60-243-----------------------NGVSRSE--------------------------W---R----T--------Y-----
F6HFB2_VITVI/154-335-----------------------SAIDQET--------------------------F---A----E--------Y-----
B8GSM8_THISH/76-268-----------------------EEVTRDE--------------------------W---R----A--------F-----
I0IHL4_PHYMF/72-260-----------------------VHVSRAG--------------------------F---S----R--------S-----
K7U4B4_MAIZE/89-270-----------------------SAIDQDT--------------------------F---A----K--------Y-----
K0HT62_9BURK/102-281-----------------------ERIDRAE--------------------------F---Q----A--------Y-----
A9WDP6_CHLAA/252-439-----------------------QRVDQHE--------------------------F---S----V--------F-----
Q2W8H8_MAGSA/104-299-----------------------.STSREG--------------------------F---R----R--------L-----
G0AJ72_COLFT/77-272-----------------------EEVSREQ--------------------------F---H----T--------F-----
I3YFT5_THIV6/76-268-----------------------DTVSREE--------------------------F---R----D--------Y-----
B1M9G3_METRJ/90-278-----------------------DTVTLAQ--------------------------F---R----A--------Y-----
A4G2U1_HERAR/63-263-----------------------DTVSREQ--------------------------F---R----S--------F-----
Q7ULL8_RHOBA/92-280-----------------------NSVSRAE--------------------------W---R----T--------Y-----
Q88L38_PSEPK/87-274-----------------------SEITPRE--------------------------F---D----G--------Y-----
G4T144_META2/60-248-----------------------DYVDRNE--------------------------F---R----I--------Y-----
Q2YCL1_NITMU/85-273-----------------------PSVSRNE--------------------------W---R----T--------Y-----
K0C646_CYCSP/90-268-----------------------..ITYRT--------------------------W---L----S--------Y-----
I3TS71_TISMK/83-268-----------------------.DMTLAA--------------------------F---R----T--------Y-----
Q1GRC4_SPHAL/74-279-----------------------SRSSGPG--------------------------V---R----A--------Y-----
C6XE67_METGS/91-266-----------------------NSVEEEE--------------------------F---L----A--------Y-----
D3RSZ8_ALLVD/110-302-----------------------EDIGTDD--------------------------F---I----T--------F-----
I3YBB8_THIV6/60-206-----------------------PDIDQNE--------------------------F---A----R--------I-----
B0BZA1_ACAM1/72-256-----------------------EQVTPKE--------------------------F---Q----Q--------F-----
C1DGR9_AZOVD/64-248-----------------------ETIEREE--------------------------F---A----S--------F-----
D8S3K5_SELML/54-234-----------------------..LDQET--------------------------F---A----V--------Y-----
K9XGZ6_9CHRO/81-269-----------------------DFVTRAD--------------------------F---Q----A--------Y-----
B9IAR0_POPTR/350-544-----------------------SAIDQKT--------------------------F---G----E--------Y-----
C4L7R2_TOLAT/82-274-----------------------DHVSRDE--------------------------F---Q----R--------Y-----
Q114Y4_TRIEI/78-266-----------------------QELTREE--------------------------F---E----E--------L-----
U5N6G5_9BURK/155-337-----------------------PDFHRLQ--------------------------F---A----Q--------Y-----
Q5E4N6_VIBF1/51-241-----------------------..KDWSQ--------------------------F---P----L--------F-----
F0ZPG2_DICPU/603-800-----------------------.STSEDQ--------------------------F---V----P--------F-----
K9TIK7_9CYAN/87-278-----------------------GQVTEEN--------------------------F---Q----R--------F-----
A2SKN1_METPP/272-452-----------------------SNVDSRE--------------------------F---E----R--------A-----
S6B0V0_9PROT/77-266-----------------------VSVDREE--------------------------W---R----V--------Y-----
V6F941_9PROT/76-261-----------------------...QRDM--------------------------L---A----G--------Y-----
B5EJ10_GEOBB/88-276-----------------------EDVTRDE--------------------------W---R----R--------Y-----
H2FTU6_OCESG/76-255-----------------------DLVTEQD--------------------------W---R----R--------F-----
K4A504_SETIT/311-506-----------------------SAIDQKT--------------------------F---E----D--------F-----
F0LUC7_VIBFN/75-264-----------------------..MNWSR--------------------------F---R----I--------Y-----
Q12H73_POLSJ/65-250-----------------------HSVERAE--------------------------F---R----A--------Y-----
B0UGP9_METS4/40-230-----------------------REVSRAE--------------------------F---A----A--------Y-----
Q141P4_BURXL/70-258-----------------------GTIDRDR--------------------------F---R----R--------Y-----
K9TE45_9CYAN/97-244-----------------------SNIDPEQ--------------------------F---D----N--------L-----
A6VZR0_MARMS/79-265-----------------------NTITRDI--------------------------F---E----Q--------Y-----
C5BTW1_TERTT/257-438-----------------------.MIDNAK--------------------------F---Q----R--------F-----
Q2RRT4_RHORT/82-267-----------------------.GITREV--------------------------F---R----G--------Y-----
M4UNQ9_9GAMM/73-254-----------------------....FAE--------------------------F---E----Y--------E-----
Q0INH2_ORYSJ/83-263-----------------------SAIDQTT--------------------------F---A----R--------Y-----
Q21FR1_SACD2/95-283-----------------------TEVTRAD--------------------------Y---A----N--------Y-----
V6F4D7_9PROT/86-266-----------------------.....NE--------------------------W---N----T--------F-----
B7VPL9_VIBTL/82-271-----------------------..ENWDK--------------------------F---D----R--------F-----
U5W1D5_9ACTN/61-242-----------------------SRLETAE--------------------------F---A----A--------I-----
D2UED2_XANAP/85-269-----------------------DRISSEG--------------------------F---A----R--------Y-----
Q47XD7_COLP3/252-452-----------------------EKVSLTE--------------------------F---N----L--------F-----
B4RFD4_PHEZH/83-270-----------------------.AVTREE--------------------------F---R----A--------Y-----
Q219B0_RHOPB/108-292-----------------------DDVSRRE--------------------------F---Q----A--------F-----
Q08QK2_STIAD/62-252-----------------------EHVTHEE--------------------------F---R----I--------Y-----
C4KA21_THASP/254-442-----------------------DQVSRAD--------------------------F---H----E--------F-----
A4Y0E4_PSEMY/86-274-----------------------EHVSRDD--------------------------W---R----T--------Y-----
F6IK42_9SPHN/137-319-----------------------SEVDPEQ--------------------------F---K----E--------F-----
Q2IJN1_ANADE/84-269-----------------------..PDRVG--------------------------F---R----T--------Y-----
D8IR87_HERSS/94-279-----------------------HALTRER--------------------------L---L----R--------Y-----
C1DAE3_LARHH/90-274-----------------------..LNYRD--------------------------I---N----T--------F-----
C6WVK9_METML/84-271-----------------------DTVKPNE--------------------------F---H----T--------Y-----
A1S3J9_SHEAM/87-273-----------------------DNFDYSR--------------------------M---Q----L--------Y-----
A6WGQ7_KINRD/89-271-----------------------PALTDEQ--------------------------F---Q----D--------L-----
Q3IF69_PSEHT/252-436-----------------------EDVNFKE--------------------------F---R----Q--------F-----
Q883N8_PSESM/123-304-----------------------HQVEQSE--------------------------F---N----G--------F-----
G4SVS5_META2/83-276-----------------------EHVDRQE--------------------------F---Q----Q--------F-----
I3TTP9_TISMK/93-271-----------------------RSFDEER--------------------------F---R----R--------F-----
L0DVR6_THIND/324-514-----------------------.TIDAAG--------------------------F---R----V--------L-----
W1PQ59_AMBTC/159-356-----------------------SAIDQRT--------------------------F---A----E--------Y-----
W0RB56_9BACT/134-324-----------------------DDVTAAE--------------------------F---G----A--------Y-----
A9S5U9_PHYPA/114-296-----------------------SAINQET--------------------------F---A----T--------Y-----
C4ZNX8_THASP/71-258-----------------------DHVGRSE--------------------------W---A----A--------Y-----
H0PUF6_9RHOO/94-283-----------------------NYVSQKE--------------------------W---Q----Q--------Y-----
D0J4K2_COMT2/81-267-----------------------QGISRAD--------------------------F---R----R--------Y-----
Q6AKV4_DESPS/76-260-----------------------HLVERYE--------------------------F---R----L--------W-----
W5DMW9_WHEAT/37-217-----------------------PALDQDT--------------------------F---A----D--------Y-----
Q2W343_MAGSA/76-261-----------------------...ERDM--------------------------L---A----S--------Y-----
DHKA_DICDI/838-1037-----------------------.STSEDQ--------------------------F---V----P--------F-----
Q0KC83_CUPNH/84-282-----------------------DHVSRGE--------------------------F---R----D--------F-----
G7ZIA9_AZOL4/105-291-----------------------..LHWTQ--------------------------W---N----R--------F-----
A1K5S9_AZOSB/253-435-----------------------ENVNGND--------------------------F---R----D--------F-----
G2KLH3_MICAA/276-461-----------------------DNVSRDE--------------------------W---Q----T--------F-----
F0LYC4_VIBFN/85-270-----------------------.NFDYDQ--------------------------M---Q----T--------Y-----
E4U250_SULKY/105-291-----------------------DDVSRTD--------------------------W---H----R--------Y-----
K9ZW21_DEIPD/84-269-----------------------SEVSRDD--------------------------F---A----R--------Y-----
D2U8Z5_XANAP/80-263-----------------------..LRSDQ--------------------------L---R----H--------Y-----
Q2SDA7_HAHCH/285-471-----------------------....PQD--------------------------F---E----R--------Y-----
K4KJ54_SIMAS/76-256-----------------------EHVSREE--------------------------F---G----E--------F-----
Q9HWR8_PSEAE/80-264-----------------------.HIDREL--------------------------F---R----R--------Y-----
G4QFV2_GLANF/57-243-----------------------.SFDYQT--------------------------M---M----N--------Y-----
Q1GF37_RUEST/79-254-----------------------GELNARD--------------------------W---H----T--------F-----
G4SUW0_META2/86-274-----------------------DDVTLEE--------------------------F---R----D--------Y-----
F9ZZJ6_METMM/258-439-----------------------KHVSREE--------------------------F---E----H--------F-----
D9SIV1_GALCS/261-453-----------------------PDINRLK--------------------------F---E----R--------Y-----
W1PSE7_AMBTC/96-292-----------------------SAIDQKT--------------------------F---A----E--------Y-----
W5GD18_WHEAT/393-584-----------------------SSINQVT--------------------------F---A----T--------Y-----
M0TSU6_MUSAM/30-211-----------------------PALDQET--------------------------F---A----Y--------Y-----
D8IWN5_HERSS/73-261-----------------------GAIDRSQ--------------------------F---R----D--------Y-----
D0KWD4_HALNC/274-462-----------------------NSLTRQQ--------------------------F---N----A--------Y-----
AHK2_ARATH/304-499-----------------------SAIDQRT--------------------------F---E----E--------Y-----
CYAG_DICDI/88-275-----------------------PNFDRND--------------------------F---N----V--------F-----
K9SC53_9CYAN/81-277-----------------------NDVSLRR--------------------------F---Q----A--------Y-----
D3RTB4_ALLVD/74-266-----------------------EAVSREE--------------------------W---R----A--------F-----
G8AFS0_AZOBR/65-258-----------------------...TRDG--------------------------F---A----A--------A-----
C7RCU7_KANKD/81-264-----------------------EKVTRFE--------------------------F---E----H--------F-----
Q8EJC3_SHEON/87-273-----------------------RGVTRSE--------------------------W---Q----T--------Y-----
M0U7W3_MUSAM/128-319-----------------------SAIDQIT--------------------------F---A----R--------Y-----
A4VIL7_PSEU5/82-268-----------------------DEVKADD--------------------------W---A----R--------A-----
Q7NXK5_CHRVO/87-272-----------------------HGINRQR--------------------------F---R----V--------Y-----
D7KBN9_ARALL/166-363-----------------------SAIDQRT--------------------------F---S----E--------Y-----
D9SIS9_GALCS/75-263-----------------------KSVEHHE--------------------------W---K----S--------Y-----
A9TVM0_PHYPA/180-361-----------------------..VNDSI--------------------------W---K----N--------F-----
W0E361_MARPU/83-262-----------------------DRVRLAE--------------------------F---R----R--------Y-----
K9U3Z3_9CYAN/81-269-----------------------ETVTSQE--------------------------F---R----A--------F-----
D4ZFW6_SHEVD/75-265-----------------------DDVNEAE--------------------------F---K----Q--------L-----
K0I1R5_9BURK/84-233-----------------------GSMSPDI--------------------------F---A----T--------V-----
G2J059_PSEUL/87-274-----------------------GDVSRQE--------------------------F---N----D--------Y-----

PF17151

A8AF72_CITK8/8-194-----------------------TWREVVV--------------------------L---E----S--------------
I2B7Y2_SHIBC/35-221-----------------------AWRVAVV--------------------------L---E----Q--------------
A6TB76_KLEP7/37-223-----------------------IWREINV--------------------------L---E----E--------------
YEDQ_ECOLI/41-227-----------------------TWREVVV--------------------------L---E----D--------------
YEDQ_SALTY/41-227-----------------------TWREVMI--------------------------L---K----D--------------
Q1LHF7_RALME/40-225-----------------------AMRDLYL--------------------------L---R----E--------------
A7MJL3_CROS8/34-221-----------------------TWREGVI--------------------------L---Q----D--------------
Q1LM75_RALME/47-231-----------------------IFRGMML--------------------------S---R----D--------------
E6WDV9_PANSA/32-218-----------------------TVHEALE--------------------------L---K----T--------------

PF10388

Q5WG23_BACSK/282-448----------------------FVDENSFK--------------------DKLKKDM---H----H--------F-----
Q9KAL0_BACHD/239-405----------------------FVDRELCK--------------------EKLQKDF---H----H--------F-----
Q8EP65_OCEIH/239-405----------------------FVEVDSCK--------------------SIIQDSF---K----Q--------F-----
A8FCM0_BACP2/240-406----------------------LIDRNKRK--------------------DQLREEF---Q----Q--------F-----
Q65K95_BACLD/240-406----------------------FIERDVLK--------------------DRLQAEF---H----Q--------F-----
Q5L150_GEOKA/240-405----------------------VVPRDLLK--------------------DLLRQEC---H----R--------F-----
B1HPH4_LYSSC/241-404----------------------LVDKDVLK--------------------ERFKKEC---Q----Q--------F-----
Q81MP3_BACAN/233-398----------------------FIETNVLK--------------------ERLGNEC---H----Q--------F-----
U5LAK7_9BACI/240-403----------------------.IEKDYLK--------------------EKLKTEF---H----R--------F-----

PF08918

A7MFU1_CROS8/11-189----------PLS----------LRVRFLL--------------------ATAAVVLVLSL----A--------Y-----
D3VIC4_XENNA/9-185----------.VS----------LRTRFLM--------------------ATIVIILALTL----S--------Y-----
Q2NU19_SODGM/11-189----------PFS----------LRVRFLL--------------------AAACVVLALSL----C--------Y-----
E0SDF9_DICD3/5-184----------PFS----------LRFRFLI--------------------ATAAVVLALTL----S--------Y-----
H2IU53_RAHAC/9-187----------PFS----------LRVRFMM--------------------ATAAVVLTLSL----A--------Y-----
Q7CJ04_YERPE/8-186----------PFS----------LRARFLM--------------------ATAGVILALSL----S--------Y-----
I2BAB0_SHIBC/10-189----------PLS----------LRVRFLL--------------------ATAAVVLVLSL----A--------Y-----
B2VDQ4_ERWT9/11-189----------PFS----------LRIRFIL--------------------ATAAVVLTMSL----S--------Y-----
D3V7Z8_XENBS/1-171----------...----------......M--------------------ATSAIILALTL----S--------Y-----
J7TLZ1_MORMO/8-188----------PFS----------LRTRFLL--------------------ATFAVILAMTL----S--------Y-----
D8MQW1_ERWBE/9-187----------PFS----------LRARFLV--------------------ATAAVVLILSL----S--------Y-----
I0DPC3_PROSM/13-190----------PLS----------LRARFLC--------------------ATSAVILALTL----S--------Y-----
Q7N3B1_PHOLL/8-189----------PFS----------LRTRFLM--------------------ATAAVILALTM----S--------Y-----
U3U2N0_9ENTR/9-187----------PFS----------LRARFLL--------------------ATAAIVLFLSL----S--------Y-----
B4EVF8_PROMH/8-186----------PFS----------LRTRFLL--------------------ATSAIILALTL----S--------Y-----
C5B8C6_EDWI9/13-191----------PLS----------LRTRFML--------------------ATAAMVFLLSL----A--------Y-----
A6T7J7_KLEP7/10-189----------PLS----------LRVRFLL--------------------ATAGVVLVLSL----A--------Y-----
A8GDC5_SERP5/8-186----------PFS----------LRARFLM--------------------ATAGVILALSL----S--------Y-----
Q6D4E5_PECAS/7-185----------PFS----------LRIRFLL--------------------ATAAIVLALSL----A--------Y-----
A8AHT7_CITK8/10-189----------PLS----------LRLRFLL--------------------ATAGVVLVLSL----A--------Y-----

PF08521

Q21ZH0_RHOFT/35-180-----------------------QLVLWLV--------------------GG----A---L....A--------Y-----
A7MHT7_CROS8/21-169-----------------------LSLLWAF--------------------SV----L---N....S--------Y-----
D7DMC5_METV0/17-156-----------------------MLVIAPV--------------------AA----T---F....Q--------Y-----
G4SVN9_META2/19-161-----------------------VLLFVVF--------------------EA----V---S....S--------Y-----
D0IYD3_COMT2/45-190-----------------------LLLLWPV--------------------SL----A---L....T--------W-----
K0HXP6_9BURK/21-166-----------------------QLVLWLS--------------------GG----F---L....A--------W-----
Q1LHC0_RALME/34-180-----------------------LALMMAV--------------------DT----W---F....T--------Y-----
V5UEH0_9BURK/16-158-----------------------LSLYIGA--------------------SA----W---L....A--------Y-----
W6REE1_9RHIZ/20-162-----------------------.AIIGMV--------------------AL----V---D....T--------Y-----
E3HE65_ACHXA/21-162-----------------------LACALIG--------------------LV----F---F....L--------R-----
Q7N2B0_PHOLL/22-170-----------------------LFVLGCL--------------------SV----G---T....H--------Y-----
D0J851_COMT2/17-157-----------------------LMLLAAM--------------------GG----W---F....S--------Y-----
B2FTQ3_STRMK/20-163-----------------------LLVLLLC--------------------SA----V---G....S--------F-----
G4RD40_PELHB/25-169-----------------------LLAGAAA--------------------LT----F---A....A--------W-----
B1XY05_LEPCP/28-171-----------------------LLVIWPM--------------------SL----A---L....T--------W-----
A1W6F7_ACISJ/19-171-----------------------TLLFVGV--------------------NT----Y---S....L--------H-----
A7IFI7_XANP2/18-161-----------------------LAGLVAL--------------------NV----W---T....S--------G-----
B1XY62_LEPCP/33-182-----------------------QLVLWLA--------------------AA----V---V....S--------Y-----
K0IC76_9BURK/24-165-----------------------LALVTGV--------------------EL----W---M....T--------R-----
W0PHH3_9BURK/20-166-----------------------LLLTMLT--------------------AL----G---L....S--------S-----
Q47FQ2_DECAR/28-166-----------------------LIVILAS--------------------SS----I---F....D--------Y-----
D5CMP6_SIDLE/20-160-----------------------LYLLWII--------------------ST----V---V....G--------Y-----
A8GH47_SERP5/22-170-----------------------LLVLGGI--------------------SI----Y---T....H--------Y-----
Q20WQ9_RHOPB/19-153-----------------------.VVWIAA--------------------VT----W---I.....--------Y-----
Q607J4_METCA/19-161-----------------------LAFVVML--------------------DA----A---V....S--------Y-----
A2SKN2_METPP/18-155-----------------------.VLIAPV--------------------RL----F---F....D--------L-----
Q47IZ4_DECAR/32-179-----------------------LLFVWPL--------------------SI----A---F....T--------H-----
B4E6M7_BURCJ/17-158-----------------------LAVFVLI--------------------AG----A---M....S--------Y-----
C6XAG9_METGS/19-164-----------------------LLILIAV--------------------DS----T---I....L--------Y-----
Q2KVA5_BORA1/16-172-----------------------VIVLLVI--------------------DS----L---N....D--------Y-----
E1V7G1_HALED/22-165-----------------------..GLGTL--------------------LM----I---E....A--------Y-----
F4GUR2_PUSST/48-190-----------------------LFLLWTV--------------------GL----V---I....T--------Y-----
D8IWK7_HERSS/26-167-----------------------LLVSAAA--------------------LL----I---A....I--------W-----
A9BTX8_DELAS/27-175-----------------------IAALWVA--------------------SF----F---IATGAA--------Y-----
D9SGQ5_GALCS/25-160-----------------------MLILLVI--------------------NI----V---V....V--------S-----
G8AZZ8_AZOBR/21-171-----------------------LAVLTAG--------------------LF----L---F....V--------S-----
V9VQU0_9RHOB/24-165-----------------------.ALLAAL--------------------LF----L---A....V--------L-----
M9R6B1_9RHOB/62-203-----------------------AALLAIV--------------------LF----L---F....V--------R-----
Q122H1_POLSJ/29-174-----------------------LLLLWPI--------------------SL----A---L....T--------W-----
V5UCE1_9BURK/87-233-----------------------LLLLWPM--------------------SI----A---V....T--------Y-----
Q1H1R1_METFK/19-157-----------------------LTALVAV--------------------GI----L---T....D--------Y-----
Q4KGR3_PSEF5/19-167-----------------------LVVLMLA--------------------SG----L---S....A--------Y-----
C7RKT3_ACCPU/5-153-----------------------LLFVWPI--------------------SI----A---F....T--------H-----
G8QN90_AZOSU/33-180-----------------------LLFVWPI--------------------SI----A---I....T--------H-----
G8PV87_PSEUV/23-165-----------------------AAVLAAL--------------------LF----V---M....V--------M-----
A6W2X9_MARMS/20-171-----------------------LIVINVV--------------------AL----W---S....A--------H-----
E3HPN1_ACHXA/41-186-----------------------.VVALAT--------------------LY----L---L....V--------R-----
C1DL46_AZOVD/26-174-----------------------LAVLLAV--------------------SG----L---S....A--------Y-----
I3THH3_TISMK/17-162-----------------------VAAGAVI--------------------LV----T---A....A--------W-----
Q47EV6_DECAR/21-164-----------------------MLVLLLL--------------------GA----L---S....A--------N-----
A7IE83_XANP2/18-150-----------------------.VIWLCA--------------------TG----W---I.....--------Y-----
G0AJ95_COLFT/18-161-----------------------LMLFVGV--------------------NI----W---V....T--------Y-----
E3F5P7_KETVY/20-164-----------------------.LFVFLS--------------------SL----W---V....T--------H-----
D0J2J1_COMT2/28-180-----------------------VLALIAL--------------------NA----W---S....L--------Y-----
A1VLL9_POLNA/25-177-----------------------VGLLVIM--------------------NT----V---G....L--------Y-----
G2IUK1_PSEUL/21-170-----------------------QLVLWLA--------------------AA----Y---L....A--------Y-----
S6AAH4_9PROT/20-166-----------------------LITLFAA--------------------RS----A---Y....T--------Y-----
Q8Y1Y8_RALSO/59-201-----------------------LLLLWPM--------------------SI----A---V....T--------Y-----
A9I4J5_BORPD/28-184-----------------------VIVLLVI--------------------DS----W---N....D--------Y-----
Q13LY1_BURXL/18-164-----------------------LLLLLAL--------------------DA----W---L....T--------Y-----
Q21TS3_RHOFT/17-160-----------------------LICAVAV--------------------DT----W---L....T--------F-----
C7RPR7_ACCPU/26-161-----------------------.LLGLAL--------------------SG----A---L....S--------Y-----
S6AAN6_9PROT/19-158-----------------------LVLLLVA--------------------GA----I---T....A--------Y-----
Q9I5H2_PSEAE/19-167-----------------------LLLVLLA--------------------SG----L---S....A--------Y-----
C5CRC4_VARPS/23-167-----------------------LLLLVPV--------------------SI----G---V....T--------W-----
K0HX06_9BURK/17-156-----------------------LCVLALV--------------------GV----W---L....D--------Y-----
C4ZLE6_THASP/17-178-----------------------TGLLLAI--------------------AG----A---V....A--------Y-----
B2JDB3_BURP8/56-201-----------------------LLLLWPM--------------------SL----A---V....T--------Y-----
A2SJH0_METPP/17-152-----------------------..LVWTG--------------------GL----L---F....S--------L-----
G0AFZ6_COLFT/38-197-----------------------LLLLWPI--------------------SI----A---I....T--------Y-----
A1TI71_ACIAC/33-170-----------------------LALTWFA--------------------GT----A---I....S--------V-----
H5WRT2_9BURK/26-164-----------------------LGVIVPA--------------------AV----A---L....Q--------Y-----
B2U723_RALPJ/34-182-----------------------LVVYVAA--------------------DG----W---L....D--------L-----
D8J290_HERSS/17-158-----------------------MAVYVGL--------------------ST----S---D....A--------Y-----
Q2JYY6_RHIEC/22-159-----------------------..GAIGF--------------------NL----Y---D....S--------F-----
A4G8B6_HERAR/45-197-----------------------LLLLWPL--------------------SI----A---I....T--------Y-----
A1TW34_ACIAC/23-169-----------------------LLLLWPV--------------------SL----A---L....T--------W-----
A9BY32_DELAS/17-157-----------------------LTLLALM--------------------GG----W---F....G--------Y-----
Q0K946_CUPNH/22-168-----------------------LMALLAF--------------------DA----W---L....T--------Y-----
A1K438_AZOSB/36-181-----------------------LLFLWPI--------------------SI----I---V....T--------H-----
D5UZP4_ARCNC/21-163-----------------------LIIFSIL--------------------LF----S---V....I--------Y-----
E1VB88_HALED/19-164-----------------------MVALGGL--------------------ML----F---Q....A--------W-----
D5BND2_PUNMI/39-180-----------------------.IVISAL--------------------LF----F---T....M--------R-----
B9JD92_AGRRK/17-156-----------------------LIGAICV--------------------NL----Y---L....S--------Y-----
G0AH57_COLFT/17-159-----------------------LAVFVAI--------------------SA----T---L....S--------Y-----
B0UD46_METS4/18-149-----------------------.LIWLSA--------------------VA----W---I.....--------Y-----
Q63Z01_BURPS/17-161-----------------------LAVFVAI--------------------AG----A---M....S--------Y-----
A7IHL3_XANP2/20-161-----------------------VLLLAVA--------------------IG----A---G....G--------Y-----
H8GIB2_METAL/20-162-----------------------FFVLVLL--------------------DA----A---V....S--------Y-----
M4NKF0_9GAMM/25-166-----------------------VGVLLLL--------------------DA----L---L....T--------Y-----
I0DPY9_PROSM/22-170-----------------------LIMLGGF--------------------SV----Y---T....H--------Y-----
H5WKZ5_9BURK/29-178-----------------------LLLLWPM--------------------SV----A---L....T--------W-----
C5CW02_VARPS/30-171-----------------------LALTWMV--------------------GA----V---I....A--------L-----
Q1LMW7_RALME/18-164-----------------------LLGLLAF--------------------DA----W---L....T--------D-----
A6X4R7_OCHA4/24-167-----------------------LIVVAGI--------------------NL----W---T....A--------W-----
A8I2Y3_AZOC5/2-143-----------------------LALGALL--------------------LS----F---A....A--------W-----
D3VKW5_XENNA/22-170-----------------------LLLLGFT--------------------SV----H---I....Q--------Y-----
C5ACW0_BURGB/16-156-----------------------MTVFIVA--------------------AG----L---I....T--------R-----
F2J3Y9_POLGS/18-160-----------------------LIVVAGI--------------------AA----V---V....R--------F-----
E3HFF1_ACHXA/25-181-----------------------VIMLLVV--------------------DS----V---N....D--------Y-----
G8MCL6_9BURK/13-157-----------------------LALFVTM--------------------AV----I---T....G--------Y-----
H2FVD7_OCESG/24-172-----------------------LAALALL--------------------AL----V---L....M--------Q-----
U3TX11_9ENTR/19-167-----------------------LLLLWGL--------------------SV----Y---T....H--------Y-----
W8X979_CASDE/29-172-----------------------LFVLWSI--------------------GI----V---I....T--------Y-----
A2SBV0_METPP/22-171-----------------------LLLLWPM--------------------SV----A---L....T--------W-----
W0A7F6_9SPHN/28-165-----------------------LLGIAIL--------------------IG----F---A....G--------S-----
D7DK71_METV0/18-149-----------------------LGVAWLV--------------------AA----W---F....T--------H-----
H0PXM1_9RHOO/36-181-----------------------LLFLWPI--------------------SI----I---V....T--------H-----
A8LLA9_DINSH/24-162-----------------------.AATAVI--------------------LY----F---V....V--------Q-----
K0HVR7_9BURK/23-175-----------------------VVLFIGF--------------------NT----W---S....L--------Y-----
Q28LK3_JANSC/21-159-----------------------VALLALV--------------------SW----G---M....V--------T-----
D7A885_STAND/19-154-----------------------..IWLCA--------------------IA----W---I.....--------S-----
A4YN24_BRASO/26-168-----------------------LAVGAVV--------------------LS----L---A....A--------W-----
C4ZKZ6_THASP/47-192-----------------------LAVLLLI--------------------NA----F---F....T--------H-----
D8J280_HERSS/20-159-----------------------LLLVNLI--------------------GA----G---L....T--------Y-----
B9JZT0_AGRVS/33-177-----------------------LVGVIGF--------------------NL----Y---F....G--------L-----
Q92TS1_RHIME/26-169-----------------------TAVIGVV--------------------AL----A---D....T--------Y-----
E5AKH4_BURRH/19-158-----------------------LSMLALM--------------------SG----L---I....A--------Y-----
G8MB33_9BURK/27-165-----------------------LSLLALM--------------------SG----L---M....A--------Y-----
B0UNA3_METS4/20-164-----------------------LAVGAAL--------------------LL----A---A....A--------W-----
Q21SM6_RHOFT/22-157-----------------------LCLLAGV--------------------NA----W---F....D--------Y-----
G4R8W0_PELHB/23-164-----------------------LVFVALA--------------------SS----V---V....R--------Y-----
Q21RF3_RHOFT/23-167-----------------------LLLLWPV--------------------SL----V---L....T--------W-----
W6RK56_9RHIZ/35-174-----------------------LAGAICV--------------------NL----Y---L....S--------F-----
D7DN59_METV0/25-165-----------------------LFLGTIS--------------------..----.---.....A--------Y-----
Q47GU4_DECAR/25-163-----------------------LIALLIV--------------------SL----A---F....D--------Y-----
Q21VT6_RHOFT/15-158-----------------------TLALWLL--------------------GS----V---I....G--------Y-----
A4VRR5_PSEU5/22-170-----------------------LALLLLF--------------------SG----W---S....A--------Y-----
B1Y781_LEPCP/20-172-----------------------VGLLVAI--------------------NT----W---S....L--------Y-----
W8WTJ5_CASDE/25-170-----------------------.IAVLSL--------------------AL----W---L....S--------S-----
Q1LGC3_RALME/22-170-----------------------LLTVGIV--------------------SA----F---A....S--------Y-----
Q8P5J0_XANCP/24-166-----------------------.LLGAVV--------------------LF----F---A....A--------R-----
Q2KYE6_BORA1/5-149-----------------------LFLLWPM--------------------SV----A---I....T--------Y-----
B2UDU4_RALPJ/26-175-----------------------LVGVLAI--------------------DI----V---S....A--------Y-----
G8QM05_AZOSU/19-158-----------------------MLALVAA--------------------GG----L---M....A--------Y-----
A9CHT1_AGRFC/21-163-----------------------.AIIGCV--------------------AL----T---D....T--------W-----
Q12DJ3_POLSJ/2-146-----------------------.ALVTAA--------------------SL----W---L....T--------R-----
D5BMD5_PUNMI/20-162-----------------------LLFVASL--------------------AL----S---W....Q--------Y-----
A9BLF0_DELAS/26-166-----------------------...VTSV--------------------EL----Y---L....T--------R-----
C4ZNL8_THASP/41-186-----------------------LLFLWPI--------------------SI----I---V....T--------H-----
F4GTA9_PUSST/2-157-----------------------.....LF--------------------DS----W---N....D--------Y-----
Q63WW7_BURPS/62-207-----------------------LLLLWPM--------------------SI----A---V....T--------Y-----
I0HYA8_RUBGI/22-170-----------------------LLLLWPM--------------------SV----A---L....T--------W-----
E0SL95_DICD3/29-176-----------------------MALLWAL--------------------SV----W---S....H--------Y-----
A4G8H3_HERAR/5-148-----------------------LSLILLI--------------------DI----V---G....S--------Y-----
A6W3P7_MARMS/22-165-----------------------LLSIFLI--------------------LS----L---G....V--------W-----
G8MK80_9BURK/17-159-----------------------LAIYVFV--------------------TG----K---A....A--------Y-----
C5A845_BURGB/22-162-----------------------LSMLALM--------------------SG----L---I....A--------Y-----
Q0K5I3_CUPNH/61-216-----------------------LFALVLT--------------------SG----S---L....S--------Y-----
Q9PGH7_XYLFA/26-166-----------------------....IAL--------------------LF----F---A....A--------R-----
Q8XYM3_RALSO/18-164-----------------------LLGLLAL--------------------DA----W---L....T--------Y-----
Q5P7G5_AROAE/70-215-----------------------LLFLWPI--------------------SI----I---V....T--------H-----
Q0KE80_CUPNH/28-173-----------------------LLLLWPM--------------------SI----A---V....T--------Y-----
Q2L1Q3_BORA1/9-150-----------------------LACASIA--------------------LF----F---F....L--------R-----
A8I2V4_AZOC5/2-140-----------------------.....AL--------------------NV----W---T....S--------F-----
Q82XD6_NITEU/23-161-----------------------LIAVFIG--------------------SI----L---F....D--------Y-----
G0ACP3_COLFT/31-164-----------------------.TLLWLA--------------------SL----T---I....M--------V-----
B2FTU1_STRMK/26-168-----------------------LAVFAVA--------------------LL----F---A....A--------R-----
K0I0K5_9BURK/32-175-----------------------LVLIWGL--------------------GS----T---V....V--------L-----
A1TRJ2_ACIAC/23-175-----------------------VALFIAY--------------------NT----A---S....L--------Y-----
A4XSA9_PSEMY/19-167-----------------------LSLILLL--------------------SS----L---S....A--------Y-----
I7EXC3_PHAIB/24-165-----------------------.AFLASL--------------------LF----F---I....V--------L-----
A1AYT1_PARDP/20-163-----------------------TLVLGTA--------------------AL----I---D....T--------W-----
A1TUP0_ACIAC/17-156-----------------------LCVLALA--------------------GA----W---L....D--------Y-----
Q13KD9_BURXL/17-159-----------------------LALYVFV--------------------TG----K---A....E--------Y-----
Q1QZL9_CHRSD/20-165-----------------------VSALGVL--------------------LL----V---E....A--------Y-----
C5D1T2_VARPS/20-162-----------------------LAVLLVL--------------------DT----G---A....A--------Y-----
Q7VSR2_BORPE/26-171-----------------------LVFVMTG--------------------AL----W---L....S--------N-----
Q5LWY2_RUEPO/23-164-----------------------AAVLAAL--------------------LF----L---I....V--------Q-----
C1DBC6_LARHH/23-162-----------------------..AAWVV--------------------SA----M---I....N--------Y-----
Q7VVT9_BORPE/5-149-----------------------LFLLWPM--------------------SV----A---I....T--------Y-----
A1WEU1_VEREI/23-167-----------------------LLLLWPV--------------------SL----A---L....T--------W-----
B2FUF4_STRMK/20-162-----------------------MLGLLTF--------------------NT----I---L....A--------Y-----
Q984L4_RHILO/18-155-----------------------LAGLATI--------------------NL----W---T....S--------H-----
M4S398_9SPHN/10-147-----------------------.FVLLVG--------------------GG----L---A....L--------D-----
Q2SLI2_HAHCH/66-216-----------------------ILVLGTL--------------------AI----I---A....I--------D-----
Q1GD00_RUEST/23-161-----------------------AALLAGL--------------------MF----L---V....V--------Q-----
C5A8I2_BURGB/27-165-----------------------....ALA--------------------LA----V---I....T--------R-----
F6AA71_PSEF1/20-167-----------------------.TVILLV--------------------SS----L---T....A--------Y-----
F5Y2Y3_RAMTT/23-167-----------------------LLLLWPV--------------------SL----A---L....T--------W-----
B8IFI3_METNO/20-162-----------------------AAALALV--------------------LG----F---G....G--------A-----
B9JLB1_AGRRK/22-164-----------------------.VVIGVV--------------------AL----A---D....T--------Y-----
A6VW98_MARMS/41-182-----------------------...IAGL--------------------AI----N---L....I--------F-----
Q1QXK5_CHRSD/22-163-----------------------MLLLGSL--------------------VL----A---Q....A--------Y-----
I0HPY4_RUBGI/21-160-----------------------VLVLVAL--------------------TA----A---L....G--------A-----
F5XYY8_RAMTT/17-156-----------------------LVLLACL--------------------NA----W---F....D--------Y-----
S6AMF6_PSERE/19-167-----------------------LGALLLI--------------------AS----L---S....S--------Y-----
G0AFU1_COLFT/36-184-----------------------LLLLVAL--------------------DA----F---S....V--------Y-----
C5CP05_VARPS/19-171-----------------------VALFIVI--------------------NS----V---S....L--------Y-----
H5WRA6_9BURK/20-174-----------------------VLALVLA--------------------NS----V---S....L--------Y-----
Q63MF1_BURPS/18-161-----------------------FLGLLAL--------------------DS----W---L....T--------Y-----
D5X6A3_THIK1/38-189-----------------------MLLLWPL--------------------SI----G---I....T--------Y-----
F5Y4Y9_RAMTT/21-173-----------------------VVVLIAL--------------------NG----A---S....L--------Y-----
B4EL38_BURCJ/24-165-----------------------.ATGALA--------------------LA----A---I....A--------R-----
G7ZCI7_AZOL4/27-176-----------------------LAVLTGC--------------------LF----L---F....V--------D-----
Q164X8_ROSDO/23-163-----------------------AAVLAVL--------------------IY----L---F....T--------R-----
H8L6H6_FRAAD/33-174-----------------------LMMLLVA--------------------GA----A---V....T--------Y-----
A1VTK5_POLNA/19-162-----------------------QLVLWLV--------------------GG----A---L....T--------Y-----
D2UE67_XANAP/29-171-----------------------TLLLMLL--------------------VS----A---I....F--------Y-----
V5UAY1_9BURK/20-161-----------------------LAFAVAA--------------------VL----L---G....I--------W-----
B4EIF9_BURCJ/19-168-----------------------LLGLLAL--------------------DS----W---L....T--------Y-----
D8IY76_HERSS/23-171-----------------------IALFIII--------------------DS----F---S....L--------Y-----

PF17200

A0L3P0_MAGMM/40-183------------------------------------------------------------------------QTM-----
A1S653_SHEAM/40-186------------------------------------------------------------------------LEQ-----
A3QE36_SHELP/40-191------------------------------------------------------------------------LIK-----
A4JSR8_BURVG/33-185------------------------------------------------------------------------LID-----
A4YR51_BRASO/71-224------------------------------------------------------------------------LKL-----
A5G9N9_GEOUR/56-221------------------------------------------------------------------------ILD-----
A5MZ77_CLOK5/52-216------------------------------------------------------------------------LTK-----
A6LNC2_THEM4/37-187------------------------------------------------------------------------LKN-----
A6W0M2_MARMS/47-194------------------------------------------------------------------------VLE-----
A7GXL0_CAMC5/45-199------------------------------------------------------------------------VIT-----
A8FA00_BACP2/42-204------------------------------------------------------------------------LID-----
A8H430_SHEPA/40-193------------------------------------------------------------------------LIA-----
B1KDS9_SHEWM/40-192------------------------------------------------------------------------LIK-----
B3PF36_CELJU/33-187------------------------------------------------------------------------SNL-----
B8DJX7_DESVM/47-201------------------------------------------------------------------------AET-----
B8FHC1_DESAA/48-205------------------------------------------------------------------------IES-----
C0ZKG6_BREBN/43-206------------------------------------------------------------------------MDD-----
C4IB20_CLOBU/48-199------------------------------------------------------------------------MRY-----
C5AI41_BURGB/33-185------------------------------------------------------------------------LID-----
D3G0H7_BACPE/41-204------------------------------------------------------------------------LDE-----
D4H8R2_DENA2/45-194------------------------------------------------------------------------MMD-----
D6XXT0_BACIE/37-200------------------------------------------------------------------------AKE-----
F2G8C7_ALTMD/38-188------------------------------------------------------------------------LKQ-----
F2JZQ2_MARM1/41-189------------------------------------------------------------------------LKK-----
F6DRU7_DESRL/49-202------------------------------------------------------------------------SHQ-----
G2THG8_BACCO/43-205------------------------------------------------------------------------LNE-----
G8MDC4_9BURK/45-197------------------------------------------------------------------------YMS-----
I0GNI0_SELRL/45-198------------------------------------------------------------------------LTQ-----
Q896P7_CLOTE/42-204------------------------------------------------------------------------AMK-----

PF08269

A8EUE0_ARCB4/33-326----------VNNLTNQTIEEYKER.AFKTNIEEM-KNYTT------FAVNIAK....DAY----EESKIENVKA-----
B3E6F6_GEOLS/35-327----------EGSRFEQERHELDRN.MLEPRKQEL-KRQVD------SAIEYLE....YRR----SR.....LEE-----
B6BID4_SULGG/36-307----------....VNAYFHKVKEG.SIKEHVESK-KAKSE------IWVEQLNLLFDYKN----NR.....VDE-----
B6BJK6_SULGG/33-333----------INEMTEQSVSKYKEE.AYQNKESEL-KNYVS------VAMKSIE...SFYA----RTSKDK.IKK-----
B7VLV5_VIBTL/35-322----------.HLSNQKQLVRAEQL.FKDQHKQLL-KSQVD------VAKSQVL....YLK----ST.....TES-----
B8FJE3_DESAA/34-358----------LKSTAKAAAETTRIE.EMTKAQSRL-KDYVD------IAYASVD...SSYK----NAQDPAHLEK-----
B8FNF8_DESAA/36-333----------DYTSFKDQSVIMRQE.FMNQQKDLL-SSKVS------EVRDYID....YNG----NL.....TEK-----
B9LZD3_GEODF/40-338----------....ISTQQAYLGITQTSKADLEHM-ASFTI------DLLKSHHQQFQVYK----QD.....KER-----
C4XHF5_DESMR/36-364----------LGQYREASGLELRNR.LMAEAKDSQ-RQAVG------QAYDVIK...YFYD----VSQDDAALKK-----
C6BU22_DESAD/28-341----------AQRTVTESVMESEFA.HAQAIVDAV-YQEVN------NQYQSIV....FSE----KY.....AIA-----
C6BVV5_DESAD/30-331----------LNKYSEREMETYRET.IFSQKKSEL-TELVN------MADKTVA...AYFN----KSKNIELLKR-----
C6BYJ2_DESAD/31-323----------MVSSYQEELEEAEAE.IMGSVQESL-KEDVL------RIQDYIN....FSR----NA.....ARS-----
C6BYQ1_DESAD/28-326----------TSSTLEEDMAHFQGR.TARNTIRVG-MLYLQ------EGHQALD....RYR----KH.....AFQ-----
C7LTF2_DESBD/37-333----------SRQNAQSSFDRIEQT.LTEQIDARL-KAEMH------RAMTTLE....YIR----SQ.....TEA-----
D1B4Y3_SULD5/33-335----------SNTLVQTQINDEREL.ILEMHKNEL-KAHTM------MAEKAIA...SFYK----MT.....LDE-----
D1B584_SULD5/36-331----------EQTDYEKSLEQARIS.YVKRSKIQA-QERID------KLIDYIN....VNE----KL.....LRE-----
D4H1L4_DENA2/32-324----------FEEYNANNNQKLKQF.YTKQQKGLI-QNEVS------RLIQRIN....ATR----NA.....VLE-----
D4H3I8_DENA2/38-333----------TNTEFETERAQLVKN.FIETKKTNL-KSEVG------RLLDFTK....FNT----VQ.....TRN-----
D4H596_DENA2/35-327----------KYKQFQQYALQDRHN.SIENKKEII-KDIVN------SYVNHIN....YSI----NS.....KHE-----
D4H6Q5_DENA2/30-348----------IKSREKINLENFRQT.EYKRVEQKL-ESLLD------VTFESVT...STFE----NSTQKEYIQN-----
D5V1U1_ARCNC/34-335----------LYENYNKNILNLSHQ.ELELQKQHI-KTQID------SIYNYIE....YKK----TE.....APK-----
D5V2A1_ARCNC/30-322----------EYNNFLDEADQIKKD.FTKQRKADL-KREVN------KIYNYIS....YNE----NN.....III-----
D5V3A4_ARCNC/37-339----------KKQDVKNEVKILKTN.YLDENKKIV-KYEVL------NIISLIN....DEI----SK.....SEE-----
D5V3C7_ARCNC/36-334----------YNTTYLQEKKIMEKE.FIKFNKEIV-KNNVD------VAYNTIL....EIK----KN.....TEI-----
D5V4P6_ARCNC/34-297----------QQNNFKKESAQLEKE.YISKQKEIL-KKETN------GVISYIK....YQK----NL.....LIE-----
D5V4Y2_ARCNC/40-319----------EYSNFRTHIKSFKNT.LIEREMFYV-KTSVQ------NLKNDID....FES----LS.....IIN-----
E1R464_SPISS/40-311----------LSADYLQT........QMKSSTRTL-HNLIG------SL............----.......LRN-----
E6VS07_DESAO/37-301----------MHETVMTNIER.....QLDASTEAL-RAMVQ------SA............----.......TDA-----
E6W5X0_DESIS/41-338----------TYSRFEEEKHWIRQS.HMESQQSML-QERVD------NAVQVIS....KHR----EQ.....AQA-----
E8RBS9_DESPD/29-287----------...LIASALTHREEA.RAQADMTVV-RQLAE------TATQTVF.......----..........-----
E8RC22_DESPD/44-317----------HFTFTQLNA.......TIEEGMEAA-GSSIV------DMIELT........----.......VNS-----
F0JKB1_DESDE/34-312----------MYADFQADADRIREE.RYAERRSLV-KGEVD------DAIELIA....RLR----RS.....AAD-----
F2K254_MARM1/36-332----------NREKALHSTNSLREE.LLNQRREVV-RSQVH------QVYKQLI....VEK----SN.....IRS-----
F2LTM5_HIPMA/26-310----------.GYIFSKNIDVVKNE.YVNLLKEQV-KGDVI------DIKEYIP....YLA----LK.....SER-----
F2LUQ6_HIPMA/35-337----------..KIINKAIYYFNEDIHIKREIRLE-HSEIK------DAVRLIN....KKR----ED.....EYE-----
H2J6M5_MARPK/30-340----------.GIAMYKNLKNLTDQ.YVKN..GVL-KQSVE------NIATTME.......----.......TYR-----
Q2SG38_HAHCH/40-346----------THRDVGRAMLHAEES.SAQNVLKLV-ELNIK------AGYDQLT....GDK----IE.....ILS-----
Q30Q08_SULDN/33-332----------TEEIFNNSTKNLKQE.LILKEKNNT-ISKVK------MAVEILK....YEN----ST.....LEE-----
Q30XR6_DESAG/39-337----------..GFAETEGERFRAS.ETEKRKIQL-ANMVS------VAENTIR...SYYE----RSVDMEALKK-----
Q47JH8_DECAR/47-342----------.LSEQRAAFARVELA.ATQQLEARL-QAEMD------GVTNFIE....FTR----SR.....TED-----
Q6AMC2_DESPS/35-333----------EYQAYKESIDNIINN.YNNQYQSRV-REEVN------SATDYIH....YSL----QE.....ELA-----
Q7M809_WOLSU/66-363----------LAPKMKEEQFKTETH.TIERLLSKM-EHQVR------LAIKVNQFHSSSQK----TN.....NDL-----
Q7MJL5_VIBVY/36-329----------NKSRTTQLIETLRSD.FTDNQKANV-ARQVE------SVYQQLE....YER----GQ.....TIH-----

PF13777

C3KQ81_RHISN/249-440------------------------LVFNALFAVQT-LLDLA------YLWGR...AELP.A----GMT...HAEY-----
G7MAX1_9CLOT/244-433------------------------.FLCTIYVMYC-LAKFT------YLISSFM.GILP.A----EYT...FSEY-----
R6C9R7_9CLOT/244-433------------------------IPLTVLYMVFC-WIQIF------CLFGG..NFNM..Q----GMT...YAEY-----
R7XSF7_9ACTN/603-792------------------------.LVDAVFVLFL-VAQAT------AVFGGHDYVERT.T----GLT...YADY-----
E9T3K9_RHOHA/262-453------------------------VLLDLLFAGFV-AVQVP------VLFGGDDHVQGT.A----GLT...YSHY-----
Q98E42_RHILO/209-400------------------------IVFNVLFALQT-GLDAT------YLWGG...VALP.D----GLS...YAAY-----
W0RDV6_9BACT/257-448------------------------GAVTLVFGAYL-ASQLG------WLVGGERFLRER.T----GLT...AAEY-----
C0ZMG5_RHOE4/260-451------------------------GVLNVLFLGFV-AVQTK------TLFGGDEHVQVT.D----GLT...YADY-----
Q0S6K1_RHOJR/253-444------------------------ALLDLLFLGFV-AVQLT------VLFGGSTHVLTT.A----DLT...YAEY-----
A0Q168_CLONN/254-440------------------------TLITLLYSIFT-KIQIS------YLYIK...KSMP.E----GFS...YSEY-----
C6Y2K4_PEDHD/270-457------------------------SALNLLILALN-LIDIS------TLWLGETTS....T----NAS...YSEA-----
F0T1D6_SYNGF/255-442------------------------TALNLVFILFF-LSQIS------YLFSAFN.NRLP.E----LMT...YAEY-----
H6NQQ1_9BACL/283-470------------------------VMLNAVYALFA-LVQFS------YFFAGAE...LP.E----GIT...YAAY-----
R5XNB3_9CLOT/251-445------------------------TVLNIVYLLFC-IIQFV------YLFLFTNLGLN..E----IFD...YATY-----
R5B5Y8_9CLOT/255-441------------------------GMLLTLYVVYA-IFQFA------YLTGL...KGLP.E----GLT...YSQY-----
D9TC52_MICAI/510-701------------------------GALTLLFAGFV-VVQFT------TLFGGQQHVQRV.A----GLS...YAEY-----
E6XBP3_CELAD/234-418------------------------IALNSLLFIFL-ITDFI------YLIDT........D----TSTNSEYSKS-----
A5N2Q6_CLOK5/255-444------------------------AALNILYLIFT-IIQFS------YLYGGNN.IALP.A----DFT...YAEY-----
B8I1S1_CLOCE/282-473------------------------SIINIFIIAFV-GFQFM------YLFGGSDNIKI..T----GLS...YAEY-----
D7AWB3_NOCDD/181-372------------------------GALVLLFTAFL-AVQAV------AMFGGDEYVQRV.A----GVT...YAEY-----
R5KUL7_9FIRM/249-445------------------------SMVAVVYVMFA-TIQVV------YLFGH..GGSLP.Q----GYT...YAQY-----
E6UHQ5_RUMA7/288-478------------------------TPICLLYVLFF-ISQAN------YFLAAFM.NRLP.A----DLS...YAEY-----
D3PW34_STANL/613-804------------------------GLLCALFAAFL-TVQAT------AFFGGEDYVLRT.A----GLT...YAEY-----
A4FEG4_SACEN/91-282------------------------GLLVLLFAVFV-AVQST------PMFGGGQHVQHT.E----RLT...YAGY-----
G8SFI8_ACTS5/276-465------------------------GLLTLLFAAFV-AVQLT------VLFGGDRHVRTT.A----GLT...YAAY-----
C7N5K6_SLAHD/273-462------------------------VIMDTVYLLFA-GVQVV------YLFGGVESPVLA.D----G.....YAAY-----
B1MNA6_MYCA9/278-469------------------------AALNLLFIAFV-GVQIS------VLFGGDEHVQVT.E----GLT...YAEY-----
A0A068NWS3_9BACT/247-436------------------------ALLNLLFAAFI-ATQFR------HLFGGSEVIRNT.A----NLG...FGTY-----
R5F1N2_9CLOT/272-455------------------------AMVGLVYLVFC-VIQIV------YLFMG..KGSLP.E----GMT...YSQY-----
B2IDT0_BEII9/251-442------------------------FLFNALFALQT-MMDAT------YLWAG...HALP.S----GMT...HASY-----
G2NPR4_STREK/332-522------------------------IVLDLLFAVFL-GLQLV------VLLGGYDKVLEK.T----GLT...PAAY-----
R5QH46_9FIRM/290-468------------------------.ILTVIYLCFS-IIQIA------YLFIG..NMKLP.D----GYT...YAAY-----
M1MGT2_9CLOT/247-436------------------------.FLCVVYMIYC-LSQLT------YFISAFQ.GILP.S----DYT...FAAY-----
I0H5I7_ACTM4/429-619------------------------.ALVLLFAGFV-GVQFT------VLFGGSRHVLKT.A----GLS...YSEY-----
W6RZ80_9CLOT/366-546------------------------VLINILYLIFT-YIQVK------YLFIMRY......S----NFTAEGYSSY-----
R5H180_9FIRM/290-487------------------------SLLTAIYAVFC-TIQVV------YLFLR..AGTLP.E----QMT...WAQY-----
G8PM39_PSEUV/250-436------------------------VLFNGLFALQT-VLDAF------YLWGS...QELP.A----GTT...YANY-----
R5K472_9CLOT/342-524------------------------GLLTLVYLLFS-VIQIL------YLFTN..NMSLP.D----DMT...YAEY-----
R6BZX2_9CLOT/239-418------------------------ATLNIVYLVFC-FIQIQ------SLFAKINIQ....N----SFD...YANY-----
D4JS87_9FIRM/295-487------------------------TPLILIYLLFF-ACQLP------YYLSAFG.GVLP.D----GYS...YSEY-----
D5UCX5_CELFN/360-549------------------------.SLALLVLAFV-LVQVG------ALVDGHRHVLET.L----GLS...HAEY-----
R4SPS0_AMYOR/287-478------------------------GVLVLLFTSFV-VVRLV------VLFGGTEYLLAT.S----GLT...AAEY-----
B1VXS3_STRGG/257-449------------------------IVLDLLFAAFV-ILQLV------VLLGGYDKVRDV.T----GLS...HAEY-----
R6GYN0_9FIRM/86-276------------------------GAVSFVYLLYL-FSQLA------YFFSAFR.GILP.E----GYT...QAEY-----
A9B338_HERA2/243-432------------------------GLLNALFGLFV-LIQIR------YLFGGEQQIA...E----GIS...YADY-----
W5W7G3_9PSEU/246-437------------------------GALVLLFAAFV-AVQIV------TLFGGSQYVLRT.A----NLS...YADY-----
D4IVT0_BUTFI/290-484------------------------.IIGAVYLVFC-LIQVV------FLFTG..SMKLP.A----GYT...YAQY-----
D3PWK7_STANL/231-422------------------------VMLDALFAVFV-TTQVP------RLFAGKEYVLGQ.S----GPD...YADF-----
K0B5G9_CLOA9/354-542------------------------.CISIVYLIFS-VVQIS------YLYGDSE.NIIK.S----GFT...YAEY-----
E3E7I0_PAEPS/267-456------------------------IVMNLVYVVFV-VLQFG------YLFGAWE.GALP.E----GTS...YAEY-----
Q82KE7_STRAW/354-544------------------------IVLAVLFAVFN-AVQLA------VLFGGYDAVLKK.T----GQT...YAEY-----
F4H262_CELFA/231-421------------------------AALDAVVLGFV-GVQVS------ALAGGHRHVLET.E----GLS...YAQY-----
E8N655_ANATU/246-436------------------------SSVILLFVFFV-ILQFQ------YLFGGQANIHE..A----GFT...YAEY-----
V6KEH8_STRNV/234-424------------------------IVLNLLFAVFI-GVQLT------VLFGGYDKVLSE.T----GLT...YSEY-----
R6TE55_9FIRM/266-457------------------------AALDVLYLLFL-LVQSA------GLFGGPDYLAA..K----GIS...YAQW-----
W0AIE6_9SPHN/232-423------------------------ATFNAIFAIQN-GLDIA------FLWSG...APLP.G----KVT...LADY-----
R6W355_9FIRM/265-455------------------------..MLIVYLVFF-ATQFA------YFTSAFA.SLLP.S----GVDN..YAEF-----
D4Z7L7_SPHJU/247-438------------------------TVFNLIFALQN-LMDAA------WLWGW...APMP.Q----GMT...MADY-----
I2EQT1_EMTOG/254-441------------------------VSVNALLLIIN-IIDIN------FLWLSFDYS....E----AGN...LAKL-----
W8F0C6_9BACT/283-468------------------------GLVNVLLLVVN-VIDIR------WIWFGFRPE....P----GFD...LTQF-----
A4YUY5_BRASO/248-439------------------------VLFNLLFALQT-VLDGA------YLWGH...AALP.G----GVT...YATY-----
E8UC72_DEIML/268-459------------------------GSLAALFAAFM-VVQGA------YLFGGPAQVTAL.T----GLT...YAEY-----
R7IRN0_9CLOT/239-416------------------------TVLNLVYLVFC-FTQIK------VLFTE........Q----NIK...YSEF-----
E1QWA8_OLSUV/251-439------------------------VVLDLVYLLFA-VIQFA------YLFGGASAPTMH.G----G.....YAEY-----
X4ZBM1_9BACL/265-454------------------------TAVNTVYVLFV-CVQFS------YLFGSWQ.GVLP.S----GET...YAEY-----
F4B1V9_DOKS4/233-412------------------------GALNALIVLFI-ITDIW------YVLHDPLA.....D----AAT...LSTT-----
B4RCQ4_PHEZH/234-425------------------------VVFNLVFALQN-GLDAA------FLWSG...ARLP.S----DMS...HAEY-----
R5EMU4_9FIRM/249-439------------------------GTVCLIYAVYL-LSQLA------YLGGGFA.GILP.D----GYT...LAEY-----
R7R1A9_9FIRM/272-456------------------------VLITALYVLFC-GVQIF------GLFLG..KMSLP.K----GYT...YAEY-----
U5WC64_9ACTN/287-478------------------------TLLVLLFAMFV-AVQLT------VLFGDSKHVLDT.D----GLT...YAEY-----
Q67L49_SYMTH/271-462------------------------GLLNLLFLAFV-LVQIR------YLFGGADLVMAT.A----GLT...YAEY-----
R5D507_9FIRM/251-441------------------------GIISAIYVLYC-IIQIF------FLFIGVKKGLLP.A----NTT...YAEY-----
R6RSY2_9FIRM/254-446------------------------AILSVIYMVFC-WIQIR------YLFLG...GILP.H----TAT...YSSY-----
H8MFN4_CORCM/293-481------------------------FAVNALFFVFA-AFQVA------YLFVG..DASSPAA----GYT...FAEY-----
R5SVS6_9CLOT/268-452------------------------SAIALLYLFFC-GIQVI------YLFLG..KGSLP.E----GVT...YSSY-----
J9QZX6_RIEAN/237-416------------------------VVLNLLLLIFI-CT...------.....FNYEQFFED----RISASQLSSD-----
D4LA20_RUMC1/300-490------------------------TPVCFVYAVYI-GLQAS------YLFSGFA.GTLP.E----GFS...YAGY-----
G8TL52_NIAKG/267-454------------------------VLLNVLLLAVN-CIDVN------FLWLHFQYK....P----GLP...VYKM-----
G2SX70_ROSHA/263-449------------------------.PIAVLYLLFS-AIQIV------YLFIG..NMQLP.A----GVT...YAEY-----
R6TUD3_9FIRM/272-462------------------------VPLLVIYFLFF-ISQLG------YFVSAFG.NMVP.E----GCT...AAEY-----
K0F269_9NOCA/594-785------------------------GALTALFTVFV-IAQFV------ALFGGDDYVQRT.A----GLT...YAEY-----
F6ERY8_AMYSD/613-803------------------------GLVIAIFGVFL-AAQAS------AMWGGHDYVQRT.T----GLT...YAEY-----
L7W1T5_NONDD/237-418------------------------..LNLLLVFVL-ITEVL------FLTNL........N----TTQASVLSQA-----
C6WHR6_ACTMD/262-453------------------------GALVALFTAFV-AVQLR------TLFGGDRHVQVT.A----DLT...YADY-----
R7MZW7_9FIRM/280-462------------------------SIFSVIYVLFC-VIQIV------YLFAG..LGTLP.E----NYT...YASY-----
N0B1B5_9BACI/281-461------------------------VLMNAVYLLFT-IVQFK------YFFSGS....LQ.G----DLT...YAEY-----
R6PDC4_9CLOT/247-432------------------------SVIAVIYLFYS-VIQII------YLFIG.QDGGIP.A----EIT...YAEY-----
D2AQJ9_STRRD/903-1097------------------------TALNLLFAVFV-AMQVT------VLFGSTRWLVSA.T----GLT...YAEY-----
R5YBQ5_9FIRM/178-364------------------------VLISIVYAAFS-FIQIF------SLFLG..KMRLP.D----GYT...YARY-----
H6QYH8_NOCCG/169-360------------------------AALTVLFTVFV-AGQFV------AMFGGDDYVQRT.A----GLT...YAEY-----
E6TQQ3_BACCJ/245-429------------------------TTLNIIYLLFV-VVQFQ------YFFSGT....LE.T----GLS...YAEY-----
F2JL51_CELLD/281-469------------------------.LLCVVYLIFC-CSQLA------YFVSAFK.GVLP.A----DFS...SSEY-----
E6SEY9_INTC7/638-828------------------------.LVLAVFVAFV-VAQTA------AMWGGHDYLRRT.T----GLT...YAEY-----
R7F7D0_9CLOT/250-431------------------------TSLNVIYLVFC-IIQIN------SLFMQK.......T----NIN...YAEY-----
R6EB38_9FIRM/274-453------------------------SLLSLLYLLFS-GIQIF------GLFLG..KMQLP.E----GYT...YAQY-----
V4KM56_9ACTN/360-550------------------------ILLDLLFAAFV-AVQAA------VLLRGEDVVRAS.N----GLT...YSEY-----
D4KWN4_9FIRM/288-472------------------------VLVAVLYVIFC-GIQII------YLFGG..GGELP.A----GVT...YAEY-----
E3GN91_EUBLK/263-454------------------------GLLCLVYFMFF-AAQGG------YYFSAFW.GSLPGG----GIT...AAEY-----
W0ECJ4_9FIRM/268-456------------------------IVIDALYVFFI-AIQFS------YLFGSLT.DSLP.H----DFT...FAQY-----
R7MJC2_9FIRM/282-470------------------------TPICFLYVIFI-ISQTS------YLLSAFL.GNLP.D----GYS...YSEY-----
K0K8I5_SACES/209-399------------------------.TLVLVFAVFV-GVQIR------VLFGGDDYVQRT.A----NLT...YAEY-----
Q89D27_BRADU/262-453------------------------ILFNLLFAAQS-ILDGI------YLWGH...VALP.A----NMT...YAAY-----
R6UCJ7_9CLOT/455-646------------------------IPLCAVYFMYL-ISQLA------YFVSFIADNLLP.Q----TFT...IVDY-----
Q1GM10_RUEST/279-463------------------------WLFNLMFGIQT-LMDLS------ILTGG...VSLP.E----GMS...YASY-----
R7AK92_9BACE/280-471------------------------GILCFVYVLFC-LVQFA------GM.TG..AAALP.S----GCT...YAEY-----
F4L546_HALH1/255-442------------------------GLLNGLLLLVN-LIDIQ------GVWLNQQAR....S----AAE...LSDY-----
C4ZHR4_EUBR3/312-491------------------------.TISVVYVFFC-FIQIV------YLFGG..LMQLP.S----GYT...YARY-----
G0FWF9_AMYMS/284-475------------------------VVLALVFSVFV-GVRLV------VLFGGTEYVLRT.S----NLT...SAEY-----

PF13687

A5FJU0_FLAJ1/158-383----------LYTGLA.LA....ILAVDQLFKVEF.DGKIY....G.YLF......FVIAG----VFNTIFFLSG-----
A6TSA5_ALKMQ/158-379----------LYLGIAAI.....LGTINLLFDAGI.PGKFF....F.DVF......LIVVG----IFAPGFFLAD-----
A7MGD0_CROS8/150-384----------ALAGVFWGV....LLLWAKLF.NAV.DIRFF....D.ILFFDTPLFVYVMA----TVSGAVCLLL-----
A8ERI3_ARCB4/155-375----------ILFVSLYIA....ITSIVILFDLKI.EKFIY....AQYLA......IIVFG----VFCTHYFLLS-----
A8MH61_ALKOO/160-381----------LFLGLVAI.....IATVDLLFSVNI.SGNIY....F.DIW......IIVAG----VFAPAFFLAD-----
B0S2T1_FINM2/160-383----------VTIFVGIVA....ILYTTKEL.FKL.NFNLS....N.LIVT...CAVVIFL----LLNATIILSK-----
B8D209_HALOH/160-380----------LYLGLSAI.....FLTINALLDIPV.SHRFY....L.NTW......LITAG----IFAPVFFLGG-----
C6VYZ6_DYAFD/159-380----------LYIGLL.IA....VQTVKYLFNINY.KFNIE....L.DLL......IVVSS----FFHTVFFLSK-----
C6X615_FLAB3/156-381----------LTGGAE.LA....VLAIDKLFDFNF.SDRLY....A.QLF......YF.LA----IFGSCFIFLL-----
C6XYG5_PEDHD/160-384----------LFAGLA.IA....LVAIDGLFSVKI.GWQTY....M.RLF......AVVTA----GFMTIFFLAG-----
C7NDW6_LEPBD/156-378----------LFVGIA.IV....LTTISYLF.FSS.NNDFF....F.RLTTY..SFWFIAE----VFGASLFLSL-----
C8VXT5_DESAS/157-383----------LASGLAAI.....IGAINILL.FKV.NSDWY....G.YMM......AIVWI----LFATIYYLSL-----
C9LW42_SELS3/156-375----------LLIVSLSTC....LTAFDSLL.FSL.EGRLHTTLYF.LIA......EFSFL----FIGMQVFLAS-----
D2RK10_ACIFV/155-369----------VVNCMLGLC....YASVSLLL.YPL.GLPWV....L.WIS......YLSFG----VVGFQYFISC-----
Q0AX67_SYNWW/157-383----------LAAGLASI.....IGAVDILL.FRI.NSDAY....G.YMM......AIVWI----LFATTYYLSL-----
Q11HD8_CHESB/167-394----------FAGGISAI.....MASLTVLFGFEV.PDDLY....A.YVW......AFTGL----FAAPVFAMGQ-----
Q21MZ4_SACD2/153-391----------LFTLVIFGL....LKLWGGLF.NII.GIDYF....S.DLFKQ.KWFLYPAL----SLGLGFGIIL-----
Q24YZ8_DESHY/157-383----------LSAGIAAI.....LAAVDMLL.FDI.NNDAY....A.YTM......AFIWV----MFAPLYYLSL-----
Y1469_PASMU/133-357----------VLAGIICICAVLVLNSIEYLFNINLLSYRIV....P.KTL......LFIMC----FFTPVFFL.I-----
M9WU31_MANHA/141-357----------.FATLSAI.....TIAIIALFDLNK.QNN......F.HIFEK..FGIFSSF----WAFPVLFLTL-----
YHGE_ECOLI/150-389----------LANGLTWLV....LLLWSELF.KLV.GITFF....N.TLFFA..TDWFIYL----TLGLVTALAV-----
R5MAA3_9BACE/165-386----------..GGIS.LL....VFSLHQLFDVDV.SWKCY....L.YIL......VVCSV----LLPMLLFLGM-----
R5TAF8_9FIRM/157-369----------LTMGLGGIC....LLGINALL.VPI.AWNWG....Y.ALC......AFSFV----LVGINVFLSC-----

PF17202

R5PDZ8_9CLOT/73-178...................--------------------------------------------------.NI-E----LT
D9SR59_CLOC7/75-181....T............N.--------------------------------------------------..C-E----IT
R5LDM7_9FIRM/84-188...................--------------------------------------------------TGL-E----IT
A0A077LEG7_9PSED/107-217....T.............A--------------------------------------------------..G-V----AT
R7K182_9CLOT/75-183....S............G.--------------------------------------------------..M-D----VT
R7C785_9CLOT/80-187...................--------------------------------------------------QDV-E----VS
D4GNY8_PANAM/110-221....T.............S--------------------------------------------------..A-V----AT
R6ESX9_9FIRM/33-139...................--------------------------------------------------.HI-E----QT
D9SR58_CLOC7/75-181....S............N.--------------------------------------------------..S-E----VT
A1TTT5_ACIAC/43-151....T.............G--------------------------------------------------..V-R----AT
C6C0L3_DESAD/124-227....I............G.--------------------------------------------------..G-T----AT
Q2SCQ8_HAHCH/105-216....T............G.--------------------------------------------------..G-N----AT
U5LHG9_9BACI/81-186....T............G.--------------------------------------------------..D-T----VT
I4MQL7_9BURK/106-217....A............NG--------------------------------------------------..G-V----AT
A5GDW0_GEOUR/197-301....F...........GE.--------------------------------------------------.DA-E----VT
M1E435_9FIRM/183-288....M............G.--------------------------------------------------..A-E----AT
C3K447_PSEFS/107-217....S.............G--------------------------------------------------..G-V----AT
A5G6W5_GEOUR/211-327....V.....YEGVQFNGE--------------------------------------------------DVG-T----AT
I0H0J9_ACTM4/128-247....V............G.--------------------------------------------------..G-A----VT
D4H841_DENA2/120-233....E............G.--------------------------------------------------..L-T----ST
R5SF85_9CLOT/154-260....T............N.--------------------------------------------------..Y-D----IT
Q8XUQ0_RALSO/115-227....T............GG--------------------------------------------------..T-I----AT
C7RJ95_ACCPU/102-216....T............PG--------------------------------------------------GNG-V----AT
G4RG36_PELHB/93-201....T............G.--------------------------------------------------..E-T----AT
R7H980_9FIRM/84-190....T............N.--------------------------------------------------..V-D----VT
B1KL49_SHEWM/217-338....V.....YDKGTLPER--------------------------------------------------SIG-T----VT
C7LSE2_DESBD/126-226....T............G.--------------------------------------------------..G-V----TT
Q0K178_CUPNH/214-328....V.....YQPESLPRG--------------------------------------------------SEG-T----AT
R7BD52_9FIRM/83-182....T............N.--------------------------------------------------..V-D----IS
R6KC51_9FIRM/187-293.................TD--------------------------------------------------NDA-D----LA
A9DH49_9RHIZ/90-198....T............G.--------------------------------------------------..Q-T----AT
U5N9Z9_9BURK/111-222....T.............G--------------------------------------------------..A-V----AT
G4KZG5_OSCVS/79-190....M............N.--------------------------------------------------..M-V----AT
B2A0N4_NATTJ/81-187....T............G.--------------------------------------------------..S-A----FA
D7DTL6_METV3/203-310....S............G.--------------------------------------------------..E-A----TT
F3Z2D9_DESAF/126-237....V............D.--------------------------------------------------..C-T----AT
W0IVA8_9BACT/105-215....M............G.--------------------------------------------------..G-T----AT
B9JP39_AGRRK/218-334....I.....YHGSGLPEG--------------------------------------------------SHG-T----VT
D8J016_HERSS/116-227....T.............G--------------------------------------------------..V-T----AT
C5AA15_BURGB/110-221....S.............G--------------------------------------------------..A-I----AT
X2GSB3_9BACI/75-182....T...........HG.--------------------------------------------------..D-A----IT
D7DT69_METV3/191-294...................--------------------------------------------------...-.----..
A4GAL6_HERAR/223-338....V.....YADGSLPEG--------------------------------------------------SGG-T----AT
Q2FU40_METHJ/105-215....L............G.--------------------------------------------------..G-A----AT
Q7M944_WOLSU/110-221....T.............K--------------------------------------------------..A-T----AT
Q6D133_PECAS/110-221....T.............H--------------------------------------------------..A-I----ST
Q0W406_METAR/195-302....S............E.--------------------------------------------------..G-Y----ST
M1N767_9CLOT/176-278....Y............D.--------------------------------------------------..C-D----AT
Q3A4X2_PELCD/126-243....V............G.--------------------------------------------------..G-T----AT
C8X5F8_DESRD/131-248....V............G.--------------------------------------------------..G-T----CT
D3RUE8_ALLVD/81-192....L............G.--------------------------------------------------..V-L----AT
C6BZS5_DESAD/173-278....S............D.--------------------------------------------------..L-E----VT
D5V2F9_ARCNC/106-215....T.............G--------------------------------------------------..V-I----AT
B8FF41_DESAA/197-313....V.....FKNEKYKGR--------------------------------------------------SVG-T----AT
R7C7X6_9CLOT/79-185...................--------------------------------------------------TGA-D----VT
A4W5S4_ENT38/109-220....T.............G--------------------------------------------------..A-I----ST
F9TD33_9VIBR/108-219....T.............G--------------------------------------------------..A-V----AT
A4VNM3_PSEU5/150-260....T.............A--------------------------------------------------..G-V----AT
J7IZ74_DESMD/74-180....T............G.--------------------------------------------------..D-T----VT
D5WTF7_KYRT2/150-257....T............G.--------------------------------------------------..T-D----VS
R6CC53_9CLOT/83-190....T............G.--------------------------------------------------..V-E----FT
I7EZR3_PHAIB/193-308....V.....YLGDSHRIS--------------------------------------------------RKG-T----AT
B5EED7_GEOBB/207-322....V.....YEGARKNGR--------------------------------------------------DVG-N----ST
G8M385_CLOCD/77-182....T............G.--------------------------------------------------..A-H----VS
R6LTR5_9CLOT/88-195....T............G.--------------------------------------------------..S-S----LT
H1YZJ5_9EURY/105-216....V............G.--------------------------------------------------..G-T----AT
B8FKI9_DESAA/130-248....T............H.--------------------------------------------------..V-T----CT
B8I594_CLOCE/73-179....T............G.--------------------------------------------------..N-L----AT
B3EAL1_GEOLS/77-181....T............G.--------------------------------------------------..G-T----AT
M1WWC3_DESPC/126-238....T............G.--------------------------------------------------..T-T----CT
Q8EC62_SHEON/106-217....T.............G--------------------------------------------------..G-T----AT
I4D1S2_DESAJ/74-180....T............G.--------------------------------------------------..D-T----VT
G1UPC0_9DELT/173-278....S............G.--------------------------------------------------..M-D----VT
B9M7S8_GEODF/192-295....F...........GE.--------------------------------------------------.EA-E----VA
F2G5X9_ALTMD/102-211....M............G.--------------------------------------------------..G-T----AT
B4EIX9_BURCJ/110-221....S.............G--------------------------------------------------..A-I----AT
E1QD66_DESB2/210-326....V.....FKNESFAGR--------------------------------------------------QLG-T----AT
A6TKU1_ALKMQ/78-189....M............G.--------------------------------------------------..S-A----AT
A0A075WRZ3_9BACT/93-200....T............GG--------------------------------------------------..S-V----AT
R5WDE4_9CLOT/85-192....Y............D.--------------------------------------------------..C-D----VT
K4LEA6_THEPS/75-179....T............G.--------------------------------------------------..D-T----VT
R7IWW0_9FIRM/75-184....S............G.--------------------------------------------------..M-D----VT
Q4K3U8_PSEF5/107-217....T.............A--------------------------------------------------..G-V----AT
G8QPI6_AZOSU/105-210....A............G.--------------------------------------------------..G-T----AT
G7Z711_AZOL4/82-189....T............G.--------------------------------------------------..G-T----AT
R7N8R2_9FIRM/73-179....T............D.--------------------------------------------------..M-D----IT
G8ASR9_AZOBR/219-334....V.....YQDASLPLG--------------------------------------------------SQG-T----AT
R5EKY7_9CLOT/77-185....S............D.--------------------------------------------------..I-E----VT
Q31M73_SYNE7/126-244....M............G.--------------------------------------------------..G-T----VT
Q3A5N0_PELCD/126-244....L............G.--------------------------------------------------..V-T----CT
A8EX26_ARCB4/102-212....T.............G--------------------------------------------------..A-V----AT
R5JUW9_9CLOT/66-172...................--------------------------------------------------.HI-E----QT
A0A068JJ25_9DELT/173-278....F............G.--------------------------------------------------..V-E----AT
R6DFM0_9CLOT/76-184....T............G.--------------------------------------------------..M-A----VT
C4Z687_EUBE2/126-233.................SK--------------------------------------------------NDV-Q----VT
R6EK08_9FIRM/92-198....T............G.--------------------------------------------------..F-Q----VS
Q8P8Q8_XANCP/84-195....H............E.--------------------------------------------------..G-T----AT
E3DR17_HALPG/78-184....T...........QG.--------------------------------------------------..N-T----VT
W0E6D6_MARPU/81-192....L............G.--------------------------------------------------..V-L----AT
E1QEE0_DESB2/135-253....T............G.--------------------------------------------------..A-D----CT
F6DQL7_DESRL/85-189....T............G.--------------------------------------------------..N-T----CT
B5EET6_GEOBB/72-178....F............G.--------------------------------------------------..G-E----AT
G8QHB1_AZOSU/108-213....T............G.--------------------------------------------------..E-D----AA
C6WF37_ACTMD/137-256....V............S.--------------------------------------------------..A-T----VT
C4XN19_DESMR/213-318....L............G.--------------------------------------------------..A-E----AT
R5R3V5_9FIRM/219-325....T............G.--------------------------------------------------..F-E----MT
J1ATF6_9EURY/105-215....V............G.--------------------------------------------------..G-A----AT
B2VCW3_ERWT9/110-221....T.............G--------------------------------------------------..A-I----ST
Q07W74_SHEFN/224-344....V.....YGKGTLPER--------------------------------------------------SIG-T----VT
A9KHQ9_CLOPH/86-194....S............G.--------------------------------------------------..F-D----CT
K4MGY8_9EURY/99-209....V............G.--------------------------------------------------..G-T----AT
R6K7N5_9FIRM/73-182....T............G.--------------------------------------------------..M-D----VT
Q8P9I9_XANCP/109-220....T.............G--------------------------------------------------..G-V----AT
B6BNF9_SULGG/103-215....T.............G--------------------------------------------------..A-V----AT
R5NMM9_9FIRM/113-219...................--------------------------------------------------TGD-D----IT
I4EZV9_MODMB/131-249....V............G.--------------------------------------------------..G-T----AT
A8H262_SHEPA/106-216....T.............G--------------------------------------------------..G-N----AT
T2GE62_DESGI/173-279....F............L.--------------------------------------------------..S-E----AT
Q6APL6_DESPS/127-230....L............G.--------------------------------------------------..A-S----AT
I4DB95_DESAJ/75-180....A............H.--------------------------------------------------..D-N----VT
G8AW72_AZOBR/78-185....T............G.--------------------------------------------------..G-V----AT
R7A1X1_9FIRM/85-192...................--------------------------------------------------TNM-D----IT
C6PVG9_9CLOT/79-184....T............N.--------------------------------------------------..S-I----CT
A1B979_PARDP/201-316....I.....YRSDSLPEG--------------------------------------------------SHG-T----TS
J7J3G2_DESMD/75-179....S............N.--------------------------------------------------..D-N----VT
C5CXU1_VARPS/109-222....F............PG--------------------------------------------------..A-N----AT
Q6LZ41_METMP/177-282....T............G.--------------------------------------------------..D-E----AT
R7BG86_9FIRM/73-182....A............G.--------------------------------------------------..M-D----VT
G0AIH2_COLFT/110-220....S.............R--------------------------------------------------..A-V----AT
E1QGT6_DESB2/126-231....V............G.--------------------------------------------------..S-E----AA
E3PU45_CLOSD/79-190....M............S.--------------------------------------------------..I-V----AT
I0GPD1_SELRL/73-177....C............N.--------------------------------------------------..G-H----VT
D2SAB0_GEOOG/128-246....V............G.--------------------------------------------------..G-T----AT
Q2LSJ8_SYNAS/74-180....T............G.--------------------------------------------------..S-A----AT
Q6LZY6_METMP/187-291....T............G.--------------------------------------------------..N-E----AT
R6EC74_9CLOT/228-334....T............S.--------------------------------------------------..F-D----IT
D5X7V1_THEPJ/75-181....T............G.--------------------------------------------------..D-T----VT
R5LBG0_9FIRM/215-322....T............G.--------------------------------------------------..I-E----SA
D5VSC2_METIM/204-310....S............G.--------------------------------------------------..A-D----IT
Q67R82_SYMTH/236-345....S...........PDG--------------------------------------------------TPL-T----AT
F5Z460_ALTSS/106-219....V............N.--------------------------------------------------..G-T----AT
Q2KCB1_RHIEC/88-194....I............S.--------------------------------------------------..G-V----AT
A6LV74_CLOB8/104-212....T............G.--------------------------------------------------..T-I----AT
F7QPR2_9BRAD/96-204....V............G.--------------------------------------------------..G-N----AT
R6C687_9CLOT/76-182...................--------------------------------------------------VGI-D----TA
G8PV01_PSEUV/88-196....T............G.--------------------------------------------------..E-T----AT
R4L9R8_9ACTN/129-248....T............G.--------------------------------------------------..L-T----VT
A0A0A1AYZ4_9ENTR/110-221....T.............G--------------------------------------------------..A-I----AT
G8AVA4_AZOBR/79-185....A............GA--------------------------------------------------VGG-V----AT
R4KEL1_9FIRM/74-179....T............G.--------------------------------------------------..D-T----CT
B8IZC5_DESDA/173-278....S............G.--------------------------------------------------..V-N----VT
V9VW82_9RHOB/200-316....V.....YREQSLPEG--------------------------------------------------SQG-T----AT
Q74F34_GEOSL/212-328....V.....FEAVRFQGR--------------------------------------------------DVG-T----AT
R5SFX5_9CLOT/88-196...................--------------------------------------------------MGV-E----VT
Q87PJ9_VIBPA/202-320....I.....YLSDNDRLR--------------------------------------------------PVG-T----LT
F4LKK3_TREBD/186-288....V............D.--------------------------------------------------..S-N----IS
C6XN72_HIRBI/90-198....T............G.--------------------------------------------------..E-T----AT
A0A0C7P014_9BACT/77-188....M............N.--------------------------------------------------..V-V----AT
A0A085L981_9FIRM/78-183....T............G.--------------------------------------------------..D-T----VT
E6VZ02_DESAO/125-228....V............G.--------------------------------------------------..G-T----AT
R7JZV9_9CLOT/71-183.................EK--------------------------------------------------SHI-D----TT
B8HSN5_CYAP4/156-274....A............G.--------------------------------------------------..G-T----IT
Q0A7Z6_ALKEH/211-327....A.....YPEGSLPDG--------------------------------------------------RPG-T----VT
R5QN54_9FIRM/79-185...................--------------------------------------------------.EI-E----LT
M4U2E5_9GAMM/102-215...................--------------------------------------------------TGI-Q----ST
A1AN42_PELPD/73-179....F............G.--------------------------------------------------..C-T----AT
U5N966_9BURK/105-212....Q............G.--------------------------------------------------..G-T----AT
Q3A1Q1_PELCD/126-245....A............G.--------------------------------------------------..G-T----TS
W6RU28_9CLOT/73-179....T............Q.--------------------------------------------------..V-L----AT
I0HW90_RUBGI/100-211....T............G.--------------------------------------------------..G-V----AT
D1BHQ7_SANKS/162-281....L............G.--------------------------------------------------..E-A----VT
B8IZC2_DESDA/174-279....A............G.--------------------------------------------------..A-A----VT
Q74H85_GEOSL/198-301....F............G.--------------------------------------------------...-.----..
B1LVR8_METRJ/92-200....S............G.--------------------------------------------------..G-L----AT
A3DJX9_CLOTH/307-413....T............G.--------------------------------------------------..L-L----ST
A0A075LSR8_9BACI/79-184....T............G.--------------------------------------------------..D-T----VT
G7WD19_DESOD/74-176....T............G.--------------------------------------------------..D-S----VT
U5RZZ9_9CLOT/76-181....T............G.--------------------------------------------------..E-E----VT
J7IWN7_DESMD/74-180....T............G.--------------------------------------------------..D-T----VT
D4H251_DENA2/115-228....E............G.--------------------------------------------------..L-T----AT
R7I3Y6_9CLOT/77-184...................--------------------------------------------------NKI-E----TS
G4R699_PELHB/74-189....T............G.--------------------------------------------------..E-T----AA
A0A0B4XTY6_9PROT/85-193....T............G.--------------------------------------------------..Q-T----AT
B5E7Q4_GEOBB/195-298....T...........GN.--------------------------------------------------.NV-E----VT
Q72C84_DESVH/127-233....S............G.--------------------------------------------------..V-E----FT
Q2W2R7_MAGSA/89-196....V............G.--------------------------------------------------..G-S----AT
B1I534_DESAP/81-187....T............G.--------------------------------------------------..G-T----VT
R5NZ64_9CLOT/79-186....T............G.--------------------------------------------------..I-E----VT
D4JWV0_9FIRM/158-263....T............G.--------------------------------------------------..A-E----LT
A5I5P1_CLOBH/73-179....T............G.--------------------------------------------------..S-L----VT
F6DLJ5_DESRL/74-180....T............G.--------------------------------------------------..D-T----CT
F5XWM0_RAMTT/199-311....V.....YPEGSLPFG--------------------------------------------------SQG-T----AT
B6IML4_RHOCS/90-197....V............G.--------------------------------------------------..G-V----AT
A8ESX6_ARCB4/106-217....T............NG--------------------------------------------------..S-V----AT
F2JN05_CELLD/79-180....T............G.--------------------------------------------------..Y-E----YI
Q74DL3_GEOSL/77-183....C............G.--------------------------------------------------..G-T----AT
Q5E501_VIBF1/198-319....I.....YPSGDLPSN--------------------------------------------------NIG-T----VT
E1SPH8_FERBD/213-325....T.....YADGTLPSR--------------------------------------------------ARG-A----VT
B5EGJ6_GEOBB/77-183....T............G.--------------------------------------------------..S-R----AT
A5D439_PELTS/73-179....T............S.--------------------------------------------------..D-T----VT
U5N930_9BURK/110-220....T.............G--------------------------------------------------..A-V----AT
E1SQW9_FERBD/106-217....T.............D--------------------------------------------------..G-N----AT
D7DQM1_METV3/185-290....T............G.--------------------------------------------------..N-E----VT
E8RQ04_ASTEC/85-195....N............K.--------------------------------------------------..G-Y----VT
Q74EC9_GEOSL/72-178....T............G.--------------------------------------------------..G-T----AT
Q7D199_AGRFC/88-194....N............G.--------------------------------------------------..G-I----AT
B5YKT7_THEYD/87-199....T............GG--------------------------------------------------..S-V----AT
A0L9K9_MAGMM/119-226....V............G.--------------------------------------------------..G-T----AT
A1WD99_ACISJ/101-212....T.............G--------------------------------------------------..G-V----AT
C6WYS6_METML/102-211....F............G.--------------------------------------------------..G-T----AT
A5G6Y0_GEOUR/211-325....V.....YEGVQSDGK--------------------------------------------------DVG-S----AT
Q0W8Y7_METAR/199-302....T............N.--------------------------------------------------..A-Y----CS
TLPC_BACSU/80-184....T............G.--------------------------------------------------..D-T----IT
K0NLS4_DESTT/130-248....S............V.--------------------------------------------------..E-T----CT
G8M385_CLOCD/307-413....D............N.--------------------------------------------------..Y-F----ST
A5G616_GEOUR/72-178....C............G.--------------------------------------------------..G-T----AT
A9KQX1_CLOPH/40-140....N............G.--------------------------------------------------..V-D----VT
G8MN10_9BURK/110-221....S.............G--------------------------------------------------..A-I----AT
Q6LY71_METMP/187-292....T............G.--------------------------------------------------..D-E----AS
A7HEU7_ANADF/134-251....V............G.--------------------------------------------------..A-E----AT
D5X0H1_THIK1/108-218....F............G.--------------------------------------------------..G-T----AT
E3CZU3_9BACT/182-287....F............G.--------------------------------------------------..V-D----AT
E0RXX8_BUTPB/79-188....T............G.--------------------------------------------------..M-H----FT
F5YEI7_TREAZ/86-202....L............G.--------------------------------------------------..V-V----AT
G7ZDN4_AZOL4/72-179....V............G.--------------------------------------------------..G-T----AT
X2GV97_9BACI/76-181....S............H.--------------------------------------------------..A-A----IT
D3RVX8_ALLVD/111-221....T.............D--------------------------------------------------..A-V----AT
R6ZMQ4_9FIRM/73-179....S............D.--------------------------------------------------..M-D----IT
A1S844_SHEAM/106-217....T.............G--------------------------------------------------..G-T----AT
D7DHR4_METV0/102-212....V............G.--------------------------------------------------..G-T----AT
Q2ILX4_ANADE/105-215....S.............G--------------------------------------------------..A-V----AT
E0SEE2_DICD3/109-220....T.............G--------------------------------------------------..A-I----ST
Q89JH4_BRADU/94-202....V............G.--------------------------------------------------..G-N----AT
G8AT44_AZOBR/76-183....T............G.--------------------------------------------------..G-A----AT
L0HFV3_METFS/105-216....V............G.--------------------------------------------------..G-A----AT
A5G6X8_GEOUR/210-326....V.....YEGVQFNGK--------------------------------------------------DVG-T----AT
A6LZK9_CLOB8/177-278....F............G.--------------------------------------------------..C-D----AT
D4KWN6_9FIRM/76-185....S............G.--------------------------------------------------..M-D----VT
H2IST1_RAHAC/113-224....T.............G--------------------------------------------------..A-I----ST
E6TRU7_BACCJ/80-181....T............G.--------------------------------------------------..G-L----VT
B3EA57_GEOLS/72-178....C............G.--------------------------------------------------..G-T----AT
E1SQW8_FERBD/106-217....T.............G--------------------------------------------------..G-S----AT
C4IHE8_CLOBU/72-179....T............G.--------------------------------------------------..N-L----SS
C8VYH0_DESAS/73-179....T............G.--------------------------------------------------..D-T----AT
A0A023Y143_9GAMM/113-224....T.............G--------------------------------------------------..G-V----AT
F3Z371_DESAF/124-224....A............G.--------------------------------------------------..G-T----AT
Q67JS3_SYMTH/218-329....S...........THG--------------------------------------------------LRV-D----AS
D5XD62_THEPJ/76-178....T............G.--------------------------------------------------..D-T----VT
R5SDE9_9CLOT/75-183....S............G.--------------------------------------------------..M-E----VT
F2JZN6_MARM1/107-218....T.............G--------------------------------------------------..G-T----AT
F3YY29_DESAF/173-278....L............G.--------------------------------------------------..V-E----CT
Q213Z4_RHOPB/90-197....V............G.--------------------------------------------------..G-T----CT
D4J2L3_BUTFI/78-188....T............G.--------------------------------------------------..I-S----FT
G8QJI8_AZOSU/217-331....V.....FPVGTLPGG--------------------------------------------------DSG-T----AT
E4RNC2_HALHG/80-185....L............E.--------------------------------------------------..N-Q----VT
R5R8S2_9FIRM/79-186...................--------------------------------------------------YGM-D----IT
C4XTW5_DESMR/173-278...................--------------------------------------------------LDA-E----ST
A8F9U1_BACP2/79-184....T............D.--------------------------------------------------..D-T----IT
F6DKG1_DESRL/79-184....T............G.--------------------------------------------------..D-A----VT
A6UWZ1_META3/212-318....T............K.--------------------------------------------------..D-T----ST
R6FBW2_9FIRM/88-195....T............G.--------------------------------------------------..L-D----IT
D5WGD4_BURSC/49-157....T.............R--------------------------------------------------..A-T----GT
R7R090_9FIRM/112-220...................--------------------------------------------------VDL-Q----VS
F2JRS0_CELLD/85-196....L............D.--------------------------------------------------..V-Y----AT
E0S2B9_BUTPB/88-197....T............G.--------------------------------------------------..L-E----YS
Q47F07_DECAR/214-329....V.....YPEGALPFG--------------------------------------------------SAG-T----AT
A3DJX9_CLOTH/77-183....T............G.--------------------------------------------------..A-I----AT
D2S3V8_GEOOG/300-412....V............G.--------------------------------------------------..G-S----CT
A1K1I5_AZOSB/222-336....V.....YQDSSLPLD--------------------------------------------------SQG-T----AT
D7CN43_SYNLT/76-181....T............G.--------------------------------------------------..D-T----CT
E6TZ81_BACCJ/78-183....T............S.--------------------------------------------------..G-T----VT
R7N631_9FIRM/83-190...................--------------------------------------------------TNV-D----IT
D7EA93_METEZ/98-210....T............G.--------------------------------------------------..G-R----VA
W0S9Z6_9RHOO/225-339....V.....YPEGSLPLG--------------------------------------------------SVG-T----AT
Q1QVS1_CHRSD/204-320....V.....YGPGTLPEG--------------------------------------------------TTG-S----VT
W0EC93_9FIRM/75-181....A............G.--------------------------------------------------..D-T----VT
F2JGZ2_CELLD/76-178...................--------------------------------------------------TDF-E----YT
R7I9R7_9CLOT/89-196....A............D.--------------------------------------------------..T-E----IT
R6DVG8_9CLOT/5-112....S............D.--------------------------------------------------..C-D----IT
G4QFB3_GLANF/102-211....M............N.--------------------------------------------------..G-T----AT
A6VV35_MARMS/109-220....T.............G--------------------------------------------------..G-T----AT
C6XCT3_METGS/126-235....N............G.--------------------------------------------------..G-T----AT
L0K912_HALHC/77-183....T............G.--------------------------------------------------..G-N----VT
D3RQD1_ALLVD/81-192....L............G.--------------------------------------------------..L-L----FS
C9LRM7_SELS3/91-197....T............G.--------------------------------------------------..S-D----VA
R5EER7_9CLOT/71-178....S............G.--------------------------------------------------..V-D----VM
Q28LY5_JANSC/69-195....S............G.--------------------------------------------------..L-K----PT
E6U3D4_ETHHY/87-192...................--------------------------------------------------TGY-A----AT
W0E9X6_9FIRM/74-180....T............G.--------------------------------------------------..D-T----VT
A5G0G1_ACICJ/83-185....Y............G.--------------------------------------------------..G-A----VT
C7RV68_ACCPU/102-213....A.............G--------------------------------------------------..T-V----AT
A0A0C5X0D3_9GAMM/198-314....V.....YASDTLPEG--------------------------------------------------SIG-T----VT
R5DWU0_9FIRM/73-182....T............G.--------------------------------------------------..M-D----VT
F7YX84_9THEM/79-190....M............D.--------------------------------------------------..I-V----AT
I4BTU7_ANAMD/116-231...................--------------------------------------------------LNG-Q----FL
H6NGN8_9BACL/80-186....T............G.--------------------------------------------------..D-T----VT
W8KJN2_HALHR/81-192....L............G.--------------------------------------------------..I-V----FT
F2NY56_TRES6/174-270....T..............--------------------------------------------------.DC-N----FT
Q6M058_METMP/187-292....T............G.--------------------------------------------------..D-E----ST
B9TMP9_RICCO/78-188....M............G.--------------------------------------------------..G-T----AT
G2T516_ROSHA/86-192....T............G.--------------------------------------------------..L-D----VT
C4XJA0_DESMR/214-319....L............G.--------------------------------------------------..T-E----CT
Q5H0R3_XANOR/351-467ASSSK............Q.--------------------------------------------------..G-N----AT
B8DJD3_DESVM/173-278....T............G.--------------------------------------------------..L-E----VT
A0A068SK02_RHIGA/87-193....I............G.--------------------------------------------------..G-V----AT
M4RH32_9ALTE/43-149....M............D.--------------------------------------------------..G-T----AT
B5EEA7_GEOBB/208-324....V.....YEGVQFNGT--------------------------------------------------DVG-S----AT
D1B050_SULD5/102-212....T.............G--------------------------------------------------..A-I----AT
B7GJK4_ANOFW/75-180....V............G.--------------------------------------------------..A-D----ST
W8R0S9_PSEST/102-213....T.............G--------------------------------------------------..G-A----AT
D5WSX0_KYRT2/75-180....T............G.--------------------------------------------------..D-V----VT
A0KMS3_AERHH/198-314....V.....FAKNTLPAG--------------------------------------------------SIG-T----VT
W0V5R1_9BURK/112-223....T.............S--------------------------------------------------..A-V----AT
C8X019_DESRD/133-251....V............G.--------------------------------------------------..G-T----CT
C4XT43_DESMR/172-278....L............G.--------------------------------------------------..V-E----AT
Q6LXP6_METMP/208-314....S............K.--------------------------------------------------..D-A----TT
C9R7R0_AMMDK/78-183....S............G.--------------------------------------------------..C-E----AT
H6RKC7_BLASD/264-378....I............G.--------------------------------------------------..G-S----CT
C5BRD9_TERTT/103-207....M............G.--------------------------------------------------..G-T----AT
R6BYZ3_9CLOT/75-182....T............G.--------------------------------------------------..M-E----VI
G8QJH7_AZOSU/104-213....N............P.--------------------------------------------------..G-R----EP
A6W7B6_KINRD/134-252....T............G.--------------------------------------------------..A-A----TT
M1E7Y2_9FIRM/183-301....F............G.--------------------------------------------------..V-E----VA
Q39WQ1_GEOMG/73-179....F............G.--------------------------------------------------..G-T----AT
H6RSU6_BLASD/118-234....V............G.--------------------------------------------------..A-T----VT
D5XCJ0_THEPJ/210-316....F............G.--------------------------------------------------..A-R----ST
A4J257_DESRM/66-172....T............N.--------------------------------------------------..D-T----CT
Q0AYG1_SYNWW/86-190....T............G.--------------------------------------------------..D-T----VT
I4D0P6_DESAJ/74-180....T............G.--------------------------------------------------..D-A----VT
R7K0M4_9CLOT/67-193KGSFNVTDETDFLDSFVEG--------------------------------------------------TDM-Q----VT
B8IJS3_METNO/210-322....I.....YAHADLPAG--------------------------------------------------GQG-T----AT
Q87MS2_VIBPA/108-219....T.............G--------------------------------------------------..A-I----AT
F0LZR4_VIBFN/108-218....T............G.--------------------------------------------------..A-F----VT
A0A075K6B4_9FIRM/186-290....F............N.--------------------------------------------------..T-D----AT
Q085R6_SHEFN/106-217....T.............G--------------------------------------------------..G-V----AT
A9BU07_DELAS/105-220....T.............G--------------------------------------------------..A-V----AT
M1F6J6_9ALTE/102-212....M............E.--------------------------------------------------..G-T----AT
C9R7Y4_AMMDK/77-182....T............G.--------------------------------------------------..D-T----CT
C9LWK5_SELS3/73-177....G............SS--------------------------------------------------CHG-F----VT
W8UBX6_EUBAC/79-190....L............G.--------------------------------------------------..D-K----VT
D9SUK2_CLOC7/72-177....A............G.--------------------------------------------------..V-E----CT
B3EA50_GEOLS/210-324....I......APQQQDGL--------------------------------------------------LHE-T----AT

PF17201

C6BU40_DESAD/36-358----S-----------.G-----------------------------------------------------A-Y----CT
A6LV74_CLOB8/28-303----T-----------.G-----------------------------------------------------T-I----AT
E1QGT6_DESB2/31-334----V-----------.G-----------------------------------------------------S-E----AA
A8EX26_ARCB4/30-313----T-----------.G-----------------------------------------------------A-V----AT
G8QHB1_AZOSU/34-324----T-----------.G-----------------------------------------------------E-D----AA
A6VTS3_MARMS/34-320----A-----------.Q-----------------------------------------------------L-E----AS
F2K3U4_MARM1/35-301----T-----------.G-----------------------------------------------------K-K----VF
H2IST1_RAHAC/38-323----T-----------.G-----------------------------------------------------A-I----ST
A8ESX6_ARCB4/32-319----T-----------NG-----------------------------------------------------S-V----AT
F0JCL3_DESDE/35-351----T-----------.G-----------------------------------------------------T-T----CT
I0HW90_RUBGI/37-316----T-----------.G-----------------------------------------------------G-V----AT
D5V2F9_ARCNC/31-312----T-----------.G-----------------------------------------------------V-I----AT
A6VTS4_MARMS/34-318----I-----------.E-----------------------------------------------------L-N----AS
B8HSN5_CYAP4/64-390----A-----------.G-----------------------------------------------------G-T----IT
Q2SCQ8_HAHCH/31-321----T-----------.G-----------------------------------------------------G-N----AT
B8DKE8_DESVM/33-319----V-----------.G-----------------------------------------------------S-D----AT
C3K447_PSEFS/33-307----S-----------.G-----------------------------------------------------G-V----AT
G8MN10_9BURK/35-328----S-----------.G-----------------------------------------------------A-I----AT
B8DR25_DESVM/32-335----A-----------.G-----------------------------------------------------V-G----AS
Q2FQ15_METHJ/34-307----V-----------.G-----------------------------------------------------G-A----AT
E1QEE0_DESB2/42-369----T-----------.G-----------------------------------------------------A-D----CT
F6AK53_PSEF1/33-309----T-----------.A-----------------------------------------------------G-V----AT
A6W7B6_KINRD/41-362----T-----------.G-----------------------------------------------------A-A----TT
C8X019_DESRD/39-360----V-----------.G-----------------------------------------------------G-T----CT
B6BNF9_SULGG/29-306----T-----------.G-----------------------------------------------------A-V----AT
C6WF37_ACTMD/44-372----V-----------.S-----------------------------------------------------A-T----VT
B8FKI9_DESAA/38-364----T-----------.H-----------------------------------------------------V-T----CT
Q3A5N0_PELCD/34-368----L-----------.G-----------------------------------------------------V-T----CT
A6VV35_MARMS/34-326----T-----------.G-----------------------------------------------------G-T----AT
F3Z2D9_DESAF/34-350----V-----------.D-----------------------------------------------------C-T----AT
C8X5F8_DESRD/39-363----V-----------.G-----------------------------------------------------G-T----CT
Q88BA0_PSESM/33-309----T-----------.A-----------------------------------------------------G-V----AT
Q2FU40_METHJ/38-306----L-----------.G-----------------------------------------------------G-A----AT
D5UZK4_ARCNC/30-314----T-----------.G-----------------------------------------------------A-I----SA
C5CXU1_VARPS/45-330----F-----------PG-----------------------------------------------------A-N----AT
F2JZN6_MARM1/34-317----T-----------.G-----------------------------------------------------G-T----AT

PF02743

E0RXM7_BUTPB/48-273----S------------S.--------------------------------------------------..N-I....YS
D4J1J7_BUTFI/47-288----G------------K.--------------------------------------------------..M-V....ET
E0RW20_BUTPB/49-275----A------------A.--------------------------------------------------..S-Y....ED
C6PRU6_9CLOT/32-298----S------------D.--------------------------------------------------..G-V....KD
F4LMY3_TREBD/35-291----G------------Q.--------------------------------------------------..N-I....TF
A9KI79_CLOPH/38-284----S------------D.--------------------------------------------------..N-I....NT
C6CY24_PAESJ/49-303----A------------D.--------------------------------------------------..N-I....DT
D9SN50_CLOC7/34-225----K------------Y.--------------------------------------------------..T-M....ER
B3PLL6_CELJU/36-263----S------------K.--------------------------------------------------..Y-V....TD
H6NPI3_9BACL/38-270----M------------K.--------------------------------------------------..Q-VMKSSEF
Q8XIM7_CLOPE/39-272----N------------E.--------------------------------------------------..T-L....EY
B8CZL7_HALOH/50-288----K------------K.--------------------------------------------------..T-I....NN
D3EGX8_GEOS4/41-276----N------------Q.--------------------------------------------------..Y-I....DA
B8FI76_DESAA/33-279----S------------L.--------------------------------------------------..N-L....AA
F4GHS7_SPHCD/50-280----T------------N.--------------------------------------------------..S-V....KD
G7M452_9CLOT/54-282----T------------D.--------------------------------------------------..I-L....NI
G7MBH7_9CLOT/84-313----Q------------L.--------------------------------------------------..N-I....DN
E3GJM9_EUBLK/37-310----G------------D.--------------------------------------------------..G-F....DE
E3DMV9_HALPG/43-295----Q------------S.--------------------------------------------------..N-V....ES
D3EI08_GEOS4/52-270----E------------Q.--------------------------------------------------..Q-T....SS
Q729P1_DESVH/35-283----N------------D.--------------------------------------------------..F-I....AA
C0QWV4_BRAHW/43-259----K------------S.--------------------------------------------------..D-I....ES
A3DEW9_CLOTH/98-428----G------------N.--------------------------------------------------..K-I....KI
C6CUM5_PAESJ/53-294----M------------S.--------------------------------------------------..A-L....DR
H9UIR1_SPIAZ/46-279----A------------V.--------------------------------------------------..R-I....GS
D4H636_DENA2/32-256----T------------K.--------------------------------------------------..R-V....AS
F5YEX0_TREAZ/51-285----A------------Q.--------------------------------------------------..D-V....EG
A3DJL4_CLOTH/54-311----T------------K.--------------------------------------------------..N-I....ET
F8F259_TRECH/36-277----D------------K.--------------------------------------------------..N-L....EY
G7LYC8_9CLOT/33-306----T------------N.--------------------------------------------------..H-I....NT
D4GMT0_PANAM/45-292----V------------E.--------------------------------------------------..Q-M....NR
C6CV60_PAESJ/38-288----E------------N.--------------------------------------------------..N-M....QS
F8F0Y4_TRECH/37-279----S------------N.--------------------------------------------------..N-I....SA
C6CTL5_PAESJ/41-280----S------------K.--------------------------------------------------..N-V....DD
F2JPG3_CELLD/74-312----S------------A.--------------------------------------------------..N-I....SY
C6CUI3_PAESJ/43-274----E------------H.--------------------------------------------------..S-M....QS
H6NBH0_9BACL/31-281----G------------R.--------------------------------------------------..N-I....TY
F3ZVL8_MAHA5/40-277----K------------N.--------------------------------------------------..N-L....QS
C6D144_PAESJ/61-288----A------------Q.--------------------------------------------------..I-T....DF
D3EMN3_GEOS4/45-297----K------------D.--------------------------------------------------..N-V....TY
C6D7B0_PAESJ/40-294----K------------N.--------------------------------------------------..N-L....QT
C6D7J9_PAESJ/38-288----S------------F.--------------------------------------------------..N-I....DQ
E3PXB9_CLOSD/46-280----S------------H.--------------------------------------------------..E-V....ET
Q7VHJ6_HELHP/43-277----Q------------Q.--------------------------------------------------.LA-L....SS
E6W5T9_DESIS/35-272----A------------H.--------------------------------------------------..Q-I....ER
C6BZH4_DESAD/37-310----G------------E.--------------------------------------------------..K-V....LA
Q5JHH6_THEKO/57-298----A------------R.--------------------------------------------------..L-F....DD
B9M8I3_GEODF/40-299----S------------H.--------------------------------------------------..T-L....EE
Q47XG9_COLP3/35-267----A------------D.--------------------------------------------------..K-V....ET
E7A996_HELFC/33-261----S------------A.--------------------------------------------------..S-I....AD
F2JMM1_CELLD/60-290----S------------Y.--------------------------------------------------..N-I....EN
B6BIE4_SULGG/44-312----K------------K.--------------------------------------------------..F-I....DN
A9A2K6_NITMS/39-281----A------------S.--------------------------------------------------..I-I....ES
E1X671_HALMS/37-327----K------------N.--------------------------------------------------..R-L....SH
E1WYC4_HALMS/48-313----E------------Q.--------------------------------------------------..Q-L....EN
B6BK47_SULGG/36-308----T------------I.--------------------------------------------------..E-I....EG
A4XMI4_CALS8/55-277----E------------D.--------------------------------------------------..L-K....YD
D4KX95_9FIRM/51-303----V------------S.--------------------------------------------------..L-L....DN
D4LPL0_9FIRM/48-267----.------------..--------------------------------------------------..D-L....DE
C6D3Q0_PAESJ/27-245----L------------Q.--------------------------------------------------..Q-V....NE
A4XMH3_CALS8/43-295----E------------E.--------------------------------------------------..T-I....YT
Q6AR33_DESPS/36-271----S------------D.--------------------------------------------------..N-I....YS
B5YK24_THEYD/36-274----S------------NW--------------------------------------------------ILN-I....NN
G7W723_DESOD/39-297----S------------T.--------------------------------------------------..N-L....EV
F2NHZ1_DESAR/35-311----A------------S.--------------------------------------------------..D-I....ED
C6C1E7_DESAD/46-293----A------------T.--------------------------------------------------..A-I....ED
C6CXB7_PAESJ/52-257----E------------T.--------------------------------------------------..D-I....NN
Q9KDT9_BACHD/37-275----S------------N.--------------------------------------------------..D-I....SN
D4H3E5_DENA2/28-291----R------------N.--------------------------------------------------..D-I....ED
F7YVT2_9THEM/41-272----G------------K.--------------------------------------------------..A-F....EA
E1QDC1_DESB2/44-271----G------------Q.--------------------------------------------------..G-I....DR
E7ABZ2_HELFC/42-298----V------------I.--------------------------------------------------..N-I....TL
Q73RB3_TREDE/35-272----A------------E.--------------------------------------------------..I-I....DG
Q9KFJ6_BACHD/36-286----Q------------T.--------------------------------------------------..N-I....EH
Q6MQG9_BDEBA/53-313----V------------D.--------------------------------------------------..R-I....NN
A4XGK2_CALS8/62-333----S------------Q.--------------------------------------------------..Y-F....QT
Q1IM50_KORVE/59-347----A------------Q.--------------------------------------------------..E-F....ER
Q2SGW4_HAHCH/32-267----K------------N.--------------------------------------------------..N-I....RN
F8F462_TRECH/35-317----I------------K.--------------------------------------------------..D-F....NS
C7RT51_ACCPU/45-266----A------------Q.--------------------------------------------------..G-T....EA
B7K4S0_CYAP8/44-338----T------------N.--------------------------------------------------..E-V....SN
G7W9K4_DESOD/50-262----A------------Q.--------------------------------------------------..Y-L....GE
C6CSH7_PAESJ/23-253----A------------N.--------------------------------------------------..Y-L....AS
D4ZTE8_ARTPN/36-315----A------------A.--------------------------------------------------..G-I....DE
E8MZP1_ANATU/52-264----V------------S.--------------------------------------------------..N-I....ES
E1R2C1_SPISS/36-293----A------------R.--------------------------------------------------..S-I....ET
C6C0E4_DESAD/40-301----S------------M.--------------------------------------------------..A-L....TD
B5YHW7_THEYD/47-271----E------------Q.--------------------------------------------------..R-M....KE
D3E5V1_GEOS4/40-274----A------------V.--------------------------------------------------..T-I....EA
E6VUE9_DESAO/63-288----R------------R.--------------------------------------------------..T-L....AY
A1WSF6_VEREI/52-286----A------------S.--------------------------------------------------..K-I....EQ
A5D5V0_PELTS/36-281----A------------E.--------------------------------------------------..T-V....DS
Q2FLJ4_METHJ/50-283----S------------L.--------------------------------------------------..I-I....SY
A6TX67_ALKMQ/30-271----T------------Q.--------------------------------------------------..E-V....EL
C0QIP9_DESAH/38-261----A------------E.--------------------------------------------------..A-I....NG
E8RGV5_DESPD/33-283----A------------V.--------------------------------------------------..Q-L....DK
C0Q9P9_DESAH/46-273----A------------S.--------------------------------------------------..D-I....NS
B8DJ49_DESVM/62-282----A------------R.--------------------------------------------------..Y-L....EE
H6NI13_9BACL/41-267----S------------T.--------------------------------------------------..K-M....AD
E0S203_BUTPB/55-291----N------------R.--------------------------------------------------..E-L....NA
B2TQC3_CLOBB/33-283----S------------T.--------------------------------------------------..H-L....ED
A6LM24_THEM4/37-269----S------------K.--------------------------------------------------..D-I....QA
H1XW39_9BACT/40-285----K------------D.--------------------------------------------------..L-I....ED
D8PCB9_9BACT/43-311----A------------T.--------------------------------------------------..A-V....DN
C3K184_PSEFS/56-337----A------------V.--------------------------------------------------..Q-L....QK
Q1LHF7_RALME/81-344----K------------A.--------------------------------------------------..S-T....DG
F0RV54_SPHGB/66-306----A------------A.--------------------------------------------------..K-V....SS
D5MG95_9BACT/36-306----A------------D.--------------------------------------------------..Q-L....KR
C3K2B9_PSEFS/49-329----A------------N.--------------------------------------------------..A-I....QA
Q1ILB4_KORVE/57-289----Q------------R.--------------------------------------------------..N-L....QM
Q602G4_METCA/30-274----M------------E.--------------------------------------------------..Q-V....DM
C6PUI2_9CLOT/40-278----T------------T.--------------------------------------------------..Y-L....DQ
F5Z6T8_ALTSS/35-267----S------------L.--------------------------------------------------..I-V....EQ
H6NA60_9BACL/52-287----Y------------N.--------------------------------------------------..H-F....AG
G8ANA3_AZOBR/64-289----A------------V.--------------------------------------------------..A-V....DR
H8MHX3_CORCM/30-270----A------------E.--------------------------------------------------..A-V....EA
C9RM68_FIBSS/40-270----A------------N.--------------------------------------------------..T-V....NN
A7IGX4_XANP2/66-286----A------------V.--------------------------------------------------..S-Q....QN
B9M6B7_GEODF/52-287----A------------M.--------------------------------------------------..A-F....SG
C9Z824_STRSW/26-262----R------------V.--------------------------------------------------..V-V....EQ
Q3SIW6_THIDA/34-299----A------------A.--------------------------------------------------..Q-I....DS
E3FLW5_STIAD/37-269----A------------V.--------------------------------------------------..Q-V....AD
I0HU31_RUBGI/29-253----A------------A.--------------------------------------------------..Q-A....EA
E3GHH9_EUBLK/36-277----R------------Q.--------------------------------------------------..K-F....DD
E3FG36_STIAD/32-267----A------------E.--------------------------------------------------..H-V....AT
G7Z6B1_AZOL4/54-254----A------------E.--------------------------------------------------..H-A....AR
D5CLV3_SIDLE/36-276----T------------R.--------------------------------------------------..S-F....ED
G8AMV0_AZOBR/40-289----E------------A.--------------------------------------------------..S-V....SR
D0LM69_HALO1/34-257----A------------G.--------------------------------------------------..R-I....AA
C7NWH4_HALMD/48-253----A------------S.--------------------------------------------------..Q-L....DV
B8D1L9_HALOH/40-260----R------------E.--------------------------------------------------..R-L....SK
B2UE10_RALPJ/76-334----A------------A.--------------------------------------------------..N-L....KS
A8IDY9_AZOC5/74-323----V------------A.--------------------------------------------------..M-L....RS
G1UVU9_9DELT/33-268----A------------E.--------------------------------------------------..N-F....QR

PF17203

A8IJW0_AZOC5/37-200----I------------------------------------------------------------------A-L----AK
E1VUF8_ARTAR/45-184----L------------------------------------------------------------------S-A----AE
E8U7M9_DEIML/49-188----L------------------------------------------------------------------R-E----SQ
C7LRL2_DESBD/42-181----L------------------------------------------------------------------Q-T----AR
Q1QZP7_CHRSD/37-181----T------------------------------------------------------------------D-I----AQ
E8NFB8_MICTS/40-178----L------------------------------------------------------------------D-V----AT
C8WZC3_DESRD/40-169----L------------------------------------------------------------------S-L----AR
A5G384_GEOUR/38-175----Q------------------------------------------------------------------S-L----GT
C8X081_DESRD/32-168----V------------------------------------------------------------------A-I----AR
B3E2P6_GEOLS/40-167----R------------------------------------------------------------------A-L----TQ
A6W5B6_KINRD/52-190----T------------------------------------------------------------------D-V----AA
D2AVS4_STRRD/35-173----L------------------------------------------------------------------A-I----AE
A0LAG0_MAGMM/37-175----A------------------------------------------------------------------R-I----IG
E6VQM2_DESAO/32-165----L------------------------------------------------------------------A-L----AD
B3EA57_GEOLS/33-179----I------------------------------------------------------------------K-T----FW
A4FKM4_SACEN/27-164----L------------------------------------------------------------------S-V----AE
F2R3Z9_STRVP/37-173----T------------------------------------------------------------------A-T----AA
A5G7L0_GEOUR/36-180----K------------------------------------------------------------------L-L----LT

PF14827

D7DT63_METV3/43-290----N------------D-----------------------------------------------------E-L----TQ
F4LKK3_TREBD/50-285----Q------------Q-----------------------------------------------------E-A----AA
H1XWA2_9BACT/46-289----K------------N-----------------------------------------------------N-V----QT
E8N3E1_ANATU/173-421----V------------Q-----------------------------------------------------E-E----DR
A9B1A1_HERA2/45-312----E------------T-----------------------------------------------------I-E----AQ
B8GT29_THISH/39-275----D------------A-----------------------------------------------------Q-S----QQ
F6CHJ7_DESK7/41-278----A------------E-----------------------------------------------------T-N----RR
A6LZK9_CLOB8/38-271----K------------E-----------------------------------------------------L-K----NE
E1QXZ6_OLSUV/38-302----D------------L-----------------------------------------------------E-D----AI
B6BK25_SULGG/41-273----E------------L-----------------------------------------------------I-E----QM
A1TIP1_ACIAC/42-281----A------------M-----------------------------------------------------R-R----ES
D8IXU4_HERSS/39-271----D------------Q-----------------------------------------------------N-A----QK
E1QFV1_DESB2/44-282----A------------A-----------------------------------------------------R-G----RQ
C4XT43_DESMR/37-275----E------------S-----------------------------------------------------L-R----TQ
C0QD16_DESAH/44-277----N------------N-----------------------------------------------------S-S----KV
C7RNJ0_ACCPU/54-301----S------------D-----------------------------------------------------F-G----LR
H8GHU3_METAL/46-282----K------------N-----------------------------------------------------D-R----ID
E1SQJ5_FERBD/47-274----E------------Q-----------------------------------------------------R-L----VS
F5Z5Z5_ALTSS/36-270----Q------------L-----------------------------------------------------F-E----DI
D1B421_SULD5/41-285----E------------S-----------------------------------------------------Q-Y----DI
Q7M9G7_WOLSU/43-278----N------------R-----------------------------------------------------L-S----LF
Q7M861_WOLSU/41-289----G------------R-----------------------------------------------------I-E----DY
H8GKJ7_METAL/52-296----K------------H-----------------------------------------------------S-V----DR

PF05228

K9T5N2_9CYAN/61-217----A------------EW--------------------------------------------------DDT-Y----.Q
Q8THY1_METAC/52-208----V------------SR--------------------------------------------------EDV-R----.A
A1ATC4_PELPD/52-207----A------------GW--------------------------------------------------DEA-Y----.A
I0H3Y6_ACTM4/69-223----S------------VW--------------------------------------------------TGA-V----.D
V5SI81_9RHIZ/41-227----A------------WW--------------------------------------------------DEA-V----TR
Q2SK89_HAHCH/33-193----A------------AW--------------------------------------------------DDT-Y----.R
Q7MJU6_VIBVY/60-219----A------------YW--------------------------------------------------DET-Y----.Q
A4XQX9_PSEMY/55-221----A------------WW--------------------------------------------------DPS-Y----.E
Q87H61_VIBPA/60-219----A------------YW--------------------------------------------------DET-Y----.D
Q2FTW2_METHJ/54-207----G------------VW--------------------------------------------------DDT-Y----.Q
C4XMF3_DESMR/52-207----G------------LW--------------------------------------------------DDT-Y----.H
Q8TQ13_METAC/66-219----A------------CW--------------------------------------------------DDT-Y----.R
A5FVT2_ACICJ/60-228----T------------VW--------------------------------------------------DTA-V----.E
F3YXA6_DESAF/52-207----A------------WW--------------------------------------------------DDT-C----.E
D3RPD2_ALLVD/52-208----A------------VW--------------------------------------------------DET-Y----.R
D9QF18_BRESC/52-225----V------------VW--------------------------------------------------DDA-V----.V
E8N3Z5_ANATU/58-207----A------------LW--------------------------------------------------DES-Y----.T
J1APM7_9EURY/52-203----A------------TW--------------------------------------------------DDT-Y----.F
K9V905_9CYAN/52-208----S------------AW--------------------------------------------------DDT-Y----.K
A1S8V4_SHEAM/53-207----G------------VW--------------------------------------------------DEM-V----.D
K9VQQ8_9CYAN/81-235----S------------AW--------------------------------------------------DDT-Y----.D
F6CMI2_DESK7/52-198----A------------AW--------------------------------------------------DDT-Y----.I
B8FAJ2_DESAA/52-212----A------------SW--------------------------------------------------DDT-C----.D
F7YQF2_VIBA7/72-226----A------------YW--------------------------------------------------DET-Y----.Q
K9WDX4_9CYAN/52-207----A------------KW--------------------------------------------------DDT-Y----.A
K9XAQ8_9CHRO/52-206----A------------EW--------------------------------------------------DET-Y----.A
Q2K9V0_RHIEC/61-216----A------------VW--------------------------------------------------DDA-Y----.K
A5V6E3_SPHWW/65-238----T------------VW--------------------------------------------------DDA-V----EQ
E8RJK5_DESPD/57-210----A------------PW--------------------------------------------------DET-A----.V
E3CZ19_9BACT/52-205----A------------AW--------------------------------------------------DAT-Y----.A
K9TJL0_9CYAN/52-205----G------------VW--------------------------------------------------DET-Y----.R
Q11B73_CHESB/53-222----S------------VW--------------------------------------------------DDG-V----.I
Q7CV32_AGRFC/64-225----A------------AW--------------------------------------------------DDA-A----.E
I0HBV1_ACTM4/59-206----S------------IW--------------------------------------------------TGL-Y----.D
Q07W08_SHEFN/52-212----A------------VW--------------------------------------------------DEL-V----.E
D4H4D3_DENA2/52-205----A------------SW--------------------------------------------------DDT-Y----.Y
Q117I8_TRIEI/66-213----A------------NQ--------------------------------------------------NQL-E----.S
C6BS22_DESAD/54-201----A------------WW--------------------------------------------------DDT-F----.S
W0HUA8_9ENTR/58-232----T------------AW--------------------------------------------------PPL-Y----.A
Q9I243_PSEAE/59-220----S------------FW--------------------------------------------------TDA-Y----.V
Q3A254_PELCD/52-206----A------------NW--------------------------------------------------DDA-Y----.A
Q9I594_PSEAE/136-300----A------------WW--------------------------------------------------DAS-Y----.D
Q8TNE0_METAC/52-206----A------------SW--------------------------------------------------DKT-F----.E
M1NBF3_DESSD/57-211----S------------AW--------------------------------------------------DDT-Y----.E
C4XQU7_DESMR/78-233----A------------VW--------------------------------------------------DDS-Y----.Q
Q30Y92_DESAG/57-216----A------------WS--------------------------------------------------NRL-Y----.N
C7LSV6_DESBD/62-217----A------------WW--------------------------------------------------DDT-Y----.Q
Q2K442_RHIEC/64-225----A------------AW--------------------------------------------------DDA-A----.A
Q4KBE8_PSEF5/64-225----A------------LW--------------------------------------------------GDA-Y----.Q
B8HRL0_CYAP4/58-211----T------------YW--------------------------------------------------DEL-I----.Q
A1TSZ0_ACIAC/62-225----S------------KW--------------------------------------------------GEA-Y----.R
E6TUY9_BACCJ/52-200----S------------VW--------------------------------------------------DDT-Y----.Q
M1M0P0_9CLOT/53-200----G------------QW--------------------------------------------------DDT-Y----.R
Q2FNF0_METHJ/52-201----G------------EW--------------------------------------------------DTT-Y----.D
B9JAE4_AGRRK/65-226----A------------VR--------------------------------------------------DAA-A----.E
Q72E59_DESVH/54-206----A------------AW--------------------------------------------------DDS-Y----.E
B8GE07_METPE/53-209----A------------PW--------------------------------------------------DDT-Y----.A
B8DPY6_DESVM/76-231----A------------WW--------------------------------------------------DDS-Y----.Q
I4D6E9_DESAJ/52-207----A------------KW--------------------------------------------------DDT-F----.N
E6W5W0_DESIS/57-218----A------------VW--------------------------------------------------SEA-C----.D
W6RK75_9RHIZ/64-225----A------------AW--------------------------------------------------DDA-A----.A
K9TZZ8_9CYAN/51-206----A------------SW--------------------------------------------------NDT-Y----.N
B8HP72_CYAP4/52-201----A------------MW--------------------------------------------------DET-Y----.A
Q6ALC0_DESPS/53-212----A------------AW--------------------------------------------------DDL-H----.A
J1L4S7_9EURY/84-233----A------------EA--------------------------------------------------DDT-G----.R
K9U7Y2_9CYAN/52-203----A------------EW--------------------------------------------------DET-Y----.V
Q12IQ4_SHEDO/66-220----A------------HW--------------------------------------------------DDT-E----.Q
U3U4B6_9ENTR/60-210----T------------RW--------------------------------------------------SPL-A----.V
A9B039_HERA2/62-217----A------------TW--------------------------------------------------DES-Y----.D
L0HGK7_METFS/52-200<