Sequence alignment for CL0166

PF08270

Q8DYW7_STRA5/169-385SEVMIRDFIEYSNFKGCDYDLK----DLSEEYYYFYILVN--LVWKR-..KE-----YKVEIPQTESFNQLKKS--ILYM
Q8DP24_STRR6/181-399PEEDLTEFA...DFFYKITNYP----MRFSIYRMYKLMIA--ISIHR-VKNG-----HFIDLPNHFY.KEYYPL--LKSI
Q8DNN5_STRR6/193-411.SEPLSQLL...ELVYKETSFP----MNLSTHRMLKLLLV--TNLYR-IKFG-----HFMEVDKDSFNDQSLDF--LMQA
Q99XU9_STRP1/179-395.LKNCERLL...SLMIKEVDVR----VNFTLFQHLKILSS--VNLIR-YYKG-----HSAVYDNKKTSQRFSQL--IQSS
Q9A1L0_STRP1/171-383DIETIHAFIFAAQKNLQPS..A----FLDRRFLFFDVLLM--LTWKR-..HR-----YPVHLPHLALFEHLKSL--PIFD
Q9A1S4_STRP1/171-384DKNTIHSFLSHSSTHLKTS..P----WLSESFSFYDILLA--LSWKR-..HQ-----FSVTIPQTRIFQQLKKL--FVYD

PF00874

MANR_BACSU/197-285-TKEIKSL.....QKKHSLYF......TDETFESLLLHTL..LMVRR.IKMKQ.....PISLSPKEM.AAVKK...KKEY
LEVR_BACSU/841-929-LEWLQTV.....QDELGVIF......NNAVLIKVIMHTA..FAFER.VIKQ.......NPIAFSEE.EEINDQL.KEMV
LEVR_BACSU/478-566-KQLKEIA.....EHELDCTF......DRKFIYFLSMHID..AFLKR.GKQI.......DVLNTQET.DEIRDTH.VKEY
MANR_BACSU/307-397-GHLINRV.....SELKMMDFH....KDQDLINGLNIHLN..TVLQR.LSYD.......LSVANPML.NDIKKMY.PYLF
LICT_BACSU/75-163-EEIISYA.....KLQLGKKL......NDSIYVSLTDHIN..FAIQR.NQKG.......LDIKNALL.WETKRLY.KDEF
Q899A8_CLOTE/262-352-EKMVSQF.....EKEVDIALE....NKDEIINGLFVHLM..PAINR.AKYS.......IKIKNSYK.EDIKNSY.NEFY
Q8Y8I4_LISMO/177-264-QNIVKEV.....LAQESITT......NQYSMMNIVLHYA..ISIVR.IQQG........NTLIETQ.KTLIRKH.SKEY
Q8Y8V7_LISMO/481-569-EGVELRI.....EHQLGKKL......NERFLLAFSLHLT..SFIKR.IESN.......KPLKYTNI.ENVVNDQ.PEAY
Q8Y423_LISMO/304-394-EKIIAEF.....ERLACVNFE....DHRNLKKDLLLHLQ..PAYYR.LKFQ.......IEWINPLR.TDIKQSY.SDVY
Q8Y3R0_LISMO/74-162-DDIVKLF.....KMKTAKDI......SDVIYISLSDHLY..FATQR.LQEN.......VVIENPLS.WEVKRFY.QEEY
Q8RCV3_THETN/309-399-EKIIRNV.....SERIKENLL....EDQQLFEGLLDHLR..PTIYR.LKHD.......LKLKNPIL.DEIKTNY.RELF
Q8RCS2_THETN/205-292-KSLCEKI.....KEAVYEEL......PDLNYFGMFVHIL..LSIYR.SKEGK.....AIELDREFI.NDILQ...SEEF
Q8ZL25_SALTY/845-932-EGVFNHL.....TSSLS..LK....PSRQVTLRFLIHCC..CMVER.IVINRK..PLQMALESQPN.LDARA......F
Q8DUF3_STRMU/21-109-LEIIHQG.....QEKLGQTF......DISLYIALADHLH..YTIQR.TREG.......LTLQNPLA.WEVRKFY.PEEF
Q833J4_ENTFA/824-914-EVFLIQL.....EERWQQTI......QNDRKLAVYVHVS..CLIER.LIRN.......EPIENYNGAEQLKQCQ.RTVL
Q8YA62_LISMO/182-267-SELIIAY.....HKKHEFFM......NDFSTISFILHIA..VLIER.ISMG.......SYIERTAL...LEQD..KTSL
Q8EMS7_OCEIH/315-405-MLSLEKI.....EEEMHLGIS....QDTELMISLGMHLK..PAMNR.YKYG.......MNIRNPML.THIKKNY.PLAF
Q9KEK7_BACHD/181-273-SELVYVI.....ETSLELTID....RQHVDYLRLVRHLH..HAIER.IQKGE.....YNDNQERLK.KILKEEY.PVCY
Q8DW03_STRMU/320-410-SYFIDAF.....ELDYHVCFK....HKQLLLNQLLTHCK..ALLFR.KAYG.......IVSNNPLT.DQIKDKY.ADLF
Q8DT02_STRMU/309-395-VMAIEQL.....EPCLKNDF........QFIEGLLAHLS..TMLIR.LEGQ.......INLENPLT.AEIQKNY.QVKY
Q8Y4K2_LISMO/75-163-DDVVQYA.....QETLETDL......SDNIYLTLTDHIN..FAVSR.YNQG.......INLKNALL.WEIKRFY.HAEY
Q8DPP3_STRR6/76-163-YEIIDKL.....SKKYHYPI......QEYLYVTLTDHIY..CSYQA.LTQG........RYKDSNL.PDISAKY.PVAF
Q8Y3R0_LISMO/179-272-QEIISII.....KYHFNIEFD....EESTNYYRFMTHLK..FFCQR.VIIGE.....TIDEMDEFL.YQTVKKSRGVIF
Q8Y9U5_LISMO/212-300-IAIVQEF.....SERHDFTF......TDYAFQSIVIHLA..IAVER.IREG.......EYVENVES.DPMKDVF.ESQR
SACY_BACSU/74-162-EQIISHA.....EKELNIKI......NERIHVAFSDHLS..FAIER.LSNG.......MVIKNPLL.NEIKVLY.PKEF
Q97JD1_CLOAB/187-277-NTIIEFI.....EDELDITID....KHSIDYARFITHLR..FTIER.IINS.......SPIKNELL.NAIKHAY.PESY
Q8ZR51_SALTY/814-903-ETIIAEW.....QSTLGFSF......NNNLIISLYVHLS..CMIERLVMRN.......EITHYKNM.TEFNERH.GEFI
Q8R5U5_THETN/453-538-QDFLNYA.....SKKLQKEF......SDKTLYGLSMHVA..SSIER.ILEG......KDIVNHQLE..HIKKVY.PKEF
Q8DQU1_STRR6/180-274-MGIEKII.....QDFYCTEFN....QDSIDYYRFITHIK..LFAHR.LVENTT...YCDDDDEDLL.ALMKNKY.PREY
Q9KER8_BACHD/51-139-EQIIQHA.....KMAYKKDL......NDIIYVALTDHIN..FAIER.VKKG.......YEIKNALL.WEIRKLY.QDEF
Q8Y9W7_LISMO/305-395-EGLLNRI.....ESHYFYHLQ....DDMQLKKDLVAHIH..SMLYR.VKYH.......MTVKNPMT.EHIKRYY.PLAY
Q8Y8M4_LISMO/286-377-TGICEKM.....GEIYQVDFV...HGDTDFYTQIKAHIK..LMIRR.VRAG.......VIIENPIF.NEFMRDN.REIF
Q837K9_ENTFA/314-404-KQVIESV.....SKELNYPFV....NDRQLFTNLFAHLS..LRFTK.KHLF.......INEYNPFS.EEIKGKH.PALF
Q9KGB4_BACHD/297-387-VDMLRLF.....EKRACIALQ....EKEQLLTKLLLHVN..PAYYR.IKYQ.......LTEMSKTS.TKISEEY.KELH
Q97J80_CLOAB/183-273-QDILNIV.....KYTYNIVLD....EKSISYERFVTHLR..FFFHR.IDKSE....TVDTAEEDFLLKQVREKY.KDAY
BGLG_ECOLI/181-274-REMLQLI.....KFQFSLNYQ....EESLSYQRLVTHLK..FLSWR.ILEHA....SINDSDESLQ.QAVKQNY.PQAW
Q8Y6G6_LISMO/798-887-RKVISEL.....QLQLNVIL......ESGVDIGMILHLA..FLIER.VKLG......AVDREFPDL.NEFAKNH.MVEM
Q8R5U5_THETN/810-901-SSFKQFY.....STLIAKGVK....LNEDITIGLILHIA..CVIER.IIEG......KELTHVKNT.QQYIRDY.PKEF
Q839Y1_ENTFA/489-580-KKIYNFA.....AKRLSYSF......QPNFIYAMSLHIS..SFLKR.IQLGK....DPKHPLNESI.RNMVLDY.PTEF
Q9CJH3_LACLA/288-375-RQLIDKV.....STILEIEFG....KDDRLYGLLYAHLK..ESEMLPVLFP........KKENDFI.KKINKDN.PEIY
Q8DUF3_STRMU/123-220-SKIVSDI.....LEIVRLHFGEVRDEESISYNRFITHVQ..YFAQR.VANGL....VQGKNDAFLY.EQVKENY.PHAF
Q8DXP9_STRA5/320-410-TSFLKEL.....EERYHLHFV....HKKDLLRQLLTHCK..ALLYR.KRYG.......IFSVNPLT.EHIKDKY.EELF
Q9KF98_BACHD/18-111-TERASLI.....AERTVEQFVT..DENADSYTMLITHLA..MAVTR.IDRL.......EPLSPPPE.SIMKEIYESRDL
Q815F4_BACCR/376-464-EKIAELA.....EKHLSKTF......DEKVFLALSLHVQ..TTLQR.LQSG.......KQIHHPQL.NQIRTKY.KEAF
Q8Y3P6_LISMO/181-274-KKVLLIL.....EDTLSIKLD....EESLNYLRFITHLR..FFIER.INSEG....AREKEEPDMI.EQVFKLY.PKAY
ATXA_BACAN/292-383-KEITKGI.....EHKLQLGIN....YDESFLTYVVLIIK..KALDKNFIQY.......YNYNIKFI.RHIKQRH.PNTF
Q819D4_BACCR/184-276-AQLVSLI.....ETNLQITLD....QESIHYLRLIRHLQ..YAIER.VKKGE.....KVEESQSFA.DLLKAEY.PACY
Q97JD1_CLOAB/82-170-EEIISMI.....SKELNENL......NEKIHISLTDHIS..FTLKR.LLSN.......DTIQNPFL.IETATLY.KTEF
Q9KEK7_BACHD/76-164-NDAIERI.....EERFQVRL......HEHIHVALTDHLF..YAIKR.INQG.......FDIKNPFL.TETELAY.PKEF
Q8RD56_THETN/836-925-EKAISDL.....ERFIGIRF......SNDLKISLYIHVS..VMVER.LVMK......EPITSYSNL.EEFEQCH.RQFI
Q8Y5C7_LISMO/300-390-DFYIEQV.....AAKINMPI.....NKKQLKIELLSHMK..PMVNR.MNHQ.......INIKNNLL.SDIKLEY.GKLF
Q82ZR7_ENTFA/475-563-QEAIVFF.....EQLIQEKL......TEDFQNILIVHLY..SAVFYSAQMN.......ETFYSDTK.NIYSGK..VTQY
Q8RCV3_THETN/200-288-EQCVQIA.....ERELETIF......SDAAFSGLVIHIA..IAIKR.IQLG......KDIVMPKEE.LKALEM..TKEF
Q7N8X9_PHOLL/73-161-EKIIALG.....KDLLGKSL......NDSLLITLSEHLN..FAFER.VSKG.......YQIGNVLQ.WEIPHLY.PLEY
Q8RGT2_FUSNN/287-377-NKIVRTF.....EIKIKVDLK....NIDIFLDEIFYYIK..PLIFR.TKKR.......IKLKNSIL.KDVKKLY.PSIF
Q8RD56_THETN/473-563-ENVLNIM.....QNMYGIKYY...GNSVLVLSHFINYLL..SDVTY.EKYS........ESIESAL.EILKNIF.PKEF
Q8E0E5_STRA5/176-273-TEIVSYI.....EQKVKIDFRTELDESSIDYYRFMTHTK..LFAQR.VLSGM....KYEDDDADLL.LVVKKKY.PREY
Q8DR86_STRR6/201-287-ARIVLDE.....CQEANLKL......SDFVLQNLVVHIA..LSVIR.LKSGF....EIKNIDCQMT.DDAIE......R
Q9KER8_BACHD/156-249-KHILKIV.....KYHFNTDLD....EDSLNYFRFITHLK..FFCQR.LINRT....FLSSDDDTFF.DIVKEKH.KDSF
Q8RCS2_THETN/313-403-KEVVEEV.....SRIFNVNIR....CDEQLLLGLAQHLE..PAFYR.LRMG.......LVTSNPLI.EEIKSYY.KDLF
Q899A8_CLOTE/149-237-WELLIDT.....LKAINISV......SDMAFYNIIINTC..IMIKR.IQQDF.....IADIEYEKM.DYISE...TFEY
GLCT_STACT/77-168-QTIIEAM.....DIITHADRT...VVDKDLMVALTDHIL..FAYKR.IKQH.......QFIKNPFL.IETKQLY.SESY
Q9K679_BACHD/208-296-QEVLADF.....RKQMVEPM......ADRAYIGLIVHLT..LAIER.IRQGE.....KIEIDPSYL.SKLKM...DKEF
Q9KG18_BACHD/180-273-HDLLNIV.....RYHFKMEYD....EDSLTFFRFVTHLK..FFAQR.LLSGT....SLNSKDDFLL.QIVKENH.SEAY
Q8DR86_STRR6/305-398-KSLLKTFQNLGLDDMYNFSS......DFQLIEGLITHLM..TLQVR.LESR.......ITLNNPLV.DEIKQNY.SDIF
Q82Z58_ENTFA/336-426-ENVTKNI.....EKRFDLTL......SGKMKFNLMMHNA..LMVERTMLGVE.....DYEIPANLE.ELTINQ..KPFF
Q8XP92_CLOPE/83-168-EELILEI.....SRDFSDEL......NEIIHIGLIDHIS..FAIER.MKKG.......EILRNPFL.VEIETLY.PKEF
LICT_BACSU/180-273-QEILSIV.....KYHFKIEFN....EESLHYYRFVTHLK..FFAQR.LFNGT....HMESQDDFLL.DTVKEKY.HRAY
Q8RC49_THETN/207-295-EKAILRL.....KQQIDYEI......VESSYMALVVHLA..LAIKR.LQEGE.....TIQIGEETL.EDLKK...TEEY
Q819D4_BACCR/79-167-NDIMLYI.....QGKAKSPL......NEHIHIALTDHIS..FAIKK.LKQG.......LTIDNPFL.VETKMLY.PKEY
Q8Y4K2_LISMO/181-274-QDILSIV.....TYHYGMVLD....ETSLNYTRFITHLQ..YFAQR.LLRKE....IVDSGDDFLY.EQVQIKY.PEAF
Q9K679_BACHD/318-405-KALIHEV.....EKSLHVQF.....QDPSLFQGLVAHLK..PALYR.IREK.......MKIYNPLL.EKIKQDY.EELF
Q8Y9A2_LISMO/298-387-NSLITSM.....SEELNLPFL....EDAILYKGLLNHVA..PLIER.VRGN.......VQIYEDTF.DVIPTEF.LYIL
Q8YA62_LISMO/284-374-TRLLEAV.....DQNFHIDFS....ADEKIATYLVAHIS..ALYKR.ANHK.......QYLTNPLT.EELKNKF.PFIY
GLCT_BACSU/184-276-AQLVEVI.....EDSFQMKVN....KESVNYLRLIRHIR..FTIER.IKKEE.....PTKEPEKLM.LLLKNEY.PLCY
Q8DNA0_STRR6/319-409-EEFIWYF.....ESQIRMEIE....NKDDLLRNLMIHCK..SLLFR.KTYG.......IFSKNPLT.KQIRSKY.GELF
Q8DPP3_STRR6/182-276-LRNVEEV.....LKGYAIQRT...KKNNHFYDRFMIHLN..YFLDY.LDRSR....DDNQSLLDME.DHIKQSY.PKAF
Q8DNA0_STRR6/206-298-KEQVPLV.....EQDLGKKINH..HEITFMLQVLPYLLL..SCHNV.EQYQE.....RHQDIEKEF.SLIRK...RIEY
GLCT_STACT/185-277-NKSILIM.....EHDLKYKID....TNSIQYQRFIRHIQ..FLIRR.LQKGE.....IIQVNDEFG.NMLKAHY.PLCY
Q9KG92_BACHD/206-294-YDVISES.....EKVLKIQY......TDDVLHSLSLRFL..LFMKR.VAKGK.....FIKVHPLEK.QVLKG...TKEY
Q8Y8I4_LISMO/290-379-KIVLANV.....EETYLIDL.....QNEQLFIKLAIHVQ..SLYYR.SRYK.......AYTRNLSL.LDIKTSY.PVTF
Q8E206_STRA5/297-386-KAIVDEM.....ETVSLLNFS....NKEELLQGLKRHII..PAYFR.LKYG.......LTGDSGYT.QNIKEHY.SDLF
Q838N2_ENTFA/307-396-KQLIEAV.....SQETEVNFF....EDTNLYKMLLTHLS..GVFSR.AVLQ......EEDLTNPIL.ERIMNQY.QEIA
Q97M18_CLOAB/444-532-DKIIYQI.....VTSLRKNI......NNNVYTALALHIN..TLITR.INSN.......KTIINPEL.RKIKSLY.PTEY
Q839Y1_ENTFA/855-947-IDLLWSF.....AKNIQTQLAM..PEEYTFYINLIMHTS..GMLER.ILRND.....TLTVSEKEL.GRLVQ...EPIY
Q8Y5C7_LISMO/189-278-VRQMELI.....ENKLMISI......PYPYDINIFSHLY..ILINR.FRQGE.....VEDFKESDD.DYIVTN..EKLH
Q8EVW2_MYCPE/302-392-YKMLSEI.....EKNHYIFFF....EKDKLVTDLINHLI..PAYYR.AKFN.......LNVNVEYL.NIVKEKY.KKFF
Q836U6_ENTFA/806-895-QKTVHQI.....QTDMHIIV......EPGVDAGIMIHLA..FLVDA.LIKG......EETRNFPNL.AEYVKTH.RLEI
Q834W3_ENTFA/73-161-EEIIQHA.....ETVLGEKL......NEHINIGLSDHIA..FAAEN.IQNN.......IIVRNKLL.SEIEILY.SEEF
Q8RC49_THETN/314-404-EEIIKEA.....SKVFEVDFS....EDKLLEEGLQSHLA..PALYR.LEMG.......LDIRNPLL.GDIKAKY.PVLF
Q8Y9M5_LISMO/298-388-LTCLDLF.....EKKALVSLK....NKHILIEKLLLHLK..PAYYR.IKYQ.......MNLEDTLY.EKFNQEF.EALN
Q8EMS7_OCEIH/198-289-KNIIIQQ.....LDSHQMTL......SDIAIHNLFIHIA..IAVLR.IRDGHP..IDFNAAHREEM.QDMKD...TKAY
Q8EMT4_OCEIH/296-386-DKMVRLF.....EKNACIIFQ....DREQLIDKLLQHLT..PAYYR.IKYK.......LTDAIVFE.STYNEEF.EQIR
Q834W3_ENTFA/179-273-SEIIHLI.....EQELAIDIHD..DKNSLSYSRLVNHLR..LFIHR.FQQNQ.....YAVLDEEIL.EVVKKKY.AESY
Q8Y410_LISMO/298-388-EQVLSEF.....EKKACIQLV....DKESLLEKLFAHIK..PAYYR.IKYH.......LTTDYSIL.DKIDQEF.QAVH
Q8G3W9_BIFLO/181-274-QQLLDII.....DHSYGITLD....RGSVNVGRFITHLR..YLFVR.IHQHQ....QLTDEPAPVM.KVIRESY.PAAL
GLCT_BACSU/79-167-NDVIYHI.....SNRTNHSL......NEHIHIALTDHIA..FAIKR.QQQG.......FDMKNPFL.METQSLY.PEEY
Q8G3W9_BIFLO/75-163-VESMQET.....GLGERETG......STTLVMALSDHVA..NAVER.VRRG.......IDITYPLL.GEVSNLY.PQEY
Q831B3_ENTFA/181-274-RDILTII.....SRYFGQVFD....EDSLNYQRIVTHLQ..YFAQR.YLKQE....AHDEEDEFLF.ALVQGKY.PKAF
Q97J80_CLOAB/75-163-YDIIEYA.....KNVLDAKL......NDHIYVTLTDHVS..NCFKM.IESG.......IIIHNPLI.WEIKKFY.PKEF
Q8EL15_OCEIH/294-380-LYLIQEI.....SKILEVNLA....SDKKLMNDLMYHAK..SAFLR.MEQG.......AEIDNPYT.EEIKIRY.RAIY
Q9KG18_BACHD/75-163-EEIISYA.....KEKLAKDL......NDSIYISLTDHIN..FALER.FQNG.......ITISHGLL.WELRRLY.KEEF
Q8Y8V7_LISMO/846-932-SSFASVL.....EKKLGYKL......DNTFKINLLIHVG..CALER.MVLN.......DGLIYREP.KDMLE...TNIF
Q97LJ1_CLOAB/181-271-GKVMEFI.....SSALNKDID....KSSLAYERTVTHIN..FVLDR.IKNK.......KTIKNLLL.DSIKKQL.YNEY
Q97LJ1_CLOAB/76-164-EEIIFLC.....ENELGIKL......NEAIHTSLPDHID..FAFTR.IKKG.......IKIENPFL.NEIVALY.PKEY
MTLR_BACSU/205-293-ERILFQL.....KEKIAFSL......SDSSYIALVVHLT..YAIER.IKLGE.....TITMEQNEL.EELMN...AKEY
Q8Y5G4_LISMO/189-272-KKRLEKV.....ESKLQITF......TDEQMEELPYILH..GIIKRSKVTNK.....KWTFKIEMY..DIKN...TREF
Q831B3_ENTFA/75-163-KQIVDLA.....ETTLAIEL......SSNIYLTLTDHIH..YALLR.AKEG.......IDIPNPLV.FETRKFY.PKEF
MTLR_BACSU/315-403-KRLIAFI.....SDKIRMDLT....KNYSLYEGLIAHLE..PAVSR.IKEN.......IEIYNPMK.EQIKRDY.FLLY
Q8EQ40_OCEIH/75-166-QKIIDSIN..MIQKRSSEIL......NEKVHVALTDHLL..FAINR.LEKG.......MAIINPFL.SETKILY.PLEY
Q8Y3Q0_LISMO/304-394-DKMLAKI.....KELYGYDFK....QDQKMISNIALHLK..PAINR.IKFN.......MNIQNPYL.KNLKANY.PLAF
Q8Y3P6_LISMO/76-164-NKIIKDA.....ESELNVTF......DELTYLGLADHIN..YAISR.YKSG.......HQIKNALL.LEIKKFY.PKEF
Q8Y5G4_LISMO/292-382-DEFIRLL.....EMYFATEIM....KKNEFKEKVILHVR..PAIYR.TILG.......FQINNPLK.KQFIKEY.TPTF
Q7N8X9_PHOLL/179-274-NKTVKLI.....HYYFHVNLD....TTSVNYSRFITHLR..YFLIR.QNKNEH..SSAIEMDFSLQ.ELIEEKY.FKSY
Q8DQU1_STRR6/75-163-EKIINLG.....KITLGNNF......DEIIYINLTDHIS..SSIER.YKEG.......VIISNPLR.WEISKYY.KEEF
SACY_BACSU/180-273-RDIIEII.....EIQLSINIV....EDTISYERLVTHLR..FAIQH.IKAGE....SIYELDAEMI.DIIKEKF.KDAF
Q8DN39_STRR6/294-384-EAIISRM.....EDISLLHFK....QREGLRENLRRHLI..PAYYR.LKFG.......LPSSNEYV.LHVKEHY.PDLF
Q8DXP9_STRA5/203-299-LDYFHHY.....LFISQRSLG...KKINSQDGQFMIQIL..PFILM.AYRKMRLSPEVQTSLNSDF.SLVWQ...RKEY
Q815F4_BACCR/731-820-RYALNTI.....QELISLQL......TPDSLMGVILHMS..CMVDR.LQKG......ESLLPHPDK.EKRRQDE.YWMY
Q82YX2_ENTFA/282-371-QKMMKKI.....HHSVVVEF.....DEDFLFSEMKDHLR..NVMNR.LVFH.......VECHDLFY.GEIERQY.PLAY
LICR_BACSU/306-396-LAMIKAV.....DRELKLGIL....HDKELKIGLALHMK..PAISR.NRYG.......MNLRNPML.AAIKEHY.PLAF
Q97M18_CLOAB/804-893-YRFVKRV.....EFKLKLKV......DDEVFIGLVLHIA..FAISR.LKKG......SHSAEYPDK.EDFIKDN.MKVY
ATXA_BACAN/179-264-TDLINKM.....EKILNVQM......YTYSKHKLCVLFA..ITISR.LLSG.......NTIDNVSG.LILVNKN.DDHY
Q8DT02_STRMU/201-288-TIIVLDE.....CREGHLKL......SDFVIQNLVIHIA..LAIRR.ITEG......FHIAKISDK.TELSN...MPER
Q8Y9U5_LISMO/320-406-ADFVSRC.....LAEGN..Y......DKGLLEDLTTHMK..SAINR.LKLG.......MHFKNPYL.SKIKQNF.PQAF
Q8DW03_STRMU/207-299-RGELQVS.....QALLGKKINS..QDIRFMVATLPYQLL..SYQNLGLSER......EQRDLLSEF.SPIKE...RKEY
Q81HK0_BACCR/196-284-RSIILKY.....IEGGTIYL......SDIEIDNLVIHIA..IALKR.FQSQH.....YMKGLHAEQ.SELII...KKEY
Q82ZR7_ENTFA/848-937-AKIYSDI.....CLQTKIKS......DEKILLRFIIHCA..CMLERQLLNPE.....YDPTAYEVS...YREL..PEAV
Q8R5U8_THETN/491-585-EKIVNAV.....EKAYEIARRSFKNLEDNLFYSLAIHLS..ATYER.ILSG.......KPIFNPQL.ENIIREY.PLEY
Q833J4_ENTFA/458-550-RQLLETI.....ESSYQIRF......NGSLVYALSTYLFQRRCIDW.FPEQE.....PTTVIDELL.TEVQTKL.ATSY
SACT_BACSU/178-271-KEMIEKI.....KQYFNRKVD....ENSISYQRLVTHLR..YAVSR.LESNE....ALHRMDEEML.YFIQKKY.SFAY
Q82ZT1_ENTFA/281-371-GEIIRKM.....ELLAVVQFE....QPRELLMNVYYHLV..PAYFR.ISYG.......FYLPNVLI.KDIRQSY.RSLY
SACT_BACSU/72-160-EDIISYA.....EGELAAPL......SDHIHIALSDHLS..FAIER.IQNG.......LLVQNKLL.HEIKALY.KKEY
Q8Y9W7_LISMO/200-285-MTAVTDY.....FFATNIRF......TDEALQNLLLHMM..ILVER.IEFG.......HTLEQFEL.TDVS....EEEI
Q8EQ40_OCEIH/183-275-TQLINII.....ETKLSIKID....RAGIEYIRLVRHIR..YTIDR.LVEGE.....VVQEPKKIA.ELLKTEY.PICY
Q9KG92_BACHD/317-407-TSMVNDF.....QKYACVVFE....EKELLEKNLFFHIK..PAFYR.IKYG.......LEVENNIA.ESIKTSY.PELF
Q8ZJY3_SALTY/826-911-EQFLLRY.....EHLAGVTV......SNERKVALYVHIS..CLIER.LIRH.......AGITAWSG.QQCP....EQEL
Q8EVQ5_MYCPE/307-395-DTFLKNI.....KANNSIQYN....QEKKLKANIVDHIL..RSYLR.IKYF.........LMGSEY.LRIKDEY.KFIF
BGLG_ECOLI/77-164-DRIISLA.....QERLG.KL......QDSIYISLTDHCQ..FAIKR.FQQN.......VLLPNPLL.WDIQRLY.PKEF
Q8Y6G6_LISMO/443-531-EKVYAMA.....EEKLNRKY......NEKMKFAFSLHLQ..STIER.VREQ.......KHIIHPDL.NNIRKKY.PKEF
Q8Y423_LISMO/203-286-FEILAVT.....EKKIGIRY......TDEVIERIGIMIF..FFKER.MKRN.......CYLNEKEE.HEVES......F
Q837K8_ENTFA/21-107-QSIIKQT....SARLAEAQIE....PTELQWTILINHLN..EMLNR.SREG.......TTLAGVDR.TLFTELT.PETL
Q8XP91_CLOPE/31-121-NTAVEYI.....EDAFNIEVD....RTSLSYARFISHLR..FAIER.LINN.......TPVKNELL.SIIKIKY.PESF
Q8EN85_OCEIH/210-298-EEQIQRM.....RNQLPYDL......ADSAYIGLVVHIA..LAMER.LQKGD.....IIHFDDEYK.EQIKD...EQEY
Q8EUZ8_MYCPE/315-405-EKLIEKF.....EQETFVYLN....NKNMVIEDLTKHIA..CAYHR.EKIK.......FTFLLENI.PNFIVKY.NNYF
Q8Y3Q0_LISMO/201-288-EQIVVSN.....IAKYNIHM......TDISVKNLIIHIA..IAVCR.VKDN.......CYVPATDL.EDIEFS..MPEL
Q8EN85_OCEIH/320-408-KELIRSV.....SNEMNIDVT....HNNRFLNDLTTHLK..PAVYR.LKQQ.......MNINNPMI.DEIKKDY.IELF
LICR_BACSU/194-282-RSAILKK.....MKNDRIPL......SNMGLNNLIIHIA..IACKR.IRTEN.....YVSLFPKDM.DHILH...QKEY
Q81HK0_BACCR/309-398-HILFKVA.....EERNLIFY.....YDEELLFGFGIHLK..TLLNR.LKYK.......LNTRNPLL.AEVKKNY.PYAF
Q836U6_ENTFA/445-533-NRLYDIA.....EERLEHTY......NETARFAFALHLQ..STIER.VKEG.......HVIVHPDL.NNVRKNM.KKEF
E0SGT2_DICD3/223-315-QEILNIV.....KYQLNLDYN....EQAFSYHRFVTHLK..FFAQR.LLGRT....PVFSEDESLH.DVVKEKY.TLAY
I6L8Y6_STRMU/282-369-QSFVKKV.....KDTLLVNF.....DEQRLFAEIQTHLK..FLINR.LIFH.......VQANDIFH.REIQNKY.PLAF
CSIE_ECOLI/131-216-.ALVNLC.....SRRLQKRF......ESRDIHFLCLYLQ..YCLLQ.HHAG.......ITPQFNPL.QRRWAES.CLEF
Q033J9_LACC3/77-163-.EIIDVA.....QKQYRLKV......LDYIYITLSDHIY..EAYKR.YQAG........TYQETMV.PDFHIQY.PAEY
Q2FUX1_STAA8/285-374-.RLIELM.....QQRIHVPFN....EDSILQQNLYNHFS..KAYLR.ITQN.......IYLNNPLV.IEIKKLY.PFVF
Q2FW98_STAA8/208-294-..LLMDY.....LSALPYQL......TESSYLTLTVHIV..LSISR.IKNGE.....SVALNDDIY.DSVQN...TFEH
Q2FW98_STAA8/315-401-.AFVNKV.....EMISGMTFA....DLDTLVDGLTLHLN..PAINR.LQAN.......IETYNPLT.DMIKFKY.PRLF
Q2G142_STAA8/300-388-.ELITCV.....SQELGIDMS....KDNKLHTSLITHIK..PAIHR.IKYD.......MLQPNPLR.QEVMRRY.PQII
Q2G2B8_STAA8/300-388-.QMIHHF.....EQITFINIE....DKEKLSQQLLLHLT..PAFYR.IKYN.......LTDRDELI.NPLQGNY.QSLF
GLCT_STAA8/187-275-...IDII.....ESDLVTTVD....KESLQYQRFIRHVQ..FLIRR.LRRKE.....YIHAQDDFV.SMIKNHY.PICY
Q5HKT3_STAEQ/285-373-.RLIELM.....EQHIGFPFS....QDTILKDNMNVHFS..RTYLR.LMSH.......VYLNNPLT.SQIKRLY.PFVF
GLCT_STAEQ/83-165-.....II.....NESGLITD......DKNLVVALTDHII..YAYKR.LKQH.......QMITNPFV.IETKHLY.SNAY
Q5KUA6_GEOKA/74-162-EEIISYA.....EGKLQAPL......SDHIHIALTDHLS..FAIER.LKQG.......YRIQNKLL.NEIKVLY.KAEY
Q7D470_CLOAB/183-274-..ILNII.....KYFFSIEFN....EDDMSYDRLLTHLK..YFAQR.VVSRKN...AIDEEEKSFL.EIVKTNY.KEAY
Q8ZK41_SALTY/195-278-.SLLPDI.....FSHCQIRL......TDEGELFLRLYCA..VAVRR.IREG.......YPLSECVA.EEVDE....KVR
Q8ZN36_SALTY/131-216-.ALINLC.....ARRLQKPF......EHRDVQFLRLFLQ..YCLLQ.HHAG.......ITPEFNPV.QQIWAQS.CAEY
Q97MN8_CLOAB/203-290-.DIVKEI.....FKKLHFGST...NVNDIKYFSLFLLTL..LAIKK.TESKK.....NINLPNKVK.QDMKS...SIIY
Q99XZ1_STRP1/291-380-EEIINSV.....AVNTGLSIT....DTPELRQNLYSHLL..PAYYR.LYYD.......INLTNPLK.EQIKQDY.ESLF
Q99Z99_STRP1/308-396-.ACIAKI.....SQLTGMTLE....TDTNLFQGLLAHMM..PLTIR.LENH.......IQLTNPLT.EEIKSQY.PEIF
Q9A0X5_STRP1/75-163-ERIINLG.....KIKLGKTL......DEILYINLTDHIH..SAIER.HEQG.......MLIHNPLR.WEIQRYY.PDEY
Q9A1N2_STRP1/321-408-..FIDQL.....ESRYQLHFT....HKQDLLKRLTTHCK..ALVYR.KAYG.......IFLVNPLT.DHVKEKY.EELF

PF08270

Q8DYW7_STRA5/169-385ELSKAAQKSIAIHL-GIELNEGLLDYLYLVFCISDGPLF.SNRDDININEEFIFASYKISKSKAFKNFCGRLLGREFIDS
Q8DP24_STRR6/181-399PNFQETLAYFSKHF-GLEMTPDTIAQIFISFLQNDIFLDPQEFFNSLEDNSQARYSYQLLS..QILEGLSKQYKITFTNH
Q8DNN5_STRR6/193-411EGIEGVAQSFESEY-NISLDEEVVCQLFVSYFQKMFFIDESLFMKCVKKDSYVEKSYHLLS..DFIDQISVKYQIEIENK
Q99XU9_STRP1/179-395LEFQDLSRLFHLKF-GLYLDETTIAEMFSNHVNDQLEIG.YAF..DSIKQDSPTGCRKVTNWVHLLDELEIRLNLSVTNK
Q9A1L0_STRP1/171-383NIKTIAVDELAPRT-RVTFSSDDFDYLFLIYLTTDNSFL.SGYWTSHQRQQLYHLITKDPDYHLLIHRLQALVGKYSDIH
Q9A1S4_STRP1/171-384SLKKSSHDIIETYC-QLNFSAGDLDYLYLIYITANNSFA.SLQWTPEHIRQYCQLFEENDTFRLLLNPIITLLPNLKEQK

PF00874

MANR_BACSU/197-285QWTFACLQRLEPVF.AIRFPEEEAVYLT.LHILGG---------------------------------------------
LEVR_BACSU/841-929YVTERTLAPYEEKL.GLRISDDEKLFIA.AIFAEE---------------------------------------------
LEVR_BACSU/478-566RVAMIFKDKIQEYF.KVAIPEIEVIYLT.MLIHSI---------------------------------------------
MANR_BACSU/307-397HLIIDVLEDINQTF.DLHIPEEEAAYLT.LHFQAA---------------------------------------------
LICT_BACSU/75-163AIGKEALVMVKNKT.GVSLPEDEAGFIA.LHIVNA---------------------------------------------
Q899A8_CLOTE/262-352TITANLVRIINNEF.NVELGSDEISYVC.LHFVAA---------------------------------------------
Q8Y8I4_LISMO/177-264EISKKIAKILSEEY.QIHFSEAETKQLG.LLYVGL---------------------------------------------
Q8Y8V7_LISMO/481-569ELSREIKDDIEATF.HIRVPNMEVMYLT.LLISSL---------------------------------------------
Q8Y423_LISMO/304-394EITKKSLEPLEDLL.GEAIPEDEIAYVT.ILFGGY---------------------------------------------
Q8Y3R0_LISMO/74-162AVAKEAAKMVESKL.EIELPDAEISNIA.LHFVNA---------------------------------------------
Q8RCV3_THETN/309-399EIVRESLKPIEEYT.GRNLNEEEIGYFV.IHFGAA---------------------------------------------
Q8RCS2_THETN/205-292NFMKKVEKILEEE..DFYLPESEIAYLA.IHLSPK---------------------------------------------
Q8ZL25_SALTY/845-932SVIKSAFLPIEDAY.AIRLSDAEYFYIY.E.LLYS---------------------------------------------
Q8DUF3_STRMU/21-109QLGKDTIELVKEKM.TLQLADDEAASIA.LHFINA---------------------------------------------
Q833J4_ENTFA/824-914QELKEAFSVIEKVY.SVNIPESELFYVYDVLFGKT---------------------------------------------
Q8YA62_LISMO/182-267EMAAHLAETLEKEL.QINIPTQELSYIA.RLYSGK---------------------------------------------
Q8EMS7_OCEIH/315-405QAAVYAGVVIEEKT.DITIDENEIGYLA.LHIGAA---------------------------------------------
Q9KEK7_BACHD/181-273NLSYKLIKIMQQSL.KKAIPDAEAVYLT.LHLQRL---------------------------------------------
Q8DW03_STRMU/320-410AMTKVCLSILENAW.SIKMNDDDIAYIT.IHIGGE---------------------------------------------
Q8DT02_STRMU/309-395QLAQKLMHSMPIFS.PFSFSADEIAYIA.LHFMAA---------------------------------------------
Q8Y4K2_LISMO/75-163LVGMKALDFIEQEV.GIRLDEDEAGFIA.LHIVNA---------------------------------------------
Q8DPP3_STRR6/76-163QIANEAFEIYRQKL.ADHFPEDEIIRIA.YHFINA---------------------------------------------
Q8Y3R0_LISMO/179-272DCIDKIGVFLEKNY.QFTMSHSEQFYLA.LHIERL---------------------------------------------
Q8Y9U5_LISMO/212-300NNTEILVGMLEERL.DIKIPAFEVGYIQ.LHLTAA---------------------------------------------
SACY_BACSU/74-162QIGLWARALIKDKL.GIHIPDDEIGNIA.MHIHTA---------------------------------------------
Q97JD1_CLOAB/187-277KLSSKICKLLEDEL.HKKVVEDETAYLV.MHIERI---------------------------------------------
Q8ZR51_SALTY/814-903AMVNHSFQRLKILY.NVALPVAEIGYIH.DIFELR---------------------------------------------
Q8R5U5_THETN/453-538EIAKVLKEEIQREF.NIVVPEDEVGFIT.M...FL---------------------------------------------
Q8DQU1_STRR6/180-274ECGEQVAMFIQTEY.NYLLTSSELVYLM.AHIRRL---------------------------------------------
Q9KER8_BACHD/51-139AIGQHAIEIIEKKL.GITLSEDEAAFIA.LHIVNA---------------------------------------------
Q8Y9W7_LISMO/305-395EITLDAVESLKKDY.PYDINQNELAYLA.LHIGAS---------------------------------------------
Q8Y8M4_LISMO/286-377MRVKESLEALKPLL.PISVSSQEISFLA.IYFASE---------------------------------------------
Q837K9_ENTFA/314-404LAIQSACKQLIQRS.VLLVNDSFCAYIA.LHFLAA---------------------------------------------
Q9KGB4_BACHD/297-387HLVKQSMKPLETLI.GVEIPENESSYLT.LLIGGW---------------------------------------------
Q97J80_CLOAB/183-273QCMLKVQKYLGKE.....LSDEEKLYLT.VHIQRV---------------------------------------------
BGLG_ECOLI/181-274QCAERIAIFIGLQY.QRKISPAEIMFLA.INIERV---------------------------------------------
Q8Y6G6_LISMO/798-887QITQQMMENVEIEY.DIVIPQSEIAYLT.QMMLSN---------------------------------------------
Q8R5U5_THETN/810-901ETIRKTVKILEEGC.DISISDEECVNIM.KIIYSI---------------------------------------------
Q839Y1_ENTFA/489-580ETAKEIKNIIESSY.QMEIPESESYYLA.VLLISL---------------------------------------------
Q9CJH3_LACLA/288-375KTVKESLREVF....DKNFSEMEIAFIS.LHFVAT---------------------------------------------
Q8DUF3_STRMU/123-220ACTEKIKSYVESAY.NFAMSRDEQVYLT.IHIQRL---------------------------------------------
Q8DXP9_STRA5/320-410AITSSSVKLLEKAW.QIKLTDDDVAYLT.IHLGGE---------------------------------------------
Q9KF98_BACHD/18-111EEAKRRVAWIEETM.GDTLPQEEKEFLI.MHFVSA---------------------------------------------
Q815F4_BACCR/376-464SVAMQCIQLLEEEL.QITMPIDEAGFLT.MFFVVD---------------------------------------------
Q8Y3P6_LISMO/181-274ASVQIISDYIQETL.NCTVYAEELMYLT.LHVQRL---------------------------------------------
ATXA_BACAN/292-383NTIQECISNLNYTV.YSHFDCYEISLLT.MHFETQ---------------------------------------------
Q819D4_BACCR/184-276NLAWKLVKVMQKEL.QLPVYEAESIYLT.MHLQRL---------------------------------------------
Q97JD1_CLOAB/82-170ELAKKAVKMLEEKT.NIEIPEDEVGFIA.LHIHSA---------------------------------------------
Q9KEK7_BACHD/76-164DVATEIIQALEAAF.HISIPPGEIGFVA.LHIHSA---------------------------------------------
Q8RD56_THETN/836-925NFVKSAFSVIEETY.KVEIPTTEIGFIY.DLIKDR---------------------------------------------
Q8Y5C7_LISMO/300-390EIIKETARDAAKTFELNTISDDEVGYIT.IYFAKH---------------------------------------------
Q82ZR7_ENTFA/475-563QAAKTMVDFLQTLF.GISFADTEILFFD.LFIRKV---------------------------------------------
Q8RCV3_THETN/200-288AVASNIAKMLEDRF.NVSIPVDEIGYIT.IHLLGS---------------------------------------------
Q7N8X9_PHOLL/73-161EVGKQALIYINGQI.EKPLPPIEASLIA.LHFVNA---------------------------------------------
Q8RGT2_FUSNN/287-377NFLKKNFYFLEEVI.NEKVSDEEIAYLV.PFFHKA---------------------------------------------
Q8RD56_THETN/473-563IIANKMADLIEVNL.DIKLNKIAVAYFT.LYVRSL---------------------------------------------
Q8E0E5_STRA5/176-273KCVKEIGNNMAIQY.QYQLNSSELLYLT.VHVKRL---------------------------------------------
Q8DR86_STRR6/201-287KVAQRILSKVREVT.NQEFPVQEIDYIT.LHLLAK---------------------------------------------
Q9KER8_BACHD/156-249ACTEKIKEYIKKQY.DYELTNEEMLYLT.IHIDRV---------------------------------------------
Q8RCS2_THETN/313-403SAVERACKIVFSKY.NIIVPEEEIGYIT.MHIGAA---------------------------------------------
Q899A8_CLOTE/149-237DEAKNYCNELSKRY.NIIIPKTEIIWIS.MHFLGA---------------------------------------------
GLCT_STACT/77-168QIAVSVIEHLNKLL.DIEFPEDEIGFIA.LHIASS---------------------------------------------
Q9K679_BACHD/208-296ELAADLARRLEQKL.GMNIPEAEVGYMT.MHIRGA---------------------------------------------
Q9KG18_BACHD/180-273DCTLKIGEFLKAQY.HYELTKEEQLYLT.IHIERV---------------------------------------------
Q8DR86_STRR6/305-398FMTREILANMDKFL.EWSISDDEIAYVS.LHFLAA---------------------------------------------
Q82Z58_ENTFA/336-426QNAKNIFYTLEQFY.RIEISNWELYVIY.EILSSR---------------------------------------------
Q8XP92_CLOPE/83-168EAATKMVKKLEDFT.GVSIVDDEIGFIA.Y...AY---------------------------------------------
LICT_BACSU/180-273ECTKKIQTYIEREY.EHKLTSDELLYLT.IHIERV---------------------------------------------
Q8RC49_THETN/207-295LFAKKLGEYLEEEL.NIDIPEDEIGYIT.IHLLAA---------------------------------------------
Q819D4_BACCR/79-167EIAEGVVELLNSRL.QITLPEGEIGFIA.LHIYSS---------------------------------------------
Q8Y4K2_LISMO/181-274KCTKKIDAYLINTH.HTELTRDERVYLT.IHIYRV---------------------------------------------
Q9K679_BACHD/318-405HVVQVKGNKVFE...PITIPEEEAGFLV.MHFGSA---------------------------------------------
Q8Y9A2_LISMO/298-387QATSKVVKTIPL.L.ESVENESEISLLA.IHFLAS---------------------------------------------
Q8YA62_LISMO/284-374NVSVYASAFIQKEL.AITFPDDEIAYIA.LHFLSA---------------------------------------------
GLCT_BACSU/184-276NTAWKLIKILQQTL.KKPVHEAEAVYLT.LHLYRL---------------------------------------------
Q8DNA0_STRR6/319-409LVTRKSAEILEGAW.FIRLTDDDIAYLT.IHIGGF---------------------------------------------
Q8DPP3_STRR6/182-276EIGSKIYDVITQHT.GLDLYKSERVYLV.LHIQRL---------------------------------------------
Q8DNA0_STRR6/206-298QVSKKLGERLFQKF.EISLSGLEVSLVA.VLLLSY---------------------------------------------
GLCT_STACT/185-277NIAVKIIKMMQQHL.DVEVYEAELIYLT.LHINHF---------------------------------------------
Q9KG92_BACHD/206-294EAAKVMSFKLEQAF.GVHYPDEEVLYLT.THILSS---------------------------------------------
Q8Y8I4_LISMO/290-379DIAVYISSLLQEKL.AIDFNEDEISFIA.LHIGSF---------------------------------------------
Q8E206_STRA5/297-386LLVKKALRPLEEQV.GL.IPDSEISYFV.IHFGGY---------------------------------------------
Q838N2_ENTFA/307-396AALRQALPQIFP...QKNLSEEEIAYMV.LHFANS---------------------------------------------
Q97M18_CLOAB/444-532KIALNAKKQIENYI.NHPIPDDEAGYIA.LFIVNN---------------------------------------------
Q839Y1_ENTFA/855-947PVIVSSIETMEEAL.NMDVPAEEVYFIA.QLVKNA---------------------------------------------
Q8Y5C7_LISMO/189-278TLAVEAIDAIEQYL.KMKLPKRETFHFL.QYLISS---------------------------------------------
Q8EVW2_MYCPE/302-392NITVKHIGVVENYL.KIKFSQEEIALLS.LYFVSN---------------------------------------------
Q836U6_ENTFA/806-895DVVRTNFMLIERAY.RVTIPEAEVAHVT.QMFLEN---------------------------------------------
Q834W3_ENTFA/73-161AIAQWAVEYLTQTL.EIPFSYDEAGYIA.IHIHSA---------------------------------------------
Q8RC49_THETN/314-404EKSNKVCDVLRKKL.KRDIPEDEVGYIA.MHFGAA---------------------------------------------
Q8Y9M5_LISMO/298-388FIVKEAFDPLAKFI.GREIPAGEIFFIS.LFIGSD---------------------------------------------
Q8EMS7_OCEIH/198-289FVAEKIVEDTEKQL.HLSFPKTETTYVA.LHLLGT---------------------------------------------
Q8EMT4_OCEIH/296-386HLIKRALEPISEVM.ESKIPENEITYIV.MLVSGW---------------------------------------------
Q834W3_ENTFA/179-273EISKKVQVLLMRNF.HYQVPNEELGYLS.IHIERL---------------------------------------------
Q8Y410_LISMO/298-388YIVKESLAPLERFI.GSKVPENESIFIT.LFIGGH---------------------------------------------
Q8G3W9_BIFLO/181-274RCARTIASLLELRL.DTDISDDEIAYLA.MHVARV---------------------------------------------
GLCT_BACSU/79-167QIAKEVIDMINEKA.GLCLPEGEIGFIA.LHIHSA---------------------------------------------
Q8G3W9_BIFLO/75-163AQGRAMLASLNARL.DVTLPDGEATALA.MHLVNA---------------------------------------------
Q831B3_ENTFA/181-274QAVQRINEYLLKSY.DRPIDQAEMIYLT.IHIQRV---------------------------------------------
Q97J80_CLOAB/75-163KVGLKAIDFIKDEL.GKDLPEDEAANIA.LHLINA---------------------------------------------
Q8EL15_OCEIH/294-380EMVHQITTDMGYE.....MVAAEVAYIT.MHISSA---------------------------------------------
Q9KG18_BACHD/75-163AIGMEALRIIKDRL.GIELPEDEAGFIT.THIINA---------------------------------------------
Q8Y8V7_LISMO/846-932KALEQTNKEVIYKM.NLKLTNDELCYLY.DILNEI---------------------------------------------
Q97LJ1_CLOAB/181-271DLAIKVAIKLENLF.SVSVPEDEIGYIA.MHLKRL---------------------------------------------
Q97LJ1_CLOAB/76-164KLAEKALDMINKNF.TTKLPKDEIGFIS.MHINAA---------------------------------------------
MTLR_BACSU/205-293SSALEIAGELERAF.GVTIPEAEVGYIT.IHLRSA---------------------------------------------
Q8Y5G4_LISMO/189-272PIMKEMFWGYD..F....LSENDLLYLS.LQVLAS---------------------------------------------
Q831B3_ENTFA/75-163EIAKQALAIIAEKL.GVQFSENEAGFIA.FHIVNA---------------------------------------------
MTLR_BACSU/315-403MAIEEGVEKYFP...GMSFSDDEIAFIV.LHFGSA---------------------------------------------
Q8EQ40_OCEIH/75-166EIAADIVDFLNQQL.DINLPDGEIGFIA.LHVHSA---------------------------------------------
Q8Y3Q0_LISMO/304-394ELGLVAKEVLEQEL.KTNVDEAEVGYLA.IHFLYG---------------------------------------------
Q8Y3P6_LISMO/76-164NAAKNSVKTISYYE.NVKLLEDEAGFIA.LHFVNG---------------------------------------------
Q8Y5G4_LISMO/292-382NIVEKASKPFEKLV.GHKWSEEEIVYLS.MIVLGW---------------------------------------------
Q7N8X9_PHOLL/179-274NCAVKLIKYLREKY.QWKVPDDELIYLV.IHIERV---------------------------------------------
Q8DQU1_STRR6/75-163ELGKRALQIIKKEL.GIELPIDEAAFIA.LHFVNA---------------------------------------------
SACY_BACSU/180-273LCALSIGTFVKKEY.GFEFPEKELCYIA.MHIQRF---------------------------------------------
Q8DN39_STRR6/294-384ELVKDSLMPLMDAI.DNPIPDSETAYFV.IHFGGY---------------------------------------------
Q8DXP9_STRA5/203-299EIAKELADELEENF.QLSLDEIEVGLVA.MLMLSF---------------------------------------------
Q815F4_BACCR/731-820MKVKKALQPIENTF.EIQIPDDEVFYVM.DFFIKN---------------------------------------------
Q82YX2_ENTFA/282-371ELAKIGLQELGRLL.NRCVPTVEFGYLA.LYFELA---------------------------------------------
LICR_BACSU/306-396EAGIIAGIVIKEQT.GIEIHENEIGYLA.LHFGAA---------------------------------------------
Q97M18_CLOAB/804-893SVIKENFVYLYNKY.LVDFSDNELCYIT.NFFLNS---------------------------------------------
ATXA_BACAN/179-264KTVASITSELQNSF.GVTLHETEISFLA.L...AL---------------------------------------------
Q8DT02_STRMU/201-288EVARKILKRVTLAT.QIEFPIEEVDYIT.LHLISK---------------------------------------------
Q8Y9U5_LISMO/320-406EEALYFKAKFEQKY.DVQVNEDETAYIA.LHFEAY---------------------------------------------
Q8DW03_STRMU/207-299EIARHLNENLKREF.HIELDEIETSLIA.VLLLSY---------------------------------------------
Q81HK0_BACCR/196-284TIAKQILGDLEKAL.KFSFPEEEVLYVT.MHLLST---------------------------------------------
Q82ZR7_ENTFA/848-937SVIKMAFRPLEVSY.NLLIPPLEVRYIYELLFEKA---------------------------------------------
Q8R5U8_THETN/491-585STAKIMAKEINKEL.GIELPEEEIGFIA.MYLKTF---------------------------------------------
Q833J4_ENTFA/458-550GYAEQLLTLVKRSL.DIELSQMDRIIVT.IYLHYS---------------------------------------------
SACT_BACSU/178-271QCALELAEFLKNEY.QLHLPESEAGYIT.LHVQRL---------------------------------------------
Q82ZT1_ENTFA/281-371HLCEQALAPLEKLT.KRSIPSEEIGFFT.ILFGGE---------------------------------------------
SACT_BACSU/72-160EIGLWAIGHVKETL.GVSLPEDEAGYIA.LHIHTA---------------------------------------------
Q8Y9W7_LISMO/200-285LIAAKLATILESLF.EIEIADADKNYLL.LQIASK---------------------------------------------
Q8EQ40_OCEIH/183-275NLSWKLMKIIQQTL.KKPVYEAEAVYLT.MHLQRL---------------------------------------------
Q9KG92_BACHD/317-407LLTRKVVHYLERYV.GKSVNDNEVAFIT.MHFVGW---------------------------------------------
Q8ZJY3_SALTY/826-911NRLREAFSVIESNY.SVKIPTAELGYIH.NILTFE---------------------------------------------
Q8EVQ5_MYCPE/307-395NFVKENISVIEDFL.GVKIFDDEIGLIS.LYFISD---------------------------------------------
BGLG_ECOLI/77-164QLGEEALTIIDKRL.GVQLPKDEVGFIA.MHLVSA---------------------------------------------
Q8Y6G6_LISMO/443-531QVAIDLSALIEQEL.SIEIPFDEIGFLT.MFLTEE---------------------------------------------
Q8Y423_LISMO/203-286GIAQEIYQQLQQSE.NFKINHAEITYLG.KLLLGA---------------------------------------------
Q837K8_ENTFA/21-107KIAEETTEAIGQ......LSEDEWYVLA.VHFEVA---------------------------------------------
Q8XP91_CLOPE/31-121KVAEEIGKAINEDF.SLEVAEDEIGYLA.LHVERI---------------------------------------------
Q8EN85_OCEIH/210-298KIAAEVIGHLEEAF.SLFIPEDEIGYIT.MHLMGA---------------------------------------------
Q8EUZ8_MYCPE/315-405LAIKKNIYIVEQLL.DVKFQDIEIYYIL.LHLISN---------------------------------------------
Q8Y3Q0_LISMO/201-288RAAQGIIKEIDLSE.GIRFPESETAYLL.LHLSSK---------------------------------------------
Q8EN85_OCEIH/320-408EVVDKAIQHVFP...NLAFPDEEIGYIV.LHFAAT---------------------------------------------
LICR_BACSU/194-282QAAEAIVKELESKL.SVTFPKDETAYIT.MHLLGT---------------------------------------------
Q81HK0_BACCR/309-398EIAVLVGDIIGEYT.GESIPESEIGYIA.IHFGGA---------------------------------------------
Q836U6_ENTFA/445-533QVALDLSSIIEEEN.NIEIPFDEIGFIS.MFLSIN---------------------------------------------
E0SGT2_DICD3/223-315HCAEKIQDHIMLNY.DYTLTKEELMFLA.IHIER.---------------------------------------------
I6L8Y6_STRMU/282-369EMAKVAGDDLKNHF.GCQLELSEMSYLA.LYFE..---------------------------------------------
CSIE_ECOLI/131-216QVAQEIGRHWQRRA.LQPVPPDEPLFMA.LLFS..---------------------------------------------
Q033J9_LACC3/77-163AVAKQALQIIATNL.GVQFPQSEIKNLA.LHFINA---------------------------------------------
Q2FUX1_STAA8/285-374NTLFEAIDKLAIDT.DIEMSEDEIAFLT.IHFQAA---------------------------------------------
Q2FW98_STAA8/208-294KVASELADKLGQIY.DVTFNQAEIAFIT.IHLRGA---------------------------------------------
Q2FW98_STAA8/315-401ENVRLALNDCWP...DLIFPESEIAFIV.LHFGG.---------------------------------------------
Q2G142_STAA8/300-388EAVSKHISPIEQDA.AIRFNEDELTYIT.IHFAS.---------------------------------------------
Q2G2B8_STAA8/300-388HMVKQSCQSLTEYF.GKSLPDNEIAYLT.MLFGG.---------------------------------------------
GLCT_STAA8/187-275NTAYKILTMIQKQF.DVNISESEIIYLT.LHIHH.---------------------------------------------
Q5HKT3_STAEQ/285-373NTLYDSIRQLSQDT.NIQLSEDEIAFLT.IHFQS.---------------------------------------------
GLCT_STAEQ/83-165NVARKVIDKLNKTL.DVHFPEDEIGFIA.LHIAS.---------------------------------------------
Q5KUA6_GEOKA/74-162EIGLWAKQLIKERL.GIEIPDDEAAHIA.LHIHTA---------------------------------------------
Q7D470_CLOAB/183-274RCVGKIKSFIEKNY.DYEVKGGEIVYLT.LHVQR.---------------------------------------------
Q8ZK41_SALTY/195-278HAAHEIAELLQQLA.DKPLSEPEVSWLK.VHIAA.---------------------------------------------
Q8ZN36_SALTY/131-216PLAQEIGRHWQRHV.MQAAPLNEALFMA.LLFS..---------------------------------------------
Q97MN8_CLOAB/203-290NTLRSLQEKLMEN..NIILPEDELSYLC.LHLN..---------------------------------------------
Q99XZ1_STRP1/291-380YLVKRSLSPLEKQL.GKSVNEDEVAYFT.IHFGR.---------------------------------------------
Q99Z99_STRP1/308-396TLTKQTFSDLLVCQ.KNDVSDDEWAYIS.LHLMA.---------------------------------------------
Q9A0X5_STRP1/75-163SLGVKALELIERNL.GVTLAIDEAAFIA.MHFVNA---------------------------------------------
Q9A1N2_STRP1/321-408AMTQSCATILEQDW.TISLTDDDIAYLT.IHLGG.---------------------------------------------

PF08270

Q8DYW7_STRA5/169-385QHFKDIN...AYFLRHFICYCYYFIPDFYFLNTSRLSYSK.DLYHLLDKGLADIFNLKGG..NLTFSKHETVLLTMQLSN
Q8DP24_STRR6/181-399DELIWHLHNTAFFERQEIFS.TPILFEQKALTIKKFEVYFPDFMGSARQELAQYRQAIGQHDHPEQLEHLMYTILTHAEN
Q8DNN5_STRR6/193-411DNLIWHLHNTAHLYRQELFT.EFILFDQKGNTIRNFQNIFPKFVSDVKKELSHYLETLEVCSSSMMVNHLSYTFITHTKH
Q99XU9_STRP1/179-395YEVAVILHNTTVLKEEDITA.NYLFFDYKKSYLNFYKQEHPHLYKAFVAGVEKLMRSEKEPISTELTNQLIYAFFITWEN
Q9A1L0_STRP1/171-383EHIPNLI...PFFKRT.LYNLQTLI.TFDGYYFDQYQGNM.LLLDKLETVIKDWLYDTGR..QGSISSGHLHLMCLYLEQ
Q9A1S4_STRP1/171-384ASLVKAL...MFFSKSFLFNLQHFIPETNLFVSPYYKGNQ.KLYTSLKLIVEEWMAKLPG..KRDLNHKHFHLFCHYVEQ

PF00874

MANR_BACSU/197-285--------------------------------------------------------------------------------
LEVR_BACSU/841-929--------------------------------------------------------------------------------
LEVR_BACSU/478-566--------------------------------------------------------------------------------
MANR_BACSU/307-397--------------------------------------------------------------------------------
LICT_BACSU/75-163--------------------------------------------------------------------------------
Q899A8_CLOTE/262-352--------------------------------------------------------------------------------
Q8Y8I4_LISMO/177-264--------------------------------------------------------------------------------
Q8Y8V7_LISMO/481-569--------------------------------------------------------------------------------
Q8Y423_LISMO/304-394--------------------------------------------------------------------------------
Q8Y3R0_LISMO/74-162--------------------------------------------------------------------------------
Q8RCV3_THETN/309-399--------------------------------------------------------------------------------
Q8RCS2_THETN/205-292--------------------------------------------------------------------------------
Q8ZL25_SALTY/845-932--------------------------------------------------------------------------------
Q8DUF3_STRMU/21-109--------------------------------------------------------------------------------
Q833J4_ENTFA/824-914--------------------------------------------------------------------------------
Q8YA62_LISMO/182-267--------------------------------------------------------------------------------
Q8EMS7_OCEIH/315-405--------------------------------------------------------------------------------
Q9KEK7_BACHD/181-273--------------------------------------------------------------------------------
Q8DW03_STRMU/320-410--------------------------------------------------------------------------------
Q8DT02_STRMU/309-395--------------------------------------------------------------------------------
Q8Y4K2_LISMO/75-163--------------------------------------------------------------------------------
Q8DPP3_STRR6/76-163--------------------------------------------------------------------------------
Q8Y3R0_LISMO/179-272--------------------------------------------------------------------------------
Q8Y9U5_LISMO/212-300--------------------------------------------------------------------------------
SACY_BACSU/74-162--------------------------------------------------------------------------------
Q97JD1_CLOAB/187-277--------------------------------------------------------------------------------
Q8ZR51_SALTY/814-903--------------------------------------------------------------------------------
Q8R5U5_THETN/453-538--------------------------------------------------------------------------------
Q8DQU1_STRR6/180-274--------------------------------------------------------------------------------
Q9KER8_BACHD/51-139--------------------------------------------------------------------------------
Q8Y9W7_LISMO/305-395--------------------------------------------------------------------------------
Q8Y8M4_LISMO/286-377--------------------------------------------------------------------------------
Q837K9_ENTFA/314-404--------------------------------------------------------------------------------
Q9KGB4_BACHD/297-387--------------------------------------------------------------------------------
Q97J80_CLOAB/183-273--------------------------------------------------------------------------------
BGLG_ECOLI/181-274--------------------------------------------------------------------------------
Q8Y6G6_LISMO/798-887--------------------------------------------------------------------------------
Q8R5U5_THETN/810-901--------------------------------------------------------------------------------
Q839Y1_ENTFA/489-580--------------------------------------------------------------------------------
Q9CJH3_LACLA/288-375--------------------------------------------------------------------------------
Q8DUF3_STRMU/123-220--------------------------------------------------------------------------------
Q8DXP9_STRA5/320-410--------------------------------------------------------------------------------
Q9KF98_BACHD/18-111--------------------------------------------------------------------------------
Q815F4_BACCR/376-464--------------------------------------------------------------------------------
Q8Y3P6_LISMO/181-274--------------------------------------------------------------------------------
ATXA_BACAN/292-383--------------------------------------------------------------------------------
Q819D4_BACCR/184-276--------------------------------------------------------------------------------
Q97JD1_CLOAB/82-170--------------------------------------------------------------------------------
Q9KEK7_BACHD/76-164--------------------------------------------------------------------------------
Q8RD56_THETN/836-925--------------------------------------------------------------------------------
Q8Y5C7_LISMO/300-390--------------------------------------------------------------------------------
Q82ZR7_ENTFA/475-563--------------------------------------------------------------------------------
Q8RCV3_THETN/200-288--------------------------------------------------------------------------------
Q7N8X9_PHOLL/73-161--------------------------------------------------------------------------------
Q8RGT2_FUSNN/287-377--------------------------------------------------------------------------------
Q8RD56_THETN/473-563--------------------------------------------------------------------------------
Q8E0E5_STRA5/176-273--------------------------------------------------------------------------------
Q8DR86_STRR6/201-287--------------------------------------------------------------------------------
Q9KER8_BACHD/156-249--------------------------------------------------------------------------------
Q8RCS2_THETN/313-403--------------------------------------------------------------------------------
Q899A8_CLOTE/149-237--------------------------------------------------------------------------------
GLCT_STACT/77-168--------------------------------------------------------------------------------
Q9K679_BACHD/208-296--------------------------------------------------------------------------------
Q9KG18_BACHD/180-273--------------------------------------------------------------------------------
Q8DR86_STRR6/305-398--------------------------------------------------------------------------------
Q82Z58_ENTFA/336-426--------------------------------------------------------------------------------
Q8XP92_CLOPE/83-168--------------------------------------------------------------------------------
LICT_BACSU/180-273--------------------------------------------------------------------------------
Q8RC49_THETN/207-295--------------------------------------------------------------------------------
Q819D4_BACCR/79-167--------------------------------------------------------------------------------
Q8Y4K2_LISMO/181-274--------------------------------------------------------------------------------
Q9K679_BACHD/318-405--------------------------------------------------------------------------------
Q8Y9A2_LISMO/298-387--------------------------------------------------------------------------------
Q8YA62_LISMO/284-374--------------------------------------------------------------------------------
GLCT_BACSU/184-276--------------------------------------------------------------------------------
Q8DNA0_STRR6/319-409--------------------------------------------------------------------------------
Q8DPP3_STRR6/182-276--------------------------------------------------------------------------------
Q8DNA0_STRR6/206-298--------------------------------------------------------------------------------
GLCT_STACT/185-277--------------------------------------------------------------------------------
Q9KG92_BACHD/206-294--------------------------------------------------------------------------------
Q8Y8I4_LISMO/290-379--------------------------------------------------------------------------------
Q8E206_STRA5/297-386--------------------------------------------------------------------------------
Q838N2_ENTFA/307-396--------------------------------------------------------------------------------
Q97M18_CLOAB/444-532--------------------------------------------------------------------------------
Q839Y1_ENTFA/855-947--------------------------------------------------------------------------------
Q8Y5C7_LISMO/189-278--------------------------------------------------------------------------------
Q8EVW2_MYCPE/302-392--------------------------------------------------------------------------------
Q836U6_ENTFA/806-895--------------------------------------------------------------------------------
Q834W3_ENTFA/73-161--------------------------------------------------------------------------------
Q8RC49_THETN/314-404--------------------------------------------------------------------------------
Q8Y9M5_LISMO/298-388--------------------------------------------------------------------------------
Q8EMS7_OCEIH/198-289--------------------------------------------------------------------------------
Q8EMT4_OCEIH/296-386--------------------------------------------------------------------------------
Q834W3_ENTFA/179-273--------------------------------------------------------------------------------
Q8Y410_LISMO/298-388--------------------------------------------------------------------------------
Q8G3W9_BIFLO/181-274--------------------------------------------------------------------------------
GLCT_BACSU/79-167--------------------------------------------------------------------------------
Q8G3W9_BIFLO/75-163--------------------------------------------------------------------------------
Q831B3_ENTFA/181-274--------------------------------------------------------------------------------
Q97J80_CLOAB/75-163--------------------------------------------------------------------------------
Q8EL15_OCEIH/294-380--------------------------------------------------------------------------------
Q9KG18_BACHD/75-163--------------------------------------------------------------------------------
Q8Y8V7_LISMO/846-932--------------------------------------------------------------------------------
Q97LJ1_CLOAB/181-271--------------------------------------------------------------------------------
Q97LJ1_CLOAB/76-164--------------------------------------------------------------------------------
MTLR_BACSU/205-293--------------------------------------------------------------------------------
Q8Y5G4_LISMO/189-272--------------------------------------------------------------------------------
Q831B3_ENTFA/75-163--------------------------------------------------------------------------------
MTLR_BACSU/315-403--------------------------------------------------------------------------------
Q8EQ40_OCEIH/75-166--------------------------------------------------------------------------------
Q8Y3Q0_LISMO/304-394--------------------------------------------------------------------------------
Q8Y3P6_LISMO/76-164--------------------------------------------------------------------------------
Q8Y5G4_LISMO/292-382--------------------------------------------------------------------------------
Q7N8X9_PHOLL/179-274--------------------------------------------------------------------------------
Q8DQU1_STRR6/75-163--------------------------------------------------------------------------------
SACY_BACSU/180-273--------------------------------------------------------------------------------
Q8DN39_STRR6/294-384--------------------------------------------------------------------------------
Q8DXP9_STRA5/203-299--------------------------------------------------------------------------------
Q815F4_BACCR/731-820--------------------------------------------------------------------------------
Q82YX2_ENTFA/282-371--------------------------------------------------------------------------------
LICR_BACSU/306-396--------------------------------------------------------------------------------
Q97M18_CLOAB/804-893--------------------------------------------------------------------------------
ATXA_BACAN/179-264--------------------------------------------------------------------------------
Q8DT02_STRMU/201-288--------------------------------------------------------------------------------
Q8Y9U5_LISMO/320-406--------------------------------------------------------------------------------
Q8DW03_STRMU/207-299--------------------------------------------------------------------------------
Q81HK0_BACCR/196-284--------------------------------------------------------------------------------
Q82ZR7_ENTFA/848-937--------------------------------------------------------------------------------
Q8R5U8_THETN/491-585--------------------------------------------------------------------------------
Q833J4_ENTFA/458-550--------------------------------------------------------------------------------
SACT_BACSU/178-271--------------------------------------------------------------------------------
Q82ZT1_ENTFA/281-371--------------------------------------------------------------------------------
SACT_BACSU/72-160--------------------------------------------------------------------------------
Q8Y9W7_LISMO/200-285--------------------------------------------------------------------------------
Q8EQ40_OCEIH/183-275--------------------------------------------------------------------------------
Q9KG92_BACHD/317-407--------------------------------------------------------------------------------
Q8ZJY3_SALTY/826-911--------------------------------------------------------------------------------
Q8EVQ5_MYCPE/307-395--------------------------------------------------------------------------------
BGLG_ECOLI/77-164--------------------------------------------------------------------------------
Q8Y6G6_LISMO/443-531--------------------------------------------------------------------------------
Q8Y423_LISMO/203-286--------------------------------------------------------------------------------
Q837K8_ENTFA/21-107--------------------------------------------------------------------------------
Q8XP91_CLOPE/31-121--------------------------------------------------------------------------------
Q8EN85_OCEIH/210-298--------------------------------------------------------------------------------
Q8EUZ8_MYCPE/315-405--------------------------------------------------------------------------------
Q8Y3Q0_LISMO/201-288--------------------------------------------------------------------------------
Q8EN85_OCEIH/320-408--------------------------------------------------------------------------------
LICR_BACSU/194-282--------------------------------------------------------------------------------
Q81HK0_BACCR/309-398--------------------------------------------------------------------------------
Q836U6_ENTFA/445-533--------------------------------------------------------------------------------
E0SGT2_DICD3/223-315--------------------------------------------------------------------------------
I6L8Y6_STRMU/282-369--------------------------------------------------------------------------------
CSIE_ECOLI/131-216--------------------------------------------------------------------------------
Q033J9_LACC3/77-163--------------------------------------------------------------------------------
Q2FUX1_STAA8/285-374--------------------------------------------------------------------------------
Q2FW98_STAA8/208-294--------------------------------------------------------------------------------
Q2FW98_STAA8/315-401--------------------------------------------------------------------------------
Q2G142_STAA8/300-388--------------------------------------------------------------------------------
Q2G2B8_STAA8/300-388--------------------------------------------------------------------------------
GLCT_STAA8/187-275--------------------------------------------------------------------------------
Q5HKT3_STAEQ/285-373--------------------------------------------------------------------------------
GLCT_STAEQ/83-165--------------------------------------------------------------------------------
Q5KUA6_GEOKA/74-162--------------------------------------------------------------------------------
Q7D470_CLOAB/183-274--------------------------------------------------------------------------------
Q8ZK41_SALTY/195-278--------------------------------------------------------------------------------
Q8ZN36_SALTY/131-216--------------------------------------------------------------------------------
Q97MN8_CLOAB/203-290--------------------------------------------------------------------------------
Q99XZ1_STRP1/291-380--------------------------------------------------------------------------------
Q99Z99_STRP1/308-396--------------------------------------------------------------------------------
Q9A0X5_STRP1/75-163--------------------------------------------------------------------------------
Q9A1N2_STRP1/321-408--------------------------------------------------------------------------------

PF08270

Q8DYW7_STRA5/169-385L
Q8DP24_STRR6/181-399L
Q8DNN5_STRR6/193-411L
Q99XU9_STRP1/179-395.
Q9A1L0_STRP1/171-383I
Q9A1S4_STRP1/171-384.

PF00874

MANR_BACSU/197-285-
LEVR_BACSU/841-929-
LEVR_BACSU/478-566-
MANR_BACSU/307-397-
LICT_BACSU/75-163-
Q899A8_CLOTE/262-352-
Q8Y8I4_LISMO/177-264-
Q8Y8V7_LISMO/481-569-
Q8Y423_LISMO/304-394-
Q8Y3R0_LISMO/74-162-
Q8RCV3_THETN/309-399-
Q8RCS2_THETN/205-292-
Q8ZL25_SALTY/845-932-
Q8DUF3_STRMU/21-109-
Q833J4_ENTFA/824-914-
Q8YA62_LISMO/182-267-
Q8EMS7_OCEIH/315-405-
Q9KEK7_BACHD/181-273-
Q8DW03_STRMU/320-410-
Q8DT02_STRMU/309-395-
Q8Y4K2_LISMO/75-163-
Q8DPP3_STRR6/76-163-
Q8Y3R0_LISMO/179-272-
Q8Y9U5_LISMO/212-300-
SACY_BACSU/74-162-
Q97JD1_CLOAB/187-277-
Q8ZR51_SALTY/814-903-
Q8R5U5_THETN/453-538-
Q8DQU1_STRR6/180-274-
Q9KER8_BACHD/51-139-
Q8Y9W7_LISMO/305-395-
Q8Y8M4_LISMO/286-377-
Q837K9_ENTFA/314-404-
Q9KGB4_BACHD/297-387-
Q97J80_CLOAB/183-273-
BGLG_ECOLI/181-274-
Q8Y6G6_LISMO/798-887-
Q8R5U5_THETN/810-901-
Q839Y1_ENTFA/489-580-
Q9CJH3_LACLA/288-375-
Q8DUF3_STRMU/123-220-
Q8DXP9_STRA5/320-410-
Q9KF98_BACHD/18-111-
Q815F4_BACCR/376-464-
Q8Y3P6_LISMO/181-274-
ATXA_BACAN/292-383-
Q819D4_BACCR/184-276-
Q97JD1_CLOAB/82-170-
Q9KEK7_BACHD/76-164-
Q8RD56_THETN/836-925-
Q8Y5C7_LISMO/300-390-
Q82ZR7_ENTFA/475-563-
Q8RCV3_THETN/200-288-
Q7N8X9_PHOLL/73-161-
Q8RGT2_FUSNN/287-377-
Q8RD56_THETN/473-563-
Q8E0E5_STRA5/176-273-
Q8DR86_STRR6/201-287-
Q9KER8_BACHD/156-249-
Q8RCS2_THETN/313-403-
Q899A8_CLOTE/149-237-
GLCT_STACT/77-168-
Q9K679_BACHD/208-296-
Q9KG18_BACHD/180-273-
Q8DR86_STRR6/305-398-
Q82Z58_ENTFA/336-426-
Q8XP92_CLOPE/83-168-
LICT_BACSU/180-273-
Q8RC49_THETN/207-295-
Q819D4_BACCR/79-167-
Q8Y4K2_LISMO/181-274-
Q9K679_BACHD/318-405-
Q8Y9A2_LISMO/298-387-
Q8YA62_LISMO/284-374-
GLCT_BACSU/184-276-
Q8DNA0_STRR6/319-409-
Q8DPP3_STRR6/182-276-
Q8DNA0_STRR6/206-298-
GLCT_STACT/185-277-
Q9KG92_BACHD/206-294-
Q8Y8I4_LISMO/290-379-
Q8E206_STRA5/297-386-
Q838N2_ENTFA/307-396-
Q97M18_CLOAB/444-532-
Q839Y1_ENTFA/855-947-
Q8Y5C7_LISMO/189-278-
Q8EVW2_MYCPE/302-392-
Q836U6_ENTFA/806-895-
Q834W3_ENTFA/73-161-
Q8RC49_THETN/314-404-
Q8Y9M5_LISMO/298-388-
Q8EMS7_OCEIH/198-289-
Q8EMT4_OCEIH/296-386-
Q834W3_ENTFA/179-273-
Q8Y410_LISMO/298-388-
Q8G3W9_BIFLO/181-274-
GLCT_BACSU/79-167-
Q8G3W9_BIFLO/75-163-
Q831B3_ENTFA/181-274-
Q97J80_CLOAB/75-163-
Q8EL15_OCEIH/294-380-
Q9KG18_BACHD/75-163-
Q8Y8V7_LISMO/846-932-
Q97LJ1_CLOAB/181-271-
Q97LJ1_CLOAB/76-164-
MTLR_BACSU/205-293-
Q8Y5G4_LISMO/189-272-
Q831B3_ENTFA/75-163-
MTLR_BACSU/315-403-
Q8EQ40_OCEIH/75-166-
Q8Y3Q0_LISMO/304-394-
Q8Y3P6_LISMO/76-164-
Q8Y5G4_LISMO/292-382-
Q7N8X9_PHOLL/179-274-
Q8DQU1_STRR6/75-163-
SACY_BACSU/180-273-
Q8DN39_STRR6/294-384-
Q8DXP9_STRA5/203-299-
Q815F4_BACCR/731-820-
Q82YX2_ENTFA/282-371-
LICR_BACSU/306-396-
Q97M18_CLOAB/804-893-
ATXA_BACAN/179-264-
Q8DT02_STRMU/201-288-
Q8Y9U5_LISMO/320-406-
Q8DW03_STRMU/207-299-
Q81HK0_BACCR/196-284-
Q82ZR7_ENTFA/848-937-
Q8R5U8_THETN/491-585-
Q833J4_ENTFA/458-550-
SACT_BACSU/178-271-
Q82ZT1_ENTFA/281-371-
SACT_BACSU/72-160-
Q8Y9W7_LISMO/200-285-
Q8EQ40_OCEIH/183-275-
Q9KG92_BACHD/317-407-
Q8ZJY3_SALTY/826-911-
Q8EVQ5_MYCPE/307-395-
BGLG_ECOLI/77-164-
Q8Y6G6_LISMO/443-531-
Q8Y423_LISMO/203-286-
Q837K8_ENTFA/21-107-
Q8XP91_CLOPE/31-121-
Q8EN85_OCEIH/210-298-
Q8EUZ8_MYCPE/315-405-
Q8Y3Q0_LISMO/201-288-
Q8EN85_OCEIH/320-408-
LICR_BACSU/194-282-
Q81HK0_BACCR/309-398-
Q836U6_ENTFA/445-533-
E0SGT2_DICD3/223-315-
I6L8Y6_STRMU/282-369-
CSIE_ECOLI/131-216-
Q033J9_LACC3/77-163-
Q2FUX1_STAA8/285-374-
Q2FW98_STAA8/208-294-
Q2FW98_STAA8/315-401-
Q2G142_STAA8/300-388-
Q2G2B8_STAA8/300-388-
GLCT_STAA8/187-275-
Q5HKT3_STAEQ/285-373-
GLCT_STAEQ/83-165-
Q5KUA6_GEOKA/74-162-
Q7D470_CLOAB/183-274-
Q8ZK41_SALTY/195-278-
Q8ZN36_SALTY/131-216-
Q97MN8_CLOAB/203-290-
Q99XZ1_STRP1/291-380-
Q99Z99_STRP1/308-396-
Q9A0X5_STRP1/75-163-
Q9A1N2_STRP1/321-408-

This alignment is coloured according to the ClustalX colouring scheme:

 
Glycine (G)
 
Proline (P)
 
Small or hydrophobic (C,A,V,L,I,M,F,W)
 
Hydroxyl or amine amino acids (S,T,N,Q)
 
Charged amino-acids (D,E,R,K)
 
Histidine or tyrosine (H,Y)

For UniProt-based alignments, we also add some additional mark-up to the alignments where appropriate. Active site information is shown as follows:

 
Active site (residue annotated in SwissProt as an active site)
 
Predicted active site (residue aligns in a Pfam alignment with a SwissProt active site)
 
Predicted active site (residue annotated in SwissProt as a potential active site)

Some UniProt sequences can be mapped to protein structures, in which case we also show the secondary structure definition. These lines are shown below the sequence to which they apply and are marked (SS). The meaning of each of the symbols is as follows:

C
Random coil
H
Alpha-helix
G
3(10) helix
I
Pi-helix
E
Hydrogen bonded beta-strand (extended strand)
B
Residue in isolated beta-bridge
T
H-bonded turn (3-turn, 4-turn, or 5-turn)
S
Bend (five-residue bend centered at residue i)
Close window