Sequence alignment for CL0166

PF08270

A7KTA0_STRPN/170-386SMDWVTHMIVQSNSQLSHELLEITPDEYVHFSILVALTWKR..REFPLEFPESKEF......EKLKNLFMYPILMEHCQT
Q9RA73_STRDY/176-395NENNLGRLV...SLMISKTDININFSMFRHIKILGGVNLIRYCKGF.VVGESKGLS......QIFLDLLMGSREMTNISQ
Q7WUJ7_STRPN/173-392SSEPLSQLL...ELVYKETSFPMNLSTHRMLKLLLVTNLYRIKFGHFMEVDKDSFN......DQSLDFLMQAEGIEGVAQ
Q936E3_STRAG/172-385DKLLIKRLLLEYSTTFTAS..HYFPNTFIFFDTLLSLSWKR..INYNVVVPYSPLF......IELQNIFIYDTLQYCVKN
Q8DYW7_STRA5/169-385SEVMIRDFIEYSNFKGCDYDLKDLSEEYYYFYILVNLVWKR..KEYKVEIPQTESF......NQLKKSILYMELSKAAQK
Q5XE08_STRP6/171-383DIETIHAFIFAAQKNLQPS..AFLDRRFLFFDVLLMLTWKR..HRYPVHLPHLALF......EHLKSLPIFDNIKTIAVD
Q8E472_STRA3/171-385DIKIIRQFLFESGTNIRPT..THLSDIFIFFDTLFILTWKR..HHHKVKIPNSKLF......SSLKKIFIYEELNTCVKS
Q5XE72_STRP6/171-385DKNTIHSFLSHSSTHLKTS..PWLSESFSFYDILLALSWKR..HQFSVTIPQTRIF......QQLKKLFIYDSLKKSSRD
Q54508_STRPY/178-396NLKNCERLL...SLMIKEVDVRVNFTLFQHLKILSSVNLIRYYKGYSAVYDNKKTS......HRFSQLIQSSLEIQDLSR
Q9ZB46_STRPY/182-396DNQIIYRFLSQSATNLRTS..PWLEEPFSFYNMLLALSWKR..HQFAVSIPQTRIF......RQLKKLFIYDCLTRSSRQ
Q9KWY2_STREQ/179-399NQNNLERLI...ALMVKQTDVPVNFALFQHLKILSGVNLIRFQKGFTLNRKDKGLE......HLFMKVLEDSLEMKDLSA
Q8DP24_STRR6/181-399PEEDLTEFA...DFFYKITNYPMRFSIYRMYKLMIAISIHRVKNGHFIDLPNHFY.......KEYYPLLKSIPNFQETLA
Q928R8_LISIN/175-389EKKMIDDFMATLNLRINIDAVAHNAEGHEYFRSLISMVFKR.......DIPTSAIILDEQCQKYIESSRFLVMVRKSCKE

PF00874

Q8KP25_ENTAE/75-162--------------------------------------------------------------------------------
MANR_BACSU/197-285--------------------------------------------------------------------------------
LEVR_BACSU/841-929--------------------------------------------------------------------------------
LEVR_BACSU/478-566--------------------------------------------------------------------------------
MANR_BACSU/307-397--------------------------------------------------------------------------------
LICT_BACSU/75-163--------------------------------------------------------------------------------
Q899A8_CLOTE/262-352--------------------------------------------------------------------------------
Q8Y8I4_LISMO/177-264--------------------------------------------------------------------------------
GLCT_STAEP/75-166--------------------------------------------------------------------------------
Q8Y8V7_LISMO/481-569--------------------------------------------------------------------------------
Q8Y423_LISMO/304-394--------------------------------------------------------------------------------
Q8Y3R0_LISMO/74-162--------------------------------------------------------------------------------
Q8NVE5_STAAW/314-402--------------------------------------------------------------------------------
Q8RCV3_THETN/309-399--------------------------------------------------------------------------------
Q45419_GEOSE/211-299--------------------------------------------------------------------------------
Q8E4R9_STRA3/179-276--------------------------------------------------------------------------------
Q8RCS2_THETN/205-292--------------------------------------------------------------------------------
Q8P0J0_STRP8/307-397--------------------------------------------------------------------------------
Q8ZL25_SALTY/845-932--------------------------------------------------------------------------------
Q8DUF3_STRMU/21-109--------------------------------------------------------------------------------
Q8CMV7_STAES/284-374--------------------------------------------------------------------------------
Q45419_GEOSE/321-409--------------------------------------------------------------------------------
ARBG_ERWCH/180-273--------------------------------------------------------------------------------
Q833J4_ENTFA/824-914--------------------------------------------------------------------------------
Q8Z4M4_SALTI/130-218--------------------------------------------------------------------------------
Q8YA62_LISMO/182-267--------------------------------------------------------------------------------
Q8EMS7_OCEIH/315-405--------------------------------------------------------------------------------
Q99SA2_STAAM/206-294--------------------------------------------------------------------------------
Q9KEK7_BACHD/181-273--------------------------------------------------------------------------------
Q8DW03_STRMU/320-410--------------------------------------------------------------------------------
LACT_LACCA/76-163--------------------------------------------------------------------------------
Q8DT02_STRMU/309-395--------------------------------------------------------------------------------
Q8Y4K2_LISMO/75-163--------------------------------------------------------------------------------
Q8NYB1_STAAW/299-389--------------------------------------------------------------------------------
Q8DPP3_STRR6/76-163--------------------------------------------------------------------------------
Q8P1Y7_STRPQ/75-163--------------------------------------------------------------------------------
Q8Y3R0_LISMO/179-272--------------------------------------------------------------------------------
Q8CXW9_ECOL6/223-310--------------------------------------------------------------------------------
Q46128_CLOLO/76-164--------------------------------------------------------------------------------
Q8Y9U5_LISMO/212-300--------------------------------------------------------------------------------
Q8Y9M5_LISMO/193-277--------------------------------------------------------------------------------
SACY_BACSU/74-162--------------------------------------------------------------------------------
Q97JD1_CLOAB/187-277--------------------------------------------------------------------------------
O65990_CLOAT/202-292--------------------------------------------------------------------------------
Q8ZR51_SALTY/814-903--------------------------------------------------------------------------------
Q8Y410_LISMO/193-277--------------------------------------------------------------------------------
Q8P1Y7_STRPQ/176-273--------------------------------------------------------------------------------
Q8R5U5_THETN/453-538--------------------------------------------------------------------------------
Q8DQU1_STRR6/180-274--------------------------------------------------------------------------------
Q9KER8_BACHD/51-139--------------------------------------------------------------------------------
Q48639_9LACT/179-257--------------------------------------------------------------------------------
Q9KGB4_BACHD/193-276--------------------------------------------------------------------------------
Q8Y9W7_LISMO/305-395--------------------------------------------------------------------------------
Q8Y8M4_LISMO/286-377--------------------------------------------------------------------------------
O07655_ECOLX/197-271--------------------------------------------------------------------------------
Q837K9_ENTFA/314-404--------------------------------------------------------------------------------
Q9KGB4_BACHD/297-387--------------------------------------------------------------------------------
Q97J80_CLOAB/183-273--------------------------------------------------------------------------------
BGLG_ECOLI/181-274--------------------------------------------------------------------------------
Q8Y6G6_LISMO/798-887--------------------------------------------------------------------------------
Q8R5U5_THETN/810-901--------------------------------------------------------------------------------
Q839Y1_ENTFA/489-580--------------------------------------------------------------------------------
Q9CJH3_LACLA/288-375--------------------------------------------------------------------------------
Q8DUF3_STRMU/123-220--------------------------------------------------------------------------------
Q8NYI2_STAAW/195-278--------------------------------------------------------------------------------
Q8DXP9_STRA5/320-410--------------------------------------------------------------------------------
Q9KF98_BACHD/18-111--------------------------------------------------------------------------------
Q815F4_BACCR/376-464--------------------------------------------------------------------------------
Q7X1P0_9LACT/218-308--------------------------------------------------------------------------------
Q8Y3P6_LISMO/181-274--------------------------------------------------------------------------------
ATXA_BACAN/292-383--------------------------------------------------------------------------------
Q819D4_BACCR/184-276--------------------------------------------------------------------------------
Q97JD1_CLOAB/82-170--------------------------------------------------------------------------------
Q9KEK7_BACHD/76-164--------------------------------------------------------------------------------
Q8RD56_THETN/836-925--------------------------------------------------------------------------------
Q8Y5C7_LISMO/300-390--------------------------------------------------------------------------------
Q82ZR7_ENTFA/475-563--------------------------------------------------------------------------------
Q8RCV3_THETN/200-288--------------------------------------------------------------------------------
Q7N8X9_PHOLL/73-161--------------------------------------------------------------------------------
Q8RGT2_FUSNN/287-377--------------------------------------------------------------------------------
Q8NYI2_STAAW/299-389--------------------------------------------------------------------------------
Q8RD56_THETN/473-563--------------------------------------------------------------------------------
P94467_GEOSE/181-274--------------------------------------------------------------------------------
Q8E0E5_STRA5/176-273--------------------------------------------------------------------------------
ARBG_ERWCH/75-163--------------------------------------------------------------------------------
Q8DR86_STRR6/201-287--------------------------------------------------------------------------------
Q9KER8_BACHD/156-249--------------------------------------------------------------------------------
Q9X672_STRMU/282-371--------------------------------------------------------------------------------
Q9X566_ENTFC/180-273--------------------------------------------------------------------------------
Q8XA79_ECO57/246-336--------------------------------------------------------------------------------
Q8RCS2_THETN/313-403--------------------------------------------------------------------------------
Q48639_9LACT/72-162--------------------------------------------------------------------------------
Q899A8_CLOTE/149-237--------------------------------------------------------------------------------
GLCT_STACT/77-168--------------------------------------------------------------------------------
Q9K679_BACHD/208-296--------------------------------------------------------------------------------
Q8E4R9_STRA3/76-163--------------------------------------------------------------------------------
Q8XGH7_SALTI/22-108--------------------------------------------------------------------------------
Q9KG18_BACHD/180-273--------------------------------------------------------------------------------
Q8DR86_STRR6/305-398--------------------------------------------------------------------------------
Q82Z58_ENTFA/336-426--------------------------------------------------------------------------------
Q8XP92_CLOPE/83-168--------------------------------------------------------------------------------
LICT_BACSU/180-273--------------------------------------------------------------------------------
Q8XA79_ECO57/137-225--------------------------------------------------------------------------------
Q8RC49_THETN/207-295--------------------------------------------------------------------------------
Q8P0J0_STRP8/199-286--------------------------------------------------------------------------------
Q819D4_BACCR/79-167--------------------------------------------------------------------------------
Q8Y4K2_LISMO/181-274--------------------------------------------------------------------------------
Q9K679_BACHD/318-405--------------------------------------------------------------------------------
Q8Y9A2_LISMO/298-387--------------------------------------------------------------------------------
Q8YA62_LISMO/284-374--------------------------------------------------------------------------------
GLCT_BACSU/184-276--------------------------------------------------------------------------------
Q8DNA0_STRR6/319-409--------------------------------------------------------------------------------
Q8DPP3_STRR6/182-276--------------------------------------------------------------------------------
Q8DNA0_STRR6/206-298--------------------------------------------------------------------------------
GLCT_STAAM/76-167--------------------------------------------------------------------------------
GLCT_STACT/185-277--------------------------------------------------------------------------------
Q9KG92_BACHD/206-294--------------------------------------------------------------------------------
Q8Y8I4_LISMO/290-379--------------------------------------------------------------------------------
Q8E206_STRA5/297-386--------------------------------------------------------------------------------
Q838N2_ENTFA/307-396--------------------------------------------------------------------------------
Q97M18_CLOAB/444-532--------------------------------------------------------------------------------
Q839Y1_ENTFA/855-947--------------------------------------------------------------------------------
Q8Y5C7_LISMO/189-278--------------------------------------------------------------------------------
Q8EVW2_MYCPE/302-392--------------------------------------------------------------------------------
Q836U6_ENTFA/806-895--------------------------------------------------------------------------------
Q46128_CLOLO/184-273--------------------------------------------------------------------------------
Q834W3_ENTFA/73-161--------------------------------------------------------------------------------
Q8RC49_THETN/314-404--------------------------------------------------------------------------------
GLCT_STAAM/184-276--------------------------------------------------------------------------------
Q8Y9M5_LISMO/298-388--------------------------------------------------------------------------------
Q8EMS7_OCEIH/198-289--------------------------------------------------------------------------------
Q8EMT4_OCEIH/296-386--------------------------------------------------------------------------------
Q834W3_ENTFA/179-273--------------------------------------------------------------------------------
Q8Y410_LISMO/298-388--------------------------------------------------------------------------------
Q8G3W9_BIFLO/181-274--------------------------------------------------------------------------------
Q99QZ8_STAAM/284-374--------------------------------------------------------------------------------
GLCT_BACSU/79-167--------------------------------------------------------------------------------
Q8G3W9_BIFLO/75-163--------------------------------------------------------------------------------
Q831B3_ENTFA/181-274--------------------------------------------------------------------------------
Q97J80_CLOAB/75-163--------------------------------------------------------------------------------
Q8EL15_OCEIH/294-380--------------------------------------------------------------------------------
Q9KG18_BACHD/75-163--------------------------------------------------------------------------------
Q8Y8V7_LISMO/846-932--------------------------------------------------------------------------------
Q97LJ1_CLOAB/181-271--------------------------------------------------------------------------------
Q97LJ1_CLOAB/76-164--------------------------------------------------------------------------------
MTLR_BACSU/205-293--------------------------------------------------------------------------------
Q9X566_ENTFC/74-162--------------------------------------------------------------------------------
Q8P2S6_STRP8/202-298--------------------------------------------------------------------------------
Q8Y5G4_LISMO/189-272--------------------------------------------------------------------------------
Q831B3_ENTFA/75-163--------------------------------------------------------------------------------
MTLR_BACSU/315-403--------------------------------------------------------------------------------
Q8EQ40_OCEIH/75-166--------------------------------------------------------------------------------
Q8Y3Q0_LISMO/304-394--------------------------------------------------------------------------------
Q8Y3P6_LISMO/76-164--------------------------------------------------------------------------------
Q8Z139_SALTI/214-299--------------------------------------------------------------------------------
Q8Y5G4_LISMO/292-382--------------------------------------------------------------------------------
Q7N8X9_PHOLL/179-274--------------------------------------------------------------------------------
Q8DQU1_STRR6/75-163--------------------------------------------------------------------------------
Q8GGK1_CORGT/74-169--------------------------------------------------------------------------------
Q8CXW9_ECOL6/337-428--------------------------------------------------------------------------------
SACY_BACSU/180-273--------------------------------------------------------------------------------
Q8DN39_STRR6/294-384--------------------------------------------------------------------------------
Q928S7_LISIN/286-376--------------------------------------------------------------------------------
Q8DXP9_STRA5/203-299--------------------------------------------------------------------------------
Q815F4_BACCR/731-820--------------------------------------------------------------------------------
Q82YX2_ENTFA/282-371--------------------------------------------------------------------------------
LICR_BACSU/306-396--------------------------------------------------------------------------------
Q97M18_CLOAB/804-893--------------------------------------------------------------------------------
O07655_ECOLX/92-180--------------------------------------------------------------------------------
ATXA_BACAN/179-264--------------------------------------------------------------------------------
Q8DT02_STRMU/201-288--------------------------------------------------------------------------------
Q9L8G7_CLOAT/181-275--------------------------------------------------------------------------------
P94467_GEOSE/75-163--------------------------------------------------------------------------------
Q8Y9U5_LISMO/320-406--------------------------------------------------------------------------------
Q45398_GEOSE/365-457--------------------------------------------------------------------------------
Q8DW03_STRMU/207-299--------------------------------------------------------------------------------
Q8GGK1_CORGT/187-280--------------------------------------------------------------------------------
Q8Z139_SALTI/319-409--------------------------------------------------------------------------------
Q8EMT4_OCEIH/193-272--------------------------------------------------------------------------------
Q81HK0_BACCR/196-284--------------------------------------------------------------------------------
Q8NZC2_STRP8/291-381--------------------------------------------------------------------------------
Q82ZR7_ENTFA/848-937--------------------------------------------------------------------------------
Q8R5U8_THETN/491-585--------------------------------------------------------------------------------
Q833J4_ENTFA/458-550--------------------------------------------------------------------------------
SACT_BACSU/178-271--------------------------------------------------------------------------------
Q82ZT1_ENTFA/281-371--------------------------------------------------------------------------------
SACT_BACSU/72-160--------------------------------------------------------------------------------
Q8NYB1_STAAW/189-277--------------------------------------------------------------------------------
Q8Y9W7_LISMO/200-285--------------------------------------------------------------------------------
Q8EQ40_OCEIH/183-275--------------------------------------------------------------------------------
GLCT_STAEP/183-275--------------------------------------------------------------------------------
Q9KG92_BACHD/317-407--------------------------------------------------------------------------------
O65990_CLOAT/314-404--------------------------------------------------------------------------------
Q8ZJY3_SALTY/826-911--------------------------------------------------------------------------------
Q8EVQ5_MYCPE/307-395--------------------------------------------------------------------------------
BGLG_ECOLI/77-164--------------------------------------------------------------------------------
Q8Y6G6_LISMO/443-531--------------------------------------------------------------------------------
Q8P2S6_STRP8/319-409--------------------------------------------------------------------------------
Q8Y423_LISMO/203-286--------------------------------------------------------------------------------
Q837K8_ENTFA/21-107--------------------------------------------------------------------------------
Q8XP91_CLOPE/31-121--------------------------------------------------------------------------------
Q9L8G7_CLOAT/76-164--------------------------------------------------------------------------------
Q8EN85_OCEIH/210-298--------------------------------------------------------------------------------
Q8EUZ8_MYCPE/315-405--------------------------------------------------------------------------------
Q8Y3Q0_LISMO/201-288--------------------------------------------------------------------------------
LACT_LACCA/182-277--------------------------------------------------------------------------------
Q8EN85_OCEIH/320-408--------------------------------------------------------------------------------
LICR_BACSU/194-282--------------------------------------------------------------------------------
Q45398_GEOSE/8-96--------------------------------------------------------------------------------
Q81HK0_BACCR/309-398--------------------------------------------------------------------------------
Q836U6_ENTFA/445-533--------------------------------------------------------------------------------

PF08270

A7KTA0_STRPN/170-386YLEPHANMTFTQEELDYIFLVYCSANSSFS.KDKWNQEKKTHTIQLILQHTRGKHLLSKFKNILGNDISNSLSFLTAL..
Q9RA73_STRDY/176-395LFFHKYTIPLNETALSEVFSDYMSDELFLG.GSFPTLTNKMNYLDNPRELTTWIRFLDKLEDDMKVMQPNKYEMARALHT
Q7WUJ7_STRPN/173-392SFESEYNISLDEEVVCQLFVSYFQKMFFIDESLFMKCVKKDSYVEKSYHLLS..DFIDQISVKYQIEMENKDNLIWHLHN
Q936E3_STRAG/172-385VIIDSFKINLKKDDIDYIFLAYLTSHNSFS.NPNWSEKRIDNVIAIFENYPKFQKLLQPLKDALPLSDSYHDELVKVA..
Q8DYW7_STRA5/169-385SIAIHLGIELNEGLLDYLYLVFCISDGPLF.SNRDDININEEFIFASYKISKSKAFKNFCGRLLGREFIDSQHFKDIN..
Q5XE08_STRP6/171-383ELAPRTRVTFSSDDFDYLFLIYLTTDNSFL.SGYWTSHQRQQLYHLITKDPDYHLLIHRLQALVGKYSDIHEHIPNLI..
Q8E472_STRA3/171-385IVQPYFNVIFNSEDMDYIFLIYLTSANSFA.AQKWTETHVDEVLAIFKSLPKFQMLLQPLKEALPYSDTYYDELVKVT..
Q5XE72_STRP6/171-385IIETYCQLNFSAGDLDYLYLIYITANNSFA.SLQWTPEHIRQCCQLFEENDTFRLLLKPIITLLPNLKEQKPSLVKAL..
Q54508_STRPY/178-396LFYLKFGLYLDETTIAEMFSNHVNDQLEIG.YAF..DSIKQDSPTGCRKVTNWVHLLDELEIRLNLSVTNKYEVAVILHN
Q9ZB46_STRPY/182-396VIENAFSLTFSQGDLDYLFLIYITTNNSFA.SLQWTPQHIETCCHIFEKNDTFRLLLEPILKRLPQLNHSKQDLIKAL..
Q9KWY2_STREQ/179-399LFALKYNQPLDARALAEIFSNYLNPALELG.KLLQSDDSAREQTLSSHQIVPWIALLDKIEKSLQLSISNKYELARHLQT
Q8DP24_STRR6/181-399YFSKHFGLEMTPDTIAQIFISFLQNDIFLDPQEFFNSLEDNSQARYSYQLLS..QILEGLSKQYKITFTNHDELIWHLHN
Q928R8_LISIN/175-389TLEKELDLVFSYNDYLYLMLIYYSTNFSII.DASMKKVELEQFNELILKNADLQSLIDLFEEYFGSEVVNHSLFRAAL..

PF00874

Q8KP25_ENTAE/75-162----------------------------------------DRIIDLA.....RGRLG.KL......QESLYITLPDHCH.
MANR_BACSU/197-285----------------------------------------TKEIKSL.....QKKHSLYF......TDETFESLLLHTL.
LEVR_BACSU/841-929----------------------------------------LEWLQTV.....QDELGVIF......NNAVLIKVIMHTA.
LEVR_BACSU/478-566----------------------------------------KQLKEIA.....EHELDCTF......DRKFIYFLSMHID.
MANR_BACSU/307-397----------------------------------------GHLINRV.....SELKMMDF....HKDQDLINGLNIHLN.
LICT_BACSU/75-163----------------------------------------EEIISYA.....KLQLGKKL......NDSIYVSLTDHIN.
Q899A8_CLOTE/262-352----------------------------------------EKMVSQF.....EKEVDIAL....ENKDEIINGLFVHLM.
Q8Y8I4_LISMO/177-264----------------------------------------QNIVKEV.....LAQESITT......NQYSMMNIVLHYA.
GLCT_STAEP/75-166----------------------------------------QAVIESV.....NIINESGLI...TDDKNLVVALTDHII.
Q8Y8V7_LISMO/481-569----------------------------------------EGVELRI.....EHQLGKKL......NERFLLAFSLHLT.
Q8Y423_LISMO/304-394----------------------------------------EKIIAEF.....ERLACVNF....EDHRNLKKDLLLHLQ.
Q8Y3R0_LISMO/74-162----------------------------------------DDIVKLF.....KMKTAKDI......SDVIYISLSDHLY.
Q8NVE5_STAAW/314-402----------------------------------------KAFVNKV.....EMISGMTF....ADLDTLVDGLTLHLN.
Q8RCV3_THETN/309-399----------------------------------------EKIIRNV.....SERIKENL....LEDQQLFEGLLDHLR.
Q45419_GEOSE/211-299----------------------------------------EQQIERI.....KEELPFTI......ADSSYIALVVHLA.
Q8E4R9_STRA3/179-276----------------------------------------KDILSAV.....EAELMKNKIRRTTDNSNFYDRFMIHLN.
Q8RCS2_THETN/205-292----------------------------------------KSLCEKI.....KEAVYEEL......PDLNYFGMFVHIL.
Q8P0J0_STRP8/307-397----------------------------------------KACIAKI.....SQLTGMTL....ETDTNLFQGLLAHMM.
Q8ZL25_SALTY/845-932----------------------------------------EGVFNHL.....TSSLS..L....KPSRQVTLRFLIHCC.
Q8DUF3_STRMU/21-109----------------------------------------LEIIHQG.....QEKLGQTF......DISLYIALADHLH.
Q8CMV7_STAES/284-374----------------------------------------DRLIELM.....EQHIGFPF....SQDTILKDNMNVHFS.
Q45419_GEOSE/321-409----------------------------------------QELIRFV.....SAELHVDI....TNDYTLYEDLVVHLK.
ARBG_ERWCH/180-273----------------------------------------QEILNIV.....KYQLNLDY....NEQAFSYHRFVTHLK.
Q833J4_ENTFA/824-914----------------------------------------EVFLIQL.....EERWQQTI......QNDRKLAVYVHVS.
Q8Z4M4_SALTI/130-218----------------------------------------HALINLC.....ARRLQKPF......EHRDVQFLRLFLQ.
Q8YA62_LISMO/182-267----------------------------------------SELIIAY.....HKKHEFFM......NDFSTISFILHIA.
Q8EMS7_OCEIH/315-405----------------------------------------MLSLEKI.....EEEMHLGI....SQDTELMISLGMHLK.
Q99SA2_STAAM/206-294----------------------------------------ERLLMDY.....LSALPYQL......TESSYLTLTVHIV.
Q9KEK7_BACHD/181-273----------------------------------------SELVYVI.....ETSLELTI....DRQHVDYLRLVRHLH.
Q8DW03_STRMU/320-410----------------------------------------SYFIDAF.....ELDYHVCF....KHKQLLLNQLLTHCK.
LACT_LACCA/76-163----------------------------------------YEIIDVA.....QKQYRLKV......LDYIYITLSDHIY.
Q8DT02_STRMU/309-395----------------------------------------VMAIEQL.....EPCLKNDF........QFIEGLLAHLS.
Q8Y4K2_LISMO/75-163----------------------------------------DDVVQYA.....QETLETDL......SDNIYLTLTDHIN.
Q8NYB1_STAAW/299-389----------------------------------------HELITCV.....SQELGIDM....SKDNKLHTSLITHIK.
Q8DPP3_STRR6/76-163----------------------------------------YEIIDKL.....SKKYHYPI......QEYLYVTLTDHIY.
Q8P1Y7_STRPQ/75-163----------------------------------------ERIINLG.....KIKLGKTL......DEILYINLTDHIH.
Q8Y3R0_LISMO/179-272----------------------------------------QEIISII.....KYHFNIEF....DEESTNYYRFMTHLK.
Q8CXW9_ECOL6/223-310----------------------------------------QSLLLDM.....ENELSWSL......GEPYYVNIFTHIL.
Q46128_CLOLO/76-164----------------------------------------YDIIEYA.....KNILDKEL......NDYIYVTLTDHIN.
Q8Y9U5_LISMO/212-300----------------------------------------IAIVQEF.....SERHDFTF......TDYAFQSIVIHLA.
Q8Y9M5_LISMO/193-277----------------------------------------RRTLEEA.....EAMMQIKF......TYEQIELLPYLLS.
SACY_BACSU/74-162----------------------------------------EQIISHA.....EKELNIKI......NERIHVAFSDHLS.
Q97JD1_CLOAB/187-277----------------------------------------NTIIEFI.....EDELDITI....DKHSIDYARFITHLR.
O65990_CLOAT/202-292----------------------------------------IDIVKEI.....FKKLHFGST...NVNDIKYFSLFLLTL.
Q8ZR51_SALTY/814-903----------------------------------------ETIIAEW.....QSTLGFSF......NNNLIISLYVHLS.
Q8Y410_LISMO/193-277----------------------------------------REKLEQV.....EHHLNLHF......IDNKMQILPYILE.
Q8P1Y7_STRPQ/176-273----------------------------------------TEIVSYI.....EQKIKTDFKTELDDTSIDYYRFMTHIK.
Q8R5U5_THETN/453-538----------------------------------------QDFLNYA.....SKKLQKEF......SDKTLYGLSMHVA.
Q8DQU1_STRR6/180-274----------------------------------------MGIEKII.....QDFYCTEF....NQDSIDYYRFITHIK.
Q9KER8_BACHD/51-139----------------------------------------EQIIQHA.....KMAYKKDL......NDIIYVALTDHIN.
Q48639_9LACT/179-257----------------------------------------EEILTTL.....KYTLQVNF....NEQDIYFQRFITHLK.
Q9KGB4_BACHD/193-276----------------------------------------KRRIHTL.....EQKLNLTF......TDENIQSMPYTLL.
Q8Y9W7_LISMO/305-395----------------------------------------EGLLNRI.....ESHYFYHL....QDDMQLKKDLVAHIH.
Q8Y8M4_LISMO/286-377----------------------------------------TGICEKM.....GEIYQVDFV...HGDTDFYTQIKAHIK.
O07655_ECOLX/197-271----------------------------------------QIITELI.....EVVYNRKV....ERSSSNYSRFMMHLK.
Q837K9_ENTFA/314-404----------------------------------------KQVIESV.....SKELNYPF....VNDRQLFTNLFAHLS.
Q9KGB4_BACHD/297-387----------------------------------------VDMLRLF.....EKRACIAL....QEKEQLLTKLLLHVN.
Q97J80_CLOAB/183-273----------------------------------------QDILNIV.....KYTYNIVL....DEKSISYERFVTHLR.
BGLG_ECOLI/181-274----------------------------------------REMLQLI.....KFQFSLNY....QEESLSYQRLVTHLK.
Q8Y6G6_LISMO/798-887----------------------------------------RKVISEL.....QLQLNVIL......ESGVDIGMILHLA.
Q8R5U5_THETN/810-901----------------------------------------SSFKQFY.....STLIAKGV....KLNEDITIGLILHIA.
Q839Y1_ENTFA/489-580----------------------------------------KKIYNFA.....AKRLSYSF......QPNFIYAMSLHIS.
Q9CJH3_LACLA/288-375----------------------------------------RQLIDKV.....STILEIEF....GKDDRLYGLLYAHLK.
Q8DUF3_STRMU/123-220----------------------------------------SKIVSDI.....LEIVRLHFGEVRDEESISYNRFITHVQ.
Q8NYI2_STAAW/195-278----------------------------------------KDKIKQV.....EQFLKSRF......IDKSLSSLPY.VL.
Q8DXP9_STRA5/320-410----------------------------------------TSFLKEL.....EERYHLHF....VHKKDLLRQLLTHCK.
Q9KF98_BACHD/18-111----------------------------------------TERASLI.....AERTVEQFV..TDENADSYTMLITHLA.
Q815F4_BACCR/376-464----------------------------------------EKIAELA.....EKHLSKTF......DEKVFLALSLHVQ.
Q7X1P0_9LACT/218-308----------------------------------------YEICRKV.....EHSTGIEF....KAFNNVVDHIYAHLV.
Q8Y3P6_LISMO/181-274----------------------------------------KKVLLIL.....EDTLSIKL....DEESLNYLRFITHLR.
ATXA_BACAN/292-383----------------------------------------KEITKGI.....EHKLQLGI....NYDESFLTYVVLIIK.
Q819D4_BACCR/184-276----------------------------------------AQLVSLI.....ETNLQITL....DQESIHYLRLIRHLQ.
Q97JD1_CLOAB/82-170----------------------------------------EEIISMI.....SKELNENL......NEKIHISLTDHIS.
Q9KEK7_BACHD/76-164----------------------------------------NDAIERI.....EERFQVRL......HEHIHVALTDHLF.
Q8RD56_THETN/836-925----------------------------------------EKAISDL.....ERFIGIRF......SNDLKISLYIHVS.
Q8Y5C7_LISMO/300-390----------------------------------------DFYIEQV.....AAKINMPI.....NKKQLKIELLSHMK.
Q82ZR7_ENTFA/475-563----------------------------------------QEAIVFF.....EQLIQEKL......TEDFQNILIVHLY.
Q8RCV3_THETN/200-288----------------------------------------EQCVQIA.....ERELETIF......SDAAFSGLVIHIA.
Q7N8X9_PHOLL/73-161----------------------------------------EKIIALG.....KDLLGKSL......NDSLLITLSEHLN.
Q8RGT2_FUSNN/287-377----------------------------------------NKIVRTF.....EIKIKVDL....KNIDIFLDEIFYYIK.
Q8NYI2_STAAW/299-389----------------------------------------AQMIHHF.....EQITFINI....EDKEKLSQQLLLHLT.
Q8RD56_THETN/473-563----------------------------------------ENVLNIM.....QNMYGIKYY...GNSVLVLSHFINYLL.
P94467_GEOSE/181-274----------------------------------------REMIDII.....QAELDIPI....DEDSISYQRLLTHLR.
Q8E0E5_STRA5/176-273----------------------------------------TEIVSYI.....EQKVKIDFRTELDESSIDYYRFMTHTK.
ARBG_ERWCH/75-163----------------------------------------DRIIALA.....KEKLGGNL......QNSLYISLTDHCH.
Q8DR86_STRR6/201-287----------------------------------------ARIVLDE.....CQEANLKL......SDFVLQNLVVHIA.
Q9KER8_BACHD/156-249----------------------------------------KHILKIV.....KYHFNTDL....DEDSLNYFRFITHLK.
Q9X672_STRMU/282-371----------------------------------------QSFVKKV.....KDTLLVNF.....DEQRLFAEIQTHLK.
Q9X566_ENTFC/180-273----------------------------------------RDMLNII.....KYHFSLSI....DEESINYMRLVTHLQ.
Q8XA79_ECO57/246-336----------------------------------------KRLVNHF.....RELGNVRF....YDEQGLCDQLYTHLA.
Q8RCS2_THETN/313-403----------------------------------------KEVVEEV.....SRIFNVNI....RCDEQLLLGLAQHLE.
Q48639_9LACT/72-162----------------------------------------LSILTLAK...AKTKFDKTI......SDTVLVAFADHLN.
Q899A8_CLOTE/149-237----------------------------------------WELLIDT.....LKAINISV......SDMAFYNIIINTC.
GLCT_STACT/77-168----------------------------------------QTIIEAM.....DIITHADRT...VVDKDLMVALTDHIL.
Q9K679_BACHD/208-296----------------------------------------QEVLADF.....RKQMVEPM......ADRAYIGLIVHLT.
Q8E4R9_STRA3/76-163----------------------------------------YEVIDSL.....SKKYNYPV......QDYIYVTLTDHIY.
Q8XGH7_SALTI/22-108----------------------------------------EQVLTQV....DGLLGRHHI....VPNAVQTQMLTSHVR.
Q9KG18_BACHD/180-273----------------------------------------HDLLNIV.....RYHFKMEY....DEDSLTFFRFVTHLK.
Q8DR86_STRR6/305-398----------------------------------------KSLLKTFQNLGLDDMYNFSS......DFQLIEGLITHLM.
Q82Z58_ENTFA/336-426----------------------------------------ENVTKNI.....EKRFDLTL......SGKMKFNLMMHNA.
Q8XP92_CLOPE/83-168----------------------------------------EELILEI.....SRDFSDEL......NEIIHIGLIDHIS.
LICT_BACSU/180-273----------------------------------------QEILSIV.....KYHFKIEF....NEESLHYYRFVTHLK.
Q8XA79_ECO57/137-225----------------------------------------QALVNLC.....SRRLQKRF......ESRDIHFLCLYLQ.
Q8RC49_THETN/207-295----------------------------------------EKAILRL.....KQQIDYEI......VESSYMALVVHLA.
Q8P0J0_STRP8/199-286----------------------------------------MIIVLDE.....CRDAKLEL......SDFVMNNLVLHIA.
Q819D4_BACCR/79-167----------------------------------------NDIMLYI.....QGKAKSPL......NEHIHIALTDHIS.
Q8Y4K2_LISMO/181-274----------------------------------------QDILSIV.....TYHYGMVL....DETSLNYTRFITHLQ.
Q9K679_BACHD/318-405----------------------------------------KALIHEV.....EKSLHVQF.....QDPSLFQGLVAHLK.
Q8Y9A2_LISMO/298-387----------------------------------------NSLITSM.....SEELNLPF....LEDAILYKGLLNHVA.
Q8YA62_LISMO/284-374----------------------------------------TRLLEAV.....DQNFHIDF....SADEKIATYLVAHIS.
GLCT_BACSU/184-276----------------------------------------AQLVEVI.....EDSFQMKV....NKESVNYLRLIRHIR.
Q8DNA0_STRR6/319-409----------------------------------------EEFIWYF.....ESQIRMEI....ENKDDLLRNLMIHCK.
Q8DPP3_STRR6/182-276----------------------------------------LRNVEEV.....LKGYAIQRT...KKNNHFYDRFMIHLN.
Q8DNA0_STRR6/206-298----------------------------------------KEQVPLV.....EQDLGKKIN..HHEITFMLQVLPYLLL.
GLCT_STAAM/76-167----------------------------------------QVIIDSL.....NFISNTAMN...VDSKQLVVSLTDHII.
GLCT_STACT/185-277----------------------------------------NKSILIM.....EHDLKYKI....DTNSIQYQRFIRHIQ.
Q9KG92_BACHD/206-294----------------------------------------YDVISES.....EKVLKIQY......TDDVLHSLSLRFL.
Q8Y8I4_LISMO/290-379----------------------------------------KIVLANV.....EETYLIDL.....QNEQLFIKLAIHVQ.
Q8E206_STRA5/297-386----------------------------------------KAIVDEM.....ETVSLLNF....SNKEELLQGLKRHII.
Q838N2_ENTFA/307-396----------------------------------------KQLIEAV.....SQETEVNF....FEDTNLYKMLLTHLS.
Q97M18_CLOAB/444-532----------------------------------------DKIIYQI.....VTSLRKNI......NNNVYTALALHIN.
Q839Y1_ENTFA/855-947----------------------------------------IDLLWSF.....AKNIQTQLA..MPEEYTFYINLIMHTS.
Q8Y5C7_LISMO/189-278----------------------------------------VRQMELI.....ENKLMISI......PYPYDINIFSHLY.
Q8EVW2_MYCPE/302-392----------------------------------------YKMLSEI.....EKNHYIFF....FEKDKLVTDLINHLI.
Q836U6_ENTFA/806-895----------------------------------------QKTVHQI.....QTDMHIIV......EPGVDAGIMIHLA.
Q46128_CLOLO/184-273----------------------------------------NDILNIV.....KYTYNLEL....DEKTLNYERFITHLR.
Q834W3_ENTFA/73-161----------------------------------------EEIIQHA.....ETVLGEKL......NEHINIGLSDHIA.
Q8RC49_THETN/314-404----------------------------------------EEIIKEA.....SKVFEVDF....SEDKLLEEGLQSHLA.
GLCT_STAAM/184-276----------------------------------------KKGIDII.....ESDLVTTV....DKESLQYQRFIRHVQ.
Q8Y9M5_LISMO/298-388----------------------------------------LTCLDLF.....EKKALVSL....KNKHILIEKLLLHLK.
Q8EMS7_OCEIH/198-289----------------------------------------KNIIIQQ.....LDSHQMTL......SDIAIHNLFIHIA.
Q8EMT4_OCEIH/296-386----------------------------------------DKMVRLF.....EKNACIIF....QDREQLIDKLLQHLT.
Q834W3_ENTFA/179-273----------------------------------------SEIIHLI.....EQELAIDIH..DDKNSLSYSRLVNHLR.
Q8Y410_LISMO/298-388----------------------------------------EQVLSEF.....EKKACIQL....VDKESLLEKLFAHIK.
Q8G3W9_BIFLO/181-274----------------------------------------QQLLDII.....DHSYGITL....DRGSVNVGRFITHLR.
Q99QZ8_STAAM/284-374----------------------------------------DRLIELM.....QQRIHVPF....NEDSILQQNLYNHFS.
GLCT_BACSU/79-167----------------------------------------NDVIYHI.....SNRTNHSL......NEHIHIALTDHIA.
Q8G3W9_BIFLO/75-163----------------------------------------VESMQET.....GLGERETG......STTLVMALSDHVA.
Q831B3_ENTFA/181-274----------------------------------------RDILTII.....SRYFGQVF....DEDSLNYQRIVTHLQ.
Q97J80_CLOAB/75-163----------------------------------------YDIIEYA.....KNVLDAKL......NDHIYVTLTDHVS.
Q8EL15_OCEIH/294-380----------------------------------------LYLIQEI.....SKILEVNL....ASDKKLMNDLMYHAK.
Q9KG18_BACHD/75-163----------------------------------------EEIISYA.....KEKLAKDL......NDSIYISLTDHIN.
Q8Y8V7_LISMO/846-932----------------------------------------SSFASVL.....EKKLGYKL......DNTFKINLLIHVG.
Q97LJ1_CLOAB/181-271----------------------------------------GKVMEFI.....SSALNKDI....DKSSLAYERTVTHIN.
Q97LJ1_CLOAB/76-164----------------------------------------EEIIFLC.....ENELGIKL......NEAIHTSLPDHID.
MTLR_BACSU/205-293----------------------------------------ERILFQL.....KEKIAFSL......SDSSYIALVVHLT.
Q9X566_ENTFC/74-162----------------------------------------NELVSYG.....EKEIGKKA......NDYLYLALLDHLS.
Q8P2S6_STRP8/202-298----------------------------------------LTYFHEY.....LFLSQASLG...KTINTQDSQFMLQIL.
Q8Y5G4_LISMO/189-272----------------------------------------KKRLEKV.....ESKLQITF......TDEQMEELPYILH.
Q831B3_ENTFA/75-163----------------------------------------KQIVDLA.....ETTLAIEL......SSNIYLTLTDHIH.
MTLR_BACSU/315-403----------------------------------------KRLIAFI.....SDKIRMDL....TKNYSLYEGLIAHLE.
Q8EQ40_OCEIH/75-166----------------------------------------QKIIDSIN..MIQKRSSEIL......NEKVHVALTDHLL.
Q8Y3Q0_LISMO/304-394----------------------------------------DKMLAKI.....KELYGYDF....KQDQKMISNIALHLK.
Q8Y3P6_LISMO/76-164----------------------------------------NKIIKDA.....ESELNVTF......DELTYLGLADHIN.
Q8Z139_SALTI/214-299----------------------------------------QSLLPDI.....FSHCQIRL......TDEGELFLRLYCA.
Q8Y5G4_LISMO/292-382----------------------------------------DEFIRLL.....EMYFATEI....MKKNEFKEKVILHVR.
Q7N8X9_PHOLL/179-274----------------------------------------NKTVKLI.....HYYFHVNL....DTTSVNYSRFITHLR.
Q8DQU1_STRR6/75-163----------------------------------------EKIINLG.....KITLGNNF......DEIIYINLTDHIS.
Q8GGK1_CORGT/74-169----------------------------------------TELIASV.....SAELDSPV......GSATVVALADHLQ.
Q8CXW9_ECOL6/337-428----------------------------------------WRLITVF.....SDIVDCDF....SEDSALYDGLLVHIK.
SACY_BACSU/180-273----------------------------------------RDIIEII.....EIQLSINI....VEDTISYERLVTHLR.
Q8DN39_STRR6/294-384----------------------------------------EAIISRM.....EDISLLHF....KQREGLRENLRRHLI.
Q928S7_LISIN/286-376----------------------------------------LLILEEI.....KHVYLIDF....TTDLEVTSDMTKHIF.
Q8DXP9_STRA5/203-299----------------------------------------LDYFHHY.....LFISQRSLG...KKINSQDGQFMIQIL.
Q815F4_BACCR/731-820----------------------------------------RYALNTI.....QELISLQL......TPDSLMGVILHMS.
Q82YX2_ENTFA/282-371----------------------------------------QKMMKKI.....HHSVVVEF.....DEDFLFSEMKDHLR.
LICR_BACSU/306-396----------------------------------------LAMIKAV.....DRELKLGI....LHDKELKIGLALHMK.
Q97M18_CLOAB/804-893----------------------------------------YRFVKRV.....EFKLKLKV......DDEVFIGLVLHIA.
O07655_ECOLX/92-180----------------------------------------EKIVQYA.....EKNLEKNL......NPSLLLILADHIS.
ATXA_BACAN/179-264----------------------------------------TDLINKM.....EKILNVQM......YTYSKHKLCVLFA.
Q8DT02_STRMU/201-288----------------------------------------TIIVLDE.....CREGHLKL......SDFVIQNLVIHIA.
Q9L8G7_CLOAT/181-275----------------------------------------DGILNII.....KYFFSIEF....NEDDMSYDRLLTHLK.
P94467_GEOSE/75-163----------------------------------------EEIISYA.....EGKLQAPL......NNHIHIALTDHLS.
Q8Y9U5_LISMO/320-406----------------------------------------ADFVSRC.....LAEGN..Y......DKGLLEDLTTHMK.
Q45398_GEOSE/365-457----------------------------------------RAALAAI.....GRELGLEA......DGRDLVGLVFHLC.
Q8DW03_STRMU/207-299----------------------------------------RGELQVS.....QALLGKKIN..SQDIRFMVATLPYQLL.
Q8GGK1_CORGT/187-280----------------------------------------EQLFEVI.....DSSFGITL....DRQSVNAARFITHMR.
Q8Z139_SALTI/319-409----------------------------------------HYILNFI.....NTQYNYNL....LNDKQLHADLLTHIK.
Q8EMT4_OCEIH/193-272----------------------------------------HRRLERV.....ENKLHIEF......TDEKLMTMPTIFS.
Q81HK0_BACCR/196-284----------------------------------------RSIILKY.....IEGGTIYL......SDIEIDNLVIHIA.
Q8NZC2_STRP8/291-381----------------------------------------EEIINSV.....AVNTGLSI....TDTPELRQNLYSHLL.
Q82ZR7_ENTFA/848-937----------------------------------------AKIYSDI.....CLQTKIKS......DEKILLRFIIHCA.
Q8R5U8_THETN/491-585----------------------------------------EKIVNAV.....EKAYEIARRSFKNLEDNLFYSLAIHLS.
Q833J4_ENTFA/458-550----------------------------------------RQLLETI.....ESSYQIRF......NGSLVYALSTYLFQ
SACT_BACSU/178-271----------------------------------------KEMIEKI.....KQYFNRKV....DENSISYQRLVTHLR.
Q82ZT1_ENTFA/281-371----------------------------------------GEIIRKM.....ELLAVVQF....EQPRELLMNVYYHLV.
SACT_BACSU/72-160----------------------------------------EDIISYA.....EGELAAPL......SDHIHIALSDHLS.
Q8NYB1_STAAW/189-277----------------------------------------RRAIIKT.....LNSENYHL......VQSAIDGLIYHIL.
Q8Y9W7_LISMO/200-285----------------------------------------MTAVTDY.....FFATNIRF......TDEALQNLLLHMM.
Q8EQ40_OCEIH/183-275----------------------------------------TQLINII.....ETKLSIKI....DRAGIEYIRLVRHIR.
GLCT_STAEP/183-275----------------------------------------NKSITII.....ETDLQHSI....DKQTIQYQRFIRHIQ.
Q9KG92_BACHD/317-407----------------------------------------TSMVNDF.....QKYACVVF....EEKELLEKNLFFHIK.
O65990_CLOAT/314-404----------------------------------------NELVTGV.....SKKIGINI....TKDKKLVEDLSNHLK.
Q8ZJY3_SALTY/826-911----------------------------------------EQFLLRY.....EHLAGVTV......SNERKVALYVHIS.
Q8EVQ5_MYCPE/307-395----------------------------------------DTFLKNI.....KANNSIQY....NQEKKLKANIVDHIL.
BGLG_ECOLI/77-164----------------------------------------DRIISLA.....QERLG.KL......QDSIYISLTDHCQ.
Q8Y6G6_LISMO/443-531----------------------------------------EKVYAMA.....EEKLNRKY......NEKMKFAFSLHLQ.
Q8P2S6_STRP8/319-409----------------------------------------SHFIDQL.....ESRYQLHF....THKQDLLKQLTTHCK.
Q8Y423_LISMO/203-286----------------------------------------FEILAVT.....EKKIGIRY......TDEVIERIGIMIF.
Q837K8_ENTFA/21-107----------------------------------------QSIIKQT....SARLAEAQI....EPTELQWTILINHLN.
Q8XP91_CLOPE/31-121----------------------------------------NTAVEYI.....EDAFNIEV....DRTSLSYARFISHLR.
Q9L8G7_CLOAT/76-164----------------------------------------ENIISYA.....KRKLDVKF......DEHIYISLTDHLS.
Q8EN85_OCEIH/210-298----------------------------------------EEQIQRM.....RNQLPYDL......ADSAYIGLVVHIA.
Q8EUZ8_MYCPE/315-405----------------------------------------EKLIEKF.....EQETFVYL....NNKNMVIEDLTKHIA.
Q8Y3Q0_LISMO/201-288----------------------------------------EQIVVSN.....IAKYNIHM......TDISVKNLIIHIA.
LACT_LACCA/182-277----------------------------------------SQLVQEV.....LKRHHITRS...HSNGNYYDRFMIHLQ.
Q8EN85_OCEIH/320-408----------------------------------------KELIRSV.....SNEMNIDV....THNNRFLNDLTTHLK.
LICR_BACSU/194-282----------------------------------------RSAILKK.....MKNDRIPL......SNMGLNNLIIHIA.
Q45398_GEOSE/8-96----------------------------------------EAMVVYA.....EKKLGRRL......AEKVMYALAMHIQ.
Q81HK0_BACCR/309-398----------------------------------------HILFKVA.....EERNLIFY.....YDEELLFGFGIHLK.
Q836U6_ENTFA/445-533----------------------------------------NRLYDIA.....EERLEHTY......NETARFAFALHLQ.

PF08270

A7KTA0_STRPN/170-386.TFLTRTFLFG------LQNLVPYYNYYEHYGIESDK-.PLYHISKAIVQEWMTEQKI..EGVIDQHRLYLFS-LYLTET
Q9RA73_STRDY/176-395TVILDEEDINR------.NFLIYNDIECNLAFFKKNY-KFVYKKVMKSIKHVFRFVPKALSQSLLSNLIYTLL-ITWEDL
Q7WUJ7_STRPN/173-392TAHLYRQELFT------.EFILFDQKGNTIRNFQNIF-PKFVSDIKKELSHYLETLEVCSSSMMVNHLSYTFI-THTKHL
Q936E3_STRAG/172-385.IIFSRTFILG------LNQLIPETISFPSWNYHRHD-.KLTTILRPIITNWLSEIG...EYTFKEQHFLLLC-AHLERI
Q8DYW7_STRA5/169-385.AYFLRHFICY------CYYFIPDFYFLNTSRLSYSK-.DLYHLLDKGLADIFNLKGG..NLTFSKHETVLLT-MQLSNL
Q5XE08_STRP6/171-383.PFFKRT.LYN------LQTLI.TFDGYYFDQYQGNM-.LLLDKLETVIKDWLYDTGR..QGSISSGHLHLMC-LYLEQI
Q8E472_STRA3/171-385.IYFSRNFIVG------LNQLIPETLSFPSTFYPGNN-PKLISIIEPIVTHWLTEIG...ESKFKKTHFFLLC-AHLERV
Q5XE72_STRP6/171-385.MFFSKSFLFN------LQHFIPETNLFVSPYYKGNQ-.KLYTSLKLIVEEWLAKLPG..KRYLNHKHFHLFC-HYVEQI
Q54508_STRPY/178-396TTVLKEEDITA------.NYLFFDYKKSYLNFYKQEH-PHLYKAFVAGVEKLMRSEKEPISKELTNQLIYAFF-ITWENS
Q9ZB46_STRPY/182-396.MYFSKSFLFN------LQHFVIEIPSFSLPTYTGNS-.NLYKALKNIVNQWLAQLPG..KRHLNEKHLQLFC-SHIEQI
Q9KWY2_STREQ/179-399TVILAEEDISA------.NFLIYDYKKEYLKFFHKHY-RVIYDTFLTYVEDLFALDHQEFNEGIRNHLLYCLF-ITWENL
Q8DP24_STRR6/181-399TAFFERQEIFS------.TPILFEQKALTIKKFEVYF-PDFMGSARQELAQYRQAIGQHDHPEQLEHLMYTIL-THAENL
Q928R8_LISIN/175-389.CYFLKKTLFN------LQGLIPSNERLLDKKYQ...-.PLYLVVKSVLERWNEISGH..RAMLIDSHINYLT-IHLYPL

PF00874

Q8KP25_ENTAE/75-162.FAIER.QKKG..........IALRNVLL.WEIKRLY.PKEFALGQEARAIIAKRL.---GVELAEDEAGFIA.LHLVTA
MANR_BACSU/197-285.LMVRR.IKMKQ........PISLSPKEM.AAVKK...KKEYQWTFACLQRLEPVF.---AIRFPEEEAVYLT.LHILGG
LEVR_BACSU/841-929.FAFER.VIKQ..........NPIAFSEE.EEINDQL.KEMVYVTERTLAPYEEKL.---GLRISDDEKLFIA.AIFAEE
LEVR_BACSU/478-566.AFLKR.GKQI..........DVLNTQET.DEIRDTH.VKEYRVAMIFKDKIQEYF.---KVAIPEIEVIYLT.MLIHSI
MANR_BACSU/307-397.TVLQR.LSYD..........LSVANPML.NDIKKMY.PYLFHLIIDVLEDINQTF.---DLHIPEEEAAYLT.LHFQAA
LICT_BACSU/75-163.FAIQR.NQKG..........LDIKNALL.WETKRLY.KDEFAIGKEALVMVKNKT.---GVSLPEDEAGFIA.LHIVNA
Q899A8_CLOTE/262-352.PAINR.AKYS..........IKIKNSYK.EDIKNSY.NEFYTITANLVRIINNEF.---NVELGSDEISYVC.LHFVAA
Q8Y8I4_LISMO/177-264.ISIVR.IQQG...........NTLIETQ.KTLIRKH.SKEYEISKKIAKILSEEY.---QIHFSEAETKQLG.LLYVGL
GLCT_STAEP/75-166.YAYKR.LKQH..........QMITNPFV.IETKHLY.SNAYNVARKVIDKLNKTL.---DVHFPEDEIGFIA.LHIASN
Q8Y8V7_LISMO/481-569.SFIKR.IESN..........KPLKYTNI.ENVVNDQ.PEAYELSREIKDDIEATF.---HIRVPNMEVMYLT.LLISSL
Q8Y423_LISMO/304-394.PAYYR.LKFQ..........IEWINPLR.TDIKQSY.SDVYEITKKSLEPLEDLL.---GEAIPEDEIAYVT.ILFGGY
Q8Y3R0_LISMO/74-162.FATQR.LQEN..........VVIENPLS.WEVKRFY.QEEYAVAKEAAKMVESKL.---EIELPDAEISNIA.LHFVNA
Q8NVE5_STAAW/314-402.PAINR.LQAN..........IETYNPLT.DMIKFKY.PRLFENVRLALNDCWP...---DLIFPESEIAFIV.LHFGGS
Q8RCV3_THETN/309-399.PTIYR.LKHD..........LKLKNPIL.DEIKTNY.RELFEIVRESLKPIEEYT.---GRNLNEEEIGYFV.IHFGAA
Q45419_GEOSE/211-299.LAIER.ISQGE........SINFDQQYL.ETIQT...TKEYETAEKIARSLEHAF.---RITIPKEEIGYIT.MHLMGA
Q8E4R9_STRA3/179-276.YFLDY.LDRNR.......NDNVSLLEME.SQIRQTY.PEAYRIGSTIYEIVSHKT.---GVDLYQSERVYLV.LHIQRL
Q8RCS2_THETN/205-292.LSIYR.SKEGK........AIELDREFI.NDILQ...SEEFNFMKKVEKILEEE..---DFYLPESEIAYLA.IHLSPK
Q8P0J0_STRP8/307-397.PLTTR.LENH..........IQLTNPLT.EEIKSQY.PEIFTLTKQIFSDLLV.CQ---NNDVSDDEWAYIS.LHLMAA
Q8ZL25_SALTY/845-932.CMVER.IVINRK.....PLQMALESQPN.LDARA......FSVIKSAFLPIEDAY.---AIRLSDAEYFYIY.E.LLYS
Q8DUF3_STRMU/21-109.YTIQR.TREG..........LTLQNPLA.WEVRKFY.PEEFQLGKDTIELVKEKM.---TLQLADDEAASIA.LHFINA
Q8CMV7_STAES/284-374.RTYLR.LMSH..........VYLNNPLT.SQIKRLY.PFVFNTLYDSIRQLSQDT.---NIQLSEDEIAFLT.IHFQSS
Q45419_GEOSE/321-409.PALYR.IQHN..........MGIANPLL.EKIVQDY.PELFAVLEKGVKQVFP...---DVTVPKEEIGYLV.LHFAAA
ARBG_ERWCH/180-273.FFAQR.LLGRT.......PVFSEDESLH.DVVKEKY.TLAYHCAEKIQDHIMLHY.---DYTLTKEELMFLA.IHIERV
Q833J4_ENTFA/824-914.CLIER.LIRN..........EPIENYNGAEQLKQCQ.RTVLQELKEAFSVIEKVY.---SVNIPESELFYVYDVLFGKT
Q8Z4M4_SALTI/130-218.YCLLQ.HHAG..........ITPEFNPV.QQIWAQS.CAEYPLAQEIGRHWQRHV.---MQAAPLNEALFMA.LLFSMI
Q8YA62_LISMO/182-267.VLIER.ISMG..........SYIERTAL...LEQD..KTSLEMAAHLAETLEKEL.---QINIPTQELSYIA.RLYSGK
Q8EMS7_OCEIH/315-405.PAMNR.YKYG..........MNIRNPML.THIKKNY.PLAFQAAVYAGVVIEEKT.---DITIDENEIGYLA.LHIGAA
Q99SA2_STAAM/206-294.LSISR.IKNGE........YVALNDDIY.DSVQN...TFEHKVASELADKLGQIY.---DVTFNQAEIAFIT.IHLRGA
Q9KEK7_BACHD/181-273.HAIER.IQKGE........YNDNQERLK.KILKEEY.PVCYNLSYKLIKIMQQSL.---KKAIPDAEAVYLT.LHLQRL
Q8DW03_STRMU/320-410.ALLFR.KAYG..........IVSNNPLT.DQIKDKY.ADLFAMTKVCLSILENAW.---SIKMNDDDIAYIT.IHIGGE
LACT_LACCA/76-163.EAYKR.YQAG...........TYQETMV.PDFHIQY.PAEYAVAKQALQIIATNL.---GVQFPQSEIKNLA.LHFINA
Q8DT02_STRMU/309-395.TMLIR.LEGQ..........INLENPLT.AEIQKNY.QVKYQLAQKLMHSMPIFS.---PFSFSADEIAYIA.LHFMAA
Q8Y4K2_LISMO/75-163.FAVSR.YNQG..........INLKNALL.WEIKRFY.HAEYLVGMKALDFIEQEV.---GIRLDEDEAGFIA.LHIVNA
Q8NYB1_STAAW/299-389.PAIHR.IKYD..........MLQPNPLR.QEVMRRY.PQIIEAVSKHISPIEQDA.---AIRFNEDELTYIT.IHFASS
Q8DPP3_STRR6/76-163.CSYQA.LTQG...........RYKDSNL.PDISAKY.PVAFQIANEAFEIYRQKL.---ADHFPEDEIIRIA.YHFINA
Q8P1Y7_STRPQ/75-163.SAIER.HEQG..........MLIHNPLR.WEIQRYY.PDEYSLGVKALELIERNL.---GVTLAIDEAAFIA.MHFVNA
Q8Y3R0_LISMO/179-272.FFCQR.VIIGE........TIDEMDEFL.YQTVKKSRGVIFDCIDKIGVFLEKNY.---QFTMSHSEQFYLA.LHIERL
Q8CXW9_ECOL6/223-310.IMMYR.NTHG...........NALSREE.DQTRQ.YDENIFNVASQMIHKIDQRI.---AHTLPDDEVWFIY.QYIISS
Q46128_CLOLO/76-164.YVIEA.CKQG..........ISKPNILI.WEIKKFY.PKEFAVGLKAIEFIEDEL.---GYKLHEDEAGNIA.LHLINA
Q8Y9U5_LISMO/212-300.IAVER.IREG..........EYVENVES.DPMKDVF.ESQRNNTEILVGMLEERL.---DIKIPAFEVGYIQ.LHLTAA
Q8Y9M5_LISMO/193-277.VMFLR.IRDRRLI....DTAFHIDEKSL.SDTRE......YHITDILLEKTGP...---...VPEQERLFIT.LQLLTT
SACY_BACSU/74-162.FAIER.LSNG..........MVIKNPLL.NEIKVLY.PKEFQIGLWARALIKDKL.---GIHIPDDEIGNIA.MHIHTA
Q97JD1_CLOAB/187-277.FTIER.IINS..........SPIKNELL.NAIKHAY.PESYKLSSKICKLLEDEL.---HKKVVEDETAYLV.MHIERI
O65990_CLOAT/202-292.LAIKK.TESKK........NINLPNKVK.QDMKS...SIIYNTLRSLQEKLMEN..---NIILPEDELSYLC.LHLNDY
Q8ZR51_SALTY/814-903.CMIERLVMRN..........EITHYKNM.TEFNERH.GEFIAMVNHSFQRLKILY.---NVALPVAEIGYIH.DIFELR
Q8Y410_LISMO/193-277.AVFRR.MKKGQTI....TTSFLIDYNEL.SDTRE......YGAAEIFIEEEPN...---...MPEAERMYIT.LQLLTS
Q8P1Y7_STRPQ/176-273.LFAQR.VLSEM.......SYDDDDAELL.LVVKTKY.PKEYRCVLDISEEIKKRY.---NYHLNSSELLYLT.VHVKRL
Q8R5U5_THETN/453-538.SSIER.ILEG.........KDIVNHQLE..HIKKVY.PKEFEIAKVLKEEIQREF.---NIVVPEDEVGFIT.M...FL
Q8DQU1_STRR6/180-274.LFAHR.LVENTT......YCDDDDEDLL.ALMKNKY.PREYECGEQVAMFIQTEY.---NYLLTSSELVYLM.AHIRRL
Q9KER8_BACHD/51-139.FAIER.VKKG..........YEIKNALL.WEIRKLY.QDEFAIGQHAIEIIEKKL.---GITLSEDEAAFIA.LHIVNA
Q48639_9LACT/179-257.FFTER.ILSNTK......SDESTDEDLF.LLITRKY.PRAYIGTKKSVSFLNR...---...............QVRTK
Q9KGB4_BACHD/193-276.LILKR.IKLGRL.....INRFSIHYEEL.SDTKQ......YHATEELLSGFEE...---...IPREERLFIT.LYLLTT
Q8Y9W7_LISMO/305-395.SMLYR.VKYH..........MTVKNPMT.EHIKRYY.PLAYEITLDAVESLKKDY.---PYDINQNELAYLA.LHIGAS
Q8Y8M4_LISMO/286-377.LMIRR.VRAG..........VIIENPIF.NEFMRDN.REIFMRVKESLEALKPLL.---PISVSSQEISFLA.IYFASE
O07655_ECOLX/197-271.YLSSR.VLCN..........EKIKQKDI.GDIYEQF.LEKDILLQRAIHEIER...---...............YLYAT
Q837K9_ENTFA/314-404.LRFTK.KHLF..........INEYNPFS.EEIKGKH.PALFLAIQSACKQLIQRS.---VLLVNDSFCAYIA.LHFLAA
Q9KGB4_BACHD/297-387.PAYYR.IKYQ..........LTEMSKTS.TKISEEY.KELHHLVKQSMKPLETLI.---GVEIPENESSYLT.LLIGGW
Q97J80_CLOAB/183-273.FFFHR.IDKSE.......TVDTAEEDFLLKQVREKY.KDAYQCMLKVQKYLGKE..---...LSDEEKLYLT.VHIQRV
BGLG_ECOLI/181-274.FLSWR.ILEHA.......SINDSDESLQ.QAVKQNY.PQAWQCAERIAIFIGLQY.---QRKISPAEIMFLA.INIERV
Q8Y6G6_LISMO/798-887.FLIER.VKLG.........AVDREFPDL.NEFAKNH.MVEMQITQQMMENVEIEY.---DIVIPQSEIAYLT.QMMLSN
Q8R5U5_THETN/810-901.CVIER.IIEG.........KELTHVKNT.QQYIRDY.PKEFETIRKTVKILEEGC.---DISISDEECVNIM.KIIYSI
Q839Y1_ENTFA/489-580.SFLKR.IQLGK.......DPKHPLNESI.RNMVLDY.PTEFETAKEIKNIIESSY.---QMEIPESESYYLA.VLLISL
Q9CJH3_LACLA/288-375.ESEMLPVLFP...........KKENDFI.KKINKDN.PEIYKTVKESLREVF....---DKNFSEMEIAFIS.LHFVAT
Q8DUF3_STRMU/123-220.YFAQR.VANGL.......VQGKNDAFLY.EQVKENY.PHAFACTEKIKSYVESAY.---NFAMSRDEQVYLT.IHIQRL
Q8NYI2_STAAW/195-278.CVIRRRIQSGH........VMNPLNINY.QYLRD...TKEYQATEIMTQLEPD...---...LPEAEKLYLT.LHLLST
Q8DXP9_STRA5/320-410.ALLYR.KRYG..........IFSVNPLT.EHIKDKY.EELFAITSSSVKLLEKAW.---QIKLTDDDVAYLT.IHLGGE
Q9KF98_BACHD/18-111.MAVTR.IDRL..........EPLSPPPE.SIMKEIYESRDLEEAKRRVAWIEETM.---GDTLPQEEKEFLI.MHFVSA
Q815F4_BACCR/376-464.TTLQR.LQSG..........KQIHHPQL.NQIRTKY.KEAFSVAMQCIQLLEEEL.---QITMPIDEAGFLT.MFFVVD
Q7X1P0_9LACT/218-308.PAYFR.ILGK..........FTIQNVLI.EQIQKQY.NHLFQITHYSLTPLEELL.---GERLPDSEIGYFT.ILFGGE
Q8Y3P6_LISMO/181-274.FFIER.INSEG.......AREKEEPDMI.EQVFKLY.PKAYASVQIISDYIQETL.---NCTVYAEELMYLT.LHVQRL
ATXA_BACAN/292-383.KALDKNFIQY..........YNYNIKFI.RHIKQRH.PNTFNTIQECISNLNYTV.---YSHFDCYEISLLT.MHFETQ
Q819D4_BACCR/184-276.YAIER.VKKGE........KVEESQSFA.DLLKAEY.PACYNLAWKLVKVMQKEL.---QLPVYEAESIYLT.MHLQRL
Q97JD1_CLOAB/82-170.FTLKR.LLSN..........DTIQNPFL.IETATLY.KTEFELAKKAVKMLEEKT.---NIEIPEDEVGFIA.LHIHSA
Q9KEK7_BACHD/76-164.YAIKR.INQG..........FDIKNPFL.TETELAY.PKEFDVATEIIQALEAAF.---HISIPPGEIGFVA.LHIHSA
Q8RD56_THETN/836-925.VMVER.LVMK.........EPITSYSNL.EEFEQCH.RQFINFVKSAFSVIEETY.---KVEIPTTEIGFIY.DLIKDR
Q8Y5C7_LISMO/300-390.PMVNR.MNHQ..........INIKNNLL.SDIKLEY.GKLFEIIKETARDAAKTFE---LNTISDDEVGYIT.IYFAKH
Q82ZR7_ENTFA/475-563.SAVFYSAQMN..........ETFYSDTK.NIYSGK..VTQYQAAKTMVDFLQTLF.---GISFADTEILFFD.LFIRKV
Q8RCV3_THETN/200-288.IAIKR.IQLG.........KDIVMPKEE.LKALEM..TKEFAVASNIAKMLEDRF.---NVSIPVDEIGYIT.IHLLGS
Q7N8X9_PHOLL/73-161.FAFER.VSKG..........YQIGNVLQ.WEIPHLY.PLEYEVGKQALIYINGQI.---EKPLPPIEASLIA.LHFVNA
Q8RGT2_FUSNN/287-377.PLIFR.TKKR..........IKLKNSIL.KDVKKLY.PSIFNFLKKNFYFLEEVI.---NEKVSDEEIAYLV.PFFHKA
Q8NYI2_STAAW/299-389.PAFYR.IKYN..........LTDRDELI.NPLQGNY.QSLFHMVKQSCQSLTEYF.---GKSLPDNEIAYLT.MLFGGS
Q8RD56_THETN/473-563.SDVTY.EKYS...........ESIESAL.EILKNIF.PKEFIIANKMADLIEVNL.---DIKLNKIAVAYFT.LYVRSL
P94467_GEOSE/181-274.FAINR.IENGE.......LLHSMDEEML.ALIQTKY.GKEFACAQKMAEHAKGEY.---GLEFPDAELAYIA.LHIQRL
Q8E0E5_STRA5/176-273.LFAQR.VLSGM.......KYEDDDADLL.LVVKKKY.PREYKCVKEIGNNMAIQY.---QYQLNSSELLYLT.VHVKRL
ARBG_ERWCH/75-163.FAIER.HRQG..........VDIRNGLQ.WEVKRLY.QKEFAIGLDALDIIHRRL.---GVRLPEDEAGFIA.LHLVNA
Q8DR86_STRR6/201-287.LSVIR.LKSGF.......EIKNIDCQMT.DDAIE......RKVAQRILSKVREVT.---NQEFPVQEIDYIT.LHLLAK
Q9KER8_BACHD/156-249.FFCQR.LINRT.......FLSSDDDTFF.DIVKEKH.KDSFACTEKIKEYIKKQY.---DYELTNEEMLYLT.IHIDRV
Q9X672_STRMU/282-371.FLINR.LIFH..........VQANDIFH.REIQNKY.PLAFEMAKVAGDDLKNHF.---GCQLELSEMSYLA.LYFEMI
Q9X566_ENTFC/180-273.YFIER.LRKKQ.......AYVENESQLF.EQVKKLY.PKAYTAVEKIEIYVKGKF.---NTYLSQDEYTYLM.IHVNRV
Q8XA79_ECO57/246-336.QALNR.SLFA..........IGIDNTLP.EEFARLY.PRLVRTTRAALAGFESEY.---GVHLSDEESGLVA.VIFGAW
Q8RCS2_THETN/313-403.PAFYR.LRMG..........LVTSNPLI.EEIKSYY.KDLFSAVERACKIVFSKY.---NIIVPEEEIGYIT.MHIGAA
Q48639_9LACT/72-162.AAIIR.EKDN..........ITIKNFLL.WDIKRFF.PEEFALCLETLQKVQEKL.---NISLPEDEAGFLA.MHIVNG
Q899A8_CLOTE/149-237.IMIKR.IQQDF........IADIEYEKM.DYISE...TFEYDEAKNYCNELSKRY.---NIIIPKTEIIWIS.MHFLGA
GLCT_STACT/77-168.FAYKR.IKQH..........QFIKNPFL.IETKQLY.SESYQIAVSVIEHLNKLL.---DIEFPEDEIGFIA.LHIASS
Q9K679_BACHD/208-296.LAIER.IRQGE........KIEIDPSYL.SKLKM...DKEFELAADLARRLEQKL.---GMNIPEAEVGYMT.MHIRGA
Q8E4R9_STRA3/76-163.GSYQA.IQQK...........RYKDSAL.PNASEIY.PVPYQIAREAVAIYRERL.---LDTFPDDEINRIA.YHFINA
Q8XGH7_SALTI/22-108.AMAHR.SITG..........EPLPEVDA.SLFDEIS.AESMALAREIVAAFGN...---...LPDEEAWLLS.VHFEVA
Q9KG18_BACHD/180-273.FFAQR.LLSGT.......SLNSKDDFLL.QIVKENH.SEAYDCTLKIGEFLKAQY.---HYELTKEEQLYLT.IHIERV
Q8DR86_STRR6/305-398.TLQVR.LESR..........ITLNNPLV.DEIKQNY.SDIFFMTREILANMDKFL.---EWSISDDEIAYVS.LHFLAA
Q82Z58_ENTFA/336-426.LMVERTMLGVE........DYEIPANLE.ELTINQ..KPFFQNAKNIFYTLEQFY.---RIEISNWELYVIY.EILSSR
Q8XP92_CLOPE/83-168.FAIER.MKKG..........EILRNPFL.VEIETLY.PKEFEAATKMVKKLEDFT.---GVSIVDDEIGFIA.Y...AY
LICT_BACSU/180-273.FFAQR.LFNGT.......HMESQDDFLL.DTVKEKY.HRAYECTKKIQTYIEREY.---EHKLTSDELLYLT.IHIERV
Q8XA79_ECO57/137-225.YCLLQ.HHAG..........ITPQFNPL.QRRWAES.CLEFQVAQEIGRHWQRRA.---LQPVPPDEPLFMA.LLFSML
Q8RC49_THETN/207-295.LAIKR.LQEGE........TIQIGEETL.EDLKK...TEEYLFAKKLGEYLEEEL.---NIDIPEDEIGYIT.IHLLAA
Q8P0J0_STRP8/199-286.LMVQR.IRSG..........CPLELFSI.PIAIRQ..SDEYQVALRILYRVEEVM.---GIRFPKEEANYIA.LHLKVK
Q819D4_BACCR/79-167.FAIKK.LKQG..........LTIDNPFL.VETKMLY.PKEYEIAEGVVELLNSRL.---QITLPEGEIGFIA.LHIYSS
Q8Y4K2_LISMO/181-274.YFAQR.LLRKE.......IVDSGDDFLY.EQVQIKY.PEAFKCTKKIDAYLINTH.---HTELTRDERVYLT.IHIYRV
Q9K679_BACHD/318-405.PALYR.IREK..........MKIYNPLL.EKIKQDY.EELFHVVQVKGNKVFE...---PITIPEEEAGFLV.MHFGSA
Q8Y9A2_LISMO/298-387.PLIER.VRGN..........VQIYEDTF.DVIPTEF.LYILQATSKVVKTIPL.L.---ESVENESEISLLA.IHFLAS
Q8YA62_LISMO/284-374.ALYKR.ANHK..........QYLTNPLT.EELKNKF.PFIYNVSVYASAFIQKEL.---AITFPDDEIAYIA.LHFLSA
GLCT_BACSU/184-276.FTIER.IKKEE........PTKEPEKLM.LLLKNEY.PLCYNTAWKLIKILQQTL.---KKPVHEAEAVYLT.LHLYRL
Q8DNA0_STRR6/319-409.SLLFR.KTYG..........IFSKNPLT.KQIRSKY.GELFLVTRKSAEILEGAW.---FIRLTDDDIAYLT.IHIGGF
Q8DPP3_STRR6/182-276.YFLDY.LDRSR.......DDNQSLLDME.DHIKQSY.PKAFEIGSKIYDVITQHT.---GLDLYKSERVYLV.LHIQRL
Q8DNA0_STRR6/206-298.SCHNV.EQYQE........RHQDIEKEF.SLIRK...RIEYQVSKKLGERLFQKF.---EISLSGLEVSLVA.VLLLSY
GLCT_STAAM/76-167.FAYKR.LKQN..........QVISNPFV.METMQLY.SDAYHIAKQVIDQLNAAL.---DVHFPEDEIGFIA.LHIASN
GLCT_STACT/185-277.FLIRR.LQKGE........IIQVNDEFG.NMLKAHY.PLCYNIAVKIIKMMQQHL.---DVEVYEAELIYLT.LHINHF
Q9KG92_BACHD/206-294.LFMKR.VAKGK........FIKVHPLEK.QVLKG...TKEYEAAKVMSFKLEQAF.---GVHYPDEEVLYLT.THILSS
Q8Y8I4_LISMO/290-379.SLYYR.SRYK..........AYTRNLSL.LDIKTSY.PVTFDIAVYISSLLQEKL.---AIDFNEDEISFIA.LHIGSF
Q8E206_STRA5/297-386.PAYFR.LKYG..........LTGDSGYT.QNIKEHY.SDLFLLVKKALRPLEEQV.---GL.IPDSEISYFV.IHFGGY
Q838N2_ENTFA/307-396.GVFSR.AVLQ.........EEDLTNPIL.ERIMNQY.QEIAAALRQALPQIFP...---QKNLSEEEIAYMV.LHFANS
Q97M18_CLOAB/444-532.TLITR.INSN..........KTIINPEL.RKIKSLY.PTEYKIALNAKKQIENYI.---NHPIPDDEAGYIA.LFIVNN
Q839Y1_ENTFA/855-947.GMLER.ILRND........TLTVSEKEL.GRLVQ...EPIYPVIVSSIETMEEAL.---NMDVPAEEVYFIA.QLVKNA
Q8Y5C7_LISMO/189-278.ILINR.FRQGE........VEDFKESDD.DYIVTN..EKLHTLAVEAIDAIEQYL.---KMKLPKRETFHFL.QYLISS
Q8EVW2_MYCPE/302-392.PAYYR.AKFN..........LNVNVEYL.NIVKEKY.KKFFNITVKHIGVVENYL.---KIKFSQEEIALLS.LYFVSN
Q836U6_ENTFA/806-895.FLVDA.LIKG.........EETRNFPNL.AEYVKTH.RLEIDVVRTNFMLIERAY.---RVTIPEAEVAHVT.QMFLEN
Q46128_CLOLO/184-273.FFFKR.LERKE.......ITESEDNFLL.EQVKNKY.TDAYECMLKIEKYLGQE..---...LSNEEQLYLM.LHIQRV
Q834W3_ENTFA/73-161.FAAEN.IQNN..........IIVRNKLL.SEIEILY.SEEFAIAQWAVEYLTQTL.---EIPFSYDEAGYIA.IHIHSA
Q8RC49_THETN/314-404.PALYR.LEMG..........LDIRNPLL.GDIKAKY.PVLFEKSNKVCDVLRKKL.---KRDIPEDEVGYIA.MHFGAA
GLCT_STAAM/184-276.FLIRR.LRRKE........YIHAQDDFV.SMIKNHY.PICYNTAYKILTMIQKQF.---DVNISESEIIYLT.LHIHHF
Q8Y9M5_LISMO/298-388.PAYYR.IKYQ..........MNLEDTLY.EKFNQEF.EALNFIVKEAFDPLAKFI.---GREIPAGEIFFIS.LFIGSD
Q8EMS7_OCEIH/198-289.IAVLR.IRDGHP.....IDFNAAHREEM.QDMKD...TKAYFVAEKIVEDTEKQL.---HLSFPKTETTYVA.LHLLGT
Q8EMT4_OCEIH/296-386.PAYYR.IKYK..........LTDAIVFE.STYNEEF.EQIRHLIKRALEPISEVM.---ESKIPENEITYIV.MLVSGW
Q834W3_ENTFA/179-273.LFIHR.FQQNQ........YAVLDEEIL.EVVKKKY.AESYEISKKVQVLLMRNF.---HYQVPNEELGYLS.IHIERL
Q8Y410_LISMO/298-388.PAYYR.IKYH..........LTTDYSIL.DKIDQEF.QAVHYIVKESLAPLERFI.---GSKVPENESIFIT.LFIGGH
Q8G3W9_BIFLO/181-274.YLFVR.IHQHQ.......QLTDEPAPVM.KVIRESY.PAALRCARTIASLLELRL.---DTDISDDEIAYLA.MHVARV
Q99QZ8_STAAM/284-374.KAYLR.ITQN..........IYLNNPLV.IEIKKLY.PFVFNTLFEAIDKLAIDT.---DIEMSEDEIAFLT.IHFQAA
GLCT_BACSU/79-167.FAIKR.QQQG..........FDMKNPFL.METQSLY.PEEYQIAKEVIDMINEKA.---GLCLPEGEIGFIA.LHIHSA
Q8G3W9_BIFLO/75-163.NAVER.VRRG..........IDITYPLL.GEVSNLY.PQEYAQGRAMLASLNARL.---DVTLPDGEATALA.MHLVNA
Q831B3_ENTFA/181-274.YFAQR.YLKQE.......AHDEEDEFLF.ALVQGKY.PKAFQAVQRINEYLLKSY.---DRPIDQAEMIYLT.IHIQRV
Q97J80_CLOAB/75-163.NCFKM.IESG..........IIIHNPLI.WEIKKFY.PKEFKVGLKAIDFIKDEL.---GKDLPEDEAANIA.LHLINA
Q8EL15_OCEIH/294-380.SAFLR.MEQG..........AEIDNPYT.EEIKIRY.RAIYEMVHQITTDMGYE..---...MVAAEVAYIT.MHISSA
Q9KG18_BACHD/75-163.FALER.FQNG..........ITISHGLL.WELRRLY.KEEFAIGMEALRIIKDRL.---GIELPEDEAGFIT.THIINA
Q8Y8V7_LISMO/846-932.CALER.MVLN..........DGLIYREP.KDMLE...TNIFKALEQTNKEVIYKM.---NLKLTNDELCYLY.DILNEI
Q97LJ1_CLOAB/181-271.FVLDR.IKNK..........KTIKNLLL.DSIKKQL.YNEYDLAIKVAIKLENLF.---SVSVPEDEIGYIA.MHLKRL
Q97LJ1_CLOAB/76-164.FAFTR.IKKG..........IKIENPFL.NEIVALY.PKEYKLAEKALDMINKNF.---TTKLPKDEIGFIS.MHINAA
MTLR_BACSU/205-293.YAIER.IKLGE........TITMEQNEL.EELMN...AKEYSSALEIAGELERAF.---GVTIPEAEVGYIT.IHLRSA
Q9X566_ENTFC/74-162.FALKR.SEKG..........QYLRSPLF.WEVKKFY.PVYYKIGLEALKMMKKYF.---NHSFPTDEAVSIA.LHFVNL
Q8P2S6_STRP8/202-298.PFMLL.SYRNMRL...DSETKSALKQEF.HLIWK...RKEYHIAQDLARELYHNF.---KFHLDDIEVSMVA.MLMLSF
Q8Y5G4_LISMO/189-272.GIIKRSKVTNK........KWTFKIEMY..DIKN...TREFPIMKEMFWGYD..F.---...LSENDLLYLS.LQVLAS
Q831B3_ENTFA/75-163.YALLR.AKEG..........IDIPNPLV.FETRKFY.PKEFEIAKQALAIIAEKL.---GVQFSENEAGFIA.FHIVNA
MTLR_BACSU/315-403.PAVSR.IKEN..........IEIYNPMK.EQIKRDY.FLLYMAIEEGVEKYFP...---GMSFSDDEIAFIV.LHFGSA
Q8EQ40_OCEIH/75-166.FAINR.LEKG..........MAIINPFL.SETKILY.PLEYEIAADIVDFLNQQL.---DINLPDGEIGFIA.LHVHSA
Q8Y3Q0_LISMO/304-394.PAINR.IKFN..........MNIQNPYL.KNLKANY.PLAFELGLVAKEVLEQEL.---KTNVDEAEVGYLA.IHFLYG
Q8Y3P6_LISMO/76-164.YAISR.YKSG..........HQIKNALL.LEIKKFY.PKEFNAAKNSVKTISYYE.---NVKLLEDEAGFIA.LHFVNG
Q8Z139_SALTI/214-299.VAVRR.IREG..........YPLSECVA.EEVD....EKVRHAAHEIAELLQQLA.---DKPLSEPEVSWLK.VHIAAR
Q8Y5G4_LISMO/292-382.PAIYR.TILG..........FQINNPLK.KQFIKEY.TPTFNIVEKASKPFEKLV.---GHKWSEEEIVYLS.MIVLGW
Q7N8X9_PHOLL/179-274.YFLIR.QNKNEH.....SSAIEMDFSLQ.ELIEEKY.FKSYNCAVKLIKYLREKY.---QWKVPDDELIYLV.IHIERV
Q8DQU1_STRR6/75-163.SSIER.YKEG..........VIISNPLR.WEISKYY.KEEFELGKRALQIIKKEL.---GIELPIDEAAFIA.LHFVNA
Q8GGK1_CORGT/74-169.MAVKRNGLEPELT....SKPNPLSAEVH.HLYPEET.RLATEILERTNNWLAEKG.---TPPLPPAEVVAIS.LHLVNA
Q8CXW9_ECOL6/337-428.PLINR.LNYR..........IHIRNPLL.EDIKAEL.ADVWRLTQYVVNQVFKTWG---ENAVSEDEVGYLT.VHFQAA
SACY_BACSU/180-273.FAIQH.IKAGE.......SIYELDAEMI.DIIKEKF.KDAFLCALSIGTFVKKEY.---GFEFPEKELCYIA.MHIQRF
Q8DN39_STRR6/294-384.PAYYR.LKFG..........LPSSNEYV.LHVKEHY.PDLFELVKDSLMPLMDAI.---DNPIPDSETAYFV.IHFGGY
Q928S7_LISIN/286-376.IALER.AKRG..........IVIKNQVT.HIITQQY.SYLLDIAIFIGEKLLERL.---GVILNQEEIILLV.MYLYQY
Q8DXP9_STRA5/203-299.PFILM.AYRKMRL...SPEVQTSLNSDF.SLVWQ...RKEYEIAKELADELEENF.---QLSLDEIEVGLVA.MLMLSF
Q815F4_BACCR/731-820.CMVDR.LQKG.........ESLLPHPDK.EKRRQDE.YWMYMKVKKALQPIENTF.---EIQIPDDEVFYVM.DFFIKN
Q82YX2_ENTFA/282-371.NVMNR.LVFH..........VECHDLFY.GEIERQY.PLAYELAKIGLQELGRLL.---NRCVPTVEFGYLA.LYFELA
LICR_BACSU/306-396.PAISR.NRYG..........MNLRNPML.AAIKEHY.PLAFEAGIIAGIVIKEQT.---GIEIHENEIGYLA.LHFGAA
Q97M18_CLOAB/804-893.FAISR.LKKG.........SHSAEYPDK.EDFIKDN.MKVYSVIKENFVYLYNKY.---LVDFSDNELCYIT.NFFLNS
O07655_ECOLX/92-180.NAISR.VVSG..........IQINNVFL.DEIKALY.KAEYAISRDALTIINEQF.---SVQLPDDEIGFIA.LHILNN
ATXA_BACAN/179-264.ITISR.LLSG..........NTIDNVSG.LILVNKN.DDHYKTVASITSELQNSF.---GVTLHETEISFLA.L...AL
Q8DT02_STRMU/201-288.LAIRR.ITEG.........FHIAKISDK.TELSN...MPEREVARKILKRVTLAT.---QIEFPIEEVDYIT.LHLISK
Q9L8G7_CLOAT/181-275.YFAQR.VVSRKN......AIDEEEKSFL.EIVKTNY.KEAYRCVGKIKSFIEKNY.---DYEVKGGEIVYLT.LHVQRV
P94467_GEOSE/75-163.FAIER.LKQG..........YRIQNKLL.NEIKVLY.KTEYEIGLWAKQLIQERL.---GIEIPDDEAAHIA.LHIHTA
Q8Y9U5_LISMO/320-406.SAINR.LKLG..........MHFKNPYL.SKIKQNF.PQAFEEALYFKAKFEQKY.---DVQVNEDETAYIA.LHFEAY
Q45398_GEOSE/365-457.CLLDR.LLSGERTSGDRGAAKACGHEDE.DGAL.......YRAVKEGLFPLEQQY.---GVCIDEDELCHIV.HFFRSL
Q8DW03_STRMU/207-299.SYQNLGLSER.........EQRDLLSEF.SPIKE...RKEYEIARHLNENLKREF.---HIELDEIETSLIA.VLLLSY
Q8GGK1_CORGT/187-280.YFFVR.VHHDG.......QLNDGMSVLR.NSLEISH.PDSVACAERLSQILSLRL.---GAELSSDEQTYLA.LHVARL
Q8Z139_SALTI/319-409.TMITR.VRYQ..........IMIPNPLL.ENIKQHY.PMAWDMTLAAISSWGKYT.---PYTISENEIGFLV.LHIGVG
Q8EMT4_OCEIH/193-272.LILRR.IRKGFQ.....IQPLSIRYDEL.SNTKE......YQATEEILYDKS....---...LPVPEKLFIT.L...NL
Q81HK0_BACCR/196-284.IALKR.FQSQH........YMKGLHAEQ.SELII...KKEYTIAKQILGDLEKAL.---KFSFPEEEVLYVT.MHLLST
Q8NZC2_STRP8/291-381.PAYYR.LYYD..........INLTNPLK.EQIKQDY.ESLFYLVKRSLSPLEKQL.---GKLVNEDEVAYFT.IHFGRW
Q82ZR7_ENTFA/848-937.CMLERQLLNPE........YDPTAYEVS...YREL..PEAVSVIKMAFRPLEVSY.---NLLIPPLEVRYIYELLFEKA
Q8R5U8_THETN/491-585.ATYER.ILSG..........KPIFNPQL.ENIIREY.PLEYSTAKIMAKEINKEL.---GIELPEEEIGFIA.MYLKTF
Q833J4_ENTFA/458-550RRCIDW.FPEQE........PTTVIDELL.TEVQTKL.ATSYGYAEQLLTLVKRSL.---DIELSQMDRIIVT.IYLHYS
SACT_BACSU/178-271.YAVSR.LESNE.......ALHRMDEEML.YFIQKKY.SFAYQCALELAEFLKNEY.---QLHLPESEAGYIT.LHVQRL
Q82ZT1_ENTFA/281-371.PAYFR.ISYG..........FYLPNVLI.KDIRQSY.RSLYHLCEQALAPLEKLT.---KRSIPSEEIGFFT.ILFGGE
SACT_BACSU/72-160.FAIER.IQNG..........LLVQNKLL.HEIKALY.KKEYEIGLWAIGHVKETL.---GVSLPEDEAGYIA.LHIHTA
Q8NYB1_STAAW/189-277.IAIQR.LNENF........SFDIPINEI.DKWRH...TNQYAIASKMIENLERSC.---NVTFPESEIIFIT.LHLLGS
Q8Y9W7_LISMO/200-285.ILVER.IEFG..........HTLEQFEL.TDVS....EEEILIAAKLATILESLF.---EIEIADADKNYLL.LQIASK
Q8EQ40_OCEIH/183-275.YTIDR.LVEGE........VVQEPKKIA.ELLKTEY.PICYNLSWKLMKIIQQTL.---KKPVYEAEAVYLT.MHLQRL
GLCT_STAEP/183-275.FLIYR.LTKGE........YLEAQENFI.SMIKTMY.PRSFNTAYKILKMIQREF.---SVYVYEAEIVYLT.LHINHF
Q9KG92_BACHD/317-407.PAFYR.IKYG..........LEVENNIA.ESIKTSY.PELFLLTRKVVHYLERYV.---GKSVNDNEVAFIT.MHFVGW
O65990_CLOAT/314-404.QTFHM.LSVG..........LDIINPLL.NEIKEHY.SQLFAIINNECKLIFSRY.---NIKILEEEIGYIT.MHIDVA
Q8ZJY3_SALTY/826-911.CLIER.LIRH..........AGITAWSG.QQCP....EQELNRLREAFSVIESNY.---SVKIPTAELGYIH.NILTFE
Q8EVQ5_MYCPE/307-395.RSYLR.IKYF............LMGSEY.LRIKDEY.KFIFNFVKENISVIEDFL.---GVKIFDDEIGLIS.LYFISD
BGLG_ECOLI/77-164.FAIKR.FQQN..........VLLPNPLL.WDIQRLY.PKEFQLGEEALTIIDKRL.---GVQLPKDEVGFIA.MHLVSA
Q8Y6G6_LISMO/443-531.STIER.VREQ..........KHIIHPDL.NNIRKKY.PKEFQVAIDLSALIEQEL.---SIEIPFDEIGFLT.MFLTEE
Q8P2S6_STRP8/319-409.ALVYR.KAYG..........IFLVNPLT.DHIKEKY.EELFAMTQSCATILEQDW.---TISLTDDDIAYLT.IHLGGE
Q8Y423_LISMO/203-286.FFKER.MKRN..........CYLNEKEE.HEVES......FGIAQEIYQQLQQSE.---NFKINHAEITYLG.KLLLGA
Q837K8_ENTFA/21-107.EMLNR.SREG..........TTLAGVDR.TLFTELT.PETLKIAEETTEAIGQ...---...LSEDEWYVLA.VHFEVA
Q8XP91_CLOPE/31-121.FAIER.LINN..........TPVKNELL.SIIKIKY.PESFKVAEEIGKAINEDF.---SLEVAEDEIGYLA.LHVERI
Q9L8G7_CLOAT/76-164.FAFRR.YSKG..........IKIKNNML.WDIKRIY.KKEYNIGMWAVEYIKGEL.---GIKMDEDEAGFIA.LHIIDA
Q8EN85_OCEIH/210-298.LAMER.LQKGD........IIHFDDEYK.EQIKD...EQEYKIAAEVIGHLEEAF.---SLFIPEDEIGYIT.MHLMGA
Q8EUZ8_MYCPE/315-405.CAYHR.EKIK..........FTFLLENI.PNFIVKY.NNYFLAIKKNIYIVEQLL.---DVKFQDIEIYYIL.LHLISN
Q8Y3Q0_LISMO/201-288.IAVCR.VKDN..........CYVPATDL.EDIEFS..MPELRAAQGIIKEIDLSE.---GIRFPESETAYLL.LHLSSK
LACT_LACCA/182-277.YLIDR.LQRVDT......YAVTIVPEVA.TELKQNY.PQSYKIASEIFDEIKDQL.---YRSMSEDERLYFI.IHIQRL
Q8EN85_OCEIH/320-408.PAVYR.LKQQ..........MNINNPMI.DEIKKDY.IELFEVVDKAIQHVFP...---NLAFPDEEIGYIV.LHFAAT
LICR_BACSU/194-282.IACKR.IRTEN........YVSLFPKDM.DHILH...QKEYQAAEAIVKELESKL.---SVTFPKDETAYIT.MHLLGT
Q45398_GEOSE/8-96.TAINR.LRAG..........TIVSHPKL.NEVRAAY.KQEFAVALDCLQLMEERT.---NIDFPIDEAGFLT.MFFAFH
Q81HK0_BACCR/309-398.TLLNR.LKYK..........LNTRNPLL.AEVKKNY.PYAFEIAVLVGDIIGEYT.---GESIPESEIGYIA.IHFGGA
Q836U6_ENTFA/445-533.STIER.VKEG..........HVIVHPDL.NNVRKNM.KKEFQVALDLSSIIEEEN.---NIEIPFDEIGFIS.MFLSIN

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window